--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 12:39:26 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/mmpS3/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1203.13         -1207.55
2      -1203.12         -1206.92
--------------------------------------
TOTAL    -1203.13         -1207.29
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.897846    0.090886    0.363820    1.491893    0.860474   1497.45   1499.22    1.000
r(A<->C){all}   0.164309    0.018541    0.000050    0.444030    0.130548    241.23    266.88    1.001
r(A<->G){all}   0.171245    0.019153    0.000008    0.436048    0.140841    161.88    197.20    1.000
r(A<->T){all}   0.174831    0.023566    0.000033    0.485621    0.130292    255.06    298.70    1.000
r(C<->G){all}   0.149775    0.017908    0.000170    0.425154    0.110637    190.49    273.12    1.000
r(C<->T){all}   0.154773    0.019709    0.000102    0.438677    0.109364    180.79    189.70    1.001
r(G<->T){all}   0.185068    0.022997    0.000186    0.486709    0.146725    118.01    203.85    1.007
pi(A){all}      0.207948    0.000191    0.181807    0.235247    0.207892   1055.70   1145.00    1.000
pi(C){all}      0.312390    0.000247    0.281849    0.344025    0.312190   1215.26   1282.55    1.000
pi(G){all}      0.283503    0.000230    0.253346    0.313025    0.283190   1152.62   1171.59    1.000
pi(T){all}      0.196159    0.000182    0.170457    0.223346    0.195769   1254.12   1257.63    1.000
alpha{1,2}      0.433008    0.242571    0.000116    1.377535    0.255982   1100.57   1180.10    1.000
alpha{3}        0.468558    0.239355    0.000368    1.426095    0.311343   1303.79   1343.59    1.000
pinvar{all}     0.998340    0.000004    0.994738    1.000000    0.999012   1177.94   1256.00    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1161.136491
Model 2: PositiveSelection	-1161.136439
Model 0: one-ratio	-1161.136439
Model 7: beta	-1161.136439
Model 8: beta&w>1	-1161.136439


Model 0 vs 1	1.0399999973742524E-4

Model 2 vs 1	1.0399999973742524E-4

Model 8 vs 7	0.0
>C1
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C2
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C3
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C4
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C5
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C6
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=293 

C1              MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C2              MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C3              MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C4              MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C5              MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C6              MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
                **************************************************

C1              TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C2              TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C3              TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C4              TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C5              TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C6              TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
                **************************************************

C1              WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C2              WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C3              WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C4              WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C5              WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C6              WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
                **************************************************

C1              PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C2              PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C3              PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C4              PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C5              PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C6              PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
                **************************************************

C1              TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C2              TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C3              TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C4              TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C5              TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C6              TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
                **************************************************

C1              SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C2              SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C3              SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C4              SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C5              SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C6              SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
                *******************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  293 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  293 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8790]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [8790]--->[8790]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.505 Mb, Max= 30.853 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C2              MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C3              MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C4              MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C5              MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C6              MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
                **************************************************

C1              TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C2              TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C3              TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C4              TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C5              TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C6              TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
                **************************************************

C1              WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C2              WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C3              WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C4              WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C5              WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C6              WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
                **************************************************

C1              PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C2              PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C3              PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C4              PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C5              PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C6              PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
                **************************************************

C1              TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C2              TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C3              TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C4              TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C5              TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C6              TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
                **************************************************

C1              SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C2              SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C3              SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C4              SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C5              SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C6              SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
                *******************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
C2              ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
C3              ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
C4              ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
C5              ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
C6              ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
                **************************************************

C1              CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
C2              CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
C3              CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
C4              CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
C5              CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
C6              CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
                **************************************************

C1              ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
C2              ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
C3              ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
C4              ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
C5              ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
C6              ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
                **************************************************

C1              ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
C2              ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
C3              ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
C4              ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
C5              ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
C6              ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
                **************************************************

C1              GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
C2              GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
C3              GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
C4              GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
C5              GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
C6              GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
                **************************************************

C1              ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
C2              ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
C3              ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
C4              ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
C5              ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
C6              ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
                **************************************************

C1              TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
C2              TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
C3              TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
C4              TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
C5              TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
C6              TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
                **************************************************

C1              GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
C2              GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
C3              GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
C4              GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
C5              GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
C6              GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
                **************************************************

C1              CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
C2              CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
C3              CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
C4              CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
C5              CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
C6              CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
                **************************************************

C1              CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
C2              CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
C3              CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
C4              CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
C5              CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
C6              CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
                **************************************************

C1              GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
C2              GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
C3              GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
C4              GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
C5              GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
C6              GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
                **************************************************

C1              CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
C2              CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
C3              CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
C4              CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
C5              CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
C6              CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
                **************************************************

C1              ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
C2              ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
C3              ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
C4              ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
C5              ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
C6              ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
                **************************************************

C1              GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
C2              GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
C3              GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
C4              GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
C5              GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
C6              GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
                **************************************************

C1              GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
C2              GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
C3              GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
C4              GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
C5              GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
C6              GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
                **************************************************

C1              TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
C2              TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
C3              TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
C4              TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
C5              TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
C6              TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
                **************************************************

C1              CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
C2              CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
C3              CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
C4              CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
C5              CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
C6              CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
                **************************************************

C1              ATAGCAACGACGCACCGCAAACGAGTTGC
C2              ATAGCAACGACGCACCGCAAACGAGTTGC
C3              ATAGCAACGACGCACCGCAAACGAGTTGC
C4              ATAGCAACGACGCACCGCAAACGAGTTGC
C5              ATAGCAACGACGCACCGCAAACGAGTTGC
C6              ATAGCAACGACGCACCGCAAACGAGTTGC
                *****************************



>C1
ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
ATAGCAACGACGCACCGCAAACGAGTTGC
>C2
ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
ATAGCAACGACGCACCGCAAACGAGTTGC
>C3
ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
ATAGCAACGACGCACCGCAAACGAGTTGC
>C4
ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
ATAGCAACGACGCACCGCAAACGAGTTGC
>C5
ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
ATAGCAACGACGCACCGCAAACGAGTTGC
>C6
ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
ATAGCAACGACGCACCGCAAACGAGTTGC
>C1
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C2
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C3
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C4
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C5
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C6
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 879 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579783075
      Setting output file names to "/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1574836353
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9437564983
      Seed = 910620000
      Swapseed = 1579783075
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1967.244143 -- -24.965149
         Chain 2 -- -1967.244143 -- -24.965149
         Chain 3 -- -1967.243843 -- -24.965149
         Chain 4 -- -1967.244143 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1967.244031 -- -24.965149
         Chain 2 -- -1967.244031 -- -24.965149
         Chain 3 -- -1967.244031 -- -24.965149
         Chain 4 -- -1967.244031 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1967.244] (-1967.244) (-1967.244) (-1967.244) * [-1967.244] (-1967.244) (-1967.244) (-1967.244) 
        500 -- (-1222.890) (-1231.910) (-1219.449) [-1212.863] * (-1224.483) (-1216.387) [-1214.476] (-1216.527) -- 0:00:00
       1000 -- (-1214.942) (-1207.240) (-1208.519) [-1209.904] * (-1210.870) (-1210.870) [-1211.191] (-1213.721) -- 0:00:00
       1500 -- (-1218.639) (-1220.072) (-1222.244) [-1207.574] * (-1217.214) (-1210.839) [-1207.300] (-1221.995) -- 0:00:00
       2000 -- [-1211.244] (-1213.684) (-1219.241) (-1208.636) * (-1213.487) [-1214.568] (-1217.858) (-1220.556) -- 0:00:00
       2500 -- (-1212.810) [-1211.699] (-1222.058) (-1214.132) * (-1221.169) (-1211.879) [-1210.910] (-1219.183) -- 0:00:00
       3000 -- (-1209.263) (-1212.741) [-1223.597] (-1213.658) * (-1214.200) [-1210.876] (-1214.611) (-1222.374) -- 0:00:00
       3500 -- (-1207.974) (-1212.562) (-1210.934) [-1214.650] * [-1211.880] (-1215.069) (-1212.037) (-1216.131) -- 0:00:00
       4000 -- (-1208.959) (-1216.743) [-1208.280] (-1214.281) * [-1212.528] (-1217.901) (-1209.885) (-1214.179) -- 0:00:00
       4500 -- (-1211.979) (-1214.649) [-1212.790] (-1224.741) * (-1213.829) [-1211.144] (-1213.933) (-1215.802) -- 0:00:00
       5000 -- (-1230.816) [-1212.570] (-1210.758) (-1214.086) * (-1221.055) (-1214.531) (-1216.349) [-1211.385] -- 0:03:19

      Average standard deviation of split frequencies: 0.109994

       5500 -- [-1207.369] (-1210.686) (-1215.071) (-1213.439) * (-1212.861) [-1214.458] (-1214.564) (-1214.049) -- 0:03:00
       6000 -- [-1206.802] (-1213.786) (-1212.834) (-1217.720) * (-1222.433) (-1223.026) (-1218.629) [-1211.604] -- 0:02:45
       6500 -- (-1213.669) [-1214.944] (-1221.152) (-1211.130) * (-1204.558) (-1213.475) [-1208.451] (-1209.312) -- 0:02:32
       7000 -- [-1209.998] (-1217.082) (-1208.455) (-1213.253) * (-1204.368) (-1212.274) [-1209.429] (-1208.507) -- 0:02:21
       7500 -- (-1208.599) [-1215.793] (-1222.081) (-1223.693) * (-1206.597) [-1213.394] (-1213.263) (-1211.379) -- 0:02:12
       8000 -- (-1213.377) (-1213.767) [-1212.600] (-1210.218) * (-1209.018) [-1207.352] (-1215.948) (-1226.349) -- 0:02:04
       8500 -- [-1208.777] (-1212.929) (-1214.781) (-1212.093) * (-1208.646) [-1210.441] (-1207.954) (-1217.194) -- 0:01:56
       9000 -- (-1217.956) (-1220.757) [-1212.771] (-1213.653) * (-1203.104) (-1212.583) (-1215.703) [-1209.275] -- 0:01:50
       9500 -- (-1210.271) (-1219.997) (-1216.325) [-1217.141] * (-1203.123) [-1209.921] (-1211.509) (-1213.885) -- 0:01:44
      10000 -- [-1211.318] (-1212.439) (-1215.917) (-1211.481) * (-1202.925) (-1216.619) [-1209.886] (-1213.496) -- 0:01:39

      Average standard deviation of split frequencies: 0.082362

      10500 -- (-1217.522) (-1212.200) (-1219.303) [-1215.520] * (-1202.842) (-1215.596) (-1211.525) [-1213.486] -- 0:01:34
      11000 -- (-1207.214) [-1217.434] (-1221.012) (-1213.746) * [-1203.216] (-1212.507) (-1220.352) (-1211.503) -- 0:01:29
      11500 -- (-1212.233) [-1212.585] (-1213.791) (-1213.760) * (-1208.529) (-1218.246) [-1213.636] (-1211.128) -- 0:01:25
      12000 -- (-1216.756) [-1207.914] (-1220.156) (-1209.801) * (-1201.869) (-1210.612) (-1213.429) [-1212.342] -- 0:01:22
      12500 -- [-1210.455] (-1208.846) (-1209.376) (-1212.277) * (-1204.163) [-1209.243] (-1224.291) (-1213.877) -- 0:01:19
      13000 -- [-1214.626] (-1212.201) (-1210.841) (-1218.389) * [-1203.083] (-1218.582) (-1211.633) (-1218.779) -- 0:01:15
      13500 -- (-1217.554) (-1220.403) [-1211.984] (-1215.462) * (-1205.032) [-1212.602] (-1210.153) (-1214.846) -- 0:01:13
      14000 -- (-1214.869) (-1208.910) [-1209.331] (-1219.871) * (-1202.120) (-1214.091) [-1214.390] (-1210.832) -- 0:01:10
      14500 -- (-1216.839) (-1212.079) [-1211.093] (-1217.158) * (-1201.964) [-1211.962] (-1214.300) (-1210.990) -- 0:01:07
      15000 -- (-1208.450) [-1209.432] (-1217.371) (-1212.608) * [-1202.618] (-1212.214) (-1211.626) (-1213.954) -- 0:01:05

      Average standard deviation of split frequencies: 0.068230

      15500 -- (-1217.691) (-1215.381) (-1215.306) [-1210.720] * (-1202.118) (-1212.881) (-1214.625) [-1208.739] -- 0:01:03
      16000 -- (-1215.677) (-1209.376) (-1210.132) [-1212.233] * (-1203.213) [-1215.937] (-1223.126) (-1225.883) -- 0:01:01
      16500 -- (-1209.480) (-1211.823) (-1221.930) [-1218.190] * (-1202.738) (-1214.165) (-1208.126) [-1209.007] -- 0:00:59
      17000 -- (-1220.497) (-1211.963) [-1208.662] (-1218.076) * (-1206.937) [-1216.321] (-1218.568) (-1211.830) -- 0:00:57
      17500 -- (-1209.867) (-1218.092) [-1212.252] (-1214.591) * (-1202.027) (-1218.523) (-1214.652) [-1214.838] -- 0:00:56
      18000 -- [-1210.057] (-1218.984) (-1211.945) (-1213.311) * (-1202.020) [-1215.839] (-1214.309) (-1212.540) -- 0:00:54
      18500 -- (-1213.660) (-1215.852) [-1208.708] (-1216.401) * (-1203.469) (-1218.662) (-1215.143) [-1211.627] -- 0:00:53
      19000 -- (-1211.252) (-1210.548) [-1213.119] (-1216.404) * [-1202.130] (-1212.464) (-1213.234) (-1213.401) -- 0:00:51
      19500 -- (-1209.187) (-1213.674) (-1217.719) [-1215.062] * [-1204.694] (-1212.888) (-1215.663) (-1216.371) -- 0:00:50
      20000 -- (-1217.424) (-1214.390) [-1212.636] (-1216.083) * [-1205.652] (-1213.828) (-1212.762) (-1217.142) -- 0:00:49

      Average standard deviation of split frequencies: 0.081635

      20500 -- [-1211.024] (-1209.637) (-1205.574) (-1214.228) * [-1203.260] (-1210.039) (-1215.019) (-1214.939) -- 0:01:35
      21000 -- (-1208.123) [-1205.936] (-1204.619) (-1212.687) * (-1202.774) (-1214.848) [-1212.043] (-1216.015) -- 0:01:33
      21500 -- [-1213.317] (-1212.353) (-1204.094) (-1213.499) * (-1204.291) (-1218.331) (-1214.496) [-1211.265] -- 0:01:31
      22000 -- (-1219.578) (-1217.972) (-1205.006) [-1209.340] * (-1204.878) (-1211.421) [-1206.763] (-1209.295) -- 0:01:28
      22500 -- (-1214.992) (-1215.412) [-1203.299] (-1219.245) * [-1207.863] (-1213.040) (-1219.347) (-1214.528) -- 0:01:26
      23000 -- (-1213.213) (-1213.011) [-1204.012] (-1215.038) * (-1210.886) (-1222.346) (-1207.651) [-1209.459] -- 0:01:24
      23500 -- [-1210.421] (-1219.124) (-1204.154) (-1212.199) * [-1205.407] (-1212.265) (-1211.001) (-1207.683) -- 0:01:23
      24000 -- (-1211.917) [-1209.066] (-1202.889) (-1208.362) * (-1206.412) (-1209.252) (-1215.153) [-1213.293] -- 0:01:21
      24500 -- (-1208.455) [-1214.264] (-1203.103) (-1205.381) * (-1206.676) (-1209.650) (-1211.608) [-1211.350] -- 0:01:19
      25000 -- [-1218.839] (-1215.566) (-1207.360) (-1203.521) * (-1208.584) (-1213.081) (-1211.277) [-1216.193] -- 0:01:18

      Average standard deviation of split frequencies: 0.065931

      25500 -- [-1209.110] (-1218.738) (-1205.851) (-1203.388) * (-1204.240) [-1209.594] (-1211.840) (-1219.747) -- 0:01:16
      26000 -- (-1210.277) (-1216.176) (-1204.299) [-1204.032] * (-1203.842) (-1211.368) (-1206.603) [-1208.762] -- 0:01:14
      26500 -- (-1216.243) [-1206.633] (-1209.317) (-1203.489) * (-1204.974) (-1221.218) (-1214.704) [-1210.066] -- 0:01:13
      27000 -- (-1208.249) (-1204.251) (-1205.366) [-1203.587] * (-1206.737) (-1209.137) (-1209.171) [-1216.520] -- 0:01:12
      27500 -- (-1209.056) (-1204.376) [-1203.861] (-1204.111) * (-1203.038) [-1210.475] (-1218.362) (-1217.254) -- 0:01:10
      28000 -- [-1214.989] (-1210.341) (-1201.657) (-1204.306) * [-1202.890] (-1211.231) (-1214.557) (-1216.073) -- 0:01:09
      28500 -- (-1214.658) [-1203.771] (-1204.583) (-1202.422) * (-1202.574) (-1209.567) [-1209.458] (-1214.700) -- 0:01:08
      29000 -- (-1217.163) [-1203.365] (-1206.216) (-1203.180) * (-1205.083) (-1214.405) [-1209.515] (-1211.297) -- 0:01:06
      29500 -- (-1210.132) (-1203.313) (-1207.044) [-1205.447] * (-1203.195) (-1209.820) [-1212.099] (-1210.328) -- 0:01:05
      30000 -- [-1206.686] (-1203.872) (-1208.033) (-1205.187) * (-1207.505) (-1214.206) (-1213.546) [-1212.519] -- 0:01:04

      Average standard deviation of split frequencies: 0.041724

      30500 -- (-1221.865) (-1203.210) [-1207.338] (-1205.941) * (-1208.438) (-1211.168) [-1210.638] (-1218.253) -- 0:01:03
      31000 -- (-1212.683) (-1202.872) [-1206.145] (-1203.477) * (-1204.610) (-1215.165) (-1214.069) [-1211.091] -- 0:01:02
      31500 -- (-1216.110) (-1204.473) (-1207.756) [-1203.587] * (-1204.051) (-1206.319) (-1214.293) [-1213.640] -- 0:01:01
      32000 -- (-1213.516) [-1205.844] (-1203.615) (-1202.923) * [-1204.080] (-1213.914) (-1209.003) (-1220.463) -- 0:01:00
      32500 -- (-1226.083) (-1203.751) [-1202.572] (-1202.851) * (-1204.258) [-1218.973] (-1209.629) (-1215.151) -- 0:00:59
      33000 -- (-1204.331) [-1202.801] (-1202.160) (-1202.261) * (-1204.344) (-1205.498) (-1212.463) [-1209.123] -- 0:00:58
      33500 -- (-1202.197) (-1210.084) [-1203.569] (-1202.620) * [-1203.421] (-1203.978) (-1214.775) (-1210.296) -- 0:00:57
      34000 -- (-1203.399) (-1210.550) [-1202.065] (-1202.057) * (-1204.116) (-1206.013) [-1208.712] (-1215.699) -- 0:00:56
      34500 -- (-1203.158) (-1206.684) [-1202.059] (-1201.690) * (-1204.395) (-1202.909) (-1216.348) [-1211.101] -- 0:00:55
      35000 -- (-1205.921) [-1203.188] (-1207.736) (-1203.470) * (-1202.189) [-1202.815] (-1210.928) (-1216.313) -- 0:00:55

      Average standard deviation of split frequencies: 0.038037

      35500 -- (-1204.070) (-1202.399) (-1206.359) [-1202.764] * (-1203.503) (-1202.231) (-1210.678) [-1211.266] -- 0:00:54
      36000 -- (-1203.046) (-1202.501) (-1202.159) [-1202.685] * (-1205.386) (-1208.596) (-1211.730) [-1209.376] -- 0:01:20
      36500 -- (-1201.974) (-1205.042) (-1202.803) [-1202.663] * (-1202.006) [-1207.997] (-1209.890) (-1212.424) -- 0:01:19
      37000 -- (-1202.121) [-1203.594] (-1204.598) (-1202.926) * [-1202.590] (-1205.278) (-1208.139) (-1214.222) -- 0:01:18
      37500 -- [-1201.882] (-1207.290) (-1207.133) (-1204.967) * (-1203.565) [-1202.772] (-1221.961) (-1211.554) -- 0:01:17
      38000 -- [-1202.777] (-1205.635) (-1203.709) (-1206.062) * (-1201.869) (-1202.772) [-1218.773] (-1210.614) -- 0:01:15
      38500 -- (-1202.843) (-1203.410) (-1203.063) [-1204.313] * [-1203.277] (-1202.772) (-1214.377) (-1216.682) -- 0:01:14
      39000 -- (-1202.497) (-1204.676) [-1201.772] (-1206.139) * (-1202.633) [-1204.740] (-1212.443) (-1214.940) -- 0:01:13
      39500 -- (-1203.651) (-1204.080) (-1202.838) [-1204.879] * (-1202.090) (-1204.302) [-1212.580] (-1215.301) -- 0:01:12
      40000 -- (-1201.991) (-1203.986) (-1202.716) [-1205.672] * [-1202.395] (-1206.190) (-1209.449) (-1218.979) -- 0:01:12

      Average standard deviation of split frequencies: 0.045758

      40500 -- [-1202.105] (-1204.345) (-1202.853) (-1206.509) * [-1201.691] (-1203.520) (-1211.722) (-1207.475) -- 0:01:11
      41000 -- (-1202.374) (-1203.877) (-1203.084) [-1206.400] * (-1202.081) (-1203.471) (-1210.745) [-1214.925] -- 0:01:10
      41500 -- (-1205.339) [-1202.536] (-1203.694) (-1205.088) * (-1202.727) (-1202.961) (-1208.806) [-1211.544] -- 0:01:09
      42000 -- (-1205.411) [-1202.911] (-1204.101) (-1204.299) * (-1202.522) (-1201.896) [-1211.364] (-1212.486) -- 0:01:08
      42500 -- (-1203.444) (-1202.962) [-1205.161] (-1205.635) * [-1201.786] (-1202.533) (-1209.226) (-1215.259) -- 0:01:07
      43000 -- (-1205.099) (-1203.128) [-1206.638] (-1204.581) * (-1202.933) (-1206.661) (-1213.542) [-1208.004] -- 0:01:06
      43500 -- (-1207.729) (-1208.554) (-1201.587) [-1204.845] * (-1203.798) [-1204.798] (-1218.040) (-1211.741) -- 0:01:05
      44000 -- (-1207.971) (-1208.453) [-1203.707] (-1208.015) * (-1204.364) [-1201.845] (-1226.316) (-1220.269) -- 0:01:05
      44500 -- (-1207.182) [-1203.168] (-1205.163) (-1209.956) * (-1203.331) (-1204.604) (-1206.610) [-1212.252] -- 0:01:04
      45000 -- [-1206.737] (-1201.995) (-1203.178) (-1211.969) * [-1203.614] (-1207.560) (-1215.249) (-1214.182) -- 0:01:03

      Average standard deviation of split frequencies: 0.036893

      45500 -- (-1205.526) (-1202.463) (-1204.245) [-1203.259] * (-1203.018) (-1206.199) [-1214.140] (-1211.235) -- 0:01:02
      46000 -- (-1202.705) (-1203.153) [-1206.377] (-1202.281) * (-1203.767) [-1205.313] (-1209.690) (-1213.754) -- 0:01:02
      46500 -- (-1202.541) (-1206.238) (-1204.127) [-1202.594] * (-1211.312) (-1203.360) [-1210.503] (-1206.236) -- 0:01:01
      47000 -- (-1202.448) [-1204.569] (-1204.055) (-1202.275) * (-1208.655) (-1202.984) [-1213.248] (-1212.502) -- 0:01:00
      47500 -- [-1202.049] (-1204.379) (-1205.956) (-1201.763) * (-1211.145) (-1207.175) (-1213.119) [-1211.120] -- 0:01:00
      48000 -- (-1202.485) (-1205.801) (-1208.052) [-1201.469] * (-1208.617) (-1208.540) [-1209.652] (-1208.842) -- 0:00:59
      48500 -- (-1205.674) (-1209.795) (-1206.299) [-1203.286] * [-1206.049] (-1205.553) (-1216.597) (-1214.330) -- 0:00:58
      49000 -- [-1203.167] (-1207.717) (-1206.905) (-1206.076) * (-1203.509) [-1204.144] (-1219.359) (-1216.628) -- 0:00:58
      49500 -- (-1204.844) [-1205.804] (-1205.017) (-1204.669) * (-1203.775) [-1203.970] (-1213.791) (-1209.248) -- 0:00:57
      50000 -- (-1203.085) (-1202.848) (-1203.819) [-1203.626] * (-1207.390) [-1202.795] (-1212.147) (-1215.263) -- 0:00:57

      Average standard deviation of split frequencies: 0.032343

      50500 -- [-1204.317] (-1202.149) (-1203.771) (-1208.199) * (-1204.967) [-1207.312] (-1230.180) (-1213.389) -- 0:00:56
      51000 -- (-1204.587) [-1203.400] (-1202.590) (-1205.521) * (-1205.784) (-1208.663) [-1205.561] (-1219.120) -- 0:00:55
      51500 -- (-1204.321) (-1206.719) [-1202.437] (-1206.770) * (-1205.514) (-1207.037) [-1202.864] (-1217.515) -- 0:00:55
      52000 -- (-1204.586) [-1205.246] (-1203.676) (-1202.864) * (-1207.804) [-1209.500] (-1203.827) (-1209.286) -- 0:01:12
      52500 -- (-1202.236) (-1205.660) [-1202.792] (-1205.275) * (-1206.292) (-1205.280) (-1203.748) [-1208.548] -- 0:01:12
      53000 -- (-1202.008) [-1203.839] (-1205.447) (-1204.663) * [-1203.914] (-1204.663) (-1202.093) (-1213.014) -- 0:01:11
      53500 -- (-1203.739) (-1202.885) (-1205.197) [-1204.256] * (-1204.739) [-1203.339] (-1203.133) (-1217.448) -- 0:01:10
      54000 -- (-1205.414) (-1208.672) (-1204.095) [-1202.305] * (-1204.603) (-1203.986) [-1202.186] (-1215.821) -- 0:01:10
      54500 -- (-1205.460) (-1209.438) [-1205.654] (-1205.915) * (-1203.719) (-1203.538) (-1204.291) [-1211.105] -- 0:01:09
      55000 -- (-1203.545) (-1205.548) (-1206.598) [-1202.805] * (-1203.924) (-1204.303) (-1205.940) [-1211.544] -- 0:01:08

      Average standard deviation of split frequencies: 0.031988

      55500 -- (-1206.084) [-1204.536] (-1205.067) (-1203.959) * (-1203.236) (-1204.224) (-1202.439) [-1210.944] -- 0:01:08
      56000 -- (-1204.916) (-1203.432) [-1205.380] (-1203.957) * (-1203.875) [-1204.827] (-1202.528) (-1212.316) -- 0:01:07
      56500 -- (-1205.255) (-1202.106) (-1205.500) [-1205.028] * [-1203.795] (-1205.401) (-1204.070) (-1217.929) -- 0:01:06
      57000 -- (-1204.554) (-1202.936) [-1210.261] (-1204.981) * [-1203.768] (-1209.257) (-1204.851) (-1209.574) -- 0:01:06
      57500 -- (-1204.799) (-1203.497) (-1209.493) [-1205.470] * (-1206.582) (-1202.876) [-1202.731] (-1211.157) -- 0:01:05
      58000 -- [-1205.095] (-1202.678) (-1213.718) (-1201.786) * (-1205.870) [-1203.763] (-1204.631) (-1217.035) -- 0:01:04
      58500 -- (-1203.621) (-1202.553) (-1207.206) [-1203.268] * (-1204.570) [-1203.214] (-1203.628) (-1207.761) -- 0:01:04
      59000 -- [-1203.037] (-1201.990) (-1203.391) (-1203.815) * (-1203.774) (-1204.628) [-1205.525] (-1215.953) -- 0:01:03
      59500 -- (-1203.038) (-1203.471) (-1203.595) [-1202.225] * (-1203.701) (-1202.585) (-1203.164) [-1209.552] -- 0:01:03
      60000 -- (-1203.277) (-1204.865) [-1203.130] (-1202.717) * (-1204.086) (-1204.239) [-1204.522] (-1209.523) -- 0:01:02

      Average standard deviation of split frequencies: 0.036694

      60500 -- (-1202.799) [-1205.507] (-1203.123) (-1206.789) * (-1207.824) (-1203.281) (-1202.637) [-1214.791] -- 0:01:02
      61000 -- [-1204.133] (-1203.075) (-1204.663) (-1206.021) * (-1210.345) [-1203.992] (-1204.432) (-1211.851) -- 0:01:01
      61500 -- (-1202.947) (-1203.452) [-1205.807] (-1206.377) * (-1205.993) (-1204.298) [-1204.084] (-1210.818) -- 0:01:01
      62000 -- [-1202.917] (-1207.528) (-1204.722) (-1206.085) * (-1203.363) (-1202.026) (-1202.030) [-1210.077] -- 0:01:00
      62500 -- (-1206.969) [-1206.116] (-1205.006) (-1207.196) * (-1205.737) [-1201.705] (-1204.059) (-1218.411) -- 0:01:00
      63000 -- (-1202.421) (-1203.753) (-1205.544) [-1204.462] * (-1207.904) (-1203.593) [-1202.574] (-1217.041) -- 0:00:59
      63500 -- [-1203.745] (-1204.025) (-1204.108) (-1204.339) * (-1203.292) (-1205.375) (-1202.368) [-1210.181] -- 0:00:58
      64000 -- (-1205.107) (-1205.322) [-1203.805] (-1205.635) * [-1202.680] (-1205.261) (-1203.621) (-1207.289) -- 0:00:58
      64500 -- (-1205.434) (-1202.984) [-1203.945] (-1204.857) * (-1204.052) (-1202.569) [-1208.369] (-1210.355) -- 0:00:58
      65000 -- [-1205.151] (-1202.487) (-1204.217) (-1204.240) * (-1204.186) (-1203.106) [-1202.873] (-1207.669) -- 0:00:57

      Average standard deviation of split frequencies: 0.034284

      65500 -- (-1204.775) (-1204.010) [-1202.950] (-1203.956) * [-1203.808] (-1201.610) (-1202.976) (-1215.807) -- 0:00:57
      66000 -- [-1203.585] (-1206.129) (-1206.379) (-1203.463) * [-1204.890] (-1201.504) (-1205.815) (-1222.077) -- 0:00:56
      66500 -- (-1204.991) (-1202.752) (-1207.917) [-1206.844] * [-1203.098] (-1202.103) (-1207.317) (-1210.426) -- 0:00:56
      67000 -- (-1205.234) (-1204.138) (-1202.842) [-1204.591] * (-1203.207) [-1201.694] (-1209.224) (-1214.686) -- 0:00:55
      67500 -- (-1202.925) (-1203.546) [-1204.026] (-1206.210) * [-1206.807] (-1202.780) (-1205.704) (-1212.000) -- 0:01:09
      68000 -- [-1206.941] (-1203.404) (-1202.628) (-1207.565) * (-1205.031) [-1203.002] (-1203.699) (-1210.635) -- 0:01:08
      68500 -- [-1205.619] (-1204.091) (-1203.353) (-1205.971) * (-1208.241) [-1204.579] (-1203.282) (-1218.323) -- 0:01:07
      69000 -- (-1203.089) (-1205.192) [-1204.864] (-1208.234) * (-1203.178) [-1202.663] (-1205.702) (-1213.535) -- 0:01:07
      69500 -- [-1205.106] (-1201.908) (-1202.885) (-1204.352) * (-1202.888) [-1204.432] (-1203.736) (-1218.980) -- 0:01:06
      70000 -- [-1203.120] (-1205.179) (-1203.066) (-1203.933) * (-1201.950) [-1202.061] (-1206.048) (-1220.172) -- 0:01:06

      Average standard deviation of split frequencies: 0.027954

      70500 -- (-1203.411) [-1205.614] (-1204.180) (-1203.500) * (-1204.470) (-1202.367) (-1202.768) [-1213.799] -- 0:01:05
      71000 -- (-1203.476) (-1205.838) [-1205.641] (-1211.411) * (-1203.776) (-1202.552) [-1203.156] (-1214.626) -- 0:01:05
      71500 -- (-1203.197) (-1203.204) [-1204.714] (-1204.205) * (-1205.351) [-1202.703] (-1203.346) (-1219.882) -- 0:01:04
      72000 -- [-1206.287] (-1203.653) (-1205.603) (-1204.693) * [-1203.958] (-1205.385) (-1203.650) (-1220.807) -- 0:01:04
      72500 -- (-1211.660) (-1204.879) [-1202.941] (-1210.998) * (-1203.748) (-1204.204) (-1203.791) [-1216.852] -- 0:01:03
      73000 -- (-1202.777) (-1203.591) (-1202.966) [-1202.509] * (-1203.282) (-1204.882) (-1204.559) [-1210.226] -- 0:01:03
      73500 -- (-1201.958) (-1203.226) (-1202.683) [-1202.908] * [-1206.488] (-1207.162) (-1202.780) (-1207.493) -- 0:01:03
      74000 -- [-1203.926] (-1204.393) (-1202.959) (-1202.881) * (-1203.772) (-1207.485) (-1201.833) [-1207.525] -- 0:01:02
      74500 -- (-1205.141) (-1205.826) [-1202.403] (-1201.736) * (-1203.502) (-1203.465) (-1207.736) [-1208.603] -- 0:01:02
      75000 -- (-1201.766) (-1205.492) [-1202.395] (-1202.391) * (-1203.620) (-1205.421) [-1203.186] (-1207.904) -- 0:01:01

      Average standard deviation of split frequencies: 0.030450

      75500 -- (-1203.511) (-1203.431) [-1202.359] (-1202.713) * [-1203.232] (-1203.366) (-1202.030) (-1209.622) -- 0:01:01
      76000 -- (-1203.449) [-1203.107] (-1203.527) (-1204.271) * [-1204.075] (-1204.562) (-1202.095) (-1211.946) -- 0:01:00
      76500 -- (-1203.458) (-1202.577) [-1203.991] (-1202.972) * (-1205.938) [-1203.941] (-1201.900) (-1214.004) -- 0:01:00
      77000 -- (-1204.299) (-1202.826) (-1207.811) [-1202.224] * (-1205.515) (-1203.316) [-1203.372] (-1216.250) -- 0:00:59
      77500 -- [-1203.541] (-1204.432) (-1203.913) (-1202.074) * [-1205.971] (-1204.321) (-1203.689) (-1218.091) -- 0:00:59
      78000 -- [-1205.108] (-1202.803) (-1205.975) (-1203.283) * (-1203.106) (-1202.847) [-1201.788] (-1218.451) -- 0:00:59
      78500 -- (-1206.035) (-1206.516) (-1204.283) [-1203.339] * (-1203.759) (-1204.191) [-1201.788] (-1211.201) -- 0:00:58
      79000 -- [-1204.739] (-1202.073) (-1204.420) (-1204.725) * (-1204.700) [-1206.879] (-1203.804) (-1208.657) -- 0:00:58
      79500 -- [-1205.726] (-1202.571) (-1205.820) (-1203.479) * (-1210.598) [-1205.051] (-1205.160) (-1212.203) -- 0:00:57
      80000 -- (-1203.959) (-1204.079) [-1201.769] (-1203.380) * (-1203.674) (-1202.818) [-1202.221] (-1220.359) -- 0:00:57

      Average standard deviation of split frequencies: 0.033602

      80500 -- [-1203.111] (-1205.197) (-1202.583) (-1202.692) * (-1205.469) (-1204.495) (-1202.152) [-1212.366] -- 0:00:57
      81000 -- (-1202.985) (-1203.975) [-1209.790] (-1202.171) * (-1204.419) (-1204.944) (-1202.135) [-1210.931] -- 0:00:56
      81500 -- (-1204.863) (-1203.739) (-1207.681) [-1202.766] * (-1204.315) (-1204.814) [-1201.958] (-1211.211) -- 0:00:56
      82000 -- (-1205.787) (-1202.509) (-1206.047) [-1202.572] * (-1202.574) (-1202.537) [-1202.047] (-1213.168) -- 0:00:55
      82500 -- (-1205.572) [-1204.254] (-1201.742) (-1204.514) * (-1202.520) (-1203.902) [-1202.967] (-1211.725) -- 0:00:55
      83000 -- (-1205.665) [-1202.621] (-1201.896) (-1203.121) * (-1202.303) [-1201.770] (-1208.095) (-1212.829) -- 0:00:55
      83500 -- [-1206.139] (-1204.642) (-1202.709) (-1203.349) * (-1202.310) [-1204.601] (-1204.635) (-1212.845) -- 0:00:54
      84000 -- (-1210.099) (-1203.022) [-1201.739] (-1203.188) * (-1202.573) (-1203.059) (-1202.701) [-1217.987] -- 0:01:05
      84500 -- [-1205.486] (-1204.002) (-1203.075) (-1206.848) * (-1202.641) (-1206.275) (-1203.398) [-1224.866] -- 0:01:05
      85000 -- (-1208.034) [-1203.159] (-1203.658) (-1207.329) * (-1204.669) (-1202.414) (-1203.173) [-1208.373] -- 0:01:04

      Average standard deviation of split frequencies: 0.030397

      85500 -- [-1205.002] (-1202.808) (-1204.294) (-1204.407) * (-1203.207) [-1203.975] (-1202.508) (-1208.937) -- 0:01:04
      86000 -- (-1209.349) [-1203.618] (-1204.360) (-1203.063) * (-1202.514) [-1203.567] (-1205.399) (-1213.669) -- 0:01:03
      86500 -- (-1208.028) (-1204.447) (-1203.341) [-1202.954] * (-1203.412) [-1202.564] (-1209.093) (-1215.055) -- 0:01:03
      87000 -- (-1204.730) (-1204.644) [-1204.855] (-1206.998) * (-1202.890) (-1204.682) [-1204.193] (-1210.718) -- 0:01:02
      87500 -- (-1204.790) [-1204.367] (-1205.981) (-1204.739) * [-1204.023] (-1204.980) (-1202.652) (-1212.275) -- 0:01:02
      88000 -- (-1203.963) (-1203.752) (-1205.622) [-1205.138] * (-1203.085) (-1203.642) (-1203.161) [-1206.666] -- 0:01:02
      88500 -- (-1203.663) (-1204.548) (-1203.707) [-1207.981] * (-1203.892) [-1203.055] (-1202.984) (-1211.969) -- 0:01:01
      89000 -- [-1204.058] (-1203.935) (-1204.094) (-1208.545) * (-1206.328) [-1202.932] (-1202.217) (-1221.743) -- 0:01:01
      89500 -- (-1204.365) (-1204.637) [-1204.691] (-1203.629) * (-1203.884) (-1203.114) (-1207.600) [-1207.576] -- 0:01:01
      90000 -- (-1206.164) (-1205.665) [-1203.652] (-1202.893) * (-1203.330) [-1204.215] (-1203.133) (-1215.185) -- 0:01:00

      Average standard deviation of split frequencies: 0.031443

      90500 -- (-1206.070) [-1207.783] (-1203.887) (-1203.322) * [-1202.268] (-1202.171) (-1202.026) (-1213.307) -- 0:01:00
      91000 -- [-1203.282] (-1203.672) (-1204.117) (-1203.281) * (-1202.694) (-1203.845) (-1207.883) [-1210.831] -- 0:00:59
      91500 -- [-1204.703] (-1202.324) (-1204.693) (-1203.341) * (-1202.188) (-1204.675) [-1204.357] (-1220.895) -- 0:00:59
      92000 -- (-1209.977) (-1203.065) [-1207.974] (-1205.060) * (-1204.892) (-1204.646) (-1202.384) [-1213.816] -- 0:00:59
      92500 -- (-1204.789) [-1205.152] (-1206.179) (-1204.419) * (-1203.628) [-1202.748] (-1202.980) (-1216.189) -- 0:00:58
      93000 -- [-1204.124] (-1206.280) (-1203.872) (-1202.068) * (-1203.792) (-1202.423) (-1203.111) [-1211.166] -- 0:00:58
      93500 -- (-1204.516) (-1204.945) (-1203.042) [-1203.003] * (-1202.854) (-1205.727) (-1202.603) [-1215.551] -- 0:00:58
      94000 -- (-1205.644) (-1203.972) (-1202.990) [-1202.576] * (-1204.049) (-1204.031) (-1202.709) [-1210.721] -- 0:00:57
      94500 -- [-1205.259] (-1207.263) (-1206.013) (-1203.765) * (-1204.140) (-1207.380) [-1202.776] (-1217.708) -- 0:00:57
      95000 -- [-1206.762] (-1204.446) (-1203.551) (-1204.530) * (-1204.888) (-1204.859) (-1203.220) [-1209.787] -- 0:00:57

      Average standard deviation of split frequencies: 0.032655

      95500 -- (-1201.977) [-1204.861] (-1204.253) (-1205.916) * (-1204.321) [-1207.635] (-1203.775) (-1211.407) -- 0:00:56
      96000 -- [-1204.253] (-1202.860) (-1204.224) (-1208.789) * (-1207.933) [-1202.170] (-1205.159) (-1213.256) -- 0:00:56
      96500 -- [-1203.433] (-1203.688) (-1203.072) (-1202.336) * (-1208.042) [-1204.384] (-1205.810) (-1211.803) -- 0:00:56
      97000 -- (-1204.300) [-1204.116] (-1210.199) (-1205.614) * (-1207.105) (-1202.975) (-1202.033) [-1212.088] -- 0:00:55
      97500 -- (-1202.745) [-1204.787] (-1203.031) (-1203.086) * (-1205.660) (-1202.999) [-1201.979] (-1215.843) -- 0:00:55
      98000 -- [-1203.249] (-1204.968) (-1204.601) (-1203.559) * (-1203.346) (-1202.894) [-1201.918] (-1216.044) -- 0:00:55
      98500 -- (-1202.839) (-1204.476) [-1203.339] (-1205.266) * (-1204.875) (-1202.076) (-1203.174) [-1209.732] -- 0:00:54
      99000 -- [-1203.211] (-1203.325) (-1203.384) (-1209.794) * (-1205.688) (-1203.850) [-1203.691] (-1212.529) -- 0:00:54
      99500 -- (-1203.090) (-1204.618) [-1202.775] (-1207.580) * [-1203.586] (-1203.734) (-1206.532) (-1214.030) -- 0:00:54
      100000 -- (-1204.442) [-1203.586] (-1203.694) (-1202.982) * (-1203.418) [-1201.865] (-1204.022) (-1212.382) -- 0:01:02

      Average standard deviation of split frequencies: 0.032780

      100500 -- (-1205.489) [-1202.061] (-1206.161) (-1204.377) * (-1204.361) (-1204.727) (-1208.410) [-1214.386] -- 0:01:02
      101000 -- (-1204.573) (-1206.068) [-1201.966] (-1202.082) * [-1204.022] (-1203.379) (-1205.806) (-1221.064) -- 0:01:02
      101500 -- (-1204.891) (-1205.766) (-1202.170) [-1202.015] * (-1203.082) (-1203.539) [-1207.213] (-1214.011) -- 0:01:01
      102000 -- (-1205.676) (-1202.206) (-1204.211) [-1202.848] * (-1205.183) [-1202.353] (-1202.045) (-1209.427) -- 0:01:01
      102500 -- (-1206.114) [-1202.902] (-1204.784) (-1202.953) * (-1204.270) [-1202.642] (-1202.105) (-1212.503) -- 0:01:01
      103000 -- [-1211.571] (-1203.105) (-1204.578) (-1203.111) * (-1205.855) [-1202.438] (-1206.284) (-1214.541) -- 0:01:00
      103500 -- [-1204.864] (-1202.911) (-1207.427) (-1203.471) * (-1204.607) (-1203.014) [-1202.294] (-1214.323) -- 0:01:00
      104000 -- [-1206.650] (-1202.286) (-1206.982) (-1202.430) * (-1203.856) [-1204.018] (-1204.025) (-1210.570) -- 0:01:00
      104500 -- [-1206.445] (-1202.483) (-1205.323) (-1204.636) * [-1203.755] (-1201.770) (-1204.860) (-1213.214) -- 0:00:59
      105000 -- [-1203.981] (-1203.224) (-1202.509) (-1202.571) * (-1204.888) (-1201.632) (-1205.958) [-1217.080] -- 0:00:59

      Average standard deviation of split frequencies: 0.029129

      105500 -- [-1204.482] (-1214.030) (-1202.892) (-1202.739) * (-1204.118) [-1202.776] (-1206.543) (-1211.686) -- 0:00:59
      106000 -- [-1205.534] (-1208.024) (-1205.628) (-1207.442) * (-1202.733) [-1202.137] (-1208.412) (-1209.555) -- 0:00:59
      106500 -- [-1203.559] (-1204.634) (-1202.552) (-1203.534) * (-1207.751) (-1203.254) (-1204.389) [-1210.304] -- 0:00:58
      107000 -- (-1204.626) (-1205.000) [-1207.070] (-1205.737) * (-1210.901) [-1202.356] (-1203.753) (-1214.397) -- 0:00:58
      107500 -- [-1202.884] (-1206.548) (-1206.616) (-1206.235) * (-1202.776) (-1206.097) (-1204.490) [-1216.812] -- 0:00:58
      108000 -- [-1205.110] (-1204.263) (-1206.216) (-1204.078) * (-1205.030) (-1204.136) [-1203.308] (-1212.986) -- 0:00:57
      108500 -- [-1203.915] (-1202.947) (-1203.683) (-1202.587) * [-1203.467] (-1204.376) (-1204.420) (-1217.393) -- 0:00:57
      109000 -- (-1203.717) [-1203.695] (-1204.169) (-1204.641) * (-1202.547) (-1206.519) (-1208.388) [-1214.923] -- 0:00:57
      109500 -- (-1203.265) [-1202.753] (-1205.352) (-1204.117) * [-1203.967] (-1203.476) (-1207.995) (-1214.972) -- 0:00:56
      110000 -- [-1203.221] (-1203.929) (-1206.100) (-1201.947) * (-1203.853) (-1204.876) (-1204.900) [-1213.634] -- 0:00:56

      Average standard deviation of split frequencies: 0.028804

      110500 -- (-1203.384) [-1203.007] (-1203.530) (-1202.302) * (-1206.098) (-1206.796) (-1203.135) [-1214.255] -- 0:00:56
      111000 -- (-1204.555) [-1202.023] (-1208.730) (-1202.055) * (-1204.998) [-1202.342] (-1202.773) (-1214.152) -- 0:00:56
      111500 -- (-1204.396) [-1202.859] (-1205.661) (-1205.162) * (-1202.084) (-1205.682) [-1204.032] (-1211.401) -- 0:00:55
      112000 -- (-1203.877) (-1208.153) (-1204.728) [-1202.668] * (-1202.100) [-1202.727] (-1205.815) (-1221.612) -- 0:00:55
      112500 -- (-1207.410) [-1205.312] (-1203.381) (-1203.440) * (-1207.716) [-1203.306] (-1206.396) (-1212.487) -- 0:00:55
      113000 -- (-1207.686) [-1203.235] (-1204.625) (-1203.221) * [-1202.956] (-1202.491) (-1207.472) (-1213.387) -- 0:00:54
      113500 -- [-1202.665] (-1202.026) (-1205.583) (-1204.076) * [-1204.996] (-1203.252) (-1203.621) (-1213.753) -- 0:00:54
      114000 -- (-1203.272) (-1202.028) (-1207.316) [-1202.960] * [-1202.689] (-1201.928) (-1204.867) (-1222.131) -- 0:00:54
      114500 -- (-1202.727) [-1202.057] (-1204.475) (-1206.434) * (-1205.556) (-1203.065) [-1202.472] (-1217.413) -- 0:00:54
      115000 -- (-1203.701) [-1202.438] (-1202.544) (-1203.789) * (-1207.847) (-1204.372) [-1202.397] (-1210.541) -- 0:00:53

      Average standard deviation of split frequencies: 0.029666

      115500 -- (-1205.339) (-1202.402) (-1205.610) [-1202.872] * [-1204.372] (-1204.288) (-1202.394) (-1218.179) -- 0:00:53
      116000 -- (-1201.847) (-1202.123) (-1206.968) [-1203.403] * (-1204.106) [-1206.351] (-1203.551) (-1216.162) -- 0:01:00
      116500 -- [-1204.706] (-1202.186) (-1204.952) (-1203.322) * (-1204.863) (-1203.275) [-1204.205] (-1222.019) -- 0:01:00
      117000 -- [-1201.616] (-1202.196) (-1202.456) (-1203.221) * [-1203.193] (-1202.831) (-1201.861) (-1215.929) -- 0:01:00
      117500 -- [-1203.049] (-1202.412) (-1207.315) (-1206.539) * (-1205.997) (-1205.805) (-1201.872) [-1212.760] -- 0:01:00
      118000 -- (-1203.096) (-1203.841) [-1207.968] (-1204.986) * (-1210.525) (-1203.379) (-1201.606) [-1214.245] -- 0:00:59
      118500 -- (-1202.432) (-1201.888) [-1206.290] (-1206.696) * (-1202.965) [-1202.835] (-1201.805) (-1213.351) -- 0:00:59
      119000 -- (-1201.998) (-1202.771) (-1210.167) [-1208.550] * [-1203.502] (-1205.201) (-1202.133) (-1211.971) -- 0:00:59
      119500 -- (-1203.887) (-1202.313) (-1212.365) [-1206.112] * (-1202.644) (-1204.728) (-1202.621) [-1208.025] -- 0:00:58
      120000 -- (-1204.143) [-1204.789] (-1205.060) (-1202.778) * (-1203.724) (-1206.340) (-1202.432) [-1210.321] -- 0:00:58

      Average standard deviation of split frequencies: 0.027905

      120500 -- [-1205.693] (-1205.567) (-1210.524) (-1204.627) * (-1203.188) (-1202.539) (-1204.540) [-1209.099] -- 0:00:58
      121000 -- (-1205.818) (-1203.620) (-1207.712) [-1202.662] * (-1204.039) (-1204.007) (-1204.479) [-1210.940] -- 0:00:58
      121500 -- (-1208.500) (-1202.616) (-1204.193) [-1203.130] * (-1202.732) (-1206.316) [-1204.234] (-1212.315) -- 0:00:57
      122000 -- [-1203.245] (-1204.365) (-1204.380) (-1203.623) * (-1203.140) (-1205.946) (-1201.863) [-1214.025] -- 0:00:57
      122500 -- (-1208.215) [-1205.536] (-1202.572) (-1203.809) * [-1203.103] (-1202.357) (-1202.017) (-1211.220) -- 0:00:57
      123000 -- [-1206.907] (-1204.045) (-1204.890) (-1203.239) * (-1202.201) [-1203.868] (-1203.310) (-1220.963) -- 0:00:57
      123500 -- (-1207.816) [-1205.181] (-1203.776) (-1202.848) * (-1202.848) (-1203.841) (-1205.931) [-1218.769] -- 0:00:56
      124000 -- (-1206.250) [-1207.182] (-1214.162) (-1202.815) * (-1203.629) (-1206.591) (-1204.427) [-1202.486] -- 0:00:56
      124500 -- (-1206.839) [-1204.875] (-1206.818) (-1202.635) * (-1203.986) (-1204.234) [-1204.923] (-1208.704) -- 0:00:56
      125000 -- (-1204.176) (-1204.169) [-1202.784] (-1204.553) * (-1205.283) (-1205.854) [-1204.884] (-1202.389) -- 0:00:56

      Average standard deviation of split frequencies: 0.023944

      125500 -- (-1211.744) (-1208.188) [-1201.983] (-1205.068) * [-1202.983] (-1202.227) (-1204.667) (-1201.870) -- 0:00:55
      126000 -- (-1202.410) (-1206.864) [-1202.255] (-1203.932) * (-1203.594) [-1205.161] (-1204.923) (-1201.875) -- 0:00:55
      126500 -- [-1202.956] (-1205.792) (-1205.276) (-1204.214) * (-1205.206) (-1202.372) (-1209.039) [-1201.950] -- 0:00:55
      127000 -- [-1204.405] (-1203.292) (-1205.775) (-1203.484) * (-1205.881) (-1202.647) [-1204.419] (-1204.595) -- 0:00:54
      127500 -- [-1203.547] (-1203.835) (-1203.816) (-1204.578) * (-1204.337) (-1202.907) [-1203.404] (-1203.357) -- 0:00:54
      128000 -- (-1202.543) (-1204.864) (-1204.775) [-1203.523] * (-1205.698) (-1203.145) (-1205.371) [-1203.074] -- 0:00:54
      128500 -- (-1203.476) (-1204.652) [-1204.784] (-1202.667) * (-1204.325) (-1203.208) (-1207.226) [-1202.618] -- 0:00:54
      129000 -- [-1203.718] (-1205.441) (-1207.170) (-1208.686) * [-1205.422] (-1202.754) (-1207.404) (-1204.114) -- 0:00:54
      129500 -- [-1202.842] (-1202.978) (-1208.996) (-1207.342) * (-1203.114) (-1206.030) (-1205.351) [-1206.483] -- 0:00:53
      130000 -- (-1203.699) [-1203.485] (-1206.420) (-1205.267) * (-1204.137) (-1204.009) (-1205.196) [-1202.499] -- 0:00:53

      Average standard deviation of split frequencies: 0.023811

      130500 -- [-1202.700] (-1204.810) (-1203.710) (-1205.811) * (-1203.225) (-1202.863) (-1204.147) [-1205.735] -- 0:00:53
      131000 -- (-1206.167) [-1204.028] (-1203.511) (-1203.748) * [-1203.171] (-1203.963) (-1203.364) (-1208.338) -- 0:00:53
      131500 -- [-1206.901] (-1204.079) (-1205.170) (-1206.498) * (-1204.394) (-1205.372) [-1204.960] (-1213.930) -- 0:00:52
      132000 -- (-1203.096) (-1206.284) [-1204.796] (-1208.054) * (-1203.792) (-1202.693) [-1202.902] (-1205.473) -- 0:00:52
      132500 -- (-1204.803) (-1205.746) [-1203.422] (-1207.362) * (-1203.691) [-1202.403] (-1204.422) (-1205.337) -- 0:00:58
      133000 -- (-1204.096) (-1204.434) [-1205.092] (-1205.271) * (-1202.613) (-1202.286) (-1203.527) [-1206.082] -- 0:00:58
      133500 -- (-1204.957) (-1206.416) (-1205.892) [-1204.806] * (-1204.062) (-1202.125) (-1203.632) [-1205.981] -- 0:00:58
      134000 -- (-1205.528) (-1204.858) (-1204.296) [-1205.288] * (-1204.952) [-1204.657] (-1202.694) (-1202.416) -- 0:00:58
      134500 -- (-1205.675) (-1205.884) (-1208.710) [-1204.600] * (-1205.174) (-1206.227) [-1204.561] (-1203.782) -- 0:00:57
      135000 -- (-1207.491) [-1210.233] (-1206.210) (-1202.182) * (-1203.166) [-1204.090] (-1204.634) (-1203.603) -- 0:00:57

      Average standard deviation of split frequencies: 0.024263

      135500 -- (-1204.092) (-1204.738) (-1209.238) [-1202.178] * (-1201.877) [-1205.442] (-1204.916) (-1203.771) -- 0:00:57
      136000 -- (-1203.824) [-1203.972] (-1207.259) (-1202.962) * [-1203.556] (-1203.158) (-1203.888) (-1203.752) -- 0:00:57
      136500 -- (-1209.147) (-1203.517) [-1204.602] (-1201.719) * (-1202.710) (-1203.228) [-1204.050] (-1209.164) -- 0:00:56
      137000 -- (-1203.522) [-1203.372] (-1204.024) (-1202.373) * [-1204.174] (-1204.072) (-1203.486) (-1209.724) -- 0:00:56
      137500 -- (-1203.378) [-1203.238] (-1204.940) (-1202.969) * [-1203.725] (-1203.389) (-1205.443) (-1209.397) -- 0:00:56
      138000 -- (-1203.817) (-1202.909) (-1205.401) [-1203.021] * (-1204.348) (-1201.645) (-1203.397) [-1203.675] -- 0:00:56
      138500 -- (-1204.339) (-1204.309) (-1205.189) [-1202.641] * (-1205.540) [-1202.294] (-1202.770) (-1203.712) -- 0:00:55
      139000 -- (-1201.828) [-1203.646] (-1204.058) (-1202.806) * (-1205.281) (-1202.985) [-1202.380] (-1202.916) -- 0:00:55
      139500 -- (-1202.471) (-1208.525) (-1208.332) [-1202.913] * (-1206.767) [-1201.909] (-1203.149) (-1203.535) -- 0:00:55
      140000 -- (-1203.479) [-1204.295] (-1203.950) (-1205.307) * (-1203.778) (-1203.794) [-1205.396] (-1205.657) -- 0:00:55

      Average standard deviation of split frequencies: 0.023831

      140500 -- (-1203.940) (-1202.582) (-1206.534) [-1203.162] * (-1203.123) (-1202.978) (-1202.945) [-1203.559] -- 0:00:55
      141000 -- [-1202.996] (-1202.582) (-1206.304) (-1206.186) * (-1203.591) (-1203.766) (-1202.669) [-1203.698] -- 0:00:54
      141500 -- (-1203.792) [-1202.775] (-1203.767) (-1203.316) * [-1205.874] (-1203.764) (-1202.669) (-1204.446) -- 0:00:54
      142000 -- (-1203.285) (-1206.261) (-1206.248) [-1202.420] * (-1205.085) [-1203.464] (-1203.037) (-1204.963) -- 0:00:54
      142500 -- (-1203.512) (-1202.446) (-1209.583) [-1205.386] * [-1203.745] (-1203.186) (-1204.088) (-1202.440) -- 0:00:54
      143000 -- (-1205.925) [-1204.946] (-1205.415) (-1204.318) * (-1207.721) (-1202.896) (-1205.364) [-1202.229] -- 0:00:53
      143500 -- (-1205.114) [-1203.899] (-1208.031) (-1203.757) * (-1207.199) (-1204.067) [-1204.628] (-1205.311) -- 0:00:53
      144000 -- [-1207.553] (-1208.334) (-1206.065) (-1203.532) * (-1204.974) (-1203.826) (-1204.389) [-1209.368] -- 0:00:53
      144500 -- (-1205.976) [-1205.184] (-1203.671) (-1204.782) * [-1203.751] (-1204.078) (-1202.192) (-1205.461) -- 0:00:53
      145000 -- [-1204.526] (-1207.058) (-1203.108) (-1202.621) * (-1207.835) (-1203.650) (-1202.073) [-1202.528] -- 0:00:53

      Average standard deviation of split frequencies: 0.021633

      145500 -- [-1206.796] (-1207.423) (-1203.306) (-1206.087) * (-1203.742) [-1201.915] (-1203.738) (-1202.926) -- 0:00:52
      146000 -- [-1202.581] (-1209.759) (-1204.059) (-1206.485) * (-1202.381) (-1207.054) [-1204.632] (-1203.617) -- 0:00:52
      146500 -- [-1204.085] (-1207.146) (-1205.213) (-1204.133) * (-1203.889) (-1204.795) [-1203.409] (-1203.965) -- 0:00:52
      147000 -- (-1202.903) [-1201.992] (-1211.301) (-1204.782) * (-1204.399) (-1203.048) [-1203.275] (-1206.002) -- 0:00:52
      147500 -- (-1203.461) [-1203.258] (-1203.565) (-1203.345) * [-1202.028] (-1203.655) (-1208.138) (-1202.756) -- 0:00:52
      148000 -- (-1204.251) (-1205.054) [-1202.343] (-1205.106) * (-1206.048) [-1205.854] (-1205.929) (-1202.988) -- 0:00:51
      148500 -- (-1201.697) (-1203.238) (-1202.493) [-1202.268] * (-1204.206) [-1206.255] (-1206.103) (-1207.348) -- 0:00:57
      149000 -- (-1207.878) (-1202.448) (-1202.408) [-1203.640] * (-1203.778) (-1203.573) [-1207.540] (-1203.180) -- 0:00:57
      149500 -- [-1204.751] (-1204.794) (-1205.527) (-1202.468) * [-1203.054] (-1203.486) (-1204.844) (-1202.796) -- 0:00:56
      150000 -- (-1203.241) (-1205.861) (-1202.270) [-1202.478] * (-1205.742) [-1205.226] (-1202.856) (-1203.462) -- 0:00:56

      Average standard deviation of split frequencies: 0.021380

      150500 -- (-1205.761) (-1204.015) [-1203.297] (-1202.586) * (-1205.051) (-1205.001) [-1203.006] (-1205.733) -- 0:00:56
      151000 -- (-1202.493) (-1206.593) (-1203.947) [-1203.875] * (-1203.894) (-1206.696) (-1202.202) [-1205.386] -- 0:00:56
      151500 -- (-1202.083) (-1204.446) [-1203.565] (-1204.311) * [-1204.039] (-1203.376) (-1202.815) (-1203.621) -- 0:00:56
      152000 -- (-1202.307) (-1204.992) [-1204.301] (-1204.601) * [-1203.692] (-1210.800) (-1202.259) (-1203.722) -- 0:00:55
      152500 -- (-1203.917) (-1205.601) [-1203.243] (-1206.509) * (-1204.103) (-1205.423) [-1203.120] (-1203.064) -- 0:00:55
      153000 -- (-1204.145) [-1204.753] (-1205.474) (-1205.537) * (-1206.651) (-1205.612) [-1202.663] (-1203.720) -- 0:00:55
      153500 -- (-1202.200) [-1204.755] (-1202.693) (-1206.503) * (-1204.498) [-1202.780] (-1206.504) (-1203.135) -- 0:00:55
      154000 -- (-1202.724) (-1205.265) (-1205.721) [-1203.551] * (-1207.669) (-1202.495) [-1203.949] (-1203.257) -- 0:00:54
      154500 -- [-1203.136] (-1204.139) (-1202.092) (-1206.962) * (-1204.761) (-1204.296) [-1202.749] (-1202.437) -- 0:00:54
      155000 -- (-1202.429) [-1205.393] (-1203.158) (-1207.867) * [-1202.903] (-1204.955) (-1203.608) (-1204.908) -- 0:00:54

      Average standard deviation of split frequencies: 0.021153

      155500 -- (-1202.510) (-1204.953) [-1203.133] (-1205.006) * [-1203.757] (-1203.120) (-1202.307) (-1203.467) -- 0:00:54
      156000 -- (-1203.097) [-1204.253] (-1206.824) (-1206.707) * [-1201.768] (-1203.648) (-1208.587) (-1207.973) -- 0:00:54
      156500 -- (-1202.157) (-1204.290) [-1205.687] (-1204.983) * [-1202.663] (-1201.878) (-1205.112) (-1204.409) -- 0:00:53
      157000 -- (-1206.222) (-1203.011) (-1201.844) [-1204.486] * (-1203.442) [-1204.303] (-1208.318) (-1204.767) -- 0:00:53
      157500 -- (-1206.665) (-1202.928) [-1202.621] (-1204.501) * [-1205.520] (-1207.647) (-1204.928) (-1204.027) -- 0:00:53
      158000 -- [-1206.450] (-1204.367) (-1205.073) (-1203.454) * (-1204.024) (-1203.991) [-1204.791] (-1206.952) -- 0:00:53
      158500 -- (-1203.946) (-1207.319) [-1205.928] (-1206.141) * (-1205.095) [-1203.914] (-1204.020) (-1205.473) -- 0:00:53
      159000 -- (-1203.777) (-1207.748) [-1203.110] (-1205.666) * (-1203.580) (-1204.250) (-1204.011) [-1206.107] -- 0:00:52
      159500 -- (-1207.080) (-1203.850) [-1203.087] (-1204.499) * (-1203.486) [-1202.390] (-1204.959) (-1204.484) -- 0:00:52
      160000 -- (-1204.213) [-1204.005] (-1203.687) (-1203.804) * (-1203.293) [-1202.432] (-1203.053) (-1204.135) -- 0:00:52

      Average standard deviation of split frequencies: 0.019723

      160500 -- (-1203.885) (-1205.216) [-1202.963] (-1204.651) * [-1203.599] (-1204.535) (-1203.618) (-1204.678) -- 0:00:52
      161000 -- (-1202.431) [-1206.117] (-1204.916) (-1203.058) * (-1202.890) (-1205.301) [-1204.516] (-1204.020) -- 0:00:52
      161500 -- (-1205.695) (-1203.526) (-1205.089) [-1204.002] * (-1203.083) (-1204.395) (-1204.547) [-1203.443] -- 0:00:51
      162000 -- (-1203.208) (-1203.713) (-1202.138) [-1202.613] * [-1201.570] (-1205.736) (-1204.157) (-1203.506) -- 0:00:51
      162500 -- (-1202.213) (-1203.688) (-1203.028) [-1203.894] * [-1204.416] (-1205.153) (-1202.614) (-1206.829) -- 0:00:51
      163000 -- [-1203.330] (-1205.457) (-1203.819) (-1204.241) * (-1203.230) (-1206.091) (-1205.485) [-1205.088] -- 0:00:51
      163500 -- (-1208.797) (-1203.678) (-1202.881) [-1204.069] * [-1203.888] (-1203.564) (-1206.445) (-1205.382) -- 0:00:51
      164000 -- (-1204.791) (-1205.007) (-1209.096) [-1204.036] * (-1205.173) (-1204.074) (-1203.760) [-1204.540] -- 0:00:50
      164500 -- (-1204.772) [-1205.093] (-1204.604) (-1202.418) * (-1204.380) (-1204.901) [-1203.940] (-1203.483) -- 0:00:50
      165000 -- (-1205.009) (-1203.821) [-1203.086] (-1206.583) * (-1205.124) (-1205.599) (-1204.395) [-1204.042] -- 0:00:55

      Average standard deviation of split frequencies: 0.019430

      165500 -- [-1203.319] (-1203.464) (-1205.112) (-1208.462) * (-1206.481) [-1202.471] (-1205.621) (-1205.089) -- 0:00:55
      166000 -- (-1203.532) (-1204.206) [-1204.034] (-1203.762) * (-1209.627) (-1202.167) [-1205.230] (-1206.663) -- 0:00:55
      166500 -- (-1202.370) (-1202.456) (-1204.363) [-1204.243] * (-1205.830) (-1208.506) (-1202.108) [-1205.436] -- 0:00:55
      167000 -- [-1203.841] (-1202.365) (-1204.597) (-1203.597) * (-1206.940) (-1210.842) [-1201.977] (-1203.003) -- 0:00:54
      167500 -- (-1201.883) (-1204.186) (-1203.028) [-1202.626] * [-1203.258] (-1207.214) (-1202.394) (-1202.435) -- 0:00:54
      168000 -- [-1201.815] (-1204.512) (-1204.175) (-1202.038) * [-1204.228] (-1203.755) (-1205.442) (-1202.298) -- 0:00:54
      168500 -- (-1202.742) (-1206.423) [-1202.998] (-1204.474) * [-1204.011] (-1204.237) (-1204.200) (-1204.940) -- 0:00:54
      169000 -- (-1201.962) (-1203.537) [-1204.350] (-1204.574) * (-1204.353) [-1204.599] (-1202.689) (-1204.874) -- 0:00:54
      169500 -- (-1207.118) [-1204.731] (-1202.867) (-1204.062) * (-1205.585) (-1204.902) [-1202.463] (-1203.233) -- 0:00:53
      170000 -- [-1203.899] (-1203.068) (-1203.821) (-1206.320) * (-1206.385) (-1202.372) [-1202.422] (-1202.809) -- 0:00:53

      Average standard deviation of split frequencies: 0.018899

      170500 -- (-1203.611) [-1207.645] (-1204.143) (-1205.762) * (-1204.181) [-1202.054] (-1201.742) (-1202.523) -- 0:00:53
      171000 -- (-1204.301) (-1202.485) (-1210.964) [-1209.476] * (-1206.318) (-1203.323) (-1203.536) [-1204.176] -- 0:00:53
      171500 -- [-1207.332] (-1205.046) (-1207.850) (-1204.776) * (-1206.013) [-1203.245] (-1203.457) (-1204.934) -- 0:00:53
      172000 -- (-1206.461) (-1205.938) (-1206.086) [-1202.665] * (-1204.464) (-1202.968) [-1201.579] (-1205.100) -- 0:00:52
      172500 -- (-1207.023) (-1203.436) [-1204.906] (-1205.044) * [-1202.959] (-1209.392) (-1207.000) (-1203.328) -- 0:00:52
      173000 -- (-1202.495) (-1205.663) (-1206.583) [-1202.414] * [-1202.861] (-1209.313) (-1205.206) (-1203.969) -- 0:00:52
      173500 -- (-1202.962) [-1203.608] (-1202.812) (-1203.405) * (-1203.750) (-1205.999) (-1203.471) [-1203.446] -- 0:00:52
      174000 -- (-1201.908) [-1202.474] (-1206.823) (-1203.070) * (-1202.183) [-1202.622] (-1205.071) (-1205.832) -- 0:00:52
      174500 -- [-1203.804] (-1202.579) (-1203.263) (-1203.070) * (-1202.537) (-1202.870) (-1207.592) [-1204.334] -- 0:00:52
      175000 -- (-1202.238) [-1203.516] (-1202.536) (-1206.919) * (-1203.090) [-1204.693] (-1210.058) (-1206.202) -- 0:00:51

      Average standard deviation of split frequencies: 0.017198

      175500 -- (-1204.427) [-1203.216] (-1202.472) (-1206.267) * (-1203.846) (-1203.862) [-1208.008] (-1206.450) -- 0:00:51
      176000 -- [-1206.564] (-1202.777) (-1201.943) (-1205.585) * (-1203.541) (-1202.803) [-1204.841] (-1206.591) -- 0:00:51
      176500 -- (-1205.048) (-1204.044) [-1202.545] (-1204.466) * (-1203.669) [-1203.331] (-1205.168) (-1201.926) -- 0:00:51
      177000 -- (-1203.597) (-1205.120) [-1203.230] (-1202.426) * (-1203.358) [-1205.461] (-1204.687) (-1204.262) -- 0:00:51
      177500 -- (-1203.163) (-1202.626) (-1202.712) [-1201.865] * [-1203.876] (-1205.356) (-1203.342) (-1203.508) -- 0:00:50
      178000 -- (-1204.506) (-1202.571) (-1202.690) [-1202.260] * (-1204.149) [-1202.958] (-1203.018) (-1202.933) -- 0:00:50
      178500 -- [-1202.620] (-1202.718) (-1204.964) (-1203.271) * (-1204.899) (-1207.075) (-1205.915) [-1202.597] -- 0:00:50
      179000 -- (-1204.071) (-1202.793) [-1203.972] (-1204.822) * (-1205.562) [-1203.677] (-1205.566) (-1202.637) -- 0:00:50
      179500 -- (-1202.342) [-1206.863] (-1207.937) (-1204.374) * (-1205.577) [-1203.063] (-1205.469) (-1204.197) -- 0:00:50
      180000 -- [-1203.198] (-1202.834) (-1202.901) (-1204.594) * (-1202.651) (-1202.783) [-1206.326] (-1206.344) -- 0:00:50

      Average standard deviation of split frequencies: 0.018111

      180500 -- (-1209.526) (-1202.440) [-1202.916] (-1206.042) * (-1205.364) (-1204.799) (-1204.602) [-1202.500] -- 0:00:49
      181000 -- (-1204.213) (-1205.692) [-1202.295] (-1205.559) * (-1205.262) (-1202.855) (-1203.980) [-1205.308] -- 0:00:54
      181500 -- (-1203.866) (-1204.387) [-1203.302] (-1205.520) * (-1207.987) [-1203.777] (-1204.982) (-1209.420) -- 0:00:54
      182000 -- [-1202.683] (-1208.578) (-1203.012) (-1205.872) * (-1205.778) (-1204.150) (-1204.160) [-1203.114] -- 0:00:53
      182500 -- (-1202.767) (-1204.463) [-1203.014] (-1203.334) * (-1204.728) [-1204.725] (-1204.711) (-1202.740) -- 0:00:53
      183000 -- (-1205.851) [-1206.195] (-1204.727) (-1202.416) * (-1204.014) [-1204.687] (-1203.674) (-1202.223) -- 0:00:53
      183500 -- (-1207.143) (-1202.933) [-1209.115] (-1203.545) * (-1203.417) (-1203.693) (-1203.014) [-1205.555] -- 0:00:53
      184000 -- [-1202.757] (-1201.948) (-1210.485) (-1208.719) * (-1204.470) (-1205.098) (-1204.251) [-1205.261] -- 0:00:53
      184500 -- [-1202.934] (-1202.320) (-1207.483) (-1202.573) * (-1203.366) (-1206.984) [-1203.379] (-1202.984) -- 0:00:53
      185000 -- (-1210.292) (-1202.394) (-1207.192) [-1204.464] * (-1208.320) (-1202.584) (-1204.855) [-1203.121] -- 0:00:52

      Average standard deviation of split frequencies: 0.018337

      185500 -- (-1206.984) [-1201.909] (-1206.056) (-1203.304) * (-1206.650) (-1203.750) (-1203.215) [-1208.215] -- 0:00:52
      186000 -- (-1204.616) (-1202.772) (-1206.567) [-1204.799] * (-1202.532) [-1203.843] (-1203.615) (-1204.950) -- 0:00:52
      186500 -- (-1208.286) (-1204.548) (-1202.899) [-1203.372] * (-1203.046) [-1201.898] (-1203.615) (-1204.321) -- 0:00:52
      187000 -- (-1205.627) [-1204.547] (-1203.798) (-1202.229) * (-1203.147) [-1202.901] (-1202.963) (-1204.487) -- 0:00:52
      187500 -- (-1209.278) [-1203.930] (-1204.305) (-1203.225) * [-1202.444] (-1205.505) (-1204.980) (-1206.767) -- 0:00:52
      188000 -- (-1203.991) (-1202.744) (-1204.636) [-1203.269] * (-1203.507) (-1203.969) [-1202.728] (-1205.543) -- 0:00:51
      188500 -- (-1202.462) [-1207.177] (-1205.992) (-1203.786) * (-1205.195) [-1204.652] (-1207.361) (-1205.084) -- 0:00:51
      189000 -- (-1203.614) [-1203.316] (-1208.739) (-1205.020) * (-1204.102) [-1203.402] (-1205.917) (-1208.067) -- 0:00:51
      189500 -- [-1204.166] (-1203.747) (-1202.412) (-1203.090) * (-1204.013) (-1205.525) (-1203.399) [-1207.372] -- 0:00:51
      190000 -- (-1203.631) (-1203.523) (-1203.826) [-1202.726] * [-1204.511] (-1207.791) (-1204.369) (-1209.897) -- 0:00:51

      Average standard deviation of split frequencies: 0.018325

      190500 -- (-1203.791) [-1203.639] (-1202.238) (-1202.765) * (-1206.480) (-1207.493) [-1204.239] (-1203.610) -- 0:00:50
      191000 -- (-1202.062) (-1204.148) [-1202.780] (-1202.620) * (-1205.746) (-1204.123) (-1204.676) [-1203.148] -- 0:00:50
      191500 -- [-1211.257] (-1203.446) (-1202.652) (-1206.079) * (-1208.829) [-1202.670] (-1207.208) (-1203.055) -- 0:00:50
      192000 -- (-1207.739) (-1203.835) [-1202.746] (-1203.376) * (-1203.187) (-1202.666) (-1203.984) [-1208.485] -- 0:00:50
      192500 -- (-1203.187) (-1204.314) [-1202.042] (-1208.629) * (-1202.725) (-1202.396) [-1203.569] (-1205.962) -- 0:00:50
      193000 -- [-1203.003] (-1203.151) (-1205.786) (-1209.061) * [-1202.412] (-1202.987) (-1202.938) (-1215.576) -- 0:00:50
      193500 -- (-1203.496) [-1203.712] (-1207.384) (-1205.972) * (-1203.160) (-1204.532) (-1206.936) [-1203.041] -- 0:00:50
      194000 -- [-1204.173] (-1204.685) (-1204.997) (-1202.800) * (-1203.120) (-1204.607) (-1203.894) [-1203.707] -- 0:00:49
      194500 -- (-1202.785) (-1202.042) [-1203.712] (-1205.746) * (-1203.811) (-1203.158) (-1204.249) [-1203.325] -- 0:00:49
      195000 -- (-1203.234) (-1201.989) [-1202.530] (-1206.427) * (-1203.199) (-1203.356) [-1206.477] (-1205.031) -- 0:00:49

      Average standard deviation of split frequencies: 0.018189

      195500 -- (-1202.973) (-1205.465) (-1202.483) [-1203.899] * [-1203.932] (-1205.570) (-1204.905) (-1203.853) -- 0:00:49
      196000 -- (-1203.310) [-1201.995] (-1202.360) (-1206.706) * (-1202.666) [-1202.506] (-1212.999) (-1203.326) -- 0:00:49
      196500 -- (-1203.777) (-1203.418) (-1202.936) [-1204.990] * (-1202.391) (-1206.141) [-1206.320] (-1202.894) -- 0:00:49
      197000 -- (-1202.976) (-1202.122) [-1202.263] (-1204.316) * [-1202.398] (-1205.096) (-1205.271) (-1203.556) -- 0:00:48
      197500 -- (-1205.221) [-1201.841] (-1205.840) (-1206.345) * (-1202.326) [-1204.006] (-1202.475) (-1205.355) -- 0:00:52
      198000 -- (-1203.698) (-1202.693) (-1203.651) [-1202.995] * [-1203.311] (-1204.410) (-1202.531) (-1202.904) -- 0:00:52
      198500 -- (-1204.254) (-1203.116) (-1205.491) [-1203.074] * (-1211.848) (-1203.359) [-1203.327] (-1202.968) -- 0:00:52
      199000 -- [-1202.306] (-1204.914) (-1204.727) (-1203.049) * (-1203.882) [-1205.661] (-1203.897) (-1207.180) -- 0:00:52
      199500 -- (-1201.765) (-1204.088) [-1203.793] (-1202.097) * (-1204.114) (-1205.659) [-1203.326] (-1206.725) -- 0:00:52
      200000 -- (-1203.386) [-1203.725] (-1204.409) (-1203.824) * [-1204.329] (-1205.716) (-1203.021) (-1205.202) -- 0:00:51

      Average standard deviation of split frequencies: 0.017472

      200500 -- (-1207.453) (-1202.919) (-1205.650) [-1203.768] * (-1202.910) (-1202.752) [-1202.953] (-1204.668) -- 0:00:51
      201000 -- (-1211.355) [-1202.920] (-1207.553) (-1209.475) * [-1203.200] (-1202.026) (-1202.749) (-1203.047) -- 0:00:51
      201500 -- (-1210.017) [-1202.778] (-1207.645) (-1204.795) * (-1204.299) (-1204.167) [-1202.612] (-1203.125) -- 0:00:51
      202000 -- (-1207.118) (-1203.658) [-1203.749] (-1206.093) * (-1205.483) (-1202.526) [-1203.804] (-1205.378) -- 0:00:51
      202500 -- (-1204.368) (-1203.301) [-1203.707] (-1203.312) * (-1204.871) (-1204.035) (-1204.271) [-1206.043] -- 0:00:51
      203000 -- (-1208.243) [-1202.492] (-1202.685) (-1203.093) * [-1202.804] (-1204.978) (-1208.912) (-1203.834) -- 0:00:51
      203500 -- (-1205.412) (-1202.699) (-1202.468) [-1202.525] * (-1202.964) (-1206.673) (-1213.922) [-1203.981] -- 0:00:50
      204000 -- (-1204.541) [-1203.784] (-1205.422) (-1205.207) * (-1203.149) (-1204.768) [-1204.426] (-1205.854) -- 0:00:50
      204500 -- [-1204.580] (-1203.497) (-1204.854) (-1205.204) * [-1203.443] (-1206.219) (-1204.796) (-1203.393) -- 0:00:50
      205000 -- (-1202.481) (-1203.483) (-1203.619) [-1205.447] * (-1203.200) (-1202.143) (-1203.108) [-1203.420] -- 0:00:50

      Average standard deviation of split frequencies: 0.017671

      205500 -- (-1202.481) (-1205.301) [-1202.846] (-1205.829) * (-1201.568) (-1202.410) [-1204.976] (-1202.897) -- 0:00:50
      206000 -- (-1202.011) (-1205.491) (-1208.136) [-1202.715] * (-1203.417) (-1202.784) [-1203.589] (-1204.496) -- 0:00:50
      206500 -- (-1203.304) [-1207.023] (-1201.874) (-1203.792) * (-1205.342) (-1202.042) [-1202.286] (-1205.263) -- 0:00:49
      207000 -- (-1203.018) [-1206.610] (-1203.030) (-1208.073) * [-1202.676] (-1202.030) (-1212.919) (-1206.304) -- 0:00:49
      207500 -- [-1203.502] (-1205.931) (-1205.158) (-1203.220) * (-1202.644) [-1202.057] (-1204.875) (-1203.458) -- 0:00:49
      208000 -- (-1204.233) (-1204.905) (-1204.634) [-1202.317] * (-1202.519) [-1202.074] (-1205.903) (-1211.618) -- 0:00:49
      208500 -- (-1204.257) (-1203.796) (-1205.836) [-1204.763] * [-1203.952] (-1204.015) (-1206.826) (-1204.139) -- 0:00:49
      209000 -- (-1202.267) (-1203.705) (-1204.327) [-1205.637] * (-1207.234) (-1204.629) (-1204.647) [-1204.810] -- 0:00:49
      209500 -- [-1204.730] (-1202.101) (-1203.109) (-1205.897) * (-1205.882) [-1204.056] (-1205.263) (-1203.065) -- 0:00:49
      210000 -- (-1203.411) [-1201.747] (-1204.192) (-1206.340) * (-1202.564) [-1203.804] (-1204.852) (-1202.177) -- 0:00:48

      Average standard deviation of split frequencies: 0.016410

      210500 -- [-1204.559] (-1201.557) (-1202.656) (-1206.295) * (-1205.804) (-1207.314) [-1204.909] (-1204.114) -- 0:00:48
      211000 -- [-1205.268] (-1201.562) (-1202.361) (-1203.277) * (-1207.073) (-1203.435) (-1202.177) [-1203.716] -- 0:00:48
      211500 -- [-1205.584] (-1202.694) (-1203.525) (-1202.793) * (-1204.830) (-1203.195) [-1202.421] (-1204.358) -- 0:00:48
      212000 -- [-1203.987] (-1204.057) (-1206.252) (-1203.419) * (-1204.120) [-1204.182] (-1202.421) (-1204.154) -- 0:00:48
      212500 -- [-1204.484] (-1204.961) (-1202.210) (-1202.809) * [-1202.341] (-1203.410) (-1203.813) (-1204.153) -- 0:00:48
      213000 -- (-1204.351) (-1204.720) [-1201.806] (-1203.012) * (-1203.907) (-1203.829) [-1202.160] (-1204.594) -- 0:00:48
      213500 -- [-1203.163] (-1204.441) (-1205.793) (-1204.270) * (-1204.514) (-1202.157) [-1202.176] (-1202.491) -- 0:00:47
      214000 -- (-1206.772) (-1205.202) (-1205.586) [-1205.675] * (-1204.925) (-1203.755) (-1202.138) [-1202.345] -- 0:00:51
      214500 -- (-1204.041) [-1208.518] (-1202.096) (-1209.947) * (-1203.138) [-1206.727] (-1204.380) (-1205.161) -- 0:00:51
      215000 -- [-1202.971] (-1202.042) (-1204.455) (-1206.448) * (-1202.005) (-1204.486) [-1203.632] (-1211.002) -- 0:00:51

      Average standard deviation of split frequencies: 0.014792

      215500 -- (-1202.851) (-1203.643) [-1201.668] (-1202.336) * (-1202.612) [-1201.633] (-1203.369) (-1206.879) -- 0:00:50
      216000 -- (-1203.937) (-1201.634) (-1203.318) [-1205.377] * [-1203.357] (-1206.213) (-1204.306) (-1202.954) -- 0:00:50
      216500 -- (-1203.613) [-1205.137] (-1203.318) (-1205.302) * [-1203.238] (-1203.732) (-1203.152) (-1202.214) -- 0:00:50
      217000 -- (-1203.924) (-1206.062) (-1203.026) [-1203.571] * (-1204.201) (-1209.196) (-1203.632) [-1203.521] -- 0:00:50
      217500 -- [-1202.031] (-1203.116) (-1201.938) (-1205.441) * (-1205.023) (-1206.256) (-1201.815) [-1204.944] -- 0:00:50
      218000 -- [-1204.386] (-1201.993) (-1203.055) (-1204.341) * (-1203.614) [-1206.054] (-1202.147) (-1205.358) -- 0:00:50
      218500 -- (-1203.935) [-1206.869] (-1203.418) (-1204.248) * (-1205.835) (-1204.671) (-1205.172) [-1204.155] -- 0:00:50
      219000 -- (-1202.252) [-1202.672] (-1208.375) (-1204.831) * (-1204.108) (-1203.490) (-1202.026) [-1204.681] -- 0:00:49
      219500 -- (-1202.231) [-1202.711] (-1208.187) (-1202.723) * [-1203.830] (-1202.998) (-1204.979) (-1203.955) -- 0:00:49
      220000 -- (-1206.308) (-1202.227) (-1206.716) [-1201.739] * (-1202.427) [-1204.778] (-1208.232) (-1205.322) -- 0:00:49

      Average standard deviation of split frequencies: 0.012189

      220500 -- (-1208.403) (-1204.468) (-1205.252) [-1202.819] * (-1201.507) [-1203.331] (-1207.428) (-1205.542) -- 0:00:49
      221000 -- (-1209.053) (-1207.575) [-1207.710] (-1203.890) * (-1202.410) [-1202.707] (-1203.698) (-1205.224) -- 0:00:49
      221500 -- (-1208.845) [-1203.614] (-1204.429) (-1202.943) * (-1206.443) (-1201.833) (-1206.175) [-1201.730] -- 0:00:49
      222000 -- [-1205.424] (-1203.632) (-1203.566) (-1202.911) * (-1206.006) (-1201.614) (-1203.650) [-1204.166] -- 0:00:49
      222500 -- (-1202.021) (-1207.757) [-1203.637] (-1202.202) * (-1203.608) [-1205.864] (-1202.729) (-1206.140) -- 0:00:48
      223000 -- (-1202.092) (-1211.245) (-1202.170) [-1204.414] * (-1203.030) (-1206.854) [-1204.357] (-1210.851) -- 0:00:48
      223500 -- (-1205.629) (-1205.978) (-1206.679) [-1204.051] * [-1202.666] (-1208.247) (-1207.250) (-1210.322) -- 0:00:48
      224000 -- (-1205.066) (-1202.917) [-1205.974] (-1203.444) * (-1202.018) (-1211.458) [-1205.454] (-1202.759) -- 0:00:48
      224500 -- (-1203.685) (-1202.625) [-1201.802] (-1206.699) * [-1203.474] (-1204.542) (-1204.927) (-1203.563) -- 0:00:48
      225000 -- (-1202.181) (-1205.882) (-1202.242) [-1203.437] * (-1203.312) [-1204.091] (-1205.555) (-1203.119) -- 0:00:48

      Average standard deviation of split frequencies: 0.012052

      225500 -- [-1202.600] (-1206.587) (-1202.894) (-1205.512) * (-1204.145) [-1204.247] (-1203.313) (-1202.291) -- 0:00:48
      226000 -- (-1202.285) [-1206.401] (-1203.668) (-1202.994) * (-1207.135) [-1201.702] (-1202.740) (-1202.357) -- 0:00:47
      226500 -- [-1202.284] (-1207.747) (-1204.969) (-1202.994) * (-1206.624) (-1204.046) [-1208.339] (-1206.132) -- 0:00:47
      227000 -- (-1201.832) (-1202.184) [-1202.713] (-1202.293) * (-1204.248) (-1202.734) [-1204.500] (-1202.559) -- 0:00:47
      227500 -- (-1201.551) (-1201.690) (-1203.604) [-1202.225] * (-1204.538) [-1202.880] (-1202.509) (-1205.849) -- 0:00:47
      228000 -- (-1201.602) (-1201.754) (-1202.616) [-1202.330] * (-1204.310) (-1203.193) (-1203.731) [-1204.935] -- 0:00:47
      228500 -- [-1202.314] (-1201.832) (-1203.387) (-1204.026) * (-1204.265) (-1204.165) [-1202.493] (-1202.636) -- 0:00:47
      229000 -- [-1203.285] (-1203.064) (-1204.354) (-1203.509) * (-1203.573) (-1204.766) [-1201.982] (-1205.024) -- 0:00:47
      229500 -- (-1202.402) [-1205.405] (-1204.396) (-1204.234) * (-1204.251) [-1204.059] (-1203.237) (-1203.264) -- 0:00:47
      230000 -- (-1202.341) (-1204.141) (-1208.803) [-1203.155] * (-1202.650) (-1203.748) (-1203.206) [-1202.256] -- 0:00:46

      Average standard deviation of split frequencies: 0.012382

      230500 -- (-1202.432) (-1206.687) (-1207.086) [-1203.282] * (-1202.326) [-1204.678] (-1201.743) (-1202.397) -- 0:00:50
      231000 -- (-1202.550) [-1204.132] (-1210.442) (-1204.161) * [-1202.008] (-1203.026) (-1206.127) (-1201.935) -- 0:00:49
      231500 -- [-1204.801] (-1203.722) (-1202.150) (-1208.910) * (-1201.928) [-1206.485] (-1201.646) (-1202.420) -- 0:00:49
      232000 -- (-1203.293) (-1204.389) [-1201.830] (-1202.901) * (-1203.536) (-1206.228) [-1202.796] (-1202.176) -- 0:00:49
      232500 -- [-1202.641] (-1207.644) (-1201.836) (-1201.998) * [-1203.070] (-1205.956) (-1202.739) (-1201.576) -- 0:00:49
      233000 -- (-1202.990) [-1204.242] (-1204.209) (-1208.139) * [-1204.119] (-1204.309) (-1204.001) (-1206.450) -- 0:00:49
      233500 -- (-1202.746) (-1203.693) (-1206.936) [-1206.185] * (-1202.674) [-1204.279] (-1203.683) (-1204.597) -- 0:00:49
      234000 -- (-1203.174) (-1203.507) [-1204.363] (-1203.302) * (-1205.822) (-1202.287) (-1202.906) [-1202.959] -- 0:00:49
      234500 -- (-1204.273) (-1203.452) (-1205.395) [-1203.691] * (-1202.513) (-1205.054) [-1203.376] (-1203.398) -- 0:00:48
      235000 -- (-1205.029) (-1205.370) [-1203.454] (-1203.974) * (-1203.689) (-1202.974) (-1208.007) [-1202.254] -- 0:00:48

      Average standard deviation of split frequencies: 0.013042

      235500 -- (-1203.998) (-1202.416) [-1204.248] (-1205.488) * (-1204.973) [-1202.932] (-1203.119) (-1204.166) -- 0:00:48
      236000 -- [-1203.782] (-1202.653) (-1204.374) (-1204.966) * [-1203.054] (-1202.551) (-1203.298) (-1203.514) -- 0:00:48
      236500 -- [-1201.940] (-1205.877) (-1202.700) (-1207.055) * (-1202.734) (-1202.795) (-1203.508) [-1201.934] -- 0:00:48
      237000 -- (-1201.947) [-1203.016] (-1203.202) (-1203.951) * (-1204.718) [-1201.918] (-1202.090) (-1201.608) -- 0:00:48
      237500 -- (-1203.743) (-1205.163) [-1202.214] (-1203.336) * (-1202.234) (-1204.630) (-1202.237) [-1203.875] -- 0:00:48
      238000 -- [-1205.064] (-1204.047) (-1205.296) (-1202.899) * [-1201.784] (-1202.249) (-1203.985) (-1203.374) -- 0:00:48
      238500 -- [-1203.943] (-1202.892) (-1207.006) (-1202.680) * (-1202.120) (-1203.571) [-1204.768] (-1202.018) -- 0:00:47
      239000 -- (-1202.977) (-1206.450) (-1204.023) [-1205.077] * (-1203.270) (-1206.120) (-1203.488) [-1202.455] -- 0:00:47
      239500 -- [-1202.643] (-1204.049) (-1203.410) (-1203.591) * (-1203.981) (-1203.997) (-1201.464) [-1206.390] -- 0:00:47
      240000 -- (-1202.619) (-1203.228) (-1203.574) [-1203.356] * (-1204.342) (-1202.849) [-1204.141] (-1208.463) -- 0:00:47

      Average standard deviation of split frequencies: 0.011508

      240500 -- (-1203.786) [-1206.974] (-1203.005) (-1210.397) * (-1204.368) [-1204.566] (-1202.444) (-1207.676) -- 0:00:47
      241000 -- [-1204.092] (-1204.016) (-1202.122) (-1202.236) * (-1207.058) (-1206.508) [-1203.252] (-1205.443) -- 0:00:47
      241500 -- (-1202.306) (-1205.178) (-1207.653) [-1202.400] * (-1206.231) (-1211.179) [-1204.118] (-1205.444) -- 0:00:47
      242000 -- (-1203.204) [-1207.477] (-1204.969) (-1202.307) * [-1201.936] (-1202.970) (-1204.555) (-1205.373) -- 0:00:46
      242500 -- (-1204.656) (-1206.178) (-1206.919) [-1202.195] * [-1201.936] (-1202.492) (-1203.569) (-1205.180) -- 0:00:46
      243000 -- (-1208.792) [-1205.017] (-1206.121) (-1201.894) * (-1205.263) (-1202.749) (-1202.919) [-1204.267] -- 0:00:46
      243500 -- [-1204.270] (-1206.813) (-1204.878) (-1203.417) * (-1205.758) [-1202.751] (-1201.922) (-1203.780) -- 0:00:46
      244000 -- (-1202.065) [-1205.502] (-1203.858) (-1205.078) * (-1204.625) (-1202.601) (-1210.090) [-1202.984] -- 0:00:46
      244500 -- (-1202.410) (-1203.201) (-1203.674) [-1209.778] * (-1203.630) (-1203.250) (-1202.822) [-1203.144] -- 0:00:46
      245000 -- (-1203.632) [-1202.829] (-1203.163) (-1205.913) * (-1205.132) [-1202.402] (-1206.123) (-1205.612) -- 0:00:46

      Average standard deviation of split frequencies: 0.011610

      245500 -- (-1202.501) (-1202.383) (-1201.883) [-1201.501] * [-1202.466] (-1202.834) (-1204.872) (-1204.791) -- 0:00:46
      246000 -- (-1201.681) (-1202.407) [-1202.856] (-1204.143) * (-1202.980) (-1202.721) (-1202.781) [-1202.264] -- 0:00:49
      246500 -- (-1201.679) (-1202.720) [-1202.542] (-1204.971) * (-1203.631) [-1203.646] (-1208.115) (-1202.350) -- 0:00:48
      247000 -- [-1201.803] (-1204.012) (-1203.517) (-1205.275) * (-1204.671) [-1202.309] (-1207.449) (-1203.599) -- 0:00:48
      247500 -- (-1204.612) [-1203.738] (-1202.848) (-1203.750) * (-1204.476) (-1208.011) (-1202.515) [-1202.985] -- 0:00:48
      248000 -- (-1204.387) (-1205.873) (-1203.785) [-1206.813] * (-1202.413) [-1203.376] (-1204.076) (-1202.170) -- 0:00:48
      248500 -- [-1203.191] (-1206.587) (-1203.793) (-1205.601) * [-1202.001] (-1204.485) (-1203.479) (-1204.099) -- 0:00:48
      249000 -- (-1201.849) (-1202.291) [-1203.131] (-1204.592) * (-1202.384) (-1203.323) (-1202.778) [-1204.568] -- 0:00:48
      249500 -- [-1204.207] (-1202.476) (-1204.937) (-1206.882) * [-1202.797] (-1203.387) (-1202.191) (-1205.913) -- 0:00:48
      250000 -- (-1203.714) (-1207.638) (-1206.030) [-1205.374] * (-1204.091) [-1204.673] (-1203.051) (-1203.777) -- 0:00:48

      Average standard deviation of split frequencies: 0.012341

      250500 -- (-1208.162) (-1204.575) (-1205.803) [-1204.150] * (-1203.526) (-1203.779) (-1202.959) [-1206.138] -- 0:00:47
      251000 -- (-1206.558) (-1202.793) (-1208.258) [-1205.772] * [-1207.917] (-1204.894) (-1202.362) (-1205.518) -- 0:00:47
      251500 -- (-1202.802) (-1203.322) (-1203.275) [-1205.656] * (-1202.900) (-1204.376) [-1203.349] (-1203.167) -- 0:00:47
      252000 -- (-1206.740) [-1202.882] (-1207.904) (-1202.491) * (-1203.330) (-1203.797) (-1202.126) [-1203.144] -- 0:00:47
      252500 -- (-1206.715) [-1202.213] (-1205.357) (-1202.046) * (-1202.826) (-1202.294) [-1202.124] (-1204.128) -- 0:00:47
      253000 -- [-1205.196] (-1202.741) (-1204.124) (-1203.363) * (-1203.393) [-1206.748] (-1202.767) (-1203.926) -- 0:00:47
      253500 -- (-1203.451) (-1202.786) (-1206.776) [-1204.643] * (-1206.191) [-1203.217] (-1205.993) (-1204.350) -- 0:00:47
      254000 -- [-1203.544] (-1202.957) (-1205.220) (-1205.184) * (-1207.002) (-1202.936) [-1205.872] (-1204.012) -- 0:00:46
      254500 -- (-1203.959) [-1204.200] (-1204.391) (-1202.644) * (-1206.200) [-1201.800] (-1204.185) (-1203.926) -- 0:00:46
      255000 -- (-1202.932) (-1206.278) [-1204.232] (-1203.128) * (-1205.980) (-1202.349) (-1203.521) [-1202.714] -- 0:00:46

      Average standard deviation of split frequencies: 0.012084

      255500 -- [-1204.370] (-1203.623) (-1209.556) (-1205.385) * [-1206.046] (-1203.356) (-1202.844) (-1202.868) -- 0:00:46
      256000 -- (-1202.086) (-1204.828) [-1205.606] (-1207.476) * (-1207.920) (-1203.250) (-1203.826) [-1203.897] -- 0:00:46
      256500 -- (-1201.712) (-1203.609) [-1202.151] (-1205.975) * (-1205.087) (-1204.055) [-1203.947] (-1202.957) -- 0:00:46
      257000 -- (-1204.947) (-1204.204) (-1205.341) [-1206.992] * (-1205.740) (-1204.324) [-1203.970] (-1203.297) -- 0:00:46
      257500 -- [-1203.786] (-1204.697) (-1207.046) (-1203.112) * (-1207.025) (-1203.579) [-1203.785] (-1205.955) -- 0:00:46
      258000 -- (-1202.182) (-1203.428) [-1203.758] (-1204.000) * [-1203.860] (-1207.900) (-1203.144) (-1207.708) -- 0:00:46
      258500 -- (-1203.943) [-1203.654] (-1204.685) (-1203.083) * (-1204.309) [-1206.031] (-1204.417) (-1204.409) -- 0:00:45
      259000 -- [-1203.410] (-1204.557) (-1205.432) (-1203.180) * [-1202.719] (-1203.080) (-1205.305) (-1203.759) -- 0:00:45
      259500 -- (-1204.891) (-1208.863) [-1208.585] (-1203.544) * (-1203.454) [-1203.355] (-1205.848) (-1203.397) -- 0:00:45
      260000 -- (-1209.502) (-1208.053) (-1207.873) [-1201.878] * (-1204.665) (-1202.568) (-1202.854) [-1202.045] -- 0:00:45

      Average standard deviation of split frequencies: 0.012978

      260500 -- (-1203.213) (-1204.563) [-1204.010] (-1202.145) * (-1205.107) [-1206.992] (-1203.347) (-1203.034) -- 0:00:45
      261000 -- (-1203.244) (-1203.478) (-1203.749) [-1204.995] * (-1205.506) (-1203.000) [-1202.556] (-1204.411) -- 0:00:45
      261500 -- (-1202.844) (-1203.869) (-1204.529) [-1203.250] * (-1206.461) [-1203.181] (-1204.137) (-1205.934) -- 0:00:48
      262000 -- (-1202.246) (-1207.371) [-1208.573] (-1203.846) * (-1203.268) [-1203.496] (-1204.637) (-1205.227) -- 0:00:47
      262500 -- (-1202.104) [-1204.227] (-1205.269) (-1205.695) * [-1204.556] (-1202.800) (-1204.083) (-1202.712) -- 0:00:47
      263000 -- [-1204.280] (-1205.609) (-1206.639) (-1203.459) * (-1207.100) [-1204.970] (-1203.034) (-1204.200) -- 0:00:47
      263500 -- [-1203.496] (-1206.477) (-1203.936) (-1203.463) * (-1205.567) (-1202.690) (-1204.192) [-1202.772] -- 0:00:47
      264000 -- (-1203.558) (-1208.924) (-1202.764) [-1202.826] * (-1204.622) [-1203.730] (-1206.450) (-1203.250) -- 0:00:47
      264500 -- [-1203.576] (-1206.996) (-1206.294) (-1204.212) * [-1201.728] (-1205.918) (-1204.157) (-1205.834) -- 0:00:47
      265000 -- (-1205.637) (-1202.912) [-1205.828] (-1204.325) * [-1204.673] (-1202.584) (-1204.259) (-1205.312) -- 0:00:47

      Average standard deviation of split frequencies: 0.013239

      265500 -- (-1209.286) (-1202.890) (-1202.673) [-1202.116] * (-1206.919) [-1202.075] (-1205.162) (-1206.093) -- 0:00:47
      266000 -- (-1205.242) [-1202.684] (-1202.700) (-1202.046) * (-1203.139) (-1202.222) [-1206.933] (-1202.414) -- 0:00:46
      266500 -- (-1205.167) (-1203.938) [-1205.902] (-1204.966) * (-1202.593) (-1202.619) [-1202.924] (-1203.745) -- 0:00:46
      267000 -- (-1203.065) [-1203.843] (-1206.525) (-1204.447) * [-1202.332] (-1204.002) (-1202.506) (-1204.954) -- 0:00:46
      267500 -- (-1202.594) [-1204.206] (-1208.529) (-1205.465) * [-1204.572] (-1202.680) (-1201.894) (-1206.578) -- 0:00:46
      268000 -- (-1202.889) (-1203.533) (-1205.419) [-1207.266] * (-1201.836) (-1203.186) (-1206.702) [-1202.035] -- 0:00:46
      268500 -- (-1202.477) [-1203.352] (-1202.982) (-1203.067) * [-1202.213] (-1202.514) (-1202.791) (-1203.484) -- 0:00:46
      269000 -- [-1203.625] (-1203.658) (-1204.266) (-1202.289) * (-1202.412) (-1205.123) [-1202.919] (-1202.111) -- 0:00:46
      269500 -- (-1204.329) (-1204.765) (-1205.046) [-1203.045] * (-1206.043) (-1202.338) (-1202.919) [-1202.796] -- 0:00:46
      270000 -- (-1202.393) (-1206.223) (-1205.219) [-1204.212] * [-1202.401] (-1203.697) (-1202.740) (-1203.486) -- 0:00:45

      Average standard deviation of split frequencies: 0.013318

      270500 -- (-1202.577) (-1204.531) (-1203.054) [-1201.856] * (-1203.713) (-1205.585) (-1203.278) [-1203.438] -- 0:00:45
      271000 -- (-1204.197) [-1206.442] (-1203.715) (-1202.524) * [-1204.554] (-1206.733) (-1205.414) (-1204.692) -- 0:00:45
      271500 -- [-1203.789] (-1203.622) (-1205.434) (-1204.460) * [-1203.314] (-1211.444) (-1203.557) (-1204.740) -- 0:00:45
      272000 -- [-1203.173] (-1202.775) (-1207.852) (-1204.341) * [-1203.667] (-1210.797) (-1203.187) (-1203.902) -- 0:00:45
      272500 -- (-1201.879) (-1204.702) [-1203.332] (-1203.067) * (-1203.095) (-1203.796) (-1204.972) [-1203.866] -- 0:00:45
      273000 -- (-1208.578) (-1203.683) [-1202.734] (-1203.482) * (-1204.033) (-1204.445) (-1207.481) [-1205.224] -- 0:00:45
      273500 -- (-1203.493) (-1201.924) [-1204.038] (-1204.572) * (-1202.307) (-1205.844) [-1203.723] (-1203.861) -- 0:00:45
      274000 -- (-1204.031) (-1202.285) (-1203.504) [-1204.656] * [-1202.748] (-1207.156) (-1204.438) (-1203.630) -- 0:00:45
      274500 -- [-1204.058] (-1202.726) (-1204.972) (-1208.630) * [-1204.601] (-1207.430) (-1205.918) (-1204.501) -- 0:00:44
      275000 -- [-1204.273] (-1203.970) (-1205.191) (-1205.194) * [-1203.740] (-1202.505) (-1202.560) (-1204.469) -- 0:00:44

      Average standard deviation of split frequencies: 0.013463

      275500 -- (-1203.645) (-1204.074) (-1204.088) [-1205.110] * [-1202.643] (-1206.779) (-1202.251) (-1203.593) -- 0:00:44
      276000 -- [-1204.669] (-1202.603) (-1204.580) (-1204.828) * (-1204.638) (-1205.402) (-1202.229) [-1204.405] -- 0:00:44
      276500 -- (-1207.294) [-1205.697] (-1206.418) (-1204.871) * (-1203.100) [-1204.227] (-1202.246) (-1205.276) -- 0:00:44
      277000 -- (-1207.272) (-1202.009) (-1206.984) [-1203.056] * [-1203.922] (-1201.684) (-1203.158) (-1206.330) -- 0:00:44
      277500 -- (-1207.220) (-1205.674) (-1202.115) [-1203.414] * (-1203.961) [-1202.312] (-1202.496) (-1206.854) -- 0:00:44
      278000 -- [-1205.922] (-1210.569) (-1204.263) (-1202.590) * (-1205.171) (-1203.692) [-1206.498] (-1203.989) -- 0:00:46
      278500 -- (-1204.251) (-1203.946) [-1203.678] (-1202.705) * (-1205.367) (-1203.978) [-1203.567] (-1203.046) -- 0:00:46
      279000 -- (-1201.636) [-1203.285] (-1202.933) (-1204.437) * (-1203.025) (-1203.495) (-1205.077) [-1205.667] -- 0:00:46
      279500 -- [-1202.210] (-1211.174) (-1203.601) (-1206.316) * [-1202.597] (-1204.813) (-1204.820) (-1205.531) -- 0:00:46
      280000 -- (-1206.895) (-1204.611) [-1203.382] (-1204.481) * (-1202.567) (-1203.469) [-1204.766] (-1204.114) -- 0:00:46

      Average standard deviation of split frequencies: 0.014030

      280500 -- (-1203.206) [-1204.236] (-1205.454) (-1202.824) * [-1203.831] (-1202.419) (-1203.584) (-1207.325) -- 0:00:46
      281000 -- (-1202.844) (-1204.498) (-1208.286) [-1204.918] * (-1204.351) (-1202.460) [-1203.843] (-1203.242) -- 0:00:46
      281500 -- (-1206.360) (-1203.105) (-1208.724) [-1203.086] * [-1202.961] (-1202.503) (-1203.953) (-1203.408) -- 0:00:45
      282000 -- (-1205.933) (-1206.942) (-1206.574) [-1204.263] * (-1207.353) [-1202.933] (-1205.853) (-1205.204) -- 0:00:45
      282500 -- (-1204.290) (-1203.604) (-1208.074) [-1204.195] * (-1203.261) (-1203.832) [-1203.964] (-1206.573) -- 0:00:45
      283000 -- (-1204.876) [-1203.603] (-1206.183) (-1205.267) * [-1204.187] (-1203.833) (-1204.012) (-1204.597) -- 0:00:45
      283500 -- (-1205.480) (-1202.180) (-1203.976) [-1206.442] * (-1204.944) (-1211.316) [-1203.890] (-1205.986) -- 0:00:45
      284000 -- (-1203.871) (-1205.297) (-1204.063) [-1204.169] * [-1203.910] (-1202.475) (-1204.337) (-1208.593) -- 0:00:45
      284500 -- (-1203.760) (-1202.411) (-1204.575) [-1205.889] * (-1204.013) (-1206.168) (-1203.402) [-1203.002] -- 0:00:45
      285000 -- (-1202.270) (-1204.415) (-1203.363) [-1203.058] * (-1203.886) (-1207.570) (-1203.406) [-1204.632] -- 0:00:45

      Average standard deviation of split frequencies: 0.013186

      285500 -- (-1202.379) [-1203.017] (-1203.931) (-1204.696) * (-1203.951) (-1202.950) [-1205.201] (-1204.578) -- 0:00:45
      286000 -- (-1202.367) [-1201.983] (-1202.211) (-1202.138) * (-1204.492) (-1204.440) [-1204.918] (-1206.234) -- 0:00:44
      286500 -- (-1203.326) (-1202.814) (-1204.869) [-1202.287] * (-1203.791) [-1205.022] (-1203.990) (-1206.660) -- 0:00:44
      287000 -- (-1202.618) [-1202.774] (-1205.161) (-1202.594) * (-1202.537) (-1205.154) (-1206.364) [-1203.457] -- 0:00:44
      287500 -- (-1207.623) [-1203.157] (-1207.761) (-1203.482) * (-1205.461) (-1206.682) (-1205.090) [-1201.865] -- 0:00:44
      288000 -- (-1205.842) (-1202.888) (-1205.664) [-1203.774] * (-1204.991) (-1206.060) (-1206.666) [-1201.619] -- 0:00:44
      288500 -- (-1208.140) [-1207.342] (-1204.290) (-1204.024) * (-1205.008) (-1205.759) [-1207.076] (-1201.833) -- 0:00:44
      289000 -- [-1203.942] (-1203.754) (-1205.407) (-1204.146) * [-1204.928] (-1206.176) (-1208.297) (-1202.220) -- 0:00:44
      289500 -- (-1204.549) [-1202.413] (-1206.193) (-1203.262) * (-1209.230) [-1204.293] (-1205.218) (-1202.653) -- 0:00:44
      290000 -- (-1205.971) (-1202.259) (-1202.601) [-1206.894] * [-1202.944] (-1203.424) (-1204.662) (-1201.856) -- 0:00:44

      Average standard deviation of split frequencies: 0.012670

      290500 -- [-1207.908] (-1205.419) (-1204.637) (-1203.479) * (-1202.944) (-1202.597) (-1202.230) [-1203.189] -- 0:00:43
      291000 -- (-1201.883) (-1204.842) [-1206.839] (-1202.551) * [-1202.040] (-1203.330) (-1202.812) (-1202.006) -- 0:00:43
      291500 -- (-1207.888) (-1207.650) [-1202.662] (-1202.335) * (-1204.020) (-1203.010) (-1203.847) [-1203.430] -- 0:00:43
      292000 -- (-1205.733) (-1205.818) (-1202.627) [-1203.997] * [-1209.579] (-1202.612) (-1206.223) (-1204.045) -- 0:00:43
      292500 -- [-1205.123] (-1203.705) (-1204.375) (-1202.236) * (-1202.653) (-1204.854) (-1204.406) [-1203.913] -- 0:00:43
      293000 -- (-1204.443) [-1202.044] (-1203.951) (-1206.525) * [-1202.832] (-1203.372) (-1204.501) (-1203.218) -- 0:00:43
      293500 -- (-1206.814) [-1202.189] (-1204.235) (-1202.559) * (-1205.681) (-1203.508) (-1205.898) [-1205.290] -- 0:00:43
      294000 -- (-1209.883) [-1202.538] (-1203.838) (-1202.599) * [-1205.386] (-1202.498) (-1204.153) (-1203.420) -- 0:00:45
      294500 -- (-1204.403) [-1203.882] (-1204.483) (-1203.943) * (-1203.412) (-1202.247) (-1203.257) [-1203.362] -- 0:00:45
      295000 -- (-1203.569) (-1206.255) [-1202.453] (-1205.132) * [-1202.799] (-1202.944) (-1204.247) (-1202.188) -- 0:00:45

      Average standard deviation of split frequencies: 0.013022

      295500 -- (-1206.558) (-1203.509) [-1202.629] (-1204.185) * (-1203.069) (-1203.375) (-1206.675) [-1203.430] -- 0:00:45
      296000 -- (-1205.991) (-1205.559) (-1202.387) [-1202.808] * [-1205.379] (-1204.862) (-1203.851) (-1202.660) -- 0:00:45
      296500 -- (-1203.437) (-1204.073) [-1204.815] (-1206.330) * (-1202.833) (-1203.120) [-1204.752] (-1201.867) -- 0:00:45
      297000 -- (-1202.540) (-1203.582) [-1203.415] (-1205.236) * (-1202.750) [-1202.571] (-1202.318) (-1202.217) -- 0:00:44
      297500 -- (-1208.123) (-1204.339) [-1203.194] (-1209.150) * (-1204.025) (-1203.734) [-1202.448] (-1203.967) -- 0:00:44
      298000 -- (-1203.952) (-1205.765) [-1203.156] (-1208.851) * (-1203.555) [-1204.097] (-1204.984) (-1202.323) -- 0:00:44
      298500 -- [-1204.635] (-1202.864) (-1203.209) (-1204.802) * (-1203.236) (-1205.463) (-1205.267) [-1201.996] -- 0:00:44
      299000 -- [-1207.842] (-1202.630) (-1203.665) (-1205.556) * (-1203.145) (-1203.542) (-1206.283) [-1201.978] -- 0:00:44
      299500 -- (-1202.648) (-1204.103) [-1202.685] (-1205.100) * (-1202.839) (-1205.130) (-1205.236) [-1202.413] -- 0:00:44
      300000 -- (-1202.570) (-1204.431) (-1206.194) [-1203.007] * (-1203.430) [-1205.066] (-1204.275) (-1203.369) -- 0:00:44

      Average standard deviation of split frequencies: 0.013557

      300500 -- (-1203.774) (-1204.766) [-1205.855] (-1204.930) * (-1202.349) (-1205.033) (-1205.015) [-1203.288] -- 0:00:44
      301000 -- (-1204.541) (-1205.877) [-1205.147] (-1203.768) * [-1202.545] (-1205.758) (-1205.342) (-1207.499) -- 0:00:44
      301500 -- [-1204.137] (-1205.048) (-1203.468) (-1203.809) * (-1203.960) [-1204.044] (-1206.406) (-1206.319) -- 0:00:44
      302000 -- (-1205.285) [-1204.404] (-1205.377) (-1206.837) * (-1205.053) (-1202.049) [-1203.588] (-1206.229) -- 0:00:43
      302500 -- (-1204.337) (-1204.470) (-1207.143) [-1204.454] * (-1204.691) (-1204.713) (-1206.551) [-1202.299] -- 0:00:43
      303000 -- (-1207.613) (-1205.936) [-1206.778] (-1204.496) * (-1204.151) (-1203.625) [-1202.596] (-1203.359) -- 0:00:43
      303500 -- (-1203.406) (-1202.585) [-1204.897] (-1204.995) * (-1203.957) [-1203.730] (-1202.250) (-1203.792) -- 0:00:43
      304000 -- (-1203.098) (-1206.808) (-1203.947) [-1202.605] * (-1204.371) [-1202.578] (-1202.407) (-1204.820) -- 0:00:43
      304500 -- (-1203.188) [-1203.428] (-1205.896) (-1202.375) * (-1205.454) [-1203.163] (-1205.391) (-1203.564) -- 0:00:43
      305000 -- (-1205.280) [-1201.786] (-1203.341) (-1203.603) * (-1203.653) (-1206.827) (-1203.574) [-1207.714] -- 0:00:43

      Average standard deviation of split frequencies: 0.013049

      305500 -- [-1204.421] (-1201.943) (-1204.381) (-1204.036) * [-1203.734] (-1203.154) (-1203.872) (-1204.664) -- 0:00:43
      306000 -- [-1202.757] (-1202.129) (-1206.009) (-1209.148) * [-1207.916] (-1206.561) (-1203.108) (-1204.268) -- 0:00:43
      306500 -- (-1202.421) [-1204.384] (-1205.340) (-1203.028) * (-1204.518) [-1204.462] (-1205.064) (-1202.721) -- 0:00:42
      307000 -- (-1203.111) (-1203.259) (-1205.442) [-1203.032] * (-1205.220) [-1204.336] (-1204.346) (-1202.827) -- 0:00:42
      307500 -- (-1205.345) (-1206.040) (-1206.041) [-1203.351] * [-1205.819] (-1203.724) (-1202.809) (-1202.745) -- 0:00:42
      308000 -- (-1204.437) (-1201.700) (-1202.182) [-1204.490] * (-1204.183) (-1203.407) [-1203.586] (-1202.654) -- 0:00:42
      308500 -- (-1203.550) (-1202.257) [-1203.421] (-1203.736) * (-1207.541) (-1203.668) [-1203.068] (-1205.823) -- 0:00:42
      309000 -- (-1205.065) [-1202.270] (-1205.428) (-1204.231) * (-1208.985) (-1202.227) [-1202.775] (-1202.808) -- 0:00:42
      309500 -- (-1206.634) [-1203.544] (-1207.218) (-1203.873) * (-1206.128) (-1203.827) [-1204.049] (-1209.930) -- 0:00:42
      310000 -- (-1203.586) [-1202.534] (-1203.678) (-1202.761) * [-1202.690] (-1207.368) (-1203.307) (-1205.007) -- 0:00:42

      Average standard deviation of split frequencies: 0.013478

      310500 -- (-1208.499) [-1202.044] (-1207.901) (-1207.053) * (-1204.146) (-1205.821) (-1202.729) [-1204.375] -- 0:00:44
      311000 -- (-1207.106) [-1204.144] (-1203.285) (-1206.647) * (-1203.775) (-1205.750) [-1204.539] (-1204.430) -- 0:00:44
      311500 -- [-1201.837] (-1207.403) (-1202.607) (-1204.600) * (-1205.760) (-1204.306) [-1205.408] (-1203.468) -- 0:00:44
      312000 -- (-1202.921) (-1205.327) [-1203.348] (-1205.175) * (-1204.652) (-1206.295) [-1204.875] (-1203.672) -- 0:00:44
      312500 -- (-1203.264) (-1205.284) (-1207.438) [-1203.236] * (-1203.414) (-1203.675) (-1203.740) [-1205.036] -- 0:00:44
      313000 -- (-1204.052) (-1203.712) (-1210.443) [-1203.056] * [-1203.543] (-1202.904) (-1204.099) (-1203.673) -- 0:00:43
      313500 -- (-1204.829) (-1205.024) (-1203.047) [-1205.854] * [-1203.285] (-1202.903) (-1205.952) (-1204.801) -- 0:00:43
      314000 -- (-1207.991) (-1202.230) (-1203.499) [-1202.310] * (-1205.232) (-1204.738) (-1204.249) [-1204.078] -- 0:00:43
      314500 -- (-1205.548) [-1202.445] (-1202.051) (-1202.972) * (-1203.939) (-1203.290) (-1205.336) [-1206.812] -- 0:00:43
      315000 -- (-1205.467) [-1202.926] (-1202.102) (-1203.586) * (-1206.121) (-1206.177) [-1205.532] (-1203.242) -- 0:00:43

      Average standard deviation of split frequencies: 0.012198

      315500 -- [-1204.363] (-1204.685) (-1202.208) (-1204.059) * [-1203.594] (-1206.526) (-1203.414) (-1203.405) -- 0:00:43
      316000 -- [-1204.122] (-1203.698) (-1202.908) (-1207.762) * (-1202.629) (-1204.804) [-1203.388] (-1202.815) -- 0:00:43
      316500 -- (-1204.030) [-1205.415] (-1202.122) (-1207.696) * (-1202.205) [-1202.801] (-1203.389) (-1204.680) -- 0:00:43
      317000 -- [-1206.059] (-1204.460) (-1203.695) (-1204.598) * (-1202.322) (-1204.016) (-1206.717) [-1204.440] -- 0:00:43
      317500 -- [-1202.963] (-1203.542) (-1202.290) (-1203.911) * (-1206.165) (-1203.623) [-1206.995] (-1203.691) -- 0:00:42
      318000 -- (-1205.967) (-1202.608) [-1202.397] (-1206.502) * (-1206.771) [-1203.631] (-1201.706) (-1203.324) -- 0:00:42
      318500 -- (-1205.157) (-1206.035) [-1203.113] (-1205.204) * (-1208.035) [-1202.817] (-1201.603) (-1202.178) -- 0:00:42
      319000 -- (-1206.210) [-1202.373] (-1204.994) (-1205.829) * [-1204.437] (-1204.230) (-1201.954) (-1202.931) -- 0:00:42
      319500 -- (-1205.230) (-1202.333) [-1203.585] (-1205.412) * (-1208.658) (-1203.392) (-1203.015) [-1202.462] -- 0:00:42
      320000 -- [-1203.382] (-1201.806) (-1209.491) (-1204.164) * (-1208.886) [-1205.627] (-1203.237) (-1203.060) -- 0:00:42

      Average standard deviation of split frequencies: 0.011944

      320500 -- (-1205.343) (-1207.392) (-1205.033) [-1201.611] * (-1203.638) (-1204.240) [-1203.931] (-1207.052) -- 0:00:42
      321000 -- (-1203.805) (-1205.205) (-1206.692) [-1203.094] * [-1203.461] (-1203.594) (-1210.338) (-1206.892) -- 0:00:42
      321500 -- [-1202.219] (-1203.180) (-1203.692) (-1203.093) * (-1203.138) [-1202.670] (-1211.604) (-1210.136) -- 0:00:42
      322000 -- (-1201.934) (-1203.221) [-1202.486] (-1203.009) * [-1201.817] (-1202.103) (-1211.085) (-1202.319) -- 0:00:42
      322500 -- (-1204.467) (-1205.851) [-1202.970] (-1203.439) * (-1206.839) (-1202.473) [-1206.283] (-1202.826) -- 0:00:42
      323000 -- (-1203.526) (-1203.782) [-1201.854] (-1204.224) * [-1206.556] (-1206.900) (-1205.487) (-1201.795) -- 0:00:41
      323500 -- (-1203.416) (-1203.807) [-1201.717] (-1207.918) * (-1202.557) [-1206.580] (-1205.239) (-1205.288) -- 0:00:41
      324000 -- (-1203.132) (-1203.354) (-1204.202) [-1204.717] * (-1202.504) (-1207.093) (-1202.930) [-1206.184] -- 0:00:41
      324500 -- (-1204.521) (-1202.669) [-1202.891] (-1201.819) * (-1206.272) (-1202.227) (-1203.802) [-1203.223] -- 0:00:41
      325000 -- (-1203.413) (-1201.939) [-1203.810] (-1201.815) * [-1205.274] (-1203.505) (-1204.341) (-1203.217) -- 0:00:41

      Average standard deviation of split frequencies: 0.011568

      325500 -- (-1203.874) [-1201.967] (-1205.520) (-1202.455) * (-1202.631) (-1206.920) [-1206.513] (-1203.679) -- 0:00:41
      326000 -- (-1205.240) (-1206.904) (-1202.677) [-1203.185] * [-1202.553] (-1206.272) (-1207.339) (-1205.219) -- 0:00:41
      326500 -- [-1203.936] (-1203.493) (-1202.618) (-1202.303) * [-1203.013] (-1203.683) (-1204.543) (-1203.108) -- 0:00:43
      327000 -- (-1205.753) (-1202.728) [-1205.001] (-1203.489) * (-1205.409) (-1203.355) [-1204.871] (-1203.455) -- 0:00:43
      327500 -- (-1206.197) [-1202.729] (-1203.889) (-1202.427) * (-1202.770) (-1202.874) [-1202.209] (-1203.835) -- 0:00:43
      328000 -- [-1206.658] (-1205.380) (-1207.385) (-1202.378) * (-1202.830) (-1203.689) [-1202.300] (-1204.677) -- 0:00:43
      328500 -- (-1207.639) [-1202.241] (-1204.830) (-1203.055) * [-1203.334] (-1207.299) (-1203.660) (-1202.821) -- 0:00:42
      329000 -- (-1201.832) [-1203.249] (-1205.106) (-1205.702) * (-1203.523) (-1204.523) [-1203.228] (-1208.001) -- 0:00:42
      329500 -- [-1205.630] (-1202.967) (-1205.937) (-1202.878) * (-1202.813) [-1202.830] (-1205.678) (-1205.780) -- 0:00:42
      330000 -- (-1205.341) (-1203.711) [-1203.871] (-1201.847) * (-1201.933) [-1202.300] (-1206.115) (-1207.149) -- 0:00:42

      Average standard deviation of split frequencies: 0.011583

      330500 -- [-1203.104] (-1206.431) (-1202.587) (-1201.847) * (-1204.176) [-1203.125] (-1205.285) (-1207.450) -- 0:00:42
      331000 -- [-1203.801] (-1202.465) (-1204.257) (-1203.833) * [-1202.100] (-1201.794) (-1202.553) (-1204.390) -- 0:00:42
      331500 -- (-1206.293) (-1203.902) [-1204.610] (-1204.050) * (-1202.158) [-1204.901] (-1204.786) (-1207.170) -- 0:00:42
      332000 -- (-1206.015) [-1203.255] (-1203.462) (-1203.172) * (-1206.769) (-1205.773) [-1203.064] (-1203.356) -- 0:00:42
      332500 -- [-1203.640] (-1206.501) (-1205.962) (-1202.210) * [-1203.166] (-1201.930) (-1203.548) (-1202.712) -- 0:00:42
      333000 -- (-1204.012) (-1207.453) (-1201.858) [-1202.266] * (-1203.244) (-1204.665) (-1203.287) [-1204.045] -- 0:00:42
      333500 -- (-1206.964) (-1203.518) [-1204.532] (-1202.218) * (-1205.568) (-1203.465) [-1203.493] (-1208.173) -- 0:00:41
      334000 -- [-1203.351] (-1202.460) (-1202.175) (-1203.865) * (-1205.246) (-1202.236) (-1203.953) [-1203.835] -- 0:00:41
      334500 -- (-1203.124) [-1203.978] (-1203.216) (-1202.640) * (-1205.527) (-1203.816) (-1204.010) [-1202.170] -- 0:00:41
      335000 -- (-1203.430) (-1205.825) [-1206.153] (-1203.820) * (-1203.266) [-1203.575] (-1202.619) (-1203.395) -- 0:00:41

      Average standard deviation of split frequencies: 0.012188

      335500 -- (-1205.155) (-1204.438) (-1202.022) [-1203.565] * (-1203.336) [-1205.422] (-1202.297) (-1203.538) -- 0:00:41
      336000 -- (-1202.859) (-1203.945) [-1204.512] (-1206.497) * [-1204.715] (-1203.631) (-1203.812) (-1204.247) -- 0:00:41
      336500 -- (-1202.992) [-1201.761] (-1207.324) (-1202.907) * [-1202.888] (-1202.429) (-1204.957) (-1205.752) -- 0:00:41
      337000 -- (-1204.960) (-1202.892) [-1201.984] (-1201.868) * [-1202.932] (-1203.243) (-1205.902) (-1202.825) -- 0:00:41
      337500 -- [-1204.768] (-1202.781) (-1202.353) (-1204.205) * [-1203.917] (-1203.164) (-1202.338) (-1203.134) -- 0:00:41
      338000 -- [-1204.426] (-1204.659) (-1205.789) (-1203.665) * (-1205.836) (-1203.802) [-1204.528] (-1203.256) -- 0:00:41
      338500 -- (-1205.321) (-1205.221) [-1205.047] (-1203.625) * (-1202.361) (-1203.206) [-1207.175] (-1204.828) -- 0:00:41
      339000 -- [-1203.878] (-1202.746) (-1208.423) (-1203.246) * (-1202.020) (-1204.239) (-1206.683) [-1204.546] -- 0:00:40
      339500 -- (-1202.516) (-1208.692) (-1202.963) [-1202.395] * (-1201.918) (-1204.182) [-1202.698] (-1204.673) -- 0:00:40
      340000 -- [-1202.720] (-1207.884) (-1204.217) (-1204.100) * (-1201.930) [-1204.280] (-1201.945) (-1205.578) -- 0:00:40

      Average standard deviation of split frequencies: 0.012047

      340500 -- (-1203.327) (-1205.270) [-1203.698] (-1203.982) * (-1201.599) [-1207.680] (-1202.487) (-1205.536) -- 0:00:40
      341000 -- (-1202.351) (-1205.037) [-1201.554] (-1204.472) * (-1202.119) [-1203.209] (-1203.632) (-1206.007) -- 0:00:40
      341500 -- (-1206.089) [-1202.003] (-1201.890) (-1204.927) * (-1202.680) (-1207.515) (-1202.434) [-1206.687] -- 0:00:40
      342000 -- (-1204.727) [-1204.334] (-1207.403) (-1202.095) * (-1206.597) (-1203.078) [-1204.307] (-1205.515) -- 0:00:40
      342500 -- [-1204.443] (-1203.007) (-1207.209) (-1202.212) * (-1202.823) (-1203.020) [-1204.091] (-1204.468) -- 0:00:40
      343000 -- (-1204.022) (-1202.400) [-1206.738] (-1206.631) * (-1202.949) [-1204.022] (-1204.739) (-1203.570) -- 0:00:42
      343500 -- [-1204.218] (-1204.882) (-1203.430) (-1203.486) * (-1205.435) (-1203.529) [-1208.326] (-1205.209) -- 0:00:42
      344000 -- (-1206.564) (-1207.944) (-1203.576) [-1205.071] * [-1203.591] (-1208.332) (-1203.048) (-1203.848) -- 0:00:41
      344500 -- (-1204.032) (-1204.568) [-1203.605] (-1205.716) * (-1203.843) (-1203.510) [-1205.864] (-1208.528) -- 0:00:41
      345000 -- [-1204.946] (-1204.288) (-1201.733) (-1207.985) * (-1203.354) [-1211.434] (-1202.631) (-1203.989) -- 0:00:41

      Average standard deviation of split frequencies: 0.012983

      345500 -- (-1204.116) (-1203.510) (-1202.027) [-1206.511] * (-1203.807) [-1204.366] (-1203.264) (-1203.785) -- 0:00:41
      346000 -- (-1203.994) (-1203.510) [-1203.305] (-1209.338) * (-1203.904) (-1206.130) [-1206.694] (-1203.813) -- 0:00:41
      346500 -- (-1206.104) [-1203.293] (-1202.178) (-1205.246) * (-1202.352) [-1202.500] (-1203.323) (-1204.897) -- 0:00:41
      347000 -- (-1204.115) (-1203.411) (-1208.609) [-1203.425] * (-1203.464) (-1204.020) (-1203.272) [-1204.090] -- 0:00:41
      347500 -- (-1203.406) (-1203.644) (-1205.228) [-1203.482] * (-1203.124) (-1203.099) (-1202.685) [-1203.126] -- 0:00:41
      348000 -- (-1204.312) (-1203.686) [-1206.780] (-1204.446) * (-1207.050) (-1203.422) (-1202.806) [-1202.395] -- 0:00:41
      348500 -- (-1203.546) [-1202.837] (-1203.252) (-1202.252) * [-1207.946] (-1207.567) (-1205.499) (-1203.607) -- 0:00:41
      349000 -- [-1205.314] (-1204.101) (-1203.259) (-1206.734) * (-1205.605) (-1204.320) (-1202.046) [-1204.299] -- 0:00:41
      349500 -- (-1204.635) (-1202.768) (-1204.836) [-1202.040] * (-1203.284) (-1204.687) (-1204.308) [-1201.901] -- 0:00:40
      350000 -- (-1204.742) (-1203.963) (-1205.212) [-1203.802] * (-1204.268) (-1203.228) (-1203.025) [-1202.926] -- 0:00:40

      Average standard deviation of split frequencies: 0.013443

      350500 -- [-1204.266] (-1205.883) (-1209.201) (-1204.875) * (-1206.276) [-1202.766] (-1206.383) (-1213.572) -- 0:00:40
      351000 -- (-1204.479) (-1204.192) [-1204.430] (-1202.949) * (-1208.274) (-1203.299) (-1204.980) [-1204.282] -- 0:00:40
      351500 -- (-1204.527) (-1208.215) [-1207.576] (-1204.561) * (-1206.675) (-1203.292) [-1205.076] (-1206.120) -- 0:00:40
      352000 -- (-1203.863) [-1201.798] (-1205.268) (-1202.764) * (-1207.716) (-1207.373) (-1202.369) [-1201.947] -- 0:00:40
      352500 -- [-1205.467] (-1201.798) (-1203.278) (-1203.011) * (-1203.916) (-1205.763) [-1202.628] (-1203.832) -- 0:00:40
      353000 -- [-1203.866] (-1201.667) (-1204.053) (-1204.377) * (-1202.966) (-1207.569) (-1205.900) [-1203.809] -- 0:00:40
      353500 -- (-1203.362) [-1205.220] (-1203.533) (-1203.329) * (-1202.966) (-1206.563) [-1202.931] (-1203.017) -- 0:00:40
      354000 -- [-1203.560] (-1205.921) (-1203.707) (-1205.665) * [-1204.203] (-1205.032) (-1201.692) (-1204.707) -- 0:00:40
      354500 -- (-1204.609) (-1203.443) (-1204.341) [-1202.708] * (-1204.402) (-1203.088) [-1204.022] (-1202.647) -- 0:00:40
      355000 -- (-1202.712) (-1208.836) [-1203.298] (-1205.348) * [-1205.372] (-1202.752) (-1205.503) (-1205.187) -- 0:00:39

      Average standard deviation of split frequencies: 0.013407

      355500 -- (-1205.377) [-1204.819] (-1204.681) (-1214.641) * (-1205.430) [-1203.607] (-1206.356) (-1204.176) -- 0:00:39
      356000 -- [-1203.036] (-1202.736) (-1205.597) (-1206.535) * (-1203.939) (-1203.167) (-1205.080) [-1205.399] -- 0:00:39
      356500 -- (-1202.821) (-1205.195) (-1206.989) [-1203.582] * [-1201.531] (-1205.526) (-1203.756) (-1204.580) -- 0:00:39
      357000 -- [-1203.959] (-1207.211) (-1204.778) (-1206.619) * [-1203.520] (-1202.826) (-1203.767) (-1205.946) -- 0:00:39
      357500 -- [-1203.614] (-1203.274) (-1204.507) (-1202.379) * (-1204.964) (-1205.218) (-1203.978) [-1202.057] -- 0:00:39
      358000 -- (-1204.988) [-1202.794] (-1204.223) (-1205.027) * [-1206.965] (-1204.283) (-1203.695) (-1202.578) -- 0:00:39
      358500 -- (-1203.227) (-1202.312) [-1201.979] (-1203.289) * (-1203.007) (-1204.302) [-1201.867] (-1202.697) -- 0:00:39
      359000 -- [-1206.856] (-1202.436) (-1203.544) (-1206.146) * (-1201.609) (-1204.312) (-1202.880) [-1203.389] -- 0:00:41
      359500 -- (-1204.946) [-1205.388] (-1204.765) (-1204.374) * (-1203.033) (-1202.911) (-1202.680) [-1203.180] -- 0:00:40
      360000 -- (-1203.425) (-1204.553) (-1203.957) [-1205.548] * [-1205.061] (-1206.088) (-1205.441) (-1203.157) -- 0:00:40

      Average standard deviation of split frequencies: 0.013685

      360500 -- (-1202.231) (-1203.096) [-1203.770] (-1203.135) * (-1204.890) [-1205.793] (-1203.506) (-1202.254) -- 0:00:40
      361000 -- [-1203.655] (-1203.355) (-1208.389) (-1202.774) * [-1205.449] (-1204.811) (-1203.859) (-1204.662) -- 0:00:40
      361500 -- (-1203.504) (-1202.468) [-1206.071] (-1203.111) * [-1204.092] (-1204.459) (-1206.073) (-1203.794) -- 0:00:40
      362000 -- [-1203.537] (-1202.458) (-1203.581) (-1206.055) * [-1211.994] (-1202.708) (-1203.100) (-1205.812) -- 0:00:40
      362500 -- (-1203.594) (-1202.543) (-1204.506) [-1207.911] * (-1213.391) (-1204.102) (-1206.180) [-1206.118] -- 0:00:40
      363000 -- [-1206.908] (-1206.033) (-1202.960) (-1207.941) * (-1209.398) [-1203.713] (-1208.396) (-1203.168) -- 0:00:40
      363500 -- (-1205.244) [-1202.709] (-1205.343) (-1205.928) * (-1204.259) (-1202.550) [-1206.750] (-1203.917) -- 0:00:40
      364000 -- (-1204.864) [-1207.202] (-1203.168) (-1205.267) * (-1203.458) (-1205.951) (-1206.878) [-1202.506] -- 0:00:40
      364500 -- (-1206.183) [-1204.160] (-1203.058) (-1204.574) * [-1204.074] (-1205.312) (-1211.394) (-1203.634) -- 0:00:40
      365000 -- (-1204.687) [-1206.280] (-1202.234) (-1202.706) * [-1204.863] (-1204.797) (-1206.331) (-1205.984) -- 0:00:40

      Average standard deviation of split frequencies: 0.013334

      365500 -- (-1206.101) (-1209.314) [-1202.234] (-1202.460) * [-1202.290] (-1203.070) (-1204.195) (-1203.033) -- 0:00:39
      366000 -- (-1202.536) [-1206.064] (-1206.019) (-1202.289) * [-1204.394] (-1203.123) (-1203.975) (-1203.619) -- 0:00:39
      366500 -- (-1206.217) [-1204.051] (-1205.483) (-1205.681) * [-1204.534] (-1206.379) (-1203.606) (-1203.807) -- 0:00:39
      367000 -- [-1204.568] (-1205.601) (-1204.838) (-1204.059) * (-1204.430) (-1207.191) [-1203.896] (-1203.520) -- 0:00:39
      367500 -- (-1209.358) [-1204.173] (-1203.014) (-1204.600) * (-1201.925) [-1202.304] (-1205.136) (-1203.531) -- 0:00:39
      368000 -- (-1202.763) (-1203.558) [-1202.887] (-1208.143) * (-1202.033) [-1202.833] (-1204.089) (-1205.930) -- 0:00:39
      368500 -- [-1202.700] (-1204.631) (-1203.226) (-1206.027) * (-1203.962) [-1203.119] (-1202.972) (-1205.572) -- 0:00:39
      369000 -- (-1207.458) (-1206.397) [-1202.218] (-1203.373) * (-1203.559) (-1203.726) [-1203.537] (-1202.881) -- 0:00:39
      369500 -- (-1202.294) (-1207.484) (-1204.526) [-1202.080] * [-1203.883] (-1203.189) (-1203.337) (-1205.613) -- 0:00:39
      370000 -- (-1202.354) (-1204.713) (-1202.016) [-1204.909] * [-1204.752] (-1203.110) (-1203.260) (-1207.144) -- 0:00:39

      Average standard deviation of split frequencies: 0.013990

      370500 -- (-1202.542) [-1204.153] (-1204.794) (-1204.628) * (-1204.602) (-1202.574) (-1201.988) [-1202.831] -- 0:00:39
      371000 -- [-1207.560] (-1204.386) (-1204.288) (-1208.214) * (-1203.293) [-1202.454] (-1204.379) (-1206.071) -- 0:00:38
      371500 -- [-1201.773] (-1202.749) (-1205.317) (-1204.240) * (-1203.208) [-1202.297] (-1206.181) (-1202.864) -- 0:00:38
      372000 -- (-1201.853) (-1202.941) (-1207.392) [-1201.690] * (-1202.155) (-1203.539) [-1204.838] (-1206.813) -- 0:00:38
      372500 -- [-1202.185] (-1201.782) (-1202.819) (-1202.044) * [-1205.710] (-1203.812) (-1203.062) (-1203.914) -- 0:00:38
      373000 -- [-1203.293] (-1204.271) (-1202.231) (-1202.284) * (-1202.982) (-1204.869) [-1202.282] (-1201.941) -- 0:00:38
      373500 -- (-1203.073) (-1204.256) [-1204.250] (-1203.682) * (-1205.983) (-1203.995) [-1203.159] (-1203.938) -- 0:00:38
      374000 -- (-1202.333) (-1202.009) [-1204.025] (-1203.382) * (-1204.314) (-1205.479) [-1202.349] (-1204.709) -- 0:00:38
      374500 -- (-1205.541) [-1204.287] (-1203.173) (-1205.512) * (-1203.631) (-1204.683) (-1203.542) [-1205.345] -- 0:00:38
      375000 -- (-1205.020) (-1202.814) (-1202.300) [-1202.266] * [-1205.590] (-1205.971) (-1206.970) (-1204.281) -- 0:00:38

      Average standard deviation of split frequencies: 0.013791

      375500 -- (-1206.072) [-1201.745] (-1204.375) (-1203.043) * [-1203.453] (-1203.717) (-1208.048) (-1208.999) -- 0:00:39
      376000 -- (-1202.612) (-1202.963) (-1204.416) [-1203.707] * (-1206.707) (-1203.852) [-1203.359] (-1209.105) -- 0:00:39
      376500 -- (-1202.994) (-1202.909) (-1204.229) [-1203.679] * (-1204.796) (-1202.953) (-1204.173) [-1205.314] -- 0:00:39
      377000 -- (-1205.377) (-1203.033) [-1202.719] (-1203.007) * (-1202.345) (-1205.734) (-1205.425) [-1202.042] -- 0:00:39
      377500 -- (-1206.545) (-1204.372) (-1202.109) [-1204.976] * (-1203.015) (-1205.712) (-1207.129) [-1203.213] -- 0:00:39
      378000 -- (-1204.252) [-1202.567] (-1203.321) (-1203.880) * (-1203.012) (-1205.447) (-1206.750) [-1201.736] -- 0:00:39
      378500 -- (-1204.579) (-1204.333) [-1204.216] (-1204.574) * (-1204.321) (-1205.667) [-1202.548] (-1202.047) -- 0:00:39
      379000 -- (-1202.893) (-1203.077) (-1204.473) [-1204.914] * (-1203.878) [-1205.063] (-1205.155) (-1205.262) -- 0:00:39
      379500 -- (-1205.536) [-1203.446] (-1202.373) (-1202.242) * [-1203.609] (-1204.294) (-1204.453) (-1203.395) -- 0:00:39
      380000 -- (-1204.456) (-1201.793) [-1201.842] (-1202.603) * [-1202.241] (-1203.712) (-1204.191) (-1204.970) -- 0:00:39

      Average standard deviation of split frequencies: 0.014278

      380500 -- (-1202.358) (-1203.053) (-1202.028) [-1202.073] * (-1203.928) (-1203.397) [-1205.165] (-1208.525) -- 0:00:39
      381000 -- (-1206.827) [-1203.412] (-1205.853) (-1207.427) * (-1205.289) [-1202.684] (-1207.433) (-1203.075) -- 0:00:38
      381500 -- (-1203.798) (-1202.845) (-1202.036) [-1204.576] * (-1205.246) (-1204.252) (-1203.618) [-1205.768] -- 0:00:38
      382000 -- (-1205.327) (-1207.156) (-1205.870) [-1201.938] * (-1205.654) [-1203.476] (-1202.591) (-1204.543) -- 0:00:38
      382500 -- (-1203.124) [-1204.219] (-1203.985) (-1201.786) * (-1206.847) (-1204.643) [-1204.657] (-1204.058) -- 0:00:38
      383000 -- (-1203.285) [-1203.784] (-1204.396) (-1203.427) * [-1205.036] (-1205.815) (-1203.756) (-1202.070) -- 0:00:38
      383500 -- (-1205.219) [-1201.769] (-1204.850) (-1207.092) * (-1208.403) (-1203.548) [-1203.295] (-1205.562) -- 0:00:38
      384000 -- [-1206.570] (-1204.734) (-1205.059) (-1203.580) * (-1203.187) [-1205.763] (-1204.285) (-1205.144) -- 0:00:38
      384500 -- (-1207.823) (-1205.677) (-1204.978) [-1202.858] * (-1207.301) (-1202.907) [-1209.346] (-1209.061) -- 0:00:38
      385000 -- (-1204.326) (-1206.748) [-1202.382] (-1206.130) * (-1203.844) [-1202.986] (-1204.405) (-1204.117) -- 0:00:38

      Average standard deviation of split frequencies: 0.013218

      385500 -- (-1204.115) [-1204.679] (-1202.765) (-1208.136) * [-1204.735] (-1202.561) (-1203.556) (-1204.916) -- 0:00:38
      386000 -- [-1203.211] (-1205.956) (-1207.528) (-1205.510) * (-1203.898) (-1203.751) [-1201.549] (-1205.574) -- 0:00:38
      386500 -- [-1205.404] (-1204.000) (-1203.785) (-1208.336) * (-1204.762) (-1202.227) [-1202.630] (-1206.724) -- 0:00:38
      387000 -- [-1204.607] (-1202.601) (-1207.886) (-1213.386) * (-1205.121) (-1205.739) [-1202.084] (-1206.930) -- 0:00:38
      387500 -- (-1207.830) (-1204.154) (-1202.603) [-1209.524] * (-1206.692) [-1203.153] (-1201.511) (-1204.749) -- 0:00:37
      388000 -- (-1203.128) (-1205.500) (-1202.493) [-1205.703] * [-1203.152] (-1203.458) (-1202.249) (-1202.930) -- 0:00:37
      388500 -- [-1202.787] (-1202.830) (-1203.977) (-1204.206) * (-1205.320) [-1205.200] (-1203.136) (-1203.029) -- 0:00:37
      389000 -- (-1203.520) [-1205.433] (-1201.892) (-1204.519) * (-1205.237) (-1203.486) (-1204.967) [-1207.421] -- 0:00:37
      389500 -- (-1203.520) [-1204.557] (-1202.904) (-1203.099) * (-1203.109) (-1202.781) [-1206.957] (-1204.418) -- 0:00:37
      390000 -- (-1203.454) [-1204.486] (-1202.203) (-1201.941) * (-1205.247) (-1204.545) (-1203.762) [-1202.776] -- 0:00:37

      Average standard deviation of split frequencies: 0.013344

      390500 -- (-1203.046) (-1205.931) [-1201.686] (-1201.941) * (-1204.724) (-1203.007) (-1204.022) [-1203.045] -- 0:00:37
      391000 -- (-1203.107) (-1202.904) (-1202.244) [-1202.478] * (-1203.928) (-1205.433) [-1203.811] (-1208.943) -- 0:00:37
      391500 -- (-1206.243) [-1206.436] (-1204.683) (-1203.387) * [-1202.894] (-1204.445) (-1205.724) (-1204.664) -- 0:00:38
      392000 -- (-1204.638) (-1205.796) (-1204.210) [-1203.984] * (-1203.216) [-1204.877] (-1206.516) (-1204.931) -- 0:00:38
      392500 -- (-1202.326) (-1204.513) [-1202.538] (-1206.190) * (-1203.717) (-1201.833) [-1204.166] (-1202.915) -- 0:00:38
      393000 -- (-1203.555) (-1202.341) [-1206.055] (-1203.403) * (-1202.693) [-1201.984] (-1202.123) (-1203.925) -- 0:00:38
      393500 -- [-1202.297] (-1203.577) (-1208.402) (-1204.606) * (-1204.153) [-1202.620] (-1202.874) (-1202.247) -- 0:00:38
      394000 -- (-1205.062) [-1203.919] (-1205.402) (-1203.314) * (-1204.336) (-1204.904) [-1203.324] (-1202.280) -- 0:00:38
      394500 -- [-1204.697] (-1203.584) (-1205.340) (-1206.542) * (-1201.807) (-1205.364) [-1203.040] (-1203.557) -- 0:00:38
      395000 -- (-1203.248) (-1203.846) (-1205.333) [-1207.515] * (-1205.006) (-1206.385) [-1203.502] (-1206.348) -- 0:00:38

      Average standard deviation of split frequencies: 0.013515

      395500 -- (-1202.664) [-1205.433] (-1202.760) (-1207.031) * (-1202.520) (-1204.322) [-1202.859] (-1204.712) -- 0:00:38
      396000 -- (-1203.658) [-1202.218] (-1206.013) (-1211.118) * (-1204.547) (-1203.072) (-1204.659) [-1204.774] -- 0:00:38
      396500 -- [-1202.289] (-1202.374) (-1202.189) (-1212.008) * [-1202.690] (-1204.728) (-1207.657) (-1203.907) -- 0:00:38
      397000 -- (-1208.697) (-1202.346) [-1202.155] (-1204.341) * (-1207.775) (-1202.382) (-1204.164) [-1205.998] -- 0:00:37
      397500 -- [-1203.844] (-1201.823) (-1202.328) (-1203.070) * (-1206.322) [-1204.528] (-1203.425) (-1202.942) -- 0:00:37
      398000 -- (-1204.443) [-1201.812] (-1205.870) (-1206.501) * (-1202.082) (-1205.036) [-1204.734] (-1202.121) -- 0:00:37
      398500 -- (-1204.636) [-1203.421] (-1203.240) (-1203.023) * (-1202.278) (-1204.878) (-1203.385) [-1201.767] -- 0:00:37
      399000 -- (-1203.640) [-1201.851] (-1202.070) (-1202.920) * [-1201.668] (-1204.251) (-1203.762) (-1206.035) -- 0:00:37
      399500 -- (-1204.720) [-1201.580] (-1209.661) (-1202.835) * (-1203.434) (-1203.475) [-1207.122] (-1204.575) -- 0:00:37
      400000 -- (-1205.147) (-1201.667) [-1205.285] (-1203.482) * (-1203.162) (-1202.294) (-1206.481) [-1206.618] -- 0:00:37

      Average standard deviation of split frequencies: 0.014576

      400500 -- (-1207.750) [-1201.809] (-1202.165) (-1203.706) * [-1203.371] (-1204.484) (-1208.756) (-1204.744) -- 0:00:37
      401000 -- (-1208.364) [-1203.741] (-1204.228) (-1204.073) * [-1202.817] (-1205.116) (-1204.507) (-1204.666) -- 0:00:37
      401500 -- (-1201.724) (-1202.872) (-1205.194) [-1205.279] * (-1202.674) (-1204.459) (-1202.920) [-1202.165] -- 0:00:37
      402000 -- [-1202.544] (-1203.085) (-1205.289) (-1204.278) * (-1202.854) (-1203.084) (-1202.825) [-1203.285] -- 0:00:37
      402500 -- (-1203.328) (-1204.244) (-1207.580) [-1209.280] * (-1205.509) (-1205.368) (-1202.334) [-1203.477] -- 0:00:37
      403000 -- (-1204.105) (-1203.921) [-1206.764] (-1206.428) * (-1206.441) (-1205.571) [-1202.634] (-1204.808) -- 0:00:37
      403500 -- (-1205.713) (-1201.909) [-1205.550] (-1206.695) * [-1205.341] (-1203.230) (-1202.632) (-1203.701) -- 0:00:36
      404000 -- (-1205.441) (-1203.251) (-1207.432) [-1202.475] * (-1206.549) [-1203.611] (-1203.788) (-1203.166) -- 0:00:36
      404500 -- (-1203.673) [-1205.133] (-1205.559) (-1202.229) * (-1207.453) (-1206.304) [-1203.174] (-1202.542) -- 0:00:36
      405000 -- (-1202.571) (-1202.967) [-1205.656] (-1202.460) * (-1207.578) (-1205.673) [-1202.724] (-1202.512) -- 0:00:36

      Average standard deviation of split frequencies: 0.015481

      405500 -- [-1203.835] (-1204.402) (-1202.427) (-1202.460) * (-1207.603) [-1207.202] (-1205.709) (-1207.338) -- 0:00:36
      406000 -- [-1204.076] (-1205.305) (-1204.286) (-1202.605) * [-1206.698] (-1203.351) (-1204.475) (-1203.895) -- 0:00:36
      406500 -- (-1204.022) [-1206.354] (-1202.926) (-1202.337) * (-1203.430) (-1202.818) [-1203.166] (-1207.684) -- 0:00:36
      407000 -- (-1207.941) (-1203.635) (-1206.563) [-1201.991] * [-1202.834] (-1202.178) (-1202.808) (-1204.039) -- 0:00:36
      407500 -- (-1205.277) (-1204.372) [-1205.980] (-1202.760) * [-1202.136] (-1203.697) (-1203.339) (-1205.233) -- 0:00:36
      408000 -- (-1203.676) [-1202.451] (-1205.087) (-1206.145) * (-1202.103) [-1202.475] (-1202.284) (-1204.679) -- 0:00:37
      408500 -- (-1202.899) [-1202.451] (-1202.187) (-1201.965) * (-1202.261) [-1201.607] (-1206.213) (-1204.298) -- 0:00:37
      409000 -- (-1205.678) [-1203.229] (-1203.563) (-1201.978) * [-1206.078] (-1203.136) (-1205.178) (-1206.300) -- 0:00:37
      409500 -- (-1204.057) (-1202.794) [-1203.374] (-1206.325) * [-1202.294] (-1205.517) (-1204.664) (-1205.799) -- 0:00:37
      410000 -- (-1204.880) (-1201.939) (-1203.783) [-1207.647] * [-1203.107] (-1204.176) (-1202.723) (-1204.806) -- 0:00:37

      Average standard deviation of split frequencies: 0.016071

      410500 -- (-1202.822) (-1201.742) (-1206.703) [-1206.107] * [-1203.570] (-1204.626) (-1204.978) (-1206.627) -- 0:00:37
      411000 -- (-1202.660) [-1202.622] (-1203.250) (-1202.868) * (-1204.027) [-1203.156] (-1207.146) (-1203.691) -- 0:00:37
      411500 -- (-1202.736) [-1205.432] (-1202.855) (-1204.685) * (-1209.958) (-1207.089) (-1207.044) [-1203.164] -- 0:00:37
      412000 -- (-1205.217) [-1205.481] (-1207.907) (-1206.433) * (-1205.732) (-1202.492) (-1206.053) [-1202.930] -- 0:00:37
      412500 -- (-1204.163) [-1207.905] (-1205.809) (-1202.230) * (-1203.712) [-1202.671] (-1204.614) (-1203.629) -- 0:00:37
      413000 -- [-1201.928] (-1206.631) (-1204.398) (-1203.092) * (-1204.209) (-1207.017) (-1205.204) [-1204.440] -- 0:00:36
      413500 -- [-1202.600] (-1202.203) (-1205.701) (-1204.685) * [-1205.352] (-1202.778) (-1201.964) (-1202.805) -- 0:00:36
      414000 -- (-1204.213) (-1202.506) (-1202.724) [-1204.717] * [-1201.817] (-1204.323) (-1204.372) (-1202.332) -- 0:00:36
      414500 -- [-1206.840] (-1204.182) (-1202.460) (-1204.199) * (-1202.341) [-1206.895] (-1204.166) (-1202.510) -- 0:00:36
      415000 -- (-1205.892) (-1203.163) [-1204.447] (-1205.097) * (-1204.365) (-1201.931) [-1202.213] (-1203.326) -- 0:00:36

      Average standard deviation of split frequencies: 0.015487

      415500 -- (-1205.599) (-1202.612) (-1202.383) [-1205.437] * (-1204.081) [-1204.334] (-1202.166) (-1203.311) -- 0:00:36
      416000 -- (-1203.117) (-1203.776) (-1202.278) [-1204.740] * (-1204.397) (-1202.921) [-1202.329] (-1203.589) -- 0:00:36
      416500 -- (-1204.849) [-1201.748] (-1203.855) (-1204.580) * (-1204.127) (-1202.780) (-1204.172) [-1203.922] -- 0:00:36
      417000 -- [-1206.119] (-1203.072) (-1203.984) (-1203.258) * [-1202.757] (-1204.575) (-1207.476) (-1206.038) -- 0:00:36
      417500 -- (-1204.162) [-1203.974] (-1203.412) (-1205.525) * (-1204.554) [-1203.396] (-1205.232) (-1207.019) -- 0:00:36
      418000 -- [-1203.083] (-1203.923) (-1202.629) (-1206.753) * (-1209.782) [-1203.515] (-1203.713) (-1203.656) -- 0:00:36
      418500 -- [-1202.310] (-1203.179) (-1203.442) (-1204.861) * (-1206.103) [-1205.140] (-1206.079) (-1203.458) -- 0:00:36
      419000 -- [-1203.144] (-1204.069) (-1203.602) (-1204.160) * (-1204.450) [-1204.063] (-1203.624) (-1206.150) -- 0:00:36
      419500 -- (-1202.086) [-1206.002] (-1204.110) (-1202.597) * (-1202.164) [-1202.960] (-1205.605) (-1202.664) -- 0:00:35
      420000 -- [-1202.220] (-1203.471) (-1201.875) (-1201.662) * (-1202.287) (-1204.706) (-1204.446) [-1202.573] -- 0:00:35

      Average standard deviation of split frequencies: 0.014692

      420500 -- (-1202.770) [-1202.653] (-1202.048) (-1203.179) * (-1202.287) (-1204.189) [-1203.364] (-1202.874) -- 0:00:35
      421000 -- (-1205.671) (-1207.958) [-1203.025] (-1202.983) * (-1203.142) (-1205.297) [-1202.861] (-1205.973) -- 0:00:35
      421500 -- (-1202.722) (-1203.941) (-1203.706) [-1204.268] * [-1202.442] (-1202.186) (-1204.050) (-1203.950) -- 0:00:35
      422000 -- (-1203.029) (-1202.254) (-1205.070) [-1204.312] * [-1203.196] (-1202.318) (-1206.483) (-1202.830) -- 0:00:35
      422500 -- (-1202.653) (-1202.715) (-1205.251) [-1205.928] * [-1203.943] (-1205.267) (-1204.451) (-1204.650) -- 0:00:35
      423000 -- (-1202.261) (-1202.902) [-1202.027] (-1203.404) * (-1203.190) (-1209.758) (-1203.948) [-1205.006] -- 0:00:35
      423500 -- [-1205.857] (-1201.762) (-1202.157) (-1202.566) * [-1201.833] (-1203.590) (-1207.241) (-1204.844) -- 0:00:35
      424000 -- (-1203.618) (-1203.440) (-1202.630) [-1202.871] * (-1202.366) (-1203.226) (-1203.340) [-1202.583] -- 0:00:35
      424500 -- (-1202.667) [-1205.408] (-1204.433) (-1203.400) * (-1203.663) (-1203.524) (-1203.062) [-1202.569] -- 0:00:36
      425000 -- [-1202.248] (-1203.250) (-1206.183) (-1208.216) * (-1201.700) (-1202.941) [-1203.122] (-1202.244) -- 0:00:36

      Average standard deviation of split frequencies: 0.014447

      425500 -- (-1210.526) (-1202.135) [-1202.759] (-1203.579) * [-1202.708] (-1206.158) (-1203.613) (-1204.445) -- 0:00:36
      426000 -- (-1203.731) (-1204.147) [-1204.101] (-1205.191) * [-1204.245] (-1204.106) (-1202.379) (-1205.224) -- 0:00:36
      426500 -- (-1203.446) (-1206.195) (-1203.011) [-1203.936] * (-1204.154) (-1203.468) [-1205.087] (-1203.990) -- 0:00:36
      427000 -- (-1204.643) (-1205.962) [-1204.831] (-1201.937) * (-1206.945) (-1204.971) (-1205.914) [-1203.468] -- 0:00:36
      427500 -- (-1205.642) (-1205.870) [-1202.342] (-1204.622) * (-1202.145) [-1204.922] (-1203.732) (-1203.988) -- 0:00:36
      428000 -- [-1204.564] (-1204.234) (-1201.608) (-1205.518) * (-1202.137) (-1203.364) (-1203.740) [-1205.010] -- 0:00:36
      428500 -- [-1202.464] (-1201.777) (-1202.598) (-1206.300) * (-1201.481) (-1202.385) [-1203.038] (-1205.174) -- 0:00:36
      429000 -- (-1204.687) (-1202.906) (-1204.493) [-1205.297] * (-1202.977) (-1202.313) [-1202.592] (-1205.874) -- 0:00:35
      429500 -- (-1204.277) (-1204.178) (-1201.693) [-1204.065] * [-1201.975] (-1202.463) (-1207.274) (-1204.281) -- 0:00:35
      430000 -- [-1202.853] (-1204.149) (-1202.821) (-1206.405) * (-1202.619) (-1202.831) (-1205.245) [-1203.943] -- 0:00:35

      Average standard deviation of split frequencies: 0.014938

      430500 -- [-1204.913] (-1204.133) (-1202.916) (-1206.250) * (-1204.273) (-1208.526) (-1205.826) [-1203.655] -- 0:00:35
      431000 -- (-1205.988) (-1205.339) (-1204.095) [-1204.770] * (-1202.032) (-1205.221) [-1202.789] (-1202.559) -- 0:00:35
      431500 -- (-1203.007) (-1205.538) (-1208.055) [-1207.361] * (-1206.378) (-1203.005) (-1202.451) [-1203.894] -- 0:00:35
      432000 -- (-1202.273) (-1203.956) (-1204.826) [-1205.541] * (-1206.890) [-1203.237] (-1202.387) (-1205.112) -- 0:00:35
      432500 -- (-1203.782) [-1201.935] (-1205.916) (-1206.027) * (-1203.843) [-1204.130] (-1204.954) (-1204.364) -- 0:00:35
      433000 -- (-1204.230) (-1204.474) (-1202.819) [-1204.485] * (-1202.321) [-1202.982] (-1206.939) (-1204.216) -- 0:00:35
      433500 -- [-1203.513] (-1202.832) (-1203.483) (-1205.789) * (-1204.851) [-1203.454] (-1202.807) (-1202.218) -- 0:00:35
      434000 -- [-1202.615] (-1204.068) (-1203.483) (-1202.622) * (-1202.197) (-1204.620) [-1202.757] (-1202.626) -- 0:00:35
      434500 -- (-1204.888) (-1204.919) (-1209.635) [-1202.676] * (-1204.293) (-1206.851) [-1202.722] (-1203.006) -- 0:00:35
      435000 -- (-1206.398) (-1208.884) [-1205.221] (-1205.899) * (-1203.366) [-1204.111] (-1203.092) (-1203.227) -- 0:00:35

      Average standard deviation of split frequencies: 0.014374

      435500 -- (-1204.643) (-1203.657) (-1202.847) [-1203.482] * (-1202.955) (-1205.857) (-1204.692) [-1210.127] -- 0:00:34
      436000 -- (-1204.478) [-1202.730] (-1203.091) (-1203.477) * (-1203.496) (-1203.557) (-1206.777) [-1205.160] -- 0:00:34
      436500 -- (-1210.215) [-1202.819] (-1202.175) (-1202.421) * [-1204.955] (-1203.455) (-1206.084) (-1202.963) -- 0:00:34
      437000 -- (-1203.501) [-1201.872] (-1205.051) (-1202.638) * (-1205.524) (-1204.024) [-1202.490] (-1204.570) -- 0:00:34
      437500 -- (-1203.088) (-1201.736) [-1207.299] (-1205.905) * (-1204.837) (-1202.380) [-1203.826] (-1203.305) -- 0:00:34
      438000 -- (-1205.206) (-1203.626) [-1204.417] (-1205.539) * (-1204.535) (-1205.131) [-1202.814] (-1202.627) -- 0:00:34
      438500 -- (-1207.756) (-1201.964) [-1205.542] (-1204.644) * (-1203.778) (-1205.397) [-1203.243] (-1202.093) -- 0:00:34
      439000 -- (-1207.795) [-1202.723] (-1203.518) (-1202.006) * [-1204.507] (-1205.646) (-1202.794) (-1202.315) -- 0:00:34
      439500 -- (-1205.470) [-1203.516] (-1203.491) (-1201.474) * (-1204.260) (-1202.607) (-1201.934) [-1202.224] -- 0:00:34
      440000 -- (-1202.344) [-1207.049] (-1203.593) (-1203.679) * (-1204.100) (-1202.534) [-1202.097] (-1202.467) -- 0:00:34

      Average standard deviation of split frequencies: 0.013718

      440500 -- (-1205.078) (-1206.043) (-1203.700) [-1205.029] * (-1207.698) [-1203.787] (-1202.088) (-1203.072) -- 0:00:35
      441000 -- (-1206.296) [-1206.595] (-1203.346) (-1206.866) * (-1204.078) (-1203.756) [-1203.605] (-1203.814) -- 0:00:35
      441500 -- (-1206.118) [-1206.113] (-1204.417) (-1206.730) * (-1207.291) (-1206.033) (-1204.373) [-1204.189] -- 0:00:35
      442000 -- (-1207.713) (-1204.954) (-1203.110) [-1203.136] * (-1205.108) [-1207.008] (-1204.330) (-1203.233) -- 0:00:35
      442500 -- (-1202.841) [-1203.642] (-1203.895) (-1202.344) * (-1203.025) (-1206.034) (-1203.076) [-1203.434] -- 0:00:35
      443000 -- (-1202.772) (-1207.280) [-1203.794] (-1204.295) * (-1203.025) (-1203.536) (-1201.956) [-1203.188] -- 0:00:35
      443500 -- (-1202.554) [-1202.289] (-1202.816) (-1201.796) * [-1203.144] (-1202.953) (-1202.489) (-1208.097) -- 0:00:35
      444000 -- (-1202.660) [-1202.597] (-1202.938) (-1203.427) * (-1204.001) (-1202.927) (-1206.360) [-1203.331] -- 0:00:35
      444500 -- (-1206.469) (-1202.879) (-1204.855) [-1203.217] * (-1205.407) [-1209.304] (-1202.603) (-1202.374) -- 0:00:34
      445000 -- (-1202.177) (-1203.171) [-1201.879] (-1203.766) * [-1205.796] (-1204.640) (-1207.597) (-1203.122) -- 0:00:34

      Average standard deviation of split frequencies: 0.012551

      445500 -- [-1203.489] (-1204.452) (-1201.917) (-1206.554) * (-1206.690) [-1203.168] (-1202.461) (-1205.405) -- 0:00:34
      446000 -- [-1204.264] (-1203.902) (-1202.336) (-1203.653) * (-1205.745) [-1202.803] (-1207.324) (-1204.723) -- 0:00:34
      446500 -- (-1202.185) [-1202.766] (-1202.339) (-1203.723) * (-1203.659) [-1202.440] (-1206.770) (-1205.970) -- 0:00:34
      447000 -- (-1202.488) (-1202.999) [-1202.417] (-1204.311) * (-1202.757) (-1202.168) (-1204.065) [-1204.756] -- 0:00:34
      447500 -- (-1205.354) [-1204.402] (-1202.613) (-1204.340) * (-1205.335) [-1202.645] (-1205.876) (-1202.808) -- 0:00:34
      448000 -- [-1203.110] (-1201.795) (-1203.849) (-1204.779) * (-1208.298) (-1206.317) (-1205.991) [-1203.043] -- 0:00:34
      448500 -- (-1204.190) [-1204.053] (-1202.510) (-1203.384) * (-1204.821) [-1202.697] (-1205.905) (-1203.520) -- 0:00:34
      449000 -- (-1203.447) (-1206.839) [-1202.376] (-1201.912) * (-1202.734) (-1204.742) (-1204.055) [-1203.532] -- 0:00:34
      449500 -- (-1203.561) [-1204.206] (-1202.977) (-1202.246) * [-1202.175] (-1206.747) (-1204.909) (-1201.955) -- 0:00:34
      450000 -- (-1203.143) (-1204.852) [-1206.687] (-1202.246) * (-1202.121) (-1205.785) (-1204.295) [-1205.010] -- 0:00:34

      Average standard deviation of split frequencies: 0.013167

      450500 -- (-1202.837) [-1202.753] (-1209.628) (-1202.246) * (-1201.903) [-1203.899] (-1204.081) (-1206.076) -- 0:00:34
      451000 -- (-1203.851) [-1208.500] (-1204.236) (-1202.091) * (-1208.043) (-1204.327) [-1202.880] (-1204.883) -- 0:00:34
      451500 -- [-1204.967] (-1202.809) (-1203.442) (-1203.102) * (-1210.163) (-1205.223) (-1204.380) [-1203.575] -- 0:00:34
      452000 -- (-1206.292) [-1204.500] (-1202.303) (-1202.566) * (-1207.327) (-1206.066) [-1202.994] (-1202.925) -- 0:00:33
      452500 -- (-1207.067) (-1203.132) [-1205.460] (-1202.936) * [-1205.950] (-1207.724) (-1203.689) (-1201.714) -- 0:00:33
      453000 -- (-1203.550) [-1203.337] (-1202.969) (-1208.078) * (-1202.785) (-1203.544) [-1202.521] (-1201.700) -- 0:00:33
      453500 -- [-1204.671] (-1203.059) (-1203.866) (-1207.813) * (-1202.487) (-1203.730) [-1202.622] (-1201.683) -- 0:00:33
      454000 -- (-1205.510) (-1202.735) [-1203.025] (-1204.038) * (-1205.318) (-1205.822) (-1202.640) [-1202.747] -- 0:00:33
      454500 -- (-1204.366) [-1203.235] (-1202.308) (-1204.478) * [-1203.596] (-1208.429) (-1204.463) (-1203.022) -- 0:00:33
      455000 -- [-1202.539] (-1204.907) (-1206.365) (-1207.776) * [-1203.807] (-1204.340) (-1203.348) (-1202.902) -- 0:00:33

      Average standard deviation of split frequencies: 0.011049

      455500 -- (-1202.723) (-1202.627) (-1208.548) [-1206.357] * (-1203.978) [-1207.979] (-1203.164) (-1207.894) -- 0:00:33
      456000 -- [-1202.716] (-1202.594) (-1209.084) (-1203.442) * (-1203.953) (-1205.799) [-1204.085] (-1207.593) -- 0:00:33
      456500 -- (-1203.012) [-1202.594] (-1202.850) (-1203.558) * [-1204.032] (-1203.550) (-1205.751) (-1203.948) -- 0:00:33
      457000 -- (-1207.208) (-1204.321) [-1204.271] (-1204.130) * (-1203.372) (-1206.411) (-1203.964) [-1204.118] -- 0:00:34
      457500 -- (-1203.834) (-1201.453) (-1203.885) [-1202.030] * (-1206.189) [-1204.334] (-1202.084) (-1203.485) -- 0:00:34
      458000 -- (-1202.403) (-1204.135) (-1205.362) [-1202.973] * (-1204.723) (-1202.340) [-1201.878] (-1205.760) -- 0:00:34
      458500 -- (-1202.593) [-1202.363] (-1204.224) (-1205.899) * (-1204.561) [-1201.623] (-1202.616) (-1206.326) -- 0:00:34
      459000 -- (-1203.492) (-1204.849) (-1202.766) [-1202.989] * (-1201.989) [-1202.982] (-1204.142) (-1203.140) -- 0:00:34
      459500 -- (-1201.805) (-1203.504) [-1203.208] (-1206.068) * (-1204.355) (-1202.264) [-1203.318] (-1202.347) -- 0:00:34
      460000 -- (-1203.313) [-1204.318] (-1205.106) (-1203.238) * (-1209.528) [-1204.248] (-1203.901) (-1204.464) -- 0:00:34

      Average standard deviation of split frequencies: 0.010617

      460500 -- (-1208.425) (-1204.729) (-1208.046) [-1204.159] * [-1204.748] (-1201.640) (-1203.138) (-1203.046) -- 0:00:33
      461000 -- (-1204.083) (-1203.077) (-1202.571) [-1203.101] * (-1202.654) [-1203.105] (-1205.169) (-1202.651) -- 0:00:33
      461500 -- (-1205.457) (-1203.059) [-1204.161] (-1203.849) * (-1202.135) (-1201.961) [-1204.082] (-1202.937) -- 0:00:33
      462000 -- [-1202.946] (-1203.481) (-1206.322) (-1202.488) * (-1202.386) (-1202.539) [-1206.889] (-1201.748) -- 0:00:33
      462500 -- (-1203.070) (-1205.300) (-1206.082) [-1202.252] * (-1202.435) (-1202.634) (-1203.916) [-1202.022] -- 0:00:33
      463000 -- [-1202.955] (-1205.891) (-1203.869) (-1201.442) * (-1202.067) (-1202.556) [-1204.148] (-1202.915) -- 0:00:33
      463500 -- (-1203.158) (-1203.817) (-1204.957) [-1205.029] * (-1201.741) [-1202.979] (-1207.034) (-1206.797) -- 0:00:33
      464000 -- (-1203.798) (-1205.796) [-1202.261] (-1202.148) * (-1210.553) [-1206.255] (-1204.159) (-1204.610) -- 0:00:33
      464500 -- (-1201.935) (-1208.437) (-1205.949) [-1202.333] * (-1206.813) (-1204.486) (-1204.814) [-1210.212] -- 0:00:33
      465000 -- (-1205.232) (-1202.594) (-1205.094) [-1201.947] * (-1203.418) [-1207.596] (-1202.859) (-1205.648) -- 0:00:33

      Average standard deviation of split frequencies: 0.011001

      465500 -- (-1202.266) (-1203.169) (-1211.414) [-1203.690] * (-1209.143) (-1203.079) (-1202.659) [-1201.906] -- 0:00:33