>C1
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C2
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C3
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C4
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C5
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C6
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=293
C1 MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C2 MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C3 MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C4 MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C5 MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C6 MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
**************************************************
C1 TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C2 TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C3 TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C4 TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C5 TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C6 TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
**************************************************
C1 WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C2 WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C3 WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C4 WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C5 WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C6 WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
**************************************************
C1 PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C2 PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C3 PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C4 PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C5 PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C6 PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
**************************************************
C1 TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C2 TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C3 TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C4 TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C5 TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C6 TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
**************************************************
C1 SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C2 SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C3 SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C4 SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C5 SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C6 SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
*******************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 293 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 293 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8790]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8790]--->[8790]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.505 Mb, Max= 30.853 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C2 MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C3 MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C4 MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C5 MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
C6 MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
**************************************************
C1 TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C2 TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C3 TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C4 TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C5 TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
C6 TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
**************************************************
C1 WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C2 WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C3 WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C4 WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C5 WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
C6 WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
**************************************************
C1 PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C2 PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C3 PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C4 PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C5 PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
C6 PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
**************************************************
C1 TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C2 TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C3 TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C4 TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C5 TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
C6 TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
**************************************************
C1 SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C2 SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C3 SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C4 SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C5 SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
C6 SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
*******************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
C2 ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
C3 ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
C4 ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
C5 ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
C6 ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
**************************************************
C1 CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
C2 CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
C3 CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
C4 CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
C5 CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
C6 CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
**************************************************
C1 ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
C2 ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
C3 ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
C4 ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
C5 ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
C6 ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
**************************************************
C1 ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
C2 ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
C3 ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
C4 ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
C5 ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
C6 ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
**************************************************
C1 GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
C2 GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
C3 GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
C4 GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
C5 GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
C6 GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
**************************************************
C1 ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
C2 ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
C3 ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
C4 ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
C5 ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
C6 ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
**************************************************
C1 TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
C2 TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
C3 TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
C4 TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
C5 TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
C6 TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
**************************************************
C1 GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
C2 GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
C3 GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
C4 GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
C5 GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
C6 GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
**************************************************
C1 CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
C2 CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
C3 CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
C4 CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
C5 CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
C6 CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
**************************************************
C1 CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
C2 CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
C3 CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
C4 CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
C5 CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
C6 CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
**************************************************
C1 GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
C2 GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
C3 GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
C4 GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
C5 GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
C6 GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
**************************************************
C1 CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
C2 CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
C3 CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
C4 CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
C5 CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
C6 CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
**************************************************
C1 ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
C2 ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
C3 ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
C4 ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
C5 ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
C6 ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
**************************************************
C1 GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
C2 GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
C3 GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
C4 GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
C5 GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
C6 GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
**************************************************
C1 GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
C2 GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
C3 GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
C4 GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
C5 GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
C6 GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
**************************************************
C1 TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
C2 TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
C3 TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
C4 TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
C5 TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
C6 TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
**************************************************
C1 CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
C2 CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
C3 CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
C4 CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
C5 CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
C6 CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
**************************************************
C1 ATAGCAACGACGCACCGCAAACGAGTTGC
C2 ATAGCAACGACGCACCGCAAACGAGTTGC
C3 ATAGCAACGACGCACCGCAAACGAGTTGC
C4 ATAGCAACGACGCACCGCAAACGAGTTGC
C5 ATAGCAACGACGCACCGCAAACGAGTTGC
C6 ATAGCAACGACGCACCGCAAACGAGTTGC
*****************************
>C1
ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
ATAGCAACGACGCACCGCAAACGAGTTGC
>C2
ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
ATAGCAACGACGCACCGCAAACGAGTTGC
>C3
ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
ATAGCAACGACGCACCGCAAACGAGTTGC
>C4
ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
ATAGCAACGACGCACCGCAAACGAGTTGC
>C5
ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
ATAGCAACGACGCACCGCAAACGAGTTGC
>C6
ATGAGCGGGCCGAATCCCCCGGGACGGGAAAATGAGGAATCCGATTCCGG
CAACGAGCTCAGCGGTGAATTGGATCCCCATAACGGCGTAGAGTCCGTTG
ACGAATTGGTACCCGTACCGGATAGCGATTTAGTAACAGCGAGTGACCAT
ACCAGCGAGACCGAGGTATACTCACAGGCCTACTCGGCTCCTGAGGCCGA
GCATTTCACTGCTGTCCCGTACGTGCCGGCGGATCTCAGGCTCTATGACT
ACGACGAGTCGTCGGTCTACGATGAGCCGGGTGCTGCTCCGCGCTGGCCG
TGGGTGGTTGGCGTTGCTGCCATCTTGGCCGCGATCTCACTGGTGGTTTC
GGTGTCGCTGCTGTTCACGCGTACCGACACCAGCAAACTTTCTACCCCAA
CCACTGGACGGTCCACTCCGCCGGTGCAGGACGAAATCACCACCGTTAAG
CCACCACCACCCAGCACGGAGACTTCGACAGCGACGGAGACGCAGACAGT
GACGGTGACGCCTTTGCCACCACCGTCGGCGACGAGCACCGCAGTGCCAC
CGTCATCGGTGGTACCGCCCCCGCCGACGACGCCTACGACTACGGTCACT
ACGTTGACTGGTCCTCGGCAGGTCACCTATTCGGTGACGGGCACCAAAGC
GCCGGGTGACATCATTTCGGTGACCTACGTTGATGCCTCCGGTCGGCGAC
GGACTCAGCACAACGTCTATATTCCGTGGTCAATGACCGTTACACCGATC
TCGCAATCCGATGTCGGCTCGGTTGAGGCGTTTAGCCTCTTTCGGGTCAG
CAAACTCAACTGCTTGATCACCACAAGTGACGGAACGGTGCTTTCGTCGA
ATAGCAACGACGCACCGCAAACGAGTTGC
>C1
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C2
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C3
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C4
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C5
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
>C6
MSGPNPPGRENEESDSGNELSGELDPHNGVESVDELVPVPDSDLVTASDH
TSETEVYSQAYSAPEAEHFTAVPYVPADLRLYDYDESSVYDEPGAAPRWP
WVVGVAAILAAISLVVSVSLLFTRTDTSKLSTPTTGRSTPPVQDEITTVK
PPPPSTETSTATETQTVTVTPLPPPSATSTAVPPSSVVPPPPTTPTTTVT
TLTGPRQVTYSVTGTKAPGDIISVTYVDASGRRRTQHNVYIPWSMTVTPI
SQSDVGSVEAFSLFRVSKLNCLITTSDGTVLSSNSNDAPQTSC
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 879 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579783075
Setting output file names to "/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1574836353
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9437564983
Seed = 910620000
Swapseed = 1579783075
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1967.244143 -- -24.965149
Chain 2 -- -1967.244143 -- -24.965149
Chain 3 -- -1967.243843 -- -24.965149
Chain 4 -- -1967.244143 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1967.244031 -- -24.965149
Chain 2 -- -1967.244031 -- -24.965149
Chain 3 -- -1967.244031 -- -24.965149
Chain 4 -- -1967.244031 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1967.244] (-1967.244) (-1967.244) (-1967.244) * [-1967.244] (-1967.244) (-1967.244) (-1967.244)
500 -- (-1222.890) (-1231.910) (-1219.449) [-1212.863] * (-1224.483) (-1216.387) [-1214.476] (-1216.527) -- 0:00:00
1000 -- (-1214.942) (-1207.240) (-1208.519) [-1209.904] * (-1210.870) (-1210.870) [-1211.191] (-1213.721) -- 0:00:00
1500 -- (-1218.639) (-1220.072) (-1222.244) [-1207.574] * (-1217.214) (-1210.839) [-1207.300] (-1221.995) -- 0:00:00
2000 -- [-1211.244] (-1213.684) (-1219.241) (-1208.636) * (-1213.487) [-1214.568] (-1217.858) (-1220.556) -- 0:00:00
2500 -- (-1212.810) [-1211.699] (-1222.058) (-1214.132) * (-1221.169) (-1211.879) [-1210.910] (-1219.183) -- 0:00:00
3000 -- (-1209.263) (-1212.741) [-1223.597] (-1213.658) * (-1214.200) [-1210.876] (-1214.611) (-1222.374) -- 0:00:00
3500 -- (-1207.974) (-1212.562) (-1210.934) [-1214.650] * [-1211.880] (-1215.069) (-1212.037) (-1216.131) -- 0:00:00
4000 -- (-1208.959) (-1216.743) [-1208.280] (-1214.281) * [-1212.528] (-1217.901) (-1209.885) (-1214.179) -- 0:00:00
4500 -- (-1211.979) (-1214.649) [-1212.790] (-1224.741) * (-1213.829) [-1211.144] (-1213.933) (-1215.802) -- 0:00:00
5000 -- (-1230.816) [-1212.570] (-1210.758) (-1214.086) * (-1221.055) (-1214.531) (-1216.349) [-1211.385] -- 0:03:19
Average standard deviation of split frequencies: 0.109994
5500 -- [-1207.369] (-1210.686) (-1215.071) (-1213.439) * (-1212.861) [-1214.458] (-1214.564) (-1214.049) -- 0:03:00
6000 -- [-1206.802] (-1213.786) (-1212.834) (-1217.720) * (-1222.433) (-1223.026) (-1218.629) [-1211.604] -- 0:02:45
6500 -- (-1213.669) [-1214.944] (-1221.152) (-1211.130) * (-1204.558) (-1213.475) [-1208.451] (-1209.312) -- 0:02:32
7000 -- [-1209.998] (-1217.082) (-1208.455) (-1213.253) * (-1204.368) (-1212.274) [-1209.429] (-1208.507) -- 0:02:21
7500 -- (-1208.599) [-1215.793] (-1222.081) (-1223.693) * (-1206.597) [-1213.394] (-1213.263) (-1211.379) -- 0:02:12
8000 -- (-1213.377) (-1213.767) [-1212.600] (-1210.218) * (-1209.018) [-1207.352] (-1215.948) (-1226.349) -- 0:02:04
8500 -- [-1208.777] (-1212.929) (-1214.781) (-1212.093) * (-1208.646) [-1210.441] (-1207.954) (-1217.194) -- 0:01:56
9000 -- (-1217.956) (-1220.757) [-1212.771] (-1213.653) * (-1203.104) (-1212.583) (-1215.703) [-1209.275] -- 0:01:50
9500 -- (-1210.271) (-1219.997) (-1216.325) [-1217.141] * (-1203.123) [-1209.921] (-1211.509) (-1213.885) -- 0:01:44
10000 -- [-1211.318] (-1212.439) (-1215.917) (-1211.481) * (-1202.925) (-1216.619) [-1209.886] (-1213.496) -- 0:01:39
Average standard deviation of split frequencies: 0.082362
10500 -- (-1217.522) (-1212.200) (-1219.303) [-1215.520] * (-1202.842) (-1215.596) (-1211.525) [-1213.486] -- 0:01:34
11000 -- (-1207.214) [-1217.434] (-1221.012) (-1213.746) * [-1203.216] (-1212.507) (-1220.352) (-1211.503) -- 0:01:29
11500 -- (-1212.233) [-1212.585] (-1213.791) (-1213.760) * (-1208.529) (-1218.246) [-1213.636] (-1211.128) -- 0:01:25
12000 -- (-1216.756) [-1207.914] (-1220.156) (-1209.801) * (-1201.869) (-1210.612) (-1213.429) [-1212.342] -- 0:01:22
12500 -- [-1210.455] (-1208.846) (-1209.376) (-1212.277) * (-1204.163) [-1209.243] (-1224.291) (-1213.877) -- 0:01:19
13000 -- [-1214.626] (-1212.201) (-1210.841) (-1218.389) * [-1203.083] (-1218.582) (-1211.633) (-1218.779) -- 0:01:15
13500 -- (-1217.554) (-1220.403) [-1211.984] (-1215.462) * (-1205.032) [-1212.602] (-1210.153) (-1214.846) -- 0:01:13
14000 -- (-1214.869) (-1208.910) [-1209.331] (-1219.871) * (-1202.120) (-1214.091) [-1214.390] (-1210.832) -- 0:01:10
14500 -- (-1216.839) (-1212.079) [-1211.093] (-1217.158) * (-1201.964) [-1211.962] (-1214.300) (-1210.990) -- 0:01:07
15000 -- (-1208.450) [-1209.432] (-1217.371) (-1212.608) * [-1202.618] (-1212.214) (-1211.626) (-1213.954) -- 0:01:05
Average standard deviation of split frequencies: 0.068230
15500 -- (-1217.691) (-1215.381) (-1215.306) [-1210.720] * (-1202.118) (-1212.881) (-1214.625) [-1208.739] -- 0:01:03
16000 -- (-1215.677) (-1209.376) (-1210.132) [-1212.233] * (-1203.213) [-1215.937] (-1223.126) (-1225.883) -- 0:01:01
16500 -- (-1209.480) (-1211.823) (-1221.930) [-1218.190] * (-1202.738) (-1214.165) (-1208.126) [-1209.007] -- 0:00:59
17000 -- (-1220.497) (-1211.963) [-1208.662] (-1218.076) * (-1206.937) [-1216.321] (-1218.568) (-1211.830) -- 0:00:57
17500 -- (-1209.867) (-1218.092) [-1212.252] (-1214.591) * (-1202.027) (-1218.523) (-1214.652) [-1214.838] -- 0:00:56
18000 -- [-1210.057] (-1218.984) (-1211.945) (-1213.311) * (-1202.020) [-1215.839] (-1214.309) (-1212.540) -- 0:00:54
18500 -- (-1213.660) (-1215.852) [-1208.708] (-1216.401) * (-1203.469) (-1218.662) (-1215.143) [-1211.627] -- 0:00:53
19000 -- (-1211.252) (-1210.548) [-1213.119] (-1216.404) * [-1202.130] (-1212.464) (-1213.234) (-1213.401) -- 0:00:51
19500 -- (-1209.187) (-1213.674) (-1217.719) [-1215.062] * [-1204.694] (-1212.888) (-1215.663) (-1216.371) -- 0:00:50
20000 -- (-1217.424) (-1214.390) [-1212.636] (-1216.083) * [-1205.652] (-1213.828) (-1212.762) (-1217.142) -- 0:00:49
Average standard deviation of split frequencies: 0.081635
20500 -- [-1211.024] (-1209.637) (-1205.574) (-1214.228) * [-1203.260] (-1210.039) (-1215.019) (-1214.939) -- 0:01:35
21000 -- (-1208.123) [-1205.936] (-1204.619) (-1212.687) * (-1202.774) (-1214.848) [-1212.043] (-1216.015) -- 0:01:33
21500 -- [-1213.317] (-1212.353) (-1204.094) (-1213.499) * (-1204.291) (-1218.331) (-1214.496) [-1211.265] -- 0:01:31
22000 -- (-1219.578) (-1217.972) (-1205.006) [-1209.340] * (-1204.878) (-1211.421) [-1206.763] (-1209.295) -- 0:01:28
22500 -- (-1214.992) (-1215.412) [-1203.299] (-1219.245) * [-1207.863] (-1213.040) (-1219.347) (-1214.528) -- 0:01:26
23000 -- (-1213.213) (-1213.011) [-1204.012] (-1215.038) * (-1210.886) (-1222.346) (-1207.651) [-1209.459] -- 0:01:24
23500 -- [-1210.421] (-1219.124) (-1204.154) (-1212.199) * [-1205.407] (-1212.265) (-1211.001) (-1207.683) -- 0:01:23
24000 -- (-1211.917) [-1209.066] (-1202.889) (-1208.362) * (-1206.412) (-1209.252) (-1215.153) [-1213.293] -- 0:01:21
24500 -- (-1208.455) [-1214.264] (-1203.103) (-1205.381) * (-1206.676) (-1209.650) (-1211.608) [-1211.350] -- 0:01:19
25000 -- [-1218.839] (-1215.566) (-1207.360) (-1203.521) * (-1208.584) (-1213.081) (-1211.277) [-1216.193] -- 0:01:18
Average standard deviation of split frequencies: 0.065931
25500 -- [-1209.110] (-1218.738) (-1205.851) (-1203.388) * (-1204.240) [-1209.594] (-1211.840) (-1219.747) -- 0:01:16
26000 -- (-1210.277) (-1216.176) (-1204.299) [-1204.032] * (-1203.842) (-1211.368) (-1206.603) [-1208.762] -- 0:01:14
26500 -- (-1216.243) [-1206.633] (-1209.317) (-1203.489) * (-1204.974) (-1221.218) (-1214.704) [-1210.066] -- 0:01:13
27000 -- (-1208.249) (-1204.251) (-1205.366) [-1203.587] * (-1206.737) (-1209.137) (-1209.171) [-1216.520] -- 0:01:12
27500 -- (-1209.056) (-1204.376) [-1203.861] (-1204.111) * (-1203.038) [-1210.475] (-1218.362) (-1217.254) -- 0:01:10
28000 -- [-1214.989] (-1210.341) (-1201.657) (-1204.306) * [-1202.890] (-1211.231) (-1214.557) (-1216.073) -- 0:01:09
28500 -- (-1214.658) [-1203.771] (-1204.583) (-1202.422) * (-1202.574) (-1209.567) [-1209.458] (-1214.700) -- 0:01:08
29000 -- (-1217.163) [-1203.365] (-1206.216) (-1203.180) * (-1205.083) (-1214.405) [-1209.515] (-1211.297) -- 0:01:06
29500 -- (-1210.132) (-1203.313) (-1207.044) [-1205.447] * (-1203.195) (-1209.820) [-1212.099] (-1210.328) -- 0:01:05
30000 -- [-1206.686] (-1203.872) (-1208.033) (-1205.187) * (-1207.505) (-1214.206) (-1213.546) [-1212.519] -- 0:01:04
Average standard deviation of split frequencies: 0.041724
30500 -- (-1221.865) (-1203.210) [-1207.338] (-1205.941) * (-1208.438) (-1211.168) [-1210.638] (-1218.253) -- 0:01:03
31000 -- (-1212.683) (-1202.872) [-1206.145] (-1203.477) * (-1204.610) (-1215.165) (-1214.069) [-1211.091] -- 0:01:02
31500 -- (-1216.110) (-1204.473) (-1207.756) [-1203.587] * (-1204.051) (-1206.319) (-1214.293) [-1213.640] -- 0:01:01
32000 -- (-1213.516) [-1205.844] (-1203.615) (-1202.923) * [-1204.080] (-1213.914) (-1209.003) (-1220.463) -- 0:01:00
32500 -- (-1226.083) (-1203.751) [-1202.572] (-1202.851) * (-1204.258) [-1218.973] (-1209.629) (-1215.151) -- 0:00:59
33000 -- (-1204.331) [-1202.801] (-1202.160) (-1202.261) * (-1204.344) (-1205.498) (-1212.463) [-1209.123] -- 0:00:58
33500 -- (-1202.197) (-1210.084) [-1203.569] (-1202.620) * [-1203.421] (-1203.978) (-1214.775) (-1210.296) -- 0:00:57
34000 -- (-1203.399) (-1210.550) [-1202.065] (-1202.057) * (-1204.116) (-1206.013) [-1208.712] (-1215.699) -- 0:00:56
34500 -- (-1203.158) (-1206.684) [-1202.059] (-1201.690) * (-1204.395) (-1202.909) (-1216.348) [-1211.101] -- 0:00:55
35000 -- (-1205.921) [-1203.188] (-1207.736) (-1203.470) * (-1202.189) [-1202.815] (-1210.928) (-1216.313) -- 0:00:55
Average standard deviation of split frequencies: 0.038037
35500 -- (-1204.070) (-1202.399) (-1206.359) [-1202.764] * (-1203.503) (-1202.231) (-1210.678) [-1211.266] -- 0:00:54
36000 -- (-1203.046) (-1202.501) (-1202.159) [-1202.685] * (-1205.386) (-1208.596) (-1211.730) [-1209.376] -- 0:01:20
36500 -- (-1201.974) (-1205.042) (-1202.803) [-1202.663] * (-1202.006) [-1207.997] (-1209.890) (-1212.424) -- 0:01:19
37000 -- (-1202.121) [-1203.594] (-1204.598) (-1202.926) * [-1202.590] (-1205.278) (-1208.139) (-1214.222) -- 0:01:18
37500 -- [-1201.882] (-1207.290) (-1207.133) (-1204.967) * (-1203.565) [-1202.772] (-1221.961) (-1211.554) -- 0:01:17
38000 -- [-1202.777] (-1205.635) (-1203.709) (-1206.062) * (-1201.869) (-1202.772) [-1218.773] (-1210.614) -- 0:01:15
38500 -- (-1202.843) (-1203.410) (-1203.063) [-1204.313] * [-1203.277] (-1202.772) (-1214.377) (-1216.682) -- 0:01:14
39000 -- (-1202.497) (-1204.676) [-1201.772] (-1206.139) * (-1202.633) [-1204.740] (-1212.443) (-1214.940) -- 0:01:13
39500 -- (-1203.651) (-1204.080) (-1202.838) [-1204.879] * (-1202.090) (-1204.302) [-1212.580] (-1215.301) -- 0:01:12
40000 -- (-1201.991) (-1203.986) (-1202.716) [-1205.672] * [-1202.395] (-1206.190) (-1209.449) (-1218.979) -- 0:01:12
Average standard deviation of split frequencies: 0.045758
40500 -- [-1202.105] (-1204.345) (-1202.853) (-1206.509) * [-1201.691] (-1203.520) (-1211.722) (-1207.475) -- 0:01:11
41000 -- (-1202.374) (-1203.877) (-1203.084) [-1206.400] * (-1202.081) (-1203.471) (-1210.745) [-1214.925] -- 0:01:10
41500 -- (-1205.339) [-1202.536] (-1203.694) (-1205.088) * (-1202.727) (-1202.961) (-1208.806) [-1211.544] -- 0:01:09
42000 -- (-1205.411) [-1202.911] (-1204.101) (-1204.299) * (-1202.522) (-1201.896) [-1211.364] (-1212.486) -- 0:01:08
42500 -- (-1203.444) (-1202.962) [-1205.161] (-1205.635) * [-1201.786] (-1202.533) (-1209.226) (-1215.259) -- 0:01:07
43000 -- (-1205.099) (-1203.128) [-1206.638] (-1204.581) * (-1202.933) (-1206.661) (-1213.542) [-1208.004] -- 0:01:06
43500 -- (-1207.729) (-1208.554) (-1201.587) [-1204.845] * (-1203.798) [-1204.798] (-1218.040) (-1211.741) -- 0:01:05
44000 -- (-1207.971) (-1208.453) [-1203.707] (-1208.015) * (-1204.364) [-1201.845] (-1226.316) (-1220.269) -- 0:01:05
44500 -- (-1207.182) [-1203.168] (-1205.163) (-1209.956) * (-1203.331) (-1204.604) (-1206.610) [-1212.252] -- 0:01:04
45000 -- [-1206.737] (-1201.995) (-1203.178) (-1211.969) * [-1203.614] (-1207.560) (-1215.249) (-1214.182) -- 0:01:03
Average standard deviation of split frequencies: 0.036893
45500 -- (-1205.526) (-1202.463) (-1204.245) [-1203.259] * (-1203.018) (-1206.199) [-1214.140] (-1211.235) -- 0:01:02
46000 -- (-1202.705) (-1203.153) [-1206.377] (-1202.281) * (-1203.767) [-1205.313] (-1209.690) (-1213.754) -- 0:01:02
46500 -- (-1202.541) (-1206.238) (-1204.127) [-1202.594] * (-1211.312) (-1203.360) [-1210.503] (-1206.236) -- 0:01:01
47000 -- (-1202.448) [-1204.569] (-1204.055) (-1202.275) * (-1208.655) (-1202.984) [-1213.248] (-1212.502) -- 0:01:00
47500 -- [-1202.049] (-1204.379) (-1205.956) (-1201.763) * (-1211.145) (-1207.175) (-1213.119) [-1211.120] -- 0:01:00
48000 -- (-1202.485) (-1205.801) (-1208.052) [-1201.469] * (-1208.617) (-1208.540) [-1209.652] (-1208.842) -- 0:00:59
48500 -- (-1205.674) (-1209.795) (-1206.299) [-1203.286] * [-1206.049] (-1205.553) (-1216.597) (-1214.330) -- 0:00:58
49000 -- [-1203.167] (-1207.717) (-1206.905) (-1206.076) * (-1203.509) [-1204.144] (-1219.359) (-1216.628) -- 0:00:58
49500 -- (-1204.844) [-1205.804] (-1205.017) (-1204.669) * (-1203.775) [-1203.970] (-1213.791) (-1209.248) -- 0:00:57
50000 -- (-1203.085) (-1202.848) (-1203.819) [-1203.626] * (-1207.390) [-1202.795] (-1212.147) (-1215.263) -- 0:00:57
Average standard deviation of split frequencies: 0.032343
50500 -- [-1204.317] (-1202.149) (-1203.771) (-1208.199) * (-1204.967) [-1207.312] (-1230.180) (-1213.389) -- 0:00:56
51000 -- (-1204.587) [-1203.400] (-1202.590) (-1205.521) * (-1205.784) (-1208.663) [-1205.561] (-1219.120) -- 0:00:55
51500 -- (-1204.321) (-1206.719) [-1202.437] (-1206.770) * (-1205.514) (-1207.037) [-1202.864] (-1217.515) -- 0:00:55
52000 -- (-1204.586) [-1205.246] (-1203.676) (-1202.864) * (-1207.804) [-1209.500] (-1203.827) (-1209.286) -- 0:01:12
52500 -- (-1202.236) (-1205.660) [-1202.792] (-1205.275) * (-1206.292) (-1205.280) (-1203.748) [-1208.548] -- 0:01:12
53000 -- (-1202.008) [-1203.839] (-1205.447) (-1204.663) * [-1203.914] (-1204.663) (-1202.093) (-1213.014) -- 0:01:11
53500 -- (-1203.739) (-1202.885) (-1205.197) [-1204.256] * (-1204.739) [-1203.339] (-1203.133) (-1217.448) -- 0:01:10
54000 -- (-1205.414) (-1208.672) (-1204.095) [-1202.305] * (-1204.603) (-1203.986) [-1202.186] (-1215.821) -- 0:01:10
54500 -- (-1205.460) (-1209.438) [-1205.654] (-1205.915) * (-1203.719) (-1203.538) (-1204.291) [-1211.105] -- 0:01:09
55000 -- (-1203.545) (-1205.548) (-1206.598) [-1202.805] * (-1203.924) (-1204.303) (-1205.940) [-1211.544] -- 0:01:08
Average standard deviation of split frequencies: 0.031988
55500 -- (-1206.084) [-1204.536] (-1205.067) (-1203.959) * (-1203.236) (-1204.224) (-1202.439) [-1210.944] -- 0:01:08
56000 -- (-1204.916) (-1203.432) [-1205.380] (-1203.957) * (-1203.875) [-1204.827] (-1202.528) (-1212.316) -- 0:01:07
56500 -- (-1205.255) (-1202.106) (-1205.500) [-1205.028] * [-1203.795] (-1205.401) (-1204.070) (-1217.929) -- 0:01:06
57000 -- (-1204.554) (-1202.936) [-1210.261] (-1204.981) * [-1203.768] (-1209.257) (-1204.851) (-1209.574) -- 0:01:06
57500 -- (-1204.799) (-1203.497) (-1209.493) [-1205.470] * (-1206.582) (-1202.876) [-1202.731] (-1211.157) -- 0:01:05
58000 -- [-1205.095] (-1202.678) (-1213.718) (-1201.786) * (-1205.870) [-1203.763] (-1204.631) (-1217.035) -- 0:01:04
58500 -- (-1203.621) (-1202.553) (-1207.206) [-1203.268] * (-1204.570) [-1203.214] (-1203.628) (-1207.761) -- 0:01:04
59000 -- [-1203.037] (-1201.990) (-1203.391) (-1203.815) * (-1203.774) (-1204.628) [-1205.525] (-1215.953) -- 0:01:03
59500 -- (-1203.038) (-1203.471) (-1203.595) [-1202.225] * (-1203.701) (-1202.585) (-1203.164) [-1209.552] -- 0:01:03
60000 -- (-1203.277) (-1204.865) [-1203.130] (-1202.717) * (-1204.086) (-1204.239) [-1204.522] (-1209.523) -- 0:01:02
Average standard deviation of split frequencies: 0.036694
60500 -- (-1202.799) [-1205.507] (-1203.123) (-1206.789) * (-1207.824) (-1203.281) (-1202.637) [-1214.791] -- 0:01:02
61000 -- [-1204.133] (-1203.075) (-1204.663) (-1206.021) * (-1210.345) [-1203.992] (-1204.432) (-1211.851) -- 0:01:01
61500 -- (-1202.947) (-1203.452) [-1205.807] (-1206.377) * (-1205.993) (-1204.298) [-1204.084] (-1210.818) -- 0:01:01
62000 -- [-1202.917] (-1207.528) (-1204.722) (-1206.085) * (-1203.363) (-1202.026) (-1202.030) [-1210.077] -- 0:01:00
62500 -- (-1206.969) [-1206.116] (-1205.006) (-1207.196) * (-1205.737) [-1201.705] (-1204.059) (-1218.411) -- 0:01:00
63000 -- (-1202.421) (-1203.753) (-1205.544) [-1204.462] * (-1207.904) (-1203.593) [-1202.574] (-1217.041) -- 0:00:59
63500 -- [-1203.745] (-1204.025) (-1204.108) (-1204.339) * (-1203.292) (-1205.375) (-1202.368) [-1210.181] -- 0:00:58
64000 -- (-1205.107) (-1205.322) [-1203.805] (-1205.635) * [-1202.680] (-1205.261) (-1203.621) (-1207.289) -- 0:00:58
64500 -- (-1205.434) (-1202.984) [-1203.945] (-1204.857) * (-1204.052) (-1202.569) [-1208.369] (-1210.355) -- 0:00:58
65000 -- [-1205.151] (-1202.487) (-1204.217) (-1204.240) * (-1204.186) (-1203.106) [-1202.873] (-1207.669) -- 0:00:57
Average standard deviation of split frequencies: 0.034284
65500 -- (-1204.775) (-1204.010) [-1202.950] (-1203.956) * [-1203.808] (-1201.610) (-1202.976) (-1215.807) -- 0:00:57
66000 -- [-1203.585] (-1206.129) (-1206.379) (-1203.463) * [-1204.890] (-1201.504) (-1205.815) (-1222.077) -- 0:00:56
66500 -- (-1204.991) (-1202.752) (-1207.917) [-1206.844] * [-1203.098] (-1202.103) (-1207.317) (-1210.426) -- 0:00:56
67000 -- (-1205.234) (-1204.138) (-1202.842) [-1204.591] * (-1203.207) [-1201.694] (-1209.224) (-1214.686) -- 0:00:55
67500 -- (-1202.925) (-1203.546) [-1204.026] (-1206.210) * [-1206.807] (-1202.780) (-1205.704) (-1212.000) -- 0:01:09
68000 -- [-1206.941] (-1203.404) (-1202.628) (-1207.565) * (-1205.031) [-1203.002] (-1203.699) (-1210.635) -- 0:01:08
68500 -- [-1205.619] (-1204.091) (-1203.353) (-1205.971) * (-1208.241) [-1204.579] (-1203.282) (-1218.323) -- 0:01:07
69000 -- (-1203.089) (-1205.192) [-1204.864] (-1208.234) * (-1203.178) [-1202.663] (-1205.702) (-1213.535) -- 0:01:07
69500 -- [-1205.106] (-1201.908) (-1202.885) (-1204.352) * (-1202.888) [-1204.432] (-1203.736) (-1218.980) -- 0:01:06
70000 -- [-1203.120] (-1205.179) (-1203.066) (-1203.933) * (-1201.950) [-1202.061] (-1206.048) (-1220.172) -- 0:01:06
Average standard deviation of split frequencies: 0.027954
70500 -- (-1203.411) [-1205.614] (-1204.180) (-1203.500) * (-1204.470) (-1202.367) (-1202.768) [-1213.799] -- 0:01:05
71000 -- (-1203.476) (-1205.838) [-1205.641] (-1211.411) * (-1203.776) (-1202.552) [-1203.156] (-1214.626) -- 0:01:05
71500 -- (-1203.197) (-1203.204) [-1204.714] (-1204.205) * (-1205.351) [-1202.703] (-1203.346) (-1219.882) -- 0:01:04
72000 -- [-1206.287] (-1203.653) (-1205.603) (-1204.693) * [-1203.958] (-1205.385) (-1203.650) (-1220.807) -- 0:01:04
72500 -- (-1211.660) (-1204.879) [-1202.941] (-1210.998) * (-1203.748) (-1204.204) (-1203.791) [-1216.852] -- 0:01:03
73000 -- (-1202.777) (-1203.591) (-1202.966) [-1202.509] * (-1203.282) (-1204.882) (-1204.559) [-1210.226] -- 0:01:03
73500 -- (-1201.958) (-1203.226) (-1202.683) [-1202.908] * [-1206.488] (-1207.162) (-1202.780) (-1207.493) -- 0:01:03
74000 -- [-1203.926] (-1204.393) (-1202.959) (-1202.881) * (-1203.772) (-1207.485) (-1201.833) [-1207.525] -- 0:01:02
74500 -- (-1205.141) (-1205.826) [-1202.403] (-1201.736) * (-1203.502) (-1203.465) (-1207.736) [-1208.603] -- 0:01:02
75000 -- (-1201.766) (-1205.492) [-1202.395] (-1202.391) * (-1203.620) (-1205.421) [-1203.186] (-1207.904) -- 0:01:01
Average standard deviation of split frequencies: 0.030450
75500 -- (-1203.511) (-1203.431) [-1202.359] (-1202.713) * [-1203.232] (-1203.366) (-1202.030) (-1209.622) -- 0:01:01
76000 -- (-1203.449) [-1203.107] (-1203.527) (-1204.271) * [-1204.075] (-1204.562) (-1202.095) (-1211.946) -- 0:01:00
76500 -- (-1203.458) (-1202.577) [-1203.991] (-1202.972) * (-1205.938) [-1203.941] (-1201.900) (-1214.004) -- 0:01:00
77000 -- (-1204.299) (-1202.826) (-1207.811) [-1202.224] * (-1205.515) (-1203.316) [-1203.372] (-1216.250) -- 0:00:59
77500 -- [-1203.541] (-1204.432) (-1203.913) (-1202.074) * [-1205.971] (-1204.321) (-1203.689) (-1218.091) -- 0:00:59
78000 -- [-1205.108] (-1202.803) (-1205.975) (-1203.283) * (-1203.106) (-1202.847) [-1201.788] (-1218.451) -- 0:00:59
78500 -- (-1206.035) (-1206.516) (-1204.283) [-1203.339] * (-1203.759) (-1204.191) [-1201.788] (-1211.201) -- 0:00:58
79000 -- [-1204.739] (-1202.073) (-1204.420) (-1204.725) * (-1204.700) [-1206.879] (-1203.804) (-1208.657) -- 0:00:58
79500 -- [-1205.726] (-1202.571) (-1205.820) (-1203.479) * (-1210.598) [-1205.051] (-1205.160) (-1212.203) -- 0:00:57
80000 -- (-1203.959) (-1204.079) [-1201.769] (-1203.380) * (-1203.674) (-1202.818) [-1202.221] (-1220.359) -- 0:00:57
Average standard deviation of split frequencies: 0.033602
80500 -- [-1203.111] (-1205.197) (-1202.583) (-1202.692) * (-1205.469) (-1204.495) (-1202.152) [-1212.366] -- 0:00:57
81000 -- (-1202.985) (-1203.975) [-1209.790] (-1202.171) * (-1204.419) (-1204.944) (-1202.135) [-1210.931] -- 0:00:56
81500 -- (-1204.863) (-1203.739) (-1207.681) [-1202.766] * (-1204.315) (-1204.814) [-1201.958] (-1211.211) -- 0:00:56
82000 -- (-1205.787) (-1202.509) (-1206.047) [-1202.572] * (-1202.574) (-1202.537) [-1202.047] (-1213.168) -- 0:00:55
82500 -- (-1205.572) [-1204.254] (-1201.742) (-1204.514) * (-1202.520) (-1203.902) [-1202.967] (-1211.725) -- 0:00:55
83000 -- (-1205.665) [-1202.621] (-1201.896) (-1203.121) * (-1202.303) [-1201.770] (-1208.095) (-1212.829) -- 0:00:55
83500 -- [-1206.139] (-1204.642) (-1202.709) (-1203.349) * (-1202.310) [-1204.601] (-1204.635) (-1212.845) -- 0:00:54
84000 -- (-1210.099) (-1203.022) [-1201.739] (-1203.188) * (-1202.573) (-1203.059) (-1202.701) [-1217.987] -- 0:01:05
84500 -- [-1205.486] (-1204.002) (-1203.075) (-1206.848) * (-1202.641) (-1206.275) (-1203.398) [-1224.866] -- 0:01:05
85000 -- (-1208.034) [-1203.159] (-1203.658) (-1207.329) * (-1204.669) (-1202.414) (-1203.173) [-1208.373] -- 0:01:04
Average standard deviation of split frequencies: 0.030397
85500 -- [-1205.002] (-1202.808) (-1204.294) (-1204.407) * (-1203.207) [-1203.975] (-1202.508) (-1208.937) -- 0:01:04
86000 -- (-1209.349) [-1203.618] (-1204.360) (-1203.063) * (-1202.514) [-1203.567] (-1205.399) (-1213.669) -- 0:01:03
86500 -- (-1208.028) (-1204.447) (-1203.341) [-1202.954] * (-1203.412) [-1202.564] (-1209.093) (-1215.055) -- 0:01:03
87000 -- (-1204.730) (-1204.644) [-1204.855] (-1206.998) * (-1202.890) (-1204.682) [-1204.193] (-1210.718) -- 0:01:02
87500 -- (-1204.790) [-1204.367] (-1205.981) (-1204.739) * [-1204.023] (-1204.980) (-1202.652) (-1212.275) -- 0:01:02
88000 -- (-1203.963) (-1203.752) (-1205.622) [-1205.138] * (-1203.085) (-1203.642) (-1203.161) [-1206.666] -- 0:01:02
88500 -- (-1203.663) (-1204.548) (-1203.707) [-1207.981] * (-1203.892) [-1203.055] (-1202.984) (-1211.969) -- 0:01:01
89000 -- [-1204.058] (-1203.935) (-1204.094) (-1208.545) * (-1206.328) [-1202.932] (-1202.217) (-1221.743) -- 0:01:01
89500 -- (-1204.365) (-1204.637) [-1204.691] (-1203.629) * (-1203.884) (-1203.114) (-1207.600) [-1207.576] -- 0:01:01
90000 -- (-1206.164) (-1205.665) [-1203.652] (-1202.893) * (-1203.330) [-1204.215] (-1203.133) (-1215.185) -- 0:01:00
Average standard deviation of split frequencies: 0.031443
90500 -- (-1206.070) [-1207.783] (-1203.887) (-1203.322) * [-1202.268] (-1202.171) (-1202.026) (-1213.307) -- 0:01:00
91000 -- [-1203.282] (-1203.672) (-1204.117) (-1203.281) * (-1202.694) (-1203.845) (-1207.883) [-1210.831] -- 0:00:59
91500 -- [-1204.703] (-1202.324) (-1204.693) (-1203.341) * (-1202.188) (-1204.675) [-1204.357] (-1220.895) -- 0:00:59
92000 -- (-1209.977) (-1203.065) [-1207.974] (-1205.060) * (-1204.892) (-1204.646) (-1202.384) [-1213.816] -- 0:00:59
92500 -- (-1204.789) [-1205.152] (-1206.179) (-1204.419) * (-1203.628) [-1202.748] (-1202.980) (-1216.189) -- 0:00:58
93000 -- [-1204.124] (-1206.280) (-1203.872) (-1202.068) * (-1203.792) (-1202.423) (-1203.111) [-1211.166] -- 0:00:58
93500 -- (-1204.516) (-1204.945) (-1203.042) [-1203.003] * (-1202.854) (-1205.727) (-1202.603) [-1215.551] -- 0:00:58
94000 -- (-1205.644) (-1203.972) (-1202.990) [-1202.576] * (-1204.049) (-1204.031) (-1202.709) [-1210.721] -- 0:00:57
94500 -- [-1205.259] (-1207.263) (-1206.013) (-1203.765) * (-1204.140) (-1207.380) [-1202.776] (-1217.708) -- 0:00:57
95000 -- [-1206.762] (-1204.446) (-1203.551) (-1204.530) * (-1204.888) (-1204.859) (-1203.220) [-1209.787] -- 0:00:57
Average standard deviation of split frequencies: 0.032655
95500 -- (-1201.977) [-1204.861] (-1204.253) (-1205.916) * (-1204.321) [-1207.635] (-1203.775) (-1211.407) -- 0:00:56
96000 -- [-1204.253] (-1202.860) (-1204.224) (-1208.789) * (-1207.933) [-1202.170] (-1205.159) (-1213.256) -- 0:00:56
96500 -- [-1203.433] (-1203.688) (-1203.072) (-1202.336) * (-1208.042) [-1204.384] (-1205.810) (-1211.803) -- 0:00:56
97000 -- (-1204.300) [-1204.116] (-1210.199) (-1205.614) * (-1207.105) (-1202.975) (-1202.033) [-1212.088] -- 0:00:55
97500 -- (-1202.745) [-1204.787] (-1203.031) (-1203.086) * (-1205.660) (-1202.999) [-1201.979] (-1215.843) -- 0:00:55
98000 -- [-1203.249] (-1204.968) (-1204.601) (-1203.559) * (-1203.346) (-1202.894) [-1201.918] (-1216.044) -- 0:00:55
98500 -- (-1202.839) (-1204.476) [-1203.339] (-1205.266) * (-1204.875) (-1202.076) (-1203.174) [-1209.732] -- 0:00:54
99000 -- [-1203.211] (-1203.325) (-1203.384) (-1209.794) * (-1205.688) (-1203.850) [-1203.691] (-1212.529) -- 0:00:54
99500 -- (-1203.090) (-1204.618) [-1202.775] (-1207.580) * [-1203.586] (-1203.734) (-1206.532) (-1214.030) -- 0:00:54
100000 -- (-1204.442) [-1203.586] (-1203.694) (-1202.982) * (-1203.418) [-1201.865] (-1204.022) (-1212.382) -- 0:01:02
Average standard deviation of split frequencies: 0.032780
100500 -- (-1205.489) [-1202.061] (-1206.161) (-1204.377) * (-1204.361) (-1204.727) (-1208.410) [-1214.386] -- 0:01:02
101000 -- (-1204.573) (-1206.068) [-1201.966] (-1202.082) * [-1204.022] (-1203.379) (-1205.806) (-1221.064) -- 0:01:02
101500 -- (-1204.891) (-1205.766) (-1202.170) [-1202.015] * (-1203.082) (-1203.539) [-1207.213] (-1214.011) -- 0:01:01
102000 -- (-1205.676) (-1202.206) (-1204.211) [-1202.848] * (-1205.183) [-1202.353] (-1202.045) (-1209.427) -- 0:01:01
102500 -- (-1206.114) [-1202.902] (-1204.784) (-1202.953) * (-1204.270) [-1202.642] (-1202.105) (-1212.503) -- 0:01:01
103000 -- [-1211.571] (-1203.105) (-1204.578) (-1203.111) * (-1205.855) [-1202.438] (-1206.284) (-1214.541) -- 0:01:00
103500 -- [-1204.864] (-1202.911) (-1207.427) (-1203.471) * (-1204.607) (-1203.014) [-1202.294] (-1214.323) -- 0:01:00
104000 -- [-1206.650] (-1202.286) (-1206.982) (-1202.430) * (-1203.856) [-1204.018] (-1204.025) (-1210.570) -- 0:01:00
104500 -- [-1206.445] (-1202.483) (-1205.323) (-1204.636) * [-1203.755] (-1201.770) (-1204.860) (-1213.214) -- 0:00:59
105000 -- [-1203.981] (-1203.224) (-1202.509) (-1202.571) * (-1204.888) (-1201.632) (-1205.958) [-1217.080] -- 0:00:59
Average standard deviation of split frequencies: 0.029129
105500 -- [-1204.482] (-1214.030) (-1202.892) (-1202.739) * (-1204.118) [-1202.776] (-1206.543) (-1211.686) -- 0:00:59
106000 -- [-1205.534] (-1208.024) (-1205.628) (-1207.442) * (-1202.733) [-1202.137] (-1208.412) (-1209.555) -- 0:00:59
106500 -- [-1203.559] (-1204.634) (-1202.552) (-1203.534) * (-1207.751) (-1203.254) (-1204.389) [-1210.304] -- 0:00:58
107000 -- (-1204.626) (-1205.000) [-1207.070] (-1205.737) * (-1210.901) [-1202.356] (-1203.753) (-1214.397) -- 0:00:58
107500 -- [-1202.884] (-1206.548) (-1206.616) (-1206.235) * (-1202.776) (-1206.097) (-1204.490) [-1216.812] -- 0:00:58
108000 -- [-1205.110] (-1204.263) (-1206.216) (-1204.078) * (-1205.030) (-1204.136) [-1203.308] (-1212.986) -- 0:00:57
108500 -- [-1203.915] (-1202.947) (-1203.683) (-1202.587) * [-1203.467] (-1204.376) (-1204.420) (-1217.393) -- 0:00:57
109000 -- (-1203.717) [-1203.695] (-1204.169) (-1204.641) * (-1202.547) (-1206.519) (-1208.388) [-1214.923] -- 0:00:57
109500 -- (-1203.265) [-1202.753] (-1205.352) (-1204.117) * [-1203.967] (-1203.476) (-1207.995) (-1214.972) -- 0:00:56
110000 -- [-1203.221] (-1203.929) (-1206.100) (-1201.947) * (-1203.853) (-1204.876) (-1204.900) [-1213.634] -- 0:00:56
Average standard deviation of split frequencies: 0.028804
110500 -- (-1203.384) [-1203.007] (-1203.530) (-1202.302) * (-1206.098) (-1206.796) (-1203.135) [-1214.255] -- 0:00:56
111000 -- (-1204.555) [-1202.023] (-1208.730) (-1202.055) * (-1204.998) [-1202.342] (-1202.773) (-1214.152) -- 0:00:56
111500 -- (-1204.396) [-1202.859] (-1205.661) (-1205.162) * (-1202.084) (-1205.682) [-1204.032] (-1211.401) -- 0:00:55
112000 -- (-1203.877) (-1208.153) (-1204.728) [-1202.668] * (-1202.100) [-1202.727] (-1205.815) (-1221.612) -- 0:00:55
112500 -- (-1207.410) [-1205.312] (-1203.381) (-1203.440) * (-1207.716) [-1203.306] (-1206.396) (-1212.487) -- 0:00:55
113000 -- (-1207.686) [-1203.235] (-1204.625) (-1203.221) * [-1202.956] (-1202.491) (-1207.472) (-1213.387) -- 0:00:54
113500 -- [-1202.665] (-1202.026) (-1205.583) (-1204.076) * [-1204.996] (-1203.252) (-1203.621) (-1213.753) -- 0:00:54
114000 -- (-1203.272) (-1202.028) (-1207.316) [-1202.960] * [-1202.689] (-1201.928) (-1204.867) (-1222.131) -- 0:00:54
114500 -- (-1202.727) [-1202.057] (-1204.475) (-1206.434) * (-1205.556) (-1203.065) [-1202.472] (-1217.413) -- 0:00:54
115000 -- (-1203.701) [-1202.438] (-1202.544) (-1203.789) * (-1207.847) (-1204.372) [-1202.397] (-1210.541) -- 0:00:53
Average standard deviation of split frequencies: 0.029666
115500 -- (-1205.339) (-1202.402) (-1205.610) [-1202.872] * [-1204.372] (-1204.288) (-1202.394) (-1218.179) -- 0:00:53
116000 -- (-1201.847) (-1202.123) (-1206.968) [-1203.403] * (-1204.106) [-1206.351] (-1203.551) (-1216.162) -- 0:01:00
116500 -- [-1204.706] (-1202.186) (-1204.952) (-1203.322) * (-1204.863) (-1203.275) [-1204.205] (-1222.019) -- 0:01:00
117000 -- [-1201.616] (-1202.196) (-1202.456) (-1203.221) * [-1203.193] (-1202.831) (-1201.861) (-1215.929) -- 0:01:00
117500 -- [-1203.049] (-1202.412) (-1207.315) (-1206.539) * (-1205.997) (-1205.805) (-1201.872) [-1212.760] -- 0:01:00
118000 -- (-1203.096) (-1203.841) [-1207.968] (-1204.986) * (-1210.525) (-1203.379) (-1201.606) [-1214.245] -- 0:00:59
118500 -- (-1202.432) (-1201.888) [-1206.290] (-1206.696) * (-1202.965) [-1202.835] (-1201.805) (-1213.351) -- 0:00:59
119000 -- (-1201.998) (-1202.771) (-1210.167) [-1208.550] * [-1203.502] (-1205.201) (-1202.133) (-1211.971) -- 0:00:59
119500 -- (-1203.887) (-1202.313) (-1212.365) [-1206.112] * (-1202.644) (-1204.728) (-1202.621) [-1208.025] -- 0:00:58
120000 -- (-1204.143) [-1204.789] (-1205.060) (-1202.778) * (-1203.724) (-1206.340) (-1202.432) [-1210.321] -- 0:00:58
Average standard deviation of split frequencies: 0.027905
120500 -- [-1205.693] (-1205.567) (-1210.524) (-1204.627) * (-1203.188) (-1202.539) (-1204.540) [-1209.099] -- 0:00:58
121000 -- (-1205.818) (-1203.620) (-1207.712) [-1202.662] * (-1204.039) (-1204.007) (-1204.479) [-1210.940] -- 0:00:58
121500 -- (-1208.500) (-1202.616) (-1204.193) [-1203.130] * (-1202.732) (-1206.316) [-1204.234] (-1212.315) -- 0:00:57
122000 -- [-1203.245] (-1204.365) (-1204.380) (-1203.623) * (-1203.140) (-1205.946) (-1201.863) [-1214.025] -- 0:00:57
122500 -- (-1208.215) [-1205.536] (-1202.572) (-1203.809) * [-1203.103] (-1202.357) (-1202.017) (-1211.220) -- 0:00:57
123000 -- [-1206.907] (-1204.045) (-1204.890) (-1203.239) * (-1202.201) [-1203.868] (-1203.310) (-1220.963) -- 0:00:57
123500 -- (-1207.816) [-1205.181] (-1203.776) (-1202.848) * (-1202.848) (-1203.841) (-1205.931) [-1218.769] -- 0:00:56
124000 -- (-1206.250) [-1207.182] (-1214.162) (-1202.815) * (-1203.629) (-1206.591) (-1204.427) [-1202.486] -- 0:00:56
124500 -- (-1206.839) [-1204.875] (-1206.818) (-1202.635) * (-1203.986) (-1204.234) [-1204.923] (-1208.704) -- 0:00:56
125000 -- (-1204.176) (-1204.169) [-1202.784] (-1204.553) * (-1205.283) (-1205.854) [-1204.884] (-1202.389) -- 0:00:56
Average standard deviation of split frequencies: 0.023944
125500 -- (-1211.744) (-1208.188) [-1201.983] (-1205.068) * [-1202.983] (-1202.227) (-1204.667) (-1201.870) -- 0:00:55
126000 -- (-1202.410) (-1206.864) [-1202.255] (-1203.932) * (-1203.594) [-1205.161] (-1204.923) (-1201.875) -- 0:00:55
126500 -- [-1202.956] (-1205.792) (-1205.276) (-1204.214) * (-1205.206) (-1202.372) (-1209.039) [-1201.950] -- 0:00:55
127000 -- [-1204.405] (-1203.292) (-1205.775) (-1203.484) * (-1205.881) (-1202.647) [-1204.419] (-1204.595) -- 0:00:54
127500 -- [-1203.547] (-1203.835) (-1203.816) (-1204.578) * (-1204.337) (-1202.907) [-1203.404] (-1203.357) -- 0:00:54
128000 -- (-1202.543) (-1204.864) (-1204.775) [-1203.523] * (-1205.698) (-1203.145) (-1205.371) [-1203.074] -- 0:00:54
128500 -- (-1203.476) (-1204.652) [-1204.784] (-1202.667) * (-1204.325) (-1203.208) (-1207.226) [-1202.618] -- 0:00:54
129000 -- [-1203.718] (-1205.441) (-1207.170) (-1208.686) * [-1205.422] (-1202.754) (-1207.404) (-1204.114) -- 0:00:54
129500 -- [-1202.842] (-1202.978) (-1208.996) (-1207.342) * (-1203.114) (-1206.030) (-1205.351) [-1206.483] -- 0:00:53
130000 -- (-1203.699) [-1203.485] (-1206.420) (-1205.267) * (-1204.137) (-1204.009) (-1205.196) [-1202.499] -- 0:00:53
Average standard deviation of split frequencies: 0.023811
130500 -- [-1202.700] (-1204.810) (-1203.710) (-1205.811) * (-1203.225) (-1202.863) (-1204.147) [-1205.735] -- 0:00:53
131000 -- (-1206.167) [-1204.028] (-1203.511) (-1203.748) * [-1203.171] (-1203.963) (-1203.364) (-1208.338) -- 0:00:53
131500 -- [-1206.901] (-1204.079) (-1205.170) (-1206.498) * (-1204.394) (-1205.372) [-1204.960] (-1213.930) -- 0:00:52
132000 -- (-1203.096) (-1206.284) [-1204.796] (-1208.054) * (-1203.792) (-1202.693) [-1202.902] (-1205.473) -- 0:00:52
132500 -- (-1204.803) (-1205.746) [-1203.422] (-1207.362) * (-1203.691) [-1202.403] (-1204.422) (-1205.337) -- 0:00:58
133000 -- (-1204.096) (-1204.434) [-1205.092] (-1205.271) * (-1202.613) (-1202.286) (-1203.527) [-1206.082] -- 0:00:58
133500 -- (-1204.957) (-1206.416) (-1205.892) [-1204.806] * (-1204.062) (-1202.125) (-1203.632) [-1205.981] -- 0:00:58
134000 -- (-1205.528) (-1204.858) (-1204.296) [-1205.288] * (-1204.952) [-1204.657] (-1202.694) (-1202.416) -- 0:00:58
134500 -- (-1205.675) (-1205.884) (-1208.710) [-1204.600] * (-1205.174) (-1206.227) [-1204.561] (-1203.782) -- 0:00:57
135000 -- (-1207.491) [-1210.233] (-1206.210) (-1202.182) * (-1203.166) [-1204.090] (-1204.634) (-1203.603) -- 0:00:57
Average standard deviation of split frequencies: 0.024263
135500 -- (-1204.092) (-1204.738) (-1209.238) [-1202.178] * (-1201.877) [-1205.442] (-1204.916) (-1203.771) -- 0:00:57
136000 -- (-1203.824) [-1203.972] (-1207.259) (-1202.962) * [-1203.556] (-1203.158) (-1203.888) (-1203.752) -- 0:00:57
136500 -- (-1209.147) (-1203.517) [-1204.602] (-1201.719) * (-1202.710) (-1203.228) [-1204.050] (-1209.164) -- 0:00:56
137000 -- (-1203.522) [-1203.372] (-1204.024) (-1202.373) * [-1204.174] (-1204.072) (-1203.486) (-1209.724) -- 0:00:56
137500 -- (-1203.378) [-1203.238] (-1204.940) (-1202.969) * [-1203.725] (-1203.389) (-1205.443) (-1209.397) -- 0:00:56
138000 -- (-1203.817) (-1202.909) (-1205.401) [-1203.021] * (-1204.348) (-1201.645) (-1203.397) [-1203.675] -- 0:00:56
138500 -- (-1204.339) (-1204.309) (-1205.189) [-1202.641] * (-1205.540) [-1202.294] (-1202.770) (-1203.712) -- 0:00:55
139000 -- (-1201.828) [-1203.646] (-1204.058) (-1202.806) * (-1205.281) (-1202.985) [-1202.380] (-1202.916) -- 0:00:55
139500 -- (-1202.471) (-1208.525) (-1208.332) [-1202.913] * (-1206.767) [-1201.909] (-1203.149) (-1203.535) -- 0:00:55
140000 -- (-1203.479) [-1204.295] (-1203.950) (-1205.307) * (-1203.778) (-1203.794) [-1205.396] (-1205.657) -- 0:00:55
Average standard deviation of split frequencies: 0.023831
140500 -- (-1203.940) (-1202.582) (-1206.534) [-1203.162] * (-1203.123) (-1202.978) (-1202.945) [-1203.559] -- 0:00:55
141000 -- [-1202.996] (-1202.582) (-1206.304) (-1206.186) * (-1203.591) (-1203.766) (-1202.669) [-1203.698] -- 0:00:54
141500 -- (-1203.792) [-1202.775] (-1203.767) (-1203.316) * [-1205.874] (-1203.764) (-1202.669) (-1204.446) -- 0:00:54
142000 -- (-1203.285) (-1206.261) (-1206.248) [-1202.420] * (-1205.085) [-1203.464] (-1203.037) (-1204.963) -- 0:00:54
142500 -- (-1203.512) (-1202.446) (-1209.583) [-1205.386] * [-1203.745] (-1203.186) (-1204.088) (-1202.440) -- 0:00:54
143000 -- (-1205.925) [-1204.946] (-1205.415) (-1204.318) * (-1207.721) (-1202.896) (-1205.364) [-1202.229] -- 0:00:53
143500 -- (-1205.114) [-1203.899] (-1208.031) (-1203.757) * (-1207.199) (-1204.067) [-1204.628] (-1205.311) -- 0:00:53
144000 -- [-1207.553] (-1208.334) (-1206.065) (-1203.532) * (-1204.974) (-1203.826) (-1204.389) [-1209.368] -- 0:00:53
144500 -- (-1205.976) [-1205.184] (-1203.671) (-1204.782) * [-1203.751] (-1204.078) (-1202.192) (-1205.461) -- 0:00:53
145000 -- [-1204.526] (-1207.058) (-1203.108) (-1202.621) * (-1207.835) (-1203.650) (-1202.073) [-1202.528] -- 0:00:53
Average standard deviation of split frequencies: 0.021633
145500 -- [-1206.796] (-1207.423) (-1203.306) (-1206.087) * (-1203.742) [-1201.915] (-1203.738) (-1202.926) -- 0:00:52
146000 -- [-1202.581] (-1209.759) (-1204.059) (-1206.485) * (-1202.381) (-1207.054) [-1204.632] (-1203.617) -- 0:00:52
146500 -- [-1204.085] (-1207.146) (-1205.213) (-1204.133) * (-1203.889) (-1204.795) [-1203.409] (-1203.965) -- 0:00:52
147000 -- (-1202.903) [-1201.992] (-1211.301) (-1204.782) * (-1204.399) (-1203.048) [-1203.275] (-1206.002) -- 0:00:52
147500 -- (-1203.461) [-1203.258] (-1203.565) (-1203.345) * [-1202.028] (-1203.655) (-1208.138) (-1202.756) -- 0:00:52
148000 -- (-1204.251) (-1205.054) [-1202.343] (-1205.106) * (-1206.048) [-1205.854] (-1205.929) (-1202.988) -- 0:00:51
148500 -- (-1201.697) (-1203.238) (-1202.493) [-1202.268] * (-1204.206) [-1206.255] (-1206.103) (-1207.348) -- 0:00:57
149000 -- (-1207.878) (-1202.448) (-1202.408) [-1203.640] * (-1203.778) (-1203.573) [-1207.540] (-1203.180) -- 0:00:57
149500 -- [-1204.751] (-1204.794) (-1205.527) (-1202.468) * [-1203.054] (-1203.486) (-1204.844) (-1202.796) -- 0:00:56
150000 -- (-1203.241) (-1205.861) (-1202.270) [-1202.478] * (-1205.742) [-1205.226] (-1202.856) (-1203.462) -- 0:00:56
Average standard deviation of split frequencies: 0.021380
150500 -- (-1205.761) (-1204.015) [-1203.297] (-1202.586) * (-1205.051) (-1205.001) [-1203.006] (-1205.733) -- 0:00:56
151000 -- (-1202.493) (-1206.593) (-1203.947) [-1203.875] * (-1203.894) (-1206.696) (-1202.202) [-1205.386] -- 0:00:56
151500 -- (-1202.083) (-1204.446) [-1203.565] (-1204.311) * [-1204.039] (-1203.376) (-1202.815) (-1203.621) -- 0:00:56
152000 -- (-1202.307) (-1204.992) [-1204.301] (-1204.601) * [-1203.692] (-1210.800) (-1202.259) (-1203.722) -- 0:00:55
152500 -- (-1203.917) (-1205.601) [-1203.243] (-1206.509) * (-1204.103) (-1205.423) [-1203.120] (-1203.064) -- 0:00:55
153000 -- (-1204.145) [-1204.753] (-1205.474) (-1205.537) * (-1206.651) (-1205.612) [-1202.663] (-1203.720) -- 0:00:55
153500 -- (-1202.200) [-1204.755] (-1202.693) (-1206.503) * (-1204.498) [-1202.780] (-1206.504) (-1203.135) -- 0:00:55
154000 -- (-1202.724) (-1205.265) (-1205.721) [-1203.551] * (-1207.669) (-1202.495) [-1203.949] (-1203.257) -- 0:00:54
154500 -- [-1203.136] (-1204.139) (-1202.092) (-1206.962) * (-1204.761) (-1204.296) [-1202.749] (-1202.437) -- 0:00:54
155000 -- (-1202.429) [-1205.393] (-1203.158) (-1207.867) * [-1202.903] (-1204.955) (-1203.608) (-1204.908) -- 0:00:54
Average standard deviation of split frequencies: 0.021153
155500 -- (-1202.510) (-1204.953) [-1203.133] (-1205.006) * [-1203.757] (-1203.120) (-1202.307) (-1203.467) -- 0:00:54
156000 -- (-1203.097) [-1204.253] (-1206.824) (-1206.707) * [-1201.768] (-1203.648) (-1208.587) (-1207.973) -- 0:00:54
156500 -- (-1202.157) (-1204.290) [-1205.687] (-1204.983) * [-1202.663] (-1201.878) (-1205.112) (-1204.409) -- 0:00:53
157000 -- (-1206.222) (-1203.011) (-1201.844) [-1204.486] * (-1203.442) [-1204.303] (-1208.318) (-1204.767) -- 0:00:53
157500 -- (-1206.665) (-1202.928) [-1202.621] (-1204.501) * [-1205.520] (-1207.647) (-1204.928) (-1204.027) -- 0:00:53
158000 -- [-1206.450] (-1204.367) (-1205.073) (-1203.454) * (-1204.024) (-1203.991) [-1204.791] (-1206.952) -- 0:00:53
158500 -- (-1203.946) (-1207.319) [-1205.928] (-1206.141) * (-1205.095) [-1203.914] (-1204.020) (-1205.473) -- 0:00:53
159000 -- (-1203.777) (-1207.748) [-1203.110] (-1205.666) * (-1203.580) (-1204.250) (-1204.011) [-1206.107] -- 0:00:52
159500 -- (-1207.080) (-1203.850) [-1203.087] (-1204.499) * (-1203.486) [-1202.390] (-1204.959) (-1204.484) -- 0:00:52
160000 -- (-1204.213) [-1204.005] (-1203.687) (-1203.804) * (-1203.293) [-1202.432] (-1203.053) (-1204.135) -- 0:00:52
Average standard deviation of split frequencies: 0.019723
160500 -- (-1203.885) (-1205.216) [-1202.963] (-1204.651) * [-1203.599] (-1204.535) (-1203.618) (-1204.678) -- 0:00:52
161000 -- (-1202.431) [-1206.117] (-1204.916) (-1203.058) * (-1202.890) (-1205.301) [-1204.516] (-1204.020) -- 0:00:52
161500 -- (-1205.695) (-1203.526) (-1205.089) [-1204.002] * (-1203.083) (-1204.395) (-1204.547) [-1203.443] -- 0:00:51
162000 -- (-1203.208) (-1203.713) (-1202.138) [-1202.613] * [-1201.570] (-1205.736) (-1204.157) (-1203.506) -- 0:00:51
162500 -- (-1202.213) (-1203.688) (-1203.028) [-1203.894] * [-1204.416] (-1205.153) (-1202.614) (-1206.829) -- 0:00:51
163000 -- [-1203.330] (-1205.457) (-1203.819) (-1204.241) * (-1203.230) (-1206.091) (-1205.485) [-1205.088] -- 0:00:51
163500 -- (-1208.797) (-1203.678) (-1202.881) [-1204.069] * [-1203.888] (-1203.564) (-1206.445) (-1205.382) -- 0:00:51
164000 -- (-1204.791) (-1205.007) (-1209.096) [-1204.036] * (-1205.173) (-1204.074) (-1203.760) [-1204.540] -- 0:00:50
164500 -- (-1204.772) [-1205.093] (-1204.604) (-1202.418) * (-1204.380) (-1204.901) [-1203.940] (-1203.483) -- 0:00:50
165000 -- (-1205.009) (-1203.821) [-1203.086] (-1206.583) * (-1205.124) (-1205.599) (-1204.395) [-1204.042] -- 0:00:55
Average standard deviation of split frequencies: 0.019430
165500 -- [-1203.319] (-1203.464) (-1205.112) (-1208.462) * (-1206.481) [-1202.471] (-1205.621) (-1205.089) -- 0:00:55
166000 -- (-1203.532) (-1204.206) [-1204.034] (-1203.762) * (-1209.627) (-1202.167) [-1205.230] (-1206.663) -- 0:00:55
166500 -- (-1202.370) (-1202.456) (-1204.363) [-1204.243] * (-1205.830) (-1208.506) (-1202.108) [-1205.436] -- 0:00:55
167000 -- [-1203.841] (-1202.365) (-1204.597) (-1203.597) * (-1206.940) (-1210.842) [-1201.977] (-1203.003) -- 0:00:54
167500 -- (-1201.883) (-1204.186) (-1203.028) [-1202.626] * [-1203.258] (-1207.214) (-1202.394) (-1202.435) -- 0:00:54
168000 -- [-1201.815] (-1204.512) (-1204.175) (-1202.038) * [-1204.228] (-1203.755) (-1205.442) (-1202.298) -- 0:00:54
168500 -- (-1202.742) (-1206.423) [-1202.998] (-1204.474) * [-1204.011] (-1204.237) (-1204.200) (-1204.940) -- 0:00:54
169000 -- (-1201.962) (-1203.537) [-1204.350] (-1204.574) * (-1204.353) [-1204.599] (-1202.689) (-1204.874) -- 0:00:54
169500 -- (-1207.118) [-1204.731] (-1202.867) (-1204.062) * (-1205.585) (-1204.902) [-1202.463] (-1203.233) -- 0:00:53
170000 -- [-1203.899] (-1203.068) (-1203.821) (-1206.320) * (-1206.385) (-1202.372) [-1202.422] (-1202.809) -- 0:00:53
Average standard deviation of split frequencies: 0.018899
170500 -- (-1203.611) [-1207.645] (-1204.143) (-1205.762) * (-1204.181) [-1202.054] (-1201.742) (-1202.523) -- 0:00:53
171000 -- (-1204.301) (-1202.485) (-1210.964) [-1209.476] * (-1206.318) (-1203.323) (-1203.536) [-1204.176] -- 0:00:53
171500 -- [-1207.332] (-1205.046) (-1207.850) (-1204.776) * (-1206.013) [-1203.245] (-1203.457) (-1204.934) -- 0:00:53
172000 -- (-1206.461) (-1205.938) (-1206.086) [-1202.665] * (-1204.464) (-1202.968) [-1201.579] (-1205.100) -- 0:00:52
172500 -- (-1207.023) (-1203.436) [-1204.906] (-1205.044) * [-1202.959] (-1209.392) (-1207.000) (-1203.328) -- 0:00:52
173000 -- (-1202.495) (-1205.663) (-1206.583) [-1202.414] * [-1202.861] (-1209.313) (-1205.206) (-1203.969) -- 0:00:52
173500 -- (-1202.962) [-1203.608] (-1202.812) (-1203.405) * (-1203.750) (-1205.999) (-1203.471) [-1203.446] -- 0:00:52
174000 -- (-1201.908) [-1202.474] (-1206.823) (-1203.070) * (-1202.183) [-1202.622] (-1205.071) (-1205.832) -- 0:00:52
174500 -- [-1203.804] (-1202.579) (-1203.263) (-1203.070) * (-1202.537) (-1202.870) (-1207.592) [-1204.334] -- 0:00:52
175000 -- (-1202.238) [-1203.516] (-1202.536) (-1206.919) * (-1203.090) [-1204.693] (-1210.058) (-1206.202) -- 0:00:51
Average standard deviation of split frequencies: 0.017198
175500 -- (-1204.427) [-1203.216] (-1202.472) (-1206.267) * (-1203.846) (-1203.862) [-1208.008] (-1206.450) -- 0:00:51
176000 -- [-1206.564] (-1202.777) (-1201.943) (-1205.585) * (-1203.541) (-1202.803) [-1204.841] (-1206.591) -- 0:00:51
176500 -- (-1205.048) (-1204.044) [-1202.545] (-1204.466) * (-1203.669) [-1203.331] (-1205.168) (-1201.926) -- 0:00:51
177000 -- (-1203.597) (-1205.120) [-1203.230] (-1202.426) * (-1203.358) [-1205.461] (-1204.687) (-1204.262) -- 0:00:51
177500 -- (-1203.163) (-1202.626) (-1202.712) [-1201.865] * [-1203.876] (-1205.356) (-1203.342) (-1203.508) -- 0:00:50
178000 -- (-1204.506) (-1202.571) (-1202.690) [-1202.260] * (-1204.149) [-1202.958] (-1203.018) (-1202.933) -- 0:00:50
178500 -- [-1202.620] (-1202.718) (-1204.964) (-1203.271) * (-1204.899) (-1207.075) (-1205.915) [-1202.597] -- 0:00:50
179000 -- (-1204.071) (-1202.793) [-1203.972] (-1204.822) * (-1205.562) [-1203.677] (-1205.566) (-1202.637) -- 0:00:50
179500 -- (-1202.342) [-1206.863] (-1207.937) (-1204.374) * (-1205.577) [-1203.063] (-1205.469) (-1204.197) -- 0:00:50
180000 -- [-1203.198] (-1202.834) (-1202.901) (-1204.594) * (-1202.651) (-1202.783) [-1206.326] (-1206.344) -- 0:00:50
Average standard deviation of split frequencies: 0.018111
180500 -- (-1209.526) (-1202.440) [-1202.916] (-1206.042) * (-1205.364) (-1204.799) (-1204.602) [-1202.500] -- 0:00:49
181000 -- (-1204.213) (-1205.692) [-1202.295] (-1205.559) * (-1205.262) (-1202.855) (-1203.980) [-1205.308] -- 0:00:54
181500 -- (-1203.866) (-1204.387) [-1203.302] (-1205.520) * (-1207.987) [-1203.777] (-1204.982) (-1209.420) -- 0:00:54
182000 -- [-1202.683] (-1208.578) (-1203.012) (-1205.872) * (-1205.778) (-1204.150) (-1204.160) [-1203.114] -- 0:00:53
182500 -- (-1202.767) (-1204.463) [-1203.014] (-1203.334) * (-1204.728) [-1204.725] (-1204.711) (-1202.740) -- 0:00:53
183000 -- (-1205.851) [-1206.195] (-1204.727) (-1202.416) * (-1204.014) [-1204.687] (-1203.674) (-1202.223) -- 0:00:53
183500 -- (-1207.143) (-1202.933) [-1209.115] (-1203.545) * (-1203.417) (-1203.693) (-1203.014) [-1205.555] -- 0:00:53
184000 -- [-1202.757] (-1201.948) (-1210.485) (-1208.719) * (-1204.470) (-1205.098) (-1204.251) [-1205.261] -- 0:00:53
184500 -- [-1202.934] (-1202.320) (-1207.483) (-1202.573) * (-1203.366) (-1206.984) [-1203.379] (-1202.984) -- 0:00:53
185000 -- (-1210.292) (-1202.394) (-1207.192) [-1204.464] * (-1208.320) (-1202.584) (-1204.855) [-1203.121] -- 0:00:52
Average standard deviation of split frequencies: 0.018337
185500 -- (-1206.984) [-1201.909] (-1206.056) (-1203.304) * (-1206.650) (-1203.750) (-1203.215) [-1208.215] -- 0:00:52
186000 -- (-1204.616) (-1202.772) (-1206.567) [-1204.799] * (-1202.532) [-1203.843] (-1203.615) (-1204.950) -- 0:00:52
186500 -- (-1208.286) (-1204.548) (-1202.899) [-1203.372] * (-1203.046) [-1201.898] (-1203.615) (-1204.321) -- 0:00:52
187000 -- (-1205.627) [-1204.547] (-1203.798) (-1202.229) * (-1203.147) [-1202.901] (-1202.963) (-1204.487) -- 0:00:52
187500 -- (-1209.278) [-1203.930] (-1204.305) (-1203.225) * [-1202.444] (-1205.505) (-1204.980) (-1206.767) -- 0:00:52
188000 -- (-1203.991) (-1202.744) (-1204.636) [-1203.269] * (-1203.507) (-1203.969) [-1202.728] (-1205.543) -- 0:00:51
188500 -- (-1202.462) [-1207.177] (-1205.992) (-1203.786) * (-1205.195) [-1204.652] (-1207.361) (-1205.084) -- 0:00:51
189000 -- (-1203.614) [-1203.316] (-1208.739) (-1205.020) * (-1204.102) [-1203.402] (-1205.917) (-1208.067) -- 0:00:51
189500 -- [-1204.166] (-1203.747) (-1202.412) (-1203.090) * (-1204.013) (-1205.525) (-1203.399) [-1207.372] -- 0:00:51
190000 -- (-1203.631) (-1203.523) (-1203.826) [-1202.726] * [-1204.511] (-1207.791) (-1204.369) (-1209.897) -- 0:00:51
Average standard deviation of split frequencies: 0.018325
190500 -- (-1203.791) [-1203.639] (-1202.238) (-1202.765) * (-1206.480) (-1207.493) [-1204.239] (-1203.610) -- 0:00:50
191000 -- (-1202.062) (-1204.148) [-1202.780] (-1202.620) * (-1205.746) (-1204.123) (-1204.676) [-1203.148] -- 0:00:50
191500 -- [-1211.257] (-1203.446) (-1202.652) (-1206.079) * (-1208.829) [-1202.670] (-1207.208) (-1203.055) -- 0:00:50
192000 -- (-1207.739) (-1203.835) [-1202.746] (-1203.376) * (-1203.187) (-1202.666) (-1203.984) [-1208.485] -- 0:00:50
192500 -- (-1203.187) (-1204.314) [-1202.042] (-1208.629) * (-1202.725) (-1202.396) [-1203.569] (-1205.962) -- 0:00:50
193000 -- [-1203.003] (-1203.151) (-1205.786) (-1209.061) * [-1202.412] (-1202.987) (-1202.938) (-1215.576) -- 0:00:50
193500 -- (-1203.496) [-1203.712] (-1207.384) (-1205.972) * (-1203.160) (-1204.532) (-1206.936) [-1203.041] -- 0:00:50
194000 -- [-1204.173] (-1204.685) (-1204.997) (-1202.800) * (-1203.120) (-1204.607) (-1203.894) [-1203.707] -- 0:00:49
194500 -- (-1202.785) (-1202.042) [-1203.712] (-1205.746) * (-1203.811) (-1203.158) (-1204.249) [-1203.325] -- 0:00:49
195000 -- (-1203.234) (-1201.989) [-1202.530] (-1206.427) * (-1203.199) (-1203.356) [-1206.477] (-1205.031) -- 0:00:49
Average standard deviation of split frequencies: 0.018189
195500 -- (-1202.973) (-1205.465) (-1202.483) [-1203.899] * [-1203.932] (-1205.570) (-1204.905) (-1203.853) -- 0:00:49
196000 -- (-1203.310) [-1201.995] (-1202.360) (-1206.706) * (-1202.666) [-1202.506] (-1212.999) (-1203.326) -- 0:00:49
196500 -- (-1203.777) (-1203.418) (-1202.936) [-1204.990] * (-1202.391) (-1206.141) [-1206.320] (-1202.894) -- 0:00:49
197000 -- (-1202.976) (-1202.122) [-1202.263] (-1204.316) * [-1202.398] (-1205.096) (-1205.271) (-1203.556) -- 0:00:48
197500 -- (-1205.221) [-1201.841] (-1205.840) (-1206.345) * (-1202.326) [-1204.006] (-1202.475) (-1205.355) -- 0:00:52
198000 -- (-1203.698) (-1202.693) (-1203.651) [-1202.995] * [-1203.311] (-1204.410) (-1202.531) (-1202.904) -- 0:00:52
198500 -- (-1204.254) (-1203.116) (-1205.491) [-1203.074] * (-1211.848) (-1203.359) [-1203.327] (-1202.968) -- 0:00:52
199000 -- [-1202.306] (-1204.914) (-1204.727) (-1203.049) * (-1203.882) [-1205.661] (-1203.897) (-1207.180) -- 0:00:52
199500 -- (-1201.765) (-1204.088) [-1203.793] (-1202.097) * (-1204.114) (-1205.659) [-1203.326] (-1206.725) -- 0:00:52
200000 -- (-1203.386) [-1203.725] (-1204.409) (-1203.824) * [-1204.329] (-1205.716) (-1203.021) (-1205.202) -- 0:00:51
Average standard deviation of split frequencies: 0.017472
200500 -- (-1207.453) (-1202.919) (-1205.650) [-1203.768] * (-1202.910) (-1202.752) [-1202.953] (-1204.668) -- 0:00:51
201000 -- (-1211.355) [-1202.920] (-1207.553) (-1209.475) * [-1203.200] (-1202.026) (-1202.749) (-1203.047) -- 0:00:51
201500 -- (-1210.017) [-1202.778] (-1207.645) (-1204.795) * (-1204.299) (-1204.167) [-1202.612] (-1203.125) -- 0:00:51
202000 -- (-1207.118) (-1203.658) [-1203.749] (-1206.093) * (-1205.483) (-1202.526) [-1203.804] (-1205.378) -- 0:00:51
202500 -- (-1204.368) (-1203.301) [-1203.707] (-1203.312) * (-1204.871) (-1204.035) (-1204.271) [-1206.043] -- 0:00:51
203000 -- (-1208.243) [-1202.492] (-1202.685) (-1203.093) * [-1202.804] (-1204.978) (-1208.912) (-1203.834) -- 0:00:51
203500 -- (-1205.412) (-1202.699) (-1202.468) [-1202.525] * (-1202.964) (-1206.673) (-1213.922) [-1203.981] -- 0:00:50
204000 -- (-1204.541) [-1203.784] (-1205.422) (-1205.207) * (-1203.149) (-1204.768) [-1204.426] (-1205.854) -- 0:00:50
204500 -- [-1204.580] (-1203.497) (-1204.854) (-1205.204) * [-1203.443] (-1206.219) (-1204.796) (-1203.393) -- 0:00:50
205000 -- (-1202.481) (-1203.483) (-1203.619) [-1205.447] * (-1203.200) (-1202.143) (-1203.108) [-1203.420] -- 0:00:50
Average standard deviation of split frequencies: 0.017671
205500 -- (-1202.481) (-1205.301) [-1202.846] (-1205.829) * (-1201.568) (-1202.410) [-1204.976] (-1202.897) -- 0:00:50
206000 -- (-1202.011) (-1205.491) (-1208.136) [-1202.715] * (-1203.417) (-1202.784) [-1203.589] (-1204.496) -- 0:00:50
206500 -- (-1203.304) [-1207.023] (-1201.874) (-1203.792) * (-1205.342) (-1202.042) [-1202.286] (-1205.263) -- 0:00:49
207000 -- (-1203.018) [-1206.610] (-1203.030) (-1208.073) * [-1202.676] (-1202.030) (-1212.919) (-1206.304) -- 0:00:49
207500 -- [-1203.502] (-1205.931) (-1205.158) (-1203.220) * (-1202.644) [-1202.057] (-1204.875) (-1203.458) -- 0:00:49
208000 -- (-1204.233) (-1204.905) (-1204.634) [-1202.317] * (-1202.519) [-1202.074] (-1205.903) (-1211.618) -- 0:00:49
208500 -- (-1204.257) (-1203.796) (-1205.836) [-1204.763] * [-1203.952] (-1204.015) (-1206.826) (-1204.139) -- 0:00:49
209000 -- (-1202.267) (-1203.705) (-1204.327) [-1205.637] * (-1207.234) (-1204.629) (-1204.647) [-1204.810] -- 0:00:49
209500 -- [-1204.730] (-1202.101) (-1203.109) (-1205.897) * (-1205.882) [-1204.056] (-1205.263) (-1203.065) -- 0:00:49
210000 -- (-1203.411) [-1201.747] (-1204.192) (-1206.340) * (-1202.564) [-1203.804] (-1204.852) (-1202.177) -- 0:00:48
Average standard deviation of split frequencies: 0.016410
210500 -- [-1204.559] (-1201.557) (-1202.656) (-1206.295) * (-1205.804) (-1207.314) [-1204.909] (-1204.114) -- 0:00:48
211000 -- [-1205.268] (-1201.562) (-1202.361) (-1203.277) * (-1207.073) (-1203.435) (-1202.177) [-1203.716] -- 0:00:48
211500 -- [-1205.584] (-1202.694) (-1203.525) (-1202.793) * (-1204.830) (-1203.195) [-1202.421] (-1204.358) -- 0:00:48
212000 -- [-1203.987] (-1204.057) (-1206.252) (-1203.419) * (-1204.120) [-1204.182] (-1202.421) (-1204.154) -- 0:00:48
212500 -- [-1204.484] (-1204.961) (-1202.210) (-1202.809) * [-1202.341] (-1203.410) (-1203.813) (-1204.153) -- 0:00:48
213000 -- (-1204.351) (-1204.720) [-1201.806] (-1203.012) * (-1203.907) (-1203.829) [-1202.160] (-1204.594) -- 0:00:48
213500 -- [-1203.163] (-1204.441) (-1205.793) (-1204.270) * (-1204.514) (-1202.157) [-1202.176] (-1202.491) -- 0:00:47
214000 -- (-1206.772) (-1205.202) (-1205.586) [-1205.675] * (-1204.925) (-1203.755) (-1202.138) [-1202.345] -- 0:00:51
214500 -- (-1204.041) [-1208.518] (-1202.096) (-1209.947) * (-1203.138) [-1206.727] (-1204.380) (-1205.161) -- 0:00:51
215000 -- [-1202.971] (-1202.042) (-1204.455) (-1206.448) * (-1202.005) (-1204.486) [-1203.632] (-1211.002) -- 0:00:51
Average standard deviation of split frequencies: 0.014792
215500 -- (-1202.851) (-1203.643) [-1201.668] (-1202.336) * (-1202.612) [-1201.633] (-1203.369) (-1206.879) -- 0:00:50
216000 -- (-1203.937) (-1201.634) (-1203.318) [-1205.377] * [-1203.357] (-1206.213) (-1204.306) (-1202.954) -- 0:00:50
216500 -- (-1203.613) [-1205.137] (-1203.318) (-1205.302) * [-1203.238] (-1203.732) (-1203.152) (-1202.214) -- 0:00:50
217000 -- (-1203.924) (-1206.062) (-1203.026) [-1203.571] * (-1204.201) (-1209.196) (-1203.632) [-1203.521] -- 0:00:50
217500 -- [-1202.031] (-1203.116) (-1201.938) (-1205.441) * (-1205.023) (-1206.256) (-1201.815) [-1204.944] -- 0:00:50
218000 -- [-1204.386] (-1201.993) (-1203.055) (-1204.341) * (-1203.614) [-1206.054] (-1202.147) (-1205.358) -- 0:00:50
218500 -- (-1203.935) [-1206.869] (-1203.418) (-1204.248) * (-1205.835) (-1204.671) (-1205.172) [-1204.155] -- 0:00:50
219000 -- (-1202.252) [-1202.672] (-1208.375) (-1204.831) * (-1204.108) (-1203.490) (-1202.026) [-1204.681] -- 0:00:49
219500 -- (-1202.231) [-1202.711] (-1208.187) (-1202.723) * [-1203.830] (-1202.998) (-1204.979) (-1203.955) -- 0:00:49
220000 -- (-1206.308) (-1202.227) (-1206.716) [-1201.739] * (-1202.427) [-1204.778] (-1208.232) (-1205.322) -- 0:00:49
Average standard deviation of split frequencies: 0.012189
220500 -- (-1208.403) (-1204.468) (-1205.252) [-1202.819] * (-1201.507) [-1203.331] (-1207.428) (-1205.542) -- 0:00:49
221000 -- (-1209.053) (-1207.575) [-1207.710] (-1203.890) * (-1202.410) [-1202.707] (-1203.698) (-1205.224) -- 0:00:49
221500 -- (-1208.845) [-1203.614] (-1204.429) (-1202.943) * (-1206.443) (-1201.833) (-1206.175) [-1201.730] -- 0:00:49
222000 -- [-1205.424] (-1203.632) (-1203.566) (-1202.911) * (-1206.006) (-1201.614) (-1203.650) [-1204.166] -- 0:00:49
222500 -- (-1202.021) (-1207.757) [-1203.637] (-1202.202) * (-1203.608) [-1205.864] (-1202.729) (-1206.140) -- 0:00:48
223000 -- (-1202.092) (-1211.245) (-1202.170) [-1204.414] * (-1203.030) (-1206.854) [-1204.357] (-1210.851) -- 0:00:48
223500 -- (-1205.629) (-1205.978) (-1206.679) [-1204.051] * [-1202.666] (-1208.247) (-1207.250) (-1210.322) -- 0:00:48
224000 -- (-1205.066) (-1202.917) [-1205.974] (-1203.444) * (-1202.018) (-1211.458) [-1205.454] (-1202.759) -- 0:00:48
224500 -- (-1203.685) (-1202.625) [-1201.802] (-1206.699) * [-1203.474] (-1204.542) (-1204.927) (-1203.563) -- 0:00:48
225000 -- (-1202.181) (-1205.882) (-1202.242) [-1203.437] * (-1203.312) [-1204.091] (-1205.555) (-1203.119) -- 0:00:48
Average standard deviation of split frequencies: 0.012052
225500 -- [-1202.600] (-1206.587) (-1202.894) (-1205.512) * (-1204.145) [-1204.247] (-1203.313) (-1202.291) -- 0:00:48
226000 -- (-1202.285) [-1206.401] (-1203.668) (-1202.994) * (-1207.135) [-1201.702] (-1202.740) (-1202.357) -- 0:00:47
226500 -- [-1202.284] (-1207.747) (-1204.969) (-1202.994) * (-1206.624) (-1204.046) [-1208.339] (-1206.132) -- 0:00:47
227000 -- (-1201.832) (-1202.184) [-1202.713] (-1202.293) * (-1204.248) (-1202.734) [-1204.500] (-1202.559) -- 0:00:47
227500 -- (-1201.551) (-1201.690) (-1203.604) [-1202.225] * (-1204.538) [-1202.880] (-1202.509) (-1205.849) -- 0:00:47
228000 -- (-1201.602) (-1201.754) (-1202.616) [-1202.330] * (-1204.310) (-1203.193) (-1203.731) [-1204.935] -- 0:00:47
228500 -- [-1202.314] (-1201.832) (-1203.387) (-1204.026) * (-1204.265) (-1204.165) [-1202.493] (-1202.636) -- 0:00:47
229000 -- [-1203.285] (-1203.064) (-1204.354) (-1203.509) * (-1203.573) (-1204.766) [-1201.982] (-1205.024) -- 0:00:47
229500 -- (-1202.402) [-1205.405] (-1204.396) (-1204.234) * (-1204.251) [-1204.059] (-1203.237) (-1203.264) -- 0:00:47
230000 -- (-1202.341) (-1204.141) (-1208.803) [-1203.155] * (-1202.650) (-1203.748) (-1203.206) [-1202.256] -- 0:00:46
Average standard deviation of split frequencies: 0.012382
230500 -- (-1202.432) (-1206.687) (-1207.086) [-1203.282] * (-1202.326) [-1204.678] (-1201.743) (-1202.397) -- 0:00:50
231000 -- (-1202.550) [-1204.132] (-1210.442) (-1204.161) * [-1202.008] (-1203.026) (-1206.127) (-1201.935) -- 0:00:49
231500 -- [-1204.801] (-1203.722) (-1202.150) (-1208.910) * (-1201.928) [-1206.485] (-1201.646) (-1202.420) -- 0:00:49
232000 -- (-1203.293) (-1204.389) [-1201.830] (-1202.901) * (-1203.536) (-1206.228) [-1202.796] (-1202.176) -- 0:00:49
232500 -- [-1202.641] (-1207.644) (-1201.836) (-1201.998) * [-1203.070] (-1205.956) (-1202.739) (-1201.576) -- 0:00:49
233000 -- (-1202.990) [-1204.242] (-1204.209) (-1208.139) * [-1204.119] (-1204.309) (-1204.001) (-1206.450) -- 0:00:49
233500 -- (-1202.746) (-1203.693) (-1206.936) [-1206.185] * (-1202.674) [-1204.279] (-1203.683) (-1204.597) -- 0:00:49
234000 -- (-1203.174) (-1203.507) [-1204.363] (-1203.302) * (-1205.822) (-1202.287) (-1202.906) [-1202.959] -- 0:00:49
234500 -- (-1204.273) (-1203.452) (-1205.395) [-1203.691] * (-1202.513) (-1205.054) [-1203.376] (-1203.398) -- 0:00:48
235000 -- (-1205.029) (-1205.370) [-1203.454] (-1203.974) * (-1203.689) (-1202.974) (-1208.007) [-1202.254] -- 0:00:48
Average standard deviation of split frequencies: 0.013042
235500 -- (-1203.998) (-1202.416) [-1204.248] (-1205.488) * (-1204.973) [-1202.932] (-1203.119) (-1204.166) -- 0:00:48
236000 -- [-1203.782] (-1202.653) (-1204.374) (-1204.966) * [-1203.054] (-1202.551) (-1203.298) (-1203.514) -- 0:00:48
236500 -- [-1201.940] (-1205.877) (-1202.700) (-1207.055) * (-1202.734) (-1202.795) (-1203.508) [-1201.934] -- 0:00:48
237000 -- (-1201.947) [-1203.016] (-1203.202) (-1203.951) * (-1204.718) [-1201.918] (-1202.090) (-1201.608) -- 0:00:48
237500 -- (-1203.743) (-1205.163) [-1202.214] (-1203.336) * (-1202.234) (-1204.630) (-1202.237) [-1203.875] -- 0:00:48
238000 -- [-1205.064] (-1204.047) (-1205.296) (-1202.899) * [-1201.784] (-1202.249) (-1203.985) (-1203.374) -- 0:00:48
238500 -- [-1203.943] (-1202.892) (-1207.006) (-1202.680) * (-1202.120) (-1203.571) [-1204.768] (-1202.018) -- 0:00:47
239000 -- (-1202.977) (-1206.450) (-1204.023) [-1205.077] * (-1203.270) (-1206.120) (-1203.488) [-1202.455] -- 0:00:47
239500 -- [-1202.643] (-1204.049) (-1203.410) (-1203.591) * (-1203.981) (-1203.997) (-1201.464) [-1206.390] -- 0:00:47
240000 -- (-1202.619) (-1203.228) (-1203.574) [-1203.356] * (-1204.342) (-1202.849) [-1204.141] (-1208.463) -- 0:00:47
Average standard deviation of split frequencies: 0.011508
240500 -- (-1203.786) [-1206.974] (-1203.005) (-1210.397) * (-1204.368) [-1204.566] (-1202.444) (-1207.676) -- 0:00:47
241000 -- [-1204.092] (-1204.016) (-1202.122) (-1202.236) * (-1207.058) (-1206.508) [-1203.252] (-1205.443) -- 0:00:47
241500 -- (-1202.306) (-1205.178) (-1207.653) [-1202.400] * (-1206.231) (-1211.179) [-1204.118] (-1205.444) -- 0:00:47
242000 -- (-1203.204) [-1207.477] (-1204.969) (-1202.307) * [-1201.936] (-1202.970) (-1204.555) (-1205.373) -- 0:00:46
242500 -- (-1204.656) (-1206.178) (-1206.919) [-1202.195] * [-1201.936] (-1202.492) (-1203.569) (-1205.180) -- 0:00:46
243000 -- (-1208.792) [-1205.017] (-1206.121) (-1201.894) * (-1205.263) (-1202.749) (-1202.919) [-1204.267] -- 0:00:46
243500 -- [-1204.270] (-1206.813) (-1204.878) (-1203.417) * (-1205.758) [-1202.751] (-1201.922) (-1203.780) -- 0:00:46
244000 -- (-1202.065) [-1205.502] (-1203.858) (-1205.078) * (-1204.625) (-1202.601) (-1210.090) [-1202.984] -- 0:00:46
244500 -- (-1202.410) (-1203.201) (-1203.674) [-1209.778] * (-1203.630) (-1203.250) (-1202.822) [-1203.144] -- 0:00:46
245000 -- (-1203.632) [-1202.829] (-1203.163) (-1205.913) * (-1205.132) [-1202.402] (-1206.123) (-1205.612) -- 0:00:46
Average standard deviation of split frequencies: 0.011610
245500 -- (-1202.501) (-1202.383) (-1201.883) [-1201.501] * [-1202.466] (-1202.834) (-1204.872) (-1204.791) -- 0:00:46
246000 -- (-1201.681) (-1202.407) [-1202.856] (-1204.143) * (-1202.980) (-1202.721) (-1202.781) [-1202.264] -- 0:00:49
246500 -- (-1201.679) (-1202.720) [-1202.542] (-1204.971) * (-1203.631) [-1203.646] (-1208.115) (-1202.350) -- 0:00:48
247000 -- [-1201.803] (-1204.012) (-1203.517) (-1205.275) * (-1204.671) [-1202.309] (-1207.449) (-1203.599) -- 0:00:48
247500 -- (-1204.612) [-1203.738] (-1202.848) (-1203.750) * (-1204.476) (-1208.011) (-1202.515) [-1202.985] -- 0:00:48
248000 -- (-1204.387) (-1205.873) (-1203.785) [-1206.813] * (-1202.413) [-1203.376] (-1204.076) (-1202.170) -- 0:00:48
248500 -- [-1203.191] (-1206.587) (-1203.793) (-1205.601) * [-1202.001] (-1204.485) (-1203.479) (-1204.099) -- 0:00:48
249000 -- (-1201.849) (-1202.291) [-1203.131] (-1204.592) * (-1202.384) (-1203.323) (-1202.778) [-1204.568] -- 0:00:48
249500 -- [-1204.207] (-1202.476) (-1204.937) (-1206.882) * [-1202.797] (-1203.387) (-1202.191) (-1205.913) -- 0:00:48
250000 -- (-1203.714) (-1207.638) (-1206.030) [-1205.374] * (-1204.091) [-1204.673] (-1203.051) (-1203.777) -- 0:00:48
Average standard deviation of split frequencies: 0.012341
250500 -- (-1208.162) (-1204.575) (-1205.803) [-1204.150] * (-1203.526) (-1203.779) (-1202.959) [-1206.138] -- 0:00:47
251000 -- (-1206.558) (-1202.793) (-1208.258) [-1205.772] * [-1207.917] (-1204.894) (-1202.362) (-1205.518) -- 0:00:47
251500 -- (-1202.802) (-1203.322) (-1203.275) [-1205.656] * (-1202.900) (-1204.376) [-1203.349] (-1203.167) -- 0:00:47
252000 -- (-1206.740) [-1202.882] (-1207.904) (-1202.491) * (-1203.330) (-1203.797) (-1202.126) [-1203.144] -- 0:00:47
252500 -- (-1206.715) [-1202.213] (-1205.357) (-1202.046) * (-1202.826) (-1202.294) [-1202.124] (-1204.128) -- 0:00:47
253000 -- [-1205.196] (-1202.741) (-1204.124) (-1203.363) * (-1203.393) [-1206.748] (-1202.767) (-1203.926) -- 0:00:47
253500 -- (-1203.451) (-1202.786) (-1206.776) [-1204.643] * (-1206.191) [-1203.217] (-1205.993) (-1204.350) -- 0:00:47
254000 -- [-1203.544] (-1202.957) (-1205.220) (-1205.184) * (-1207.002) (-1202.936) [-1205.872] (-1204.012) -- 0:00:46
254500 -- (-1203.959) [-1204.200] (-1204.391) (-1202.644) * (-1206.200) [-1201.800] (-1204.185) (-1203.926) -- 0:00:46
255000 -- (-1202.932) (-1206.278) [-1204.232] (-1203.128) * (-1205.980) (-1202.349) (-1203.521) [-1202.714] -- 0:00:46
Average standard deviation of split frequencies: 0.012084
255500 -- [-1204.370] (-1203.623) (-1209.556) (-1205.385) * [-1206.046] (-1203.356) (-1202.844) (-1202.868) -- 0:00:46
256000 -- (-1202.086) (-1204.828) [-1205.606] (-1207.476) * (-1207.920) (-1203.250) (-1203.826) [-1203.897] -- 0:00:46
256500 -- (-1201.712) (-1203.609) [-1202.151] (-1205.975) * (-1205.087) (-1204.055) [-1203.947] (-1202.957) -- 0:00:46
257000 -- (-1204.947) (-1204.204) (-1205.341) [-1206.992] * (-1205.740) (-1204.324) [-1203.970] (-1203.297) -- 0:00:46
257500 -- [-1203.786] (-1204.697) (-1207.046) (-1203.112) * (-1207.025) (-1203.579) [-1203.785] (-1205.955) -- 0:00:46
258000 -- (-1202.182) (-1203.428) [-1203.758] (-1204.000) * [-1203.860] (-1207.900) (-1203.144) (-1207.708) -- 0:00:46
258500 -- (-1203.943) [-1203.654] (-1204.685) (-1203.083) * (-1204.309) [-1206.031] (-1204.417) (-1204.409) -- 0:00:45
259000 -- [-1203.410] (-1204.557) (-1205.432) (-1203.180) * [-1202.719] (-1203.080) (-1205.305) (-1203.759) -- 0:00:45
259500 -- (-1204.891) (-1208.863) [-1208.585] (-1203.544) * (-1203.454) [-1203.355] (-1205.848) (-1203.397) -- 0:00:45
260000 -- (-1209.502) (-1208.053) (-1207.873) [-1201.878] * (-1204.665) (-1202.568) (-1202.854) [-1202.045] -- 0:00:45
Average standard deviation of split frequencies: 0.012978
260500 -- (-1203.213) (-1204.563) [-1204.010] (-1202.145) * (-1205.107) [-1206.992] (-1203.347) (-1203.034) -- 0:00:45
261000 -- (-1203.244) (-1203.478) (-1203.749) [-1204.995] * (-1205.506) (-1203.000) [-1202.556] (-1204.411) -- 0:00:45
261500 -- (-1202.844) (-1203.869) (-1204.529) [-1203.250] * (-1206.461) [-1203.181] (-1204.137) (-1205.934) -- 0:00:48
262000 -- (-1202.246) (-1207.371) [-1208.573] (-1203.846) * (-1203.268) [-1203.496] (-1204.637) (-1205.227) -- 0:00:47
262500 -- (-1202.104) [-1204.227] (-1205.269) (-1205.695) * [-1204.556] (-1202.800) (-1204.083) (-1202.712) -- 0:00:47
263000 -- [-1204.280] (-1205.609) (-1206.639) (-1203.459) * (-1207.100) [-1204.970] (-1203.034) (-1204.200) -- 0:00:47
263500 -- [-1203.496] (-1206.477) (-1203.936) (-1203.463) * (-1205.567) (-1202.690) (-1204.192) [-1202.772] -- 0:00:47
264000 -- (-1203.558) (-1208.924) (-1202.764) [-1202.826] * (-1204.622) [-1203.730] (-1206.450) (-1203.250) -- 0:00:47
264500 -- [-1203.576] (-1206.996) (-1206.294) (-1204.212) * [-1201.728] (-1205.918) (-1204.157) (-1205.834) -- 0:00:47
265000 -- (-1205.637) (-1202.912) [-1205.828] (-1204.325) * [-1204.673] (-1202.584) (-1204.259) (-1205.312) -- 0:00:47
Average standard deviation of split frequencies: 0.013239
265500 -- (-1209.286) (-1202.890) (-1202.673) [-1202.116] * (-1206.919) [-1202.075] (-1205.162) (-1206.093) -- 0:00:47
266000 -- (-1205.242) [-1202.684] (-1202.700) (-1202.046) * (-1203.139) (-1202.222) [-1206.933] (-1202.414) -- 0:00:46
266500 -- (-1205.167) (-1203.938) [-1205.902] (-1204.966) * (-1202.593) (-1202.619) [-1202.924] (-1203.745) -- 0:00:46
267000 -- (-1203.065) [-1203.843] (-1206.525) (-1204.447) * [-1202.332] (-1204.002) (-1202.506) (-1204.954) -- 0:00:46
267500 -- (-1202.594) [-1204.206] (-1208.529) (-1205.465) * [-1204.572] (-1202.680) (-1201.894) (-1206.578) -- 0:00:46
268000 -- (-1202.889) (-1203.533) (-1205.419) [-1207.266] * (-1201.836) (-1203.186) (-1206.702) [-1202.035] -- 0:00:46
268500 -- (-1202.477) [-1203.352] (-1202.982) (-1203.067) * [-1202.213] (-1202.514) (-1202.791) (-1203.484) -- 0:00:46
269000 -- [-1203.625] (-1203.658) (-1204.266) (-1202.289) * (-1202.412) (-1205.123) [-1202.919] (-1202.111) -- 0:00:46
269500 -- (-1204.329) (-1204.765) (-1205.046) [-1203.045] * (-1206.043) (-1202.338) (-1202.919) [-1202.796] -- 0:00:46
270000 -- (-1202.393) (-1206.223) (-1205.219) [-1204.212] * [-1202.401] (-1203.697) (-1202.740) (-1203.486) -- 0:00:45
Average standard deviation of split frequencies: 0.013318
270500 -- (-1202.577) (-1204.531) (-1203.054) [-1201.856] * (-1203.713) (-1205.585) (-1203.278) [-1203.438] -- 0:00:45
271000 -- (-1204.197) [-1206.442] (-1203.715) (-1202.524) * [-1204.554] (-1206.733) (-1205.414) (-1204.692) -- 0:00:45
271500 -- [-1203.789] (-1203.622) (-1205.434) (-1204.460) * [-1203.314] (-1211.444) (-1203.557) (-1204.740) -- 0:00:45
272000 -- [-1203.173] (-1202.775) (-1207.852) (-1204.341) * [-1203.667] (-1210.797) (-1203.187) (-1203.902) -- 0:00:45
272500 -- (-1201.879) (-1204.702) [-1203.332] (-1203.067) * (-1203.095) (-1203.796) (-1204.972) [-1203.866] -- 0:00:45
273000 -- (-1208.578) (-1203.683) [-1202.734] (-1203.482) * (-1204.033) (-1204.445) (-1207.481) [-1205.224] -- 0:00:45
273500 -- (-1203.493) (-1201.924) [-1204.038] (-1204.572) * (-1202.307) (-1205.844) [-1203.723] (-1203.861) -- 0:00:45
274000 -- (-1204.031) (-1202.285) (-1203.504) [-1204.656] * [-1202.748] (-1207.156) (-1204.438) (-1203.630) -- 0:00:45
274500 -- [-1204.058] (-1202.726) (-1204.972) (-1208.630) * [-1204.601] (-1207.430) (-1205.918) (-1204.501) -- 0:00:44
275000 -- [-1204.273] (-1203.970) (-1205.191) (-1205.194) * [-1203.740] (-1202.505) (-1202.560) (-1204.469) -- 0:00:44
Average standard deviation of split frequencies: 0.013463
275500 -- (-1203.645) (-1204.074) (-1204.088) [-1205.110] * [-1202.643] (-1206.779) (-1202.251) (-1203.593) -- 0:00:44
276000 -- [-1204.669] (-1202.603) (-1204.580) (-1204.828) * (-1204.638) (-1205.402) (-1202.229) [-1204.405] -- 0:00:44
276500 -- (-1207.294) [-1205.697] (-1206.418) (-1204.871) * (-1203.100) [-1204.227] (-1202.246) (-1205.276) -- 0:00:44
277000 -- (-1207.272) (-1202.009) (-1206.984) [-1203.056] * [-1203.922] (-1201.684) (-1203.158) (-1206.330) -- 0:00:44
277500 -- (-1207.220) (-1205.674) (-1202.115) [-1203.414] * (-1203.961) [-1202.312] (-1202.496) (-1206.854) -- 0:00:44
278000 -- [-1205.922] (-1210.569) (-1204.263) (-1202.590) * (-1205.171) (-1203.692) [-1206.498] (-1203.989) -- 0:00:46
278500 -- (-1204.251) (-1203.946) [-1203.678] (-1202.705) * (-1205.367) (-1203.978) [-1203.567] (-1203.046) -- 0:00:46
279000 -- (-1201.636) [-1203.285] (-1202.933) (-1204.437) * (-1203.025) (-1203.495) (-1205.077) [-1205.667] -- 0:00:46
279500 -- [-1202.210] (-1211.174) (-1203.601) (-1206.316) * [-1202.597] (-1204.813) (-1204.820) (-1205.531) -- 0:00:46
280000 -- (-1206.895) (-1204.611) [-1203.382] (-1204.481) * (-1202.567) (-1203.469) [-1204.766] (-1204.114) -- 0:00:46
Average standard deviation of split frequencies: 0.014030
280500 -- (-1203.206) [-1204.236] (-1205.454) (-1202.824) * [-1203.831] (-1202.419) (-1203.584) (-1207.325) -- 0:00:46
281000 -- (-1202.844) (-1204.498) (-1208.286) [-1204.918] * (-1204.351) (-1202.460) [-1203.843] (-1203.242) -- 0:00:46
281500 -- (-1206.360) (-1203.105) (-1208.724) [-1203.086] * [-1202.961] (-1202.503) (-1203.953) (-1203.408) -- 0:00:45
282000 -- (-1205.933) (-1206.942) (-1206.574) [-1204.263] * (-1207.353) [-1202.933] (-1205.853) (-1205.204) -- 0:00:45
282500 -- (-1204.290) (-1203.604) (-1208.074) [-1204.195] * (-1203.261) (-1203.832) [-1203.964] (-1206.573) -- 0:00:45
283000 -- (-1204.876) [-1203.603] (-1206.183) (-1205.267) * [-1204.187] (-1203.833) (-1204.012) (-1204.597) -- 0:00:45
283500 -- (-1205.480) (-1202.180) (-1203.976) [-1206.442] * (-1204.944) (-1211.316) [-1203.890] (-1205.986) -- 0:00:45
284000 -- (-1203.871) (-1205.297) (-1204.063) [-1204.169] * [-1203.910] (-1202.475) (-1204.337) (-1208.593) -- 0:00:45
284500 -- (-1203.760) (-1202.411) (-1204.575) [-1205.889] * (-1204.013) (-1206.168) (-1203.402) [-1203.002] -- 0:00:45
285000 -- (-1202.270) (-1204.415) (-1203.363) [-1203.058] * (-1203.886) (-1207.570) (-1203.406) [-1204.632] -- 0:00:45
Average standard deviation of split frequencies: 0.013186
285500 -- (-1202.379) [-1203.017] (-1203.931) (-1204.696) * (-1203.951) (-1202.950) [-1205.201] (-1204.578) -- 0:00:45
286000 -- (-1202.367) [-1201.983] (-1202.211) (-1202.138) * (-1204.492) (-1204.440) [-1204.918] (-1206.234) -- 0:00:44
286500 -- (-1203.326) (-1202.814) (-1204.869) [-1202.287] * (-1203.791) [-1205.022] (-1203.990) (-1206.660) -- 0:00:44
287000 -- (-1202.618) [-1202.774] (-1205.161) (-1202.594) * (-1202.537) (-1205.154) (-1206.364) [-1203.457] -- 0:00:44
287500 -- (-1207.623) [-1203.157] (-1207.761) (-1203.482) * (-1205.461) (-1206.682) (-1205.090) [-1201.865] -- 0:00:44
288000 -- (-1205.842) (-1202.888) (-1205.664) [-1203.774] * (-1204.991) (-1206.060) (-1206.666) [-1201.619] -- 0:00:44
288500 -- (-1208.140) [-1207.342] (-1204.290) (-1204.024) * (-1205.008) (-1205.759) [-1207.076] (-1201.833) -- 0:00:44
289000 -- [-1203.942] (-1203.754) (-1205.407) (-1204.146) * [-1204.928] (-1206.176) (-1208.297) (-1202.220) -- 0:00:44
289500 -- (-1204.549) [-1202.413] (-1206.193) (-1203.262) * (-1209.230) [-1204.293] (-1205.218) (-1202.653) -- 0:00:44
290000 -- (-1205.971) (-1202.259) (-1202.601) [-1206.894] * [-1202.944] (-1203.424) (-1204.662) (-1201.856) -- 0:00:44
Average standard deviation of split frequencies: 0.012670
290500 -- [-1207.908] (-1205.419) (-1204.637) (-1203.479) * (-1202.944) (-1202.597) (-1202.230) [-1203.189] -- 0:00:43
291000 -- (-1201.883) (-1204.842) [-1206.839] (-1202.551) * [-1202.040] (-1203.330) (-1202.812) (-1202.006) -- 0:00:43
291500 -- (-1207.888) (-1207.650) [-1202.662] (-1202.335) * (-1204.020) (-1203.010) (-1203.847) [-1203.430] -- 0:00:43
292000 -- (-1205.733) (-1205.818) (-1202.627) [-1203.997] * [-1209.579] (-1202.612) (-1206.223) (-1204.045) -- 0:00:43
292500 -- [-1205.123] (-1203.705) (-1204.375) (-1202.236) * (-1202.653) (-1204.854) (-1204.406) [-1203.913] -- 0:00:43
293000 -- (-1204.443) [-1202.044] (-1203.951) (-1206.525) * [-1202.832] (-1203.372) (-1204.501) (-1203.218) -- 0:00:43
293500 -- (-1206.814) [-1202.189] (-1204.235) (-1202.559) * (-1205.681) (-1203.508) (-1205.898) [-1205.290] -- 0:00:43
294000 -- (-1209.883) [-1202.538] (-1203.838) (-1202.599) * [-1205.386] (-1202.498) (-1204.153) (-1203.420) -- 0:00:45
294500 -- (-1204.403) [-1203.882] (-1204.483) (-1203.943) * (-1203.412) (-1202.247) (-1203.257) [-1203.362] -- 0:00:45
295000 -- (-1203.569) (-1206.255) [-1202.453] (-1205.132) * [-1202.799] (-1202.944) (-1204.247) (-1202.188) -- 0:00:45
Average standard deviation of split frequencies: 0.013022
295500 -- (-1206.558) (-1203.509) [-1202.629] (-1204.185) * (-1203.069) (-1203.375) (-1206.675) [-1203.430] -- 0:00:45
296000 -- (-1205.991) (-1205.559) (-1202.387) [-1202.808] * [-1205.379] (-1204.862) (-1203.851) (-1202.660) -- 0:00:45
296500 -- (-1203.437) (-1204.073) [-1204.815] (-1206.330) * (-1202.833) (-1203.120) [-1204.752] (-1201.867) -- 0:00:45
297000 -- (-1202.540) (-1203.582) [-1203.415] (-1205.236) * (-1202.750) [-1202.571] (-1202.318) (-1202.217) -- 0:00:44
297500 -- (-1208.123) (-1204.339) [-1203.194] (-1209.150) * (-1204.025) (-1203.734) [-1202.448] (-1203.967) -- 0:00:44
298000 -- (-1203.952) (-1205.765) [-1203.156] (-1208.851) * (-1203.555) [-1204.097] (-1204.984) (-1202.323) -- 0:00:44
298500 -- [-1204.635] (-1202.864) (-1203.209) (-1204.802) * (-1203.236) (-1205.463) (-1205.267) [-1201.996] -- 0:00:44
299000 -- [-1207.842] (-1202.630) (-1203.665) (-1205.556) * (-1203.145) (-1203.542) (-1206.283) [-1201.978] -- 0:00:44
299500 -- (-1202.648) (-1204.103) [-1202.685] (-1205.100) * (-1202.839) (-1205.130) (-1205.236) [-1202.413] -- 0:00:44
300000 -- (-1202.570) (-1204.431) (-1206.194) [-1203.007] * (-1203.430) [-1205.066] (-1204.275) (-1203.369) -- 0:00:44
Average standard deviation of split frequencies: 0.013557
300500 -- (-1203.774) (-1204.766) [-1205.855] (-1204.930) * (-1202.349) (-1205.033) (-1205.015) [-1203.288] -- 0:00:44
301000 -- (-1204.541) (-1205.877) [-1205.147] (-1203.768) * [-1202.545] (-1205.758) (-1205.342) (-1207.499) -- 0:00:44
301500 -- [-1204.137] (-1205.048) (-1203.468) (-1203.809) * (-1203.960) [-1204.044] (-1206.406) (-1206.319) -- 0:00:44
302000 -- (-1205.285) [-1204.404] (-1205.377) (-1206.837) * (-1205.053) (-1202.049) [-1203.588] (-1206.229) -- 0:00:43
302500 -- (-1204.337) (-1204.470) (-1207.143) [-1204.454] * (-1204.691) (-1204.713) (-1206.551) [-1202.299] -- 0:00:43
303000 -- (-1207.613) (-1205.936) [-1206.778] (-1204.496) * (-1204.151) (-1203.625) [-1202.596] (-1203.359) -- 0:00:43
303500 -- (-1203.406) (-1202.585) [-1204.897] (-1204.995) * (-1203.957) [-1203.730] (-1202.250) (-1203.792) -- 0:00:43
304000 -- (-1203.098) (-1206.808) (-1203.947) [-1202.605] * (-1204.371) [-1202.578] (-1202.407) (-1204.820) -- 0:00:43
304500 -- (-1203.188) [-1203.428] (-1205.896) (-1202.375) * (-1205.454) [-1203.163] (-1205.391) (-1203.564) -- 0:00:43
305000 -- (-1205.280) [-1201.786] (-1203.341) (-1203.603) * (-1203.653) (-1206.827) (-1203.574) [-1207.714] -- 0:00:43
Average standard deviation of split frequencies: 0.013049
305500 -- [-1204.421] (-1201.943) (-1204.381) (-1204.036) * [-1203.734] (-1203.154) (-1203.872) (-1204.664) -- 0:00:43
306000 -- [-1202.757] (-1202.129) (-1206.009) (-1209.148) * [-1207.916] (-1206.561) (-1203.108) (-1204.268) -- 0:00:43
306500 -- (-1202.421) [-1204.384] (-1205.340) (-1203.028) * (-1204.518) [-1204.462] (-1205.064) (-1202.721) -- 0:00:42
307000 -- (-1203.111) (-1203.259) (-1205.442) [-1203.032] * (-1205.220) [-1204.336] (-1204.346) (-1202.827) -- 0:00:42
307500 -- (-1205.345) (-1206.040) (-1206.041) [-1203.351] * [-1205.819] (-1203.724) (-1202.809) (-1202.745) -- 0:00:42
308000 -- (-1204.437) (-1201.700) (-1202.182) [-1204.490] * (-1204.183) (-1203.407) [-1203.586] (-1202.654) -- 0:00:42
308500 -- (-1203.550) (-1202.257) [-1203.421] (-1203.736) * (-1207.541) (-1203.668) [-1203.068] (-1205.823) -- 0:00:42
309000 -- (-1205.065) [-1202.270] (-1205.428) (-1204.231) * (-1208.985) (-1202.227) [-1202.775] (-1202.808) -- 0:00:42
309500 -- (-1206.634) [-1203.544] (-1207.218) (-1203.873) * (-1206.128) (-1203.827) [-1204.049] (-1209.930) -- 0:00:42
310000 -- (-1203.586) [-1202.534] (-1203.678) (-1202.761) * [-1202.690] (-1207.368) (-1203.307) (-1205.007) -- 0:00:42
Average standard deviation of split frequencies: 0.013478
310500 -- (-1208.499) [-1202.044] (-1207.901) (-1207.053) * (-1204.146) (-1205.821) (-1202.729) [-1204.375] -- 0:00:44
311000 -- (-1207.106) [-1204.144] (-1203.285) (-1206.647) * (-1203.775) (-1205.750) [-1204.539] (-1204.430) -- 0:00:44
311500 -- [-1201.837] (-1207.403) (-1202.607) (-1204.600) * (-1205.760) (-1204.306) [-1205.408] (-1203.468) -- 0:00:44
312000 -- (-1202.921) (-1205.327) [-1203.348] (-1205.175) * (-1204.652) (-1206.295) [-1204.875] (-1203.672) -- 0:00:44
312500 -- (-1203.264) (-1205.284) (-1207.438) [-1203.236] * (-1203.414) (-1203.675) (-1203.740) [-1205.036] -- 0:00:44
313000 -- (-1204.052) (-1203.712) (-1210.443) [-1203.056] * [-1203.543] (-1202.904) (-1204.099) (-1203.673) -- 0:00:43
313500 -- (-1204.829) (-1205.024) (-1203.047) [-1205.854] * [-1203.285] (-1202.903) (-1205.952) (-1204.801) -- 0:00:43
314000 -- (-1207.991) (-1202.230) (-1203.499) [-1202.310] * (-1205.232) (-1204.738) (-1204.249) [-1204.078] -- 0:00:43
314500 -- (-1205.548) [-1202.445] (-1202.051) (-1202.972) * (-1203.939) (-1203.290) (-1205.336) [-1206.812] -- 0:00:43
315000 -- (-1205.467) [-1202.926] (-1202.102) (-1203.586) * (-1206.121) (-1206.177) [-1205.532] (-1203.242) -- 0:00:43
Average standard deviation of split frequencies: 0.012198
315500 -- [-1204.363] (-1204.685) (-1202.208) (-1204.059) * [-1203.594] (-1206.526) (-1203.414) (-1203.405) -- 0:00:43
316000 -- [-1204.122] (-1203.698) (-1202.908) (-1207.762) * (-1202.629) (-1204.804) [-1203.388] (-1202.815) -- 0:00:43
316500 -- (-1204.030) [-1205.415] (-1202.122) (-1207.696) * (-1202.205) [-1202.801] (-1203.389) (-1204.680) -- 0:00:43
317000 -- [-1206.059] (-1204.460) (-1203.695) (-1204.598) * (-1202.322) (-1204.016) (-1206.717) [-1204.440] -- 0:00:43
317500 -- [-1202.963] (-1203.542) (-1202.290) (-1203.911) * (-1206.165) (-1203.623) [-1206.995] (-1203.691) -- 0:00:42
318000 -- (-1205.967) (-1202.608) [-1202.397] (-1206.502) * (-1206.771) [-1203.631] (-1201.706) (-1203.324) -- 0:00:42
318500 -- (-1205.157) (-1206.035) [-1203.113] (-1205.204) * (-1208.035) [-1202.817] (-1201.603) (-1202.178) -- 0:00:42
319000 -- (-1206.210) [-1202.373] (-1204.994) (-1205.829) * [-1204.437] (-1204.230) (-1201.954) (-1202.931) -- 0:00:42
319500 -- (-1205.230) (-1202.333) [-1203.585] (-1205.412) * (-1208.658) (-1203.392) (-1203.015) [-1202.462] -- 0:00:42
320000 -- [-1203.382] (-1201.806) (-1209.491) (-1204.164) * (-1208.886) [-1205.627] (-1203.237) (-1203.060) -- 0:00:42
Average standard deviation of split frequencies: 0.011944
320500 -- (-1205.343) (-1207.392) (-1205.033) [-1201.611] * (-1203.638) (-1204.240) [-1203.931] (-1207.052) -- 0:00:42
321000 -- (-1203.805) (-1205.205) (-1206.692) [-1203.094] * [-1203.461] (-1203.594) (-1210.338) (-1206.892) -- 0:00:42
321500 -- [-1202.219] (-1203.180) (-1203.692) (-1203.093) * (-1203.138) [-1202.670] (-1211.604) (-1210.136) -- 0:00:42
322000 -- (-1201.934) (-1203.221) [-1202.486] (-1203.009) * [-1201.817] (-1202.103) (-1211.085) (-1202.319) -- 0:00:42
322500 -- (-1204.467) (-1205.851) [-1202.970] (-1203.439) * (-1206.839) (-1202.473) [-1206.283] (-1202.826) -- 0:00:42
323000 -- (-1203.526) (-1203.782) [-1201.854] (-1204.224) * [-1206.556] (-1206.900) (-1205.487) (-1201.795) -- 0:00:41
323500 -- (-1203.416) (-1203.807) [-1201.717] (-1207.918) * (-1202.557) [-1206.580] (-1205.239) (-1205.288) -- 0:00:41
324000 -- (-1203.132) (-1203.354) (-1204.202) [-1204.717] * (-1202.504) (-1207.093) (-1202.930) [-1206.184] -- 0:00:41
324500 -- (-1204.521) (-1202.669) [-1202.891] (-1201.819) * (-1206.272) (-1202.227) (-1203.802) [-1203.223] -- 0:00:41
325000 -- (-1203.413) (-1201.939) [-1203.810] (-1201.815) * [-1205.274] (-1203.505) (-1204.341) (-1203.217) -- 0:00:41
Average standard deviation of split frequencies: 0.011568
325500 -- (-1203.874) [-1201.967] (-1205.520) (-1202.455) * (-1202.631) (-1206.920) [-1206.513] (-1203.679) -- 0:00:41
326000 -- (-1205.240) (-1206.904) (-1202.677) [-1203.185] * [-1202.553] (-1206.272) (-1207.339) (-1205.219) -- 0:00:41
326500 -- [-1203.936] (-1203.493) (-1202.618) (-1202.303) * [-1203.013] (-1203.683) (-1204.543) (-1203.108) -- 0:00:43
327000 -- (-1205.753) (-1202.728) [-1205.001] (-1203.489) * (-1205.409) (-1203.355) [-1204.871] (-1203.455) -- 0:00:43
327500 -- (-1206.197) [-1202.729] (-1203.889) (-1202.427) * (-1202.770) (-1202.874) [-1202.209] (-1203.835) -- 0:00:43
328000 -- [-1206.658] (-1205.380) (-1207.385) (-1202.378) * (-1202.830) (-1203.689) [-1202.300] (-1204.677) -- 0:00:43
328500 -- (-1207.639) [-1202.241] (-1204.830) (-1203.055) * [-1203.334] (-1207.299) (-1203.660) (-1202.821) -- 0:00:42
329000 -- (-1201.832) [-1203.249] (-1205.106) (-1205.702) * (-1203.523) (-1204.523) [-1203.228] (-1208.001) -- 0:00:42
329500 -- [-1205.630] (-1202.967) (-1205.937) (-1202.878) * (-1202.813) [-1202.830] (-1205.678) (-1205.780) -- 0:00:42
330000 -- (-1205.341) (-1203.711) [-1203.871] (-1201.847) * (-1201.933) [-1202.300] (-1206.115) (-1207.149) -- 0:00:42
Average standard deviation of split frequencies: 0.011583
330500 -- [-1203.104] (-1206.431) (-1202.587) (-1201.847) * (-1204.176) [-1203.125] (-1205.285) (-1207.450) -- 0:00:42
331000 -- [-1203.801] (-1202.465) (-1204.257) (-1203.833) * [-1202.100] (-1201.794) (-1202.553) (-1204.390) -- 0:00:42
331500 -- (-1206.293) (-1203.902) [-1204.610] (-1204.050) * (-1202.158) [-1204.901] (-1204.786) (-1207.170) -- 0:00:42
332000 -- (-1206.015) [-1203.255] (-1203.462) (-1203.172) * (-1206.769) (-1205.773) [-1203.064] (-1203.356) -- 0:00:42
332500 -- [-1203.640] (-1206.501) (-1205.962) (-1202.210) * [-1203.166] (-1201.930) (-1203.548) (-1202.712) -- 0:00:42
333000 -- (-1204.012) (-1207.453) (-1201.858) [-1202.266] * (-1203.244) (-1204.665) (-1203.287) [-1204.045] -- 0:00:42
333500 -- (-1206.964) (-1203.518) [-1204.532] (-1202.218) * (-1205.568) (-1203.465) [-1203.493] (-1208.173) -- 0:00:41
334000 -- [-1203.351] (-1202.460) (-1202.175) (-1203.865) * (-1205.246) (-1202.236) (-1203.953) [-1203.835] -- 0:00:41
334500 -- (-1203.124) [-1203.978] (-1203.216) (-1202.640) * (-1205.527) (-1203.816) (-1204.010) [-1202.170] -- 0:00:41
335000 -- (-1203.430) (-1205.825) [-1206.153] (-1203.820) * (-1203.266) [-1203.575] (-1202.619) (-1203.395) -- 0:00:41
Average standard deviation of split frequencies: 0.012188
335500 -- (-1205.155) (-1204.438) (-1202.022) [-1203.565] * (-1203.336) [-1205.422] (-1202.297) (-1203.538) -- 0:00:41
336000 -- (-1202.859) (-1203.945) [-1204.512] (-1206.497) * [-1204.715] (-1203.631) (-1203.812) (-1204.247) -- 0:00:41
336500 -- (-1202.992) [-1201.761] (-1207.324) (-1202.907) * [-1202.888] (-1202.429) (-1204.957) (-1205.752) -- 0:00:41
337000 -- (-1204.960) (-1202.892) [-1201.984] (-1201.868) * [-1202.932] (-1203.243) (-1205.902) (-1202.825) -- 0:00:41
337500 -- [-1204.768] (-1202.781) (-1202.353) (-1204.205) * [-1203.917] (-1203.164) (-1202.338) (-1203.134) -- 0:00:41
338000 -- [-1204.426] (-1204.659) (-1205.789) (-1203.665) * (-1205.836) (-1203.802) [-1204.528] (-1203.256) -- 0:00:41
338500 -- (-1205.321) (-1205.221) [-1205.047] (-1203.625) * (-1202.361) (-1203.206) [-1207.175] (-1204.828) -- 0:00:41
339000 -- [-1203.878] (-1202.746) (-1208.423) (-1203.246) * (-1202.020) (-1204.239) (-1206.683) [-1204.546] -- 0:00:40
339500 -- (-1202.516) (-1208.692) (-1202.963) [-1202.395] * (-1201.918) (-1204.182) [-1202.698] (-1204.673) -- 0:00:40
340000 -- [-1202.720] (-1207.884) (-1204.217) (-1204.100) * (-1201.930) [-1204.280] (-1201.945) (-1205.578) -- 0:00:40
Average standard deviation of split frequencies: 0.012047
340500 -- (-1203.327) (-1205.270) [-1203.698] (-1203.982) * (-1201.599) [-1207.680] (-1202.487) (-1205.536) -- 0:00:40
341000 -- (-1202.351) (-1205.037) [-1201.554] (-1204.472) * (-1202.119) [-1203.209] (-1203.632) (-1206.007) -- 0:00:40
341500 -- (-1206.089) [-1202.003] (-1201.890) (-1204.927) * (-1202.680) (-1207.515) (-1202.434) [-1206.687] -- 0:00:40
342000 -- (-1204.727) [-1204.334] (-1207.403) (-1202.095) * (-1206.597) (-1203.078) [-1204.307] (-1205.515) -- 0:00:40
342500 -- [-1204.443] (-1203.007) (-1207.209) (-1202.212) * (-1202.823) (-1203.020) [-1204.091] (-1204.468) -- 0:00:40
343000 -- (-1204.022) (-1202.400) [-1206.738] (-1206.631) * (-1202.949) [-1204.022] (-1204.739) (-1203.570) -- 0:00:42
343500 -- [-1204.218] (-1204.882) (-1203.430) (-1203.486) * (-1205.435) (-1203.529) [-1208.326] (-1205.209) -- 0:00:42
344000 -- (-1206.564) (-1207.944) (-1203.576) [-1205.071] * [-1203.591] (-1208.332) (-1203.048) (-1203.848) -- 0:00:41
344500 -- (-1204.032) (-1204.568) [-1203.605] (-1205.716) * (-1203.843) (-1203.510) [-1205.864] (-1208.528) -- 0:00:41
345000 -- [-1204.946] (-1204.288) (-1201.733) (-1207.985) * (-1203.354) [-1211.434] (-1202.631) (-1203.989) -- 0:00:41
Average standard deviation of split frequencies: 0.012983
345500 -- (-1204.116) (-1203.510) (-1202.027) [-1206.511] * (-1203.807) [-1204.366] (-1203.264) (-1203.785) -- 0:00:41
346000 -- (-1203.994) (-1203.510) [-1203.305] (-1209.338) * (-1203.904) (-1206.130) [-1206.694] (-1203.813) -- 0:00:41
346500 -- (-1206.104) [-1203.293] (-1202.178) (-1205.246) * (-1202.352) [-1202.500] (-1203.323) (-1204.897) -- 0:00:41
347000 -- (-1204.115) (-1203.411) (-1208.609) [-1203.425] * (-1203.464) (-1204.020) (-1203.272) [-1204.090] -- 0:00:41
347500 -- (-1203.406) (-1203.644) (-1205.228) [-1203.482] * (-1203.124) (-1203.099) (-1202.685) [-1203.126] -- 0:00:41
348000 -- (-1204.312) (-1203.686) [-1206.780] (-1204.446) * (-1207.050) (-1203.422) (-1202.806) [-1202.395] -- 0:00:41
348500 -- (-1203.546) [-1202.837] (-1203.252) (-1202.252) * [-1207.946] (-1207.567) (-1205.499) (-1203.607) -- 0:00:41
349000 -- [-1205.314] (-1204.101) (-1203.259) (-1206.734) * (-1205.605) (-1204.320) (-1202.046) [-1204.299] -- 0:00:41
349500 -- (-1204.635) (-1202.768) (-1204.836) [-1202.040] * (-1203.284) (-1204.687) (-1204.308) [-1201.901] -- 0:00:40
350000 -- (-1204.742) (-1203.963) (-1205.212) [-1203.802] * (-1204.268) (-1203.228) (-1203.025) [-1202.926] -- 0:00:40
Average standard deviation of split frequencies: 0.013443
350500 -- [-1204.266] (-1205.883) (-1209.201) (-1204.875) * (-1206.276) [-1202.766] (-1206.383) (-1213.572) -- 0:00:40
351000 -- (-1204.479) (-1204.192) [-1204.430] (-1202.949) * (-1208.274) (-1203.299) (-1204.980) [-1204.282] -- 0:00:40
351500 -- (-1204.527) (-1208.215) [-1207.576] (-1204.561) * (-1206.675) (-1203.292) [-1205.076] (-1206.120) -- 0:00:40
352000 -- (-1203.863) [-1201.798] (-1205.268) (-1202.764) * (-1207.716) (-1207.373) (-1202.369) [-1201.947] -- 0:00:40
352500 -- [-1205.467] (-1201.798) (-1203.278) (-1203.011) * (-1203.916) (-1205.763) [-1202.628] (-1203.832) -- 0:00:40
353000 -- [-1203.866] (-1201.667) (-1204.053) (-1204.377) * (-1202.966) (-1207.569) (-1205.900) [-1203.809] -- 0:00:40
353500 -- (-1203.362) [-1205.220] (-1203.533) (-1203.329) * (-1202.966) (-1206.563) [-1202.931] (-1203.017) -- 0:00:40
354000 -- [-1203.560] (-1205.921) (-1203.707) (-1205.665) * [-1204.203] (-1205.032) (-1201.692) (-1204.707) -- 0:00:40
354500 -- (-1204.609) (-1203.443) (-1204.341) [-1202.708] * (-1204.402) (-1203.088) [-1204.022] (-1202.647) -- 0:00:40
355000 -- (-1202.712) (-1208.836) [-1203.298] (-1205.348) * [-1205.372] (-1202.752) (-1205.503) (-1205.187) -- 0:00:39
Average standard deviation of split frequencies: 0.013407
355500 -- (-1205.377) [-1204.819] (-1204.681) (-1214.641) * (-1205.430) [-1203.607] (-1206.356) (-1204.176) -- 0:00:39
356000 -- [-1203.036] (-1202.736) (-1205.597) (-1206.535) * (-1203.939) (-1203.167) (-1205.080) [-1205.399] -- 0:00:39
356500 -- (-1202.821) (-1205.195) (-1206.989) [-1203.582] * [-1201.531] (-1205.526) (-1203.756) (-1204.580) -- 0:00:39
357000 -- [-1203.959] (-1207.211) (-1204.778) (-1206.619) * [-1203.520] (-1202.826) (-1203.767) (-1205.946) -- 0:00:39
357500 -- [-1203.614] (-1203.274) (-1204.507) (-1202.379) * (-1204.964) (-1205.218) (-1203.978) [-1202.057] -- 0:00:39
358000 -- (-1204.988) [-1202.794] (-1204.223) (-1205.027) * [-1206.965] (-1204.283) (-1203.695) (-1202.578) -- 0:00:39
358500 -- (-1203.227) (-1202.312) [-1201.979] (-1203.289) * (-1203.007) (-1204.302) [-1201.867] (-1202.697) -- 0:00:39
359000 -- [-1206.856] (-1202.436) (-1203.544) (-1206.146) * (-1201.609) (-1204.312) (-1202.880) [-1203.389] -- 0:00:41
359500 -- (-1204.946) [-1205.388] (-1204.765) (-1204.374) * (-1203.033) (-1202.911) (-1202.680) [-1203.180] -- 0:00:40
360000 -- (-1203.425) (-1204.553) (-1203.957) [-1205.548] * [-1205.061] (-1206.088) (-1205.441) (-1203.157) -- 0:00:40
Average standard deviation of split frequencies: 0.013685
360500 -- (-1202.231) (-1203.096) [-1203.770] (-1203.135) * (-1204.890) [-1205.793] (-1203.506) (-1202.254) -- 0:00:40
361000 -- [-1203.655] (-1203.355) (-1208.389) (-1202.774) * [-1205.449] (-1204.811) (-1203.859) (-1204.662) -- 0:00:40
361500 -- (-1203.504) (-1202.468) [-1206.071] (-1203.111) * [-1204.092] (-1204.459) (-1206.073) (-1203.794) -- 0:00:40
362000 -- [-1203.537] (-1202.458) (-1203.581) (-1206.055) * [-1211.994] (-1202.708) (-1203.100) (-1205.812) -- 0:00:40
362500 -- (-1203.594) (-1202.543) (-1204.506) [-1207.911] * (-1213.391) (-1204.102) (-1206.180) [-1206.118] -- 0:00:40
363000 -- [-1206.908] (-1206.033) (-1202.960) (-1207.941) * (-1209.398) [-1203.713] (-1208.396) (-1203.168) -- 0:00:40
363500 -- (-1205.244) [-1202.709] (-1205.343) (-1205.928) * (-1204.259) (-1202.550) [-1206.750] (-1203.917) -- 0:00:40
364000 -- (-1204.864) [-1207.202] (-1203.168) (-1205.267) * (-1203.458) (-1205.951) (-1206.878) [-1202.506] -- 0:00:40
364500 -- (-1206.183) [-1204.160] (-1203.058) (-1204.574) * [-1204.074] (-1205.312) (-1211.394) (-1203.634) -- 0:00:40
365000 -- (-1204.687) [-1206.280] (-1202.234) (-1202.706) * [-1204.863] (-1204.797) (-1206.331) (-1205.984) -- 0:00:40
Average standard deviation of split frequencies: 0.013334
365500 -- (-1206.101) (-1209.314) [-1202.234] (-1202.460) * [-1202.290] (-1203.070) (-1204.195) (-1203.033) -- 0:00:39
366000 -- (-1202.536) [-1206.064] (-1206.019) (-1202.289) * [-1204.394] (-1203.123) (-1203.975) (-1203.619) -- 0:00:39
366500 -- (-1206.217) [-1204.051] (-1205.483) (-1205.681) * [-1204.534] (-1206.379) (-1203.606) (-1203.807) -- 0:00:39
367000 -- [-1204.568] (-1205.601) (-1204.838) (-1204.059) * (-1204.430) (-1207.191) [-1203.896] (-1203.520) -- 0:00:39
367500 -- (-1209.358) [-1204.173] (-1203.014) (-1204.600) * (-1201.925) [-1202.304] (-1205.136) (-1203.531) -- 0:00:39
368000 -- (-1202.763) (-1203.558) [-1202.887] (-1208.143) * (-1202.033) [-1202.833] (-1204.089) (-1205.930) -- 0:00:39
368500 -- [-1202.700] (-1204.631) (-1203.226) (-1206.027) * (-1203.962) [-1203.119] (-1202.972) (-1205.572) -- 0:00:39
369000 -- (-1207.458) (-1206.397) [-1202.218] (-1203.373) * (-1203.559) (-1203.726) [-1203.537] (-1202.881) -- 0:00:39
369500 -- (-1202.294) (-1207.484) (-1204.526) [-1202.080] * [-1203.883] (-1203.189) (-1203.337) (-1205.613) -- 0:00:39
370000 -- (-1202.354) (-1204.713) (-1202.016) [-1204.909] * [-1204.752] (-1203.110) (-1203.260) (-1207.144) -- 0:00:39
Average standard deviation of split frequencies: 0.013990
370500 -- (-1202.542) [-1204.153] (-1204.794) (-1204.628) * (-1204.602) (-1202.574) (-1201.988) [-1202.831] -- 0:00:39
371000 -- [-1207.560] (-1204.386) (-1204.288) (-1208.214) * (-1203.293) [-1202.454] (-1204.379) (-1206.071) -- 0:00:38
371500 -- [-1201.773] (-1202.749) (-1205.317) (-1204.240) * (-1203.208) [-1202.297] (-1206.181) (-1202.864) -- 0:00:38
372000 -- (-1201.853) (-1202.941) (-1207.392) [-1201.690] * (-1202.155) (-1203.539) [-1204.838] (-1206.813) -- 0:00:38
372500 -- [-1202.185] (-1201.782) (-1202.819) (-1202.044) * [-1205.710] (-1203.812) (-1203.062) (-1203.914) -- 0:00:38
373000 -- [-1203.293] (-1204.271) (-1202.231) (-1202.284) * (-1202.982) (-1204.869) [-1202.282] (-1201.941) -- 0:00:38
373500 -- (-1203.073) (-1204.256) [-1204.250] (-1203.682) * (-1205.983) (-1203.995) [-1203.159] (-1203.938) -- 0:00:38
374000 -- (-1202.333) (-1202.009) [-1204.025] (-1203.382) * (-1204.314) (-1205.479) [-1202.349] (-1204.709) -- 0:00:38
374500 -- (-1205.541) [-1204.287] (-1203.173) (-1205.512) * (-1203.631) (-1204.683) (-1203.542) [-1205.345] -- 0:00:38
375000 -- (-1205.020) (-1202.814) (-1202.300) [-1202.266] * [-1205.590] (-1205.971) (-1206.970) (-1204.281) -- 0:00:38
Average standard deviation of split frequencies: 0.013791
375500 -- (-1206.072) [-1201.745] (-1204.375) (-1203.043) * [-1203.453] (-1203.717) (-1208.048) (-1208.999) -- 0:00:39
376000 -- (-1202.612) (-1202.963) (-1204.416) [-1203.707] * (-1206.707) (-1203.852) [-1203.359] (-1209.105) -- 0:00:39
376500 -- (-1202.994) (-1202.909) (-1204.229) [-1203.679] * (-1204.796) (-1202.953) (-1204.173) [-1205.314] -- 0:00:39
377000 -- (-1205.377) (-1203.033) [-1202.719] (-1203.007) * (-1202.345) (-1205.734) (-1205.425) [-1202.042] -- 0:00:39
377500 -- (-1206.545) (-1204.372) (-1202.109) [-1204.976] * (-1203.015) (-1205.712) (-1207.129) [-1203.213] -- 0:00:39
378000 -- (-1204.252) [-1202.567] (-1203.321) (-1203.880) * (-1203.012) (-1205.447) (-1206.750) [-1201.736] -- 0:00:39
378500 -- (-1204.579) (-1204.333) [-1204.216] (-1204.574) * (-1204.321) (-1205.667) [-1202.548] (-1202.047) -- 0:00:39
379000 -- (-1202.893) (-1203.077) (-1204.473) [-1204.914] * (-1203.878) [-1205.063] (-1205.155) (-1205.262) -- 0:00:39
379500 -- (-1205.536) [-1203.446] (-1202.373) (-1202.242) * [-1203.609] (-1204.294) (-1204.453) (-1203.395) -- 0:00:39
380000 -- (-1204.456) (-1201.793) [-1201.842] (-1202.603) * [-1202.241] (-1203.712) (-1204.191) (-1204.970) -- 0:00:39
Average standard deviation of split frequencies: 0.014278
380500 -- (-1202.358) (-1203.053) (-1202.028) [-1202.073] * (-1203.928) (-1203.397) [-1205.165] (-1208.525) -- 0:00:39
381000 -- (-1206.827) [-1203.412] (-1205.853) (-1207.427) * (-1205.289) [-1202.684] (-1207.433) (-1203.075) -- 0:00:38
381500 -- (-1203.798) (-1202.845) (-1202.036) [-1204.576] * (-1205.246) (-1204.252) (-1203.618) [-1205.768] -- 0:00:38
382000 -- (-1205.327) (-1207.156) (-1205.870) [-1201.938] * (-1205.654) [-1203.476] (-1202.591) (-1204.543) -- 0:00:38
382500 -- (-1203.124) [-1204.219] (-1203.985) (-1201.786) * (-1206.847) (-1204.643) [-1204.657] (-1204.058) -- 0:00:38
383000 -- (-1203.285) [-1203.784] (-1204.396) (-1203.427) * [-1205.036] (-1205.815) (-1203.756) (-1202.070) -- 0:00:38
383500 -- (-1205.219) [-1201.769] (-1204.850) (-1207.092) * (-1208.403) (-1203.548) [-1203.295] (-1205.562) -- 0:00:38
384000 -- [-1206.570] (-1204.734) (-1205.059) (-1203.580) * (-1203.187) [-1205.763] (-1204.285) (-1205.144) -- 0:00:38
384500 -- (-1207.823) (-1205.677) (-1204.978) [-1202.858] * (-1207.301) (-1202.907) [-1209.346] (-1209.061) -- 0:00:38
385000 -- (-1204.326) (-1206.748) [-1202.382] (-1206.130) * (-1203.844) [-1202.986] (-1204.405) (-1204.117) -- 0:00:38
Average standard deviation of split frequencies: 0.013218
385500 -- (-1204.115) [-1204.679] (-1202.765) (-1208.136) * [-1204.735] (-1202.561) (-1203.556) (-1204.916) -- 0:00:38
386000 -- [-1203.211] (-1205.956) (-1207.528) (-1205.510) * (-1203.898) (-1203.751) [-1201.549] (-1205.574) -- 0:00:38
386500 -- [-1205.404] (-1204.000) (-1203.785) (-1208.336) * (-1204.762) (-1202.227) [-1202.630] (-1206.724) -- 0:00:38
387000 -- [-1204.607] (-1202.601) (-1207.886) (-1213.386) * (-1205.121) (-1205.739) [-1202.084] (-1206.930) -- 0:00:38
387500 -- (-1207.830) (-1204.154) (-1202.603) [-1209.524] * (-1206.692) [-1203.153] (-1201.511) (-1204.749) -- 0:00:37
388000 -- (-1203.128) (-1205.500) (-1202.493) [-1205.703] * [-1203.152] (-1203.458) (-1202.249) (-1202.930) -- 0:00:37
388500 -- [-1202.787] (-1202.830) (-1203.977) (-1204.206) * (-1205.320) [-1205.200] (-1203.136) (-1203.029) -- 0:00:37
389000 -- (-1203.520) [-1205.433] (-1201.892) (-1204.519) * (-1205.237) (-1203.486) (-1204.967) [-1207.421] -- 0:00:37
389500 -- (-1203.520) [-1204.557] (-1202.904) (-1203.099) * (-1203.109) (-1202.781) [-1206.957] (-1204.418) -- 0:00:37
390000 -- (-1203.454) [-1204.486] (-1202.203) (-1201.941) * (-1205.247) (-1204.545) (-1203.762) [-1202.776] -- 0:00:37
Average standard deviation of split frequencies: 0.013344
390500 -- (-1203.046) (-1205.931) [-1201.686] (-1201.941) * (-1204.724) (-1203.007) (-1204.022) [-1203.045] -- 0:00:37
391000 -- (-1203.107) (-1202.904) (-1202.244) [-1202.478] * (-1203.928) (-1205.433) [-1203.811] (-1208.943) -- 0:00:37
391500 -- (-1206.243) [-1206.436] (-1204.683) (-1203.387) * [-1202.894] (-1204.445) (-1205.724) (-1204.664) -- 0:00:38
392000 -- (-1204.638) (-1205.796) (-1204.210) [-1203.984] * (-1203.216) [-1204.877] (-1206.516) (-1204.931) -- 0:00:38
392500 -- (-1202.326) (-1204.513) [-1202.538] (-1206.190) * (-1203.717) (-1201.833) [-1204.166] (-1202.915) -- 0:00:38
393000 -- (-1203.555) (-1202.341) [-1206.055] (-1203.403) * (-1202.693) [-1201.984] (-1202.123) (-1203.925) -- 0:00:38
393500 -- [-1202.297] (-1203.577) (-1208.402) (-1204.606) * (-1204.153) [-1202.620] (-1202.874) (-1202.247) -- 0:00:38
394000 -- (-1205.062) [-1203.919] (-1205.402) (-1203.314) * (-1204.336) (-1204.904) [-1203.324] (-1202.280) -- 0:00:38
394500 -- [-1204.697] (-1203.584) (-1205.340) (-1206.542) * (-1201.807) (-1205.364) [-1203.040] (-1203.557) -- 0:00:38
395000 -- (-1203.248) (-1203.846) (-1205.333) [-1207.515] * (-1205.006) (-1206.385) [-1203.502] (-1206.348) -- 0:00:38
Average standard deviation of split frequencies: 0.013515
395500 -- (-1202.664) [-1205.433] (-1202.760) (-1207.031) * (-1202.520) (-1204.322) [-1202.859] (-1204.712) -- 0:00:38
396000 -- (-1203.658) [-1202.218] (-1206.013) (-1211.118) * (-1204.547) (-1203.072) (-1204.659) [-1204.774] -- 0:00:38
396500 -- [-1202.289] (-1202.374) (-1202.189) (-1212.008) * [-1202.690] (-1204.728) (-1207.657) (-1203.907) -- 0:00:38
397000 -- (-1208.697) (-1202.346) [-1202.155] (-1204.341) * (-1207.775) (-1202.382) (-1204.164) [-1205.998] -- 0:00:37
397500 -- [-1203.844] (-1201.823) (-1202.328) (-1203.070) * (-1206.322) [-1204.528] (-1203.425) (-1202.942) -- 0:00:37
398000 -- (-1204.443) [-1201.812] (-1205.870) (-1206.501) * (-1202.082) (-1205.036) [-1204.734] (-1202.121) -- 0:00:37
398500 -- (-1204.636) [-1203.421] (-1203.240) (-1203.023) * (-1202.278) (-1204.878) (-1203.385) [-1201.767] -- 0:00:37
399000 -- (-1203.640) [-1201.851] (-1202.070) (-1202.920) * [-1201.668] (-1204.251) (-1203.762) (-1206.035) -- 0:00:37
399500 -- (-1204.720) [-1201.580] (-1209.661) (-1202.835) * (-1203.434) (-1203.475) [-1207.122] (-1204.575) -- 0:00:37
400000 -- (-1205.147) (-1201.667) [-1205.285] (-1203.482) * (-1203.162) (-1202.294) (-1206.481) [-1206.618] -- 0:00:37
Average standard deviation of split frequencies: 0.014576
400500 -- (-1207.750) [-1201.809] (-1202.165) (-1203.706) * [-1203.371] (-1204.484) (-1208.756) (-1204.744) -- 0:00:37
401000 -- (-1208.364) [-1203.741] (-1204.228) (-1204.073) * [-1202.817] (-1205.116) (-1204.507) (-1204.666) -- 0:00:37
401500 -- (-1201.724) (-1202.872) (-1205.194) [-1205.279] * (-1202.674) (-1204.459) (-1202.920) [-1202.165] -- 0:00:37
402000 -- [-1202.544] (-1203.085) (-1205.289) (-1204.278) * (-1202.854) (-1203.084) (-1202.825) [-1203.285] -- 0:00:37
402500 -- (-1203.328) (-1204.244) (-1207.580) [-1209.280] * (-1205.509) (-1205.368) (-1202.334) [-1203.477] -- 0:00:37
403000 -- (-1204.105) (-1203.921) [-1206.764] (-1206.428) * (-1206.441) (-1205.571) [-1202.634] (-1204.808) -- 0:00:37
403500 -- (-1205.713) (-1201.909) [-1205.550] (-1206.695) * [-1205.341] (-1203.230) (-1202.632) (-1203.701) -- 0:00:36
404000 -- (-1205.441) (-1203.251) (-1207.432) [-1202.475] * (-1206.549) [-1203.611] (-1203.788) (-1203.166) -- 0:00:36
404500 -- (-1203.673) [-1205.133] (-1205.559) (-1202.229) * (-1207.453) (-1206.304) [-1203.174] (-1202.542) -- 0:00:36
405000 -- (-1202.571) (-1202.967) [-1205.656] (-1202.460) * (-1207.578) (-1205.673) [-1202.724] (-1202.512) -- 0:00:36
Average standard deviation of split frequencies: 0.015481
405500 -- [-1203.835] (-1204.402) (-1202.427) (-1202.460) * (-1207.603) [-1207.202] (-1205.709) (-1207.338) -- 0:00:36
406000 -- [-1204.076] (-1205.305) (-1204.286) (-1202.605) * [-1206.698] (-1203.351) (-1204.475) (-1203.895) -- 0:00:36
406500 -- (-1204.022) [-1206.354] (-1202.926) (-1202.337) * (-1203.430) (-1202.818) [-1203.166] (-1207.684) -- 0:00:36
407000 -- (-1207.941) (-1203.635) (-1206.563) [-1201.991] * [-1202.834] (-1202.178) (-1202.808) (-1204.039) -- 0:00:36
407500 -- (-1205.277) (-1204.372) [-1205.980] (-1202.760) * [-1202.136] (-1203.697) (-1203.339) (-1205.233) -- 0:00:36
408000 -- (-1203.676) [-1202.451] (-1205.087) (-1206.145) * (-1202.103) [-1202.475] (-1202.284) (-1204.679) -- 0:00:37
408500 -- (-1202.899) [-1202.451] (-1202.187) (-1201.965) * (-1202.261) [-1201.607] (-1206.213) (-1204.298) -- 0:00:37
409000 -- (-1205.678) [-1203.229] (-1203.563) (-1201.978) * [-1206.078] (-1203.136) (-1205.178) (-1206.300) -- 0:00:37
409500 -- (-1204.057) (-1202.794) [-1203.374] (-1206.325) * [-1202.294] (-1205.517) (-1204.664) (-1205.799) -- 0:00:37
410000 -- (-1204.880) (-1201.939) (-1203.783) [-1207.647] * [-1203.107] (-1204.176) (-1202.723) (-1204.806) -- 0:00:37
Average standard deviation of split frequencies: 0.016071
410500 -- (-1202.822) (-1201.742) (-1206.703) [-1206.107] * [-1203.570] (-1204.626) (-1204.978) (-1206.627) -- 0:00:37
411000 -- (-1202.660) [-1202.622] (-1203.250) (-1202.868) * (-1204.027) [-1203.156] (-1207.146) (-1203.691) -- 0:00:37
411500 -- (-1202.736) [-1205.432] (-1202.855) (-1204.685) * (-1209.958) (-1207.089) (-1207.044) [-1203.164] -- 0:00:37
412000 -- (-1205.217) [-1205.481] (-1207.907) (-1206.433) * (-1205.732) (-1202.492) (-1206.053) [-1202.930] -- 0:00:37
412500 -- (-1204.163) [-1207.905] (-1205.809) (-1202.230) * (-1203.712) [-1202.671] (-1204.614) (-1203.629) -- 0:00:37
413000 -- [-1201.928] (-1206.631) (-1204.398) (-1203.092) * (-1204.209) (-1207.017) (-1205.204) [-1204.440] -- 0:00:36
413500 -- [-1202.600] (-1202.203) (-1205.701) (-1204.685) * [-1205.352] (-1202.778) (-1201.964) (-1202.805) -- 0:00:36
414000 -- (-1204.213) (-1202.506) (-1202.724) [-1204.717] * [-1201.817] (-1204.323) (-1204.372) (-1202.332) -- 0:00:36
414500 -- [-1206.840] (-1204.182) (-1202.460) (-1204.199) * (-1202.341) [-1206.895] (-1204.166) (-1202.510) -- 0:00:36
415000 -- (-1205.892) (-1203.163) [-1204.447] (-1205.097) * (-1204.365) (-1201.931) [-1202.213] (-1203.326) -- 0:00:36
Average standard deviation of split frequencies: 0.015487
415500 -- (-1205.599) (-1202.612) (-1202.383) [-1205.437] * (-1204.081) [-1204.334] (-1202.166) (-1203.311) -- 0:00:36
416000 -- (-1203.117) (-1203.776) (-1202.278) [-1204.740] * (-1204.397) (-1202.921) [-1202.329] (-1203.589) -- 0:00:36
416500 -- (-1204.849) [-1201.748] (-1203.855) (-1204.580) * (-1204.127) (-1202.780) (-1204.172) [-1203.922] -- 0:00:36
417000 -- [-1206.119] (-1203.072) (-1203.984) (-1203.258) * [-1202.757] (-1204.575) (-1207.476) (-1206.038) -- 0:00:36
417500 -- (-1204.162) [-1203.974] (-1203.412) (-1205.525) * (-1204.554) [-1203.396] (-1205.232) (-1207.019) -- 0:00:36
418000 -- [-1203.083] (-1203.923) (-1202.629) (-1206.753) * (-1209.782) [-1203.515] (-1203.713) (-1203.656) -- 0:00:36
418500 -- [-1202.310] (-1203.179) (-1203.442) (-1204.861) * (-1206.103) [-1205.140] (-1206.079) (-1203.458) -- 0:00:36
419000 -- [-1203.144] (-1204.069) (-1203.602) (-1204.160) * (-1204.450) [-1204.063] (-1203.624) (-1206.150) -- 0:00:36
419500 -- (-1202.086) [-1206.002] (-1204.110) (-1202.597) * (-1202.164) [-1202.960] (-1205.605) (-1202.664) -- 0:00:35
420000 -- [-1202.220] (-1203.471) (-1201.875) (-1201.662) * (-1202.287) (-1204.706) (-1204.446) [-1202.573] -- 0:00:35
Average standard deviation of split frequencies: 0.014692
420500 -- (-1202.770) [-1202.653] (-1202.048) (-1203.179) * (-1202.287) (-1204.189) [-1203.364] (-1202.874) -- 0:00:35
421000 -- (-1205.671) (-1207.958) [-1203.025] (-1202.983) * (-1203.142) (-1205.297) [-1202.861] (-1205.973) -- 0:00:35
421500 -- (-1202.722) (-1203.941) (-1203.706) [-1204.268] * [-1202.442] (-1202.186) (-1204.050) (-1203.950) -- 0:00:35
422000 -- (-1203.029) (-1202.254) (-1205.070) [-1204.312] * [-1203.196] (-1202.318) (-1206.483) (-1202.830) -- 0:00:35
422500 -- (-1202.653) (-1202.715) (-1205.251) [-1205.928] * [-1203.943] (-1205.267) (-1204.451) (-1204.650) -- 0:00:35
423000 -- (-1202.261) (-1202.902) [-1202.027] (-1203.404) * (-1203.190) (-1209.758) (-1203.948) [-1205.006] -- 0:00:35
423500 -- [-1205.857] (-1201.762) (-1202.157) (-1202.566) * [-1201.833] (-1203.590) (-1207.241) (-1204.844) -- 0:00:35
424000 -- (-1203.618) (-1203.440) (-1202.630) [-1202.871] * (-1202.366) (-1203.226) (-1203.340) [-1202.583] -- 0:00:35
424500 -- (-1202.667) [-1205.408] (-1204.433) (-1203.400) * (-1203.663) (-1203.524) (-1203.062) [-1202.569] -- 0:00:36
425000 -- [-1202.248] (-1203.250) (-1206.183) (-1208.216) * (-1201.700) (-1202.941) [-1203.122] (-1202.244) -- 0:00:36
Average standard deviation of split frequencies: 0.014447
425500 -- (-1210.526) (-1202.135) [-1202.759] (-1203.579) * [-1202.708] (-1206.158) (-1203.613) (-1204.445) -- 0:00:36
426000 -- (-1203.731) (-1204.147) [-1204.101] (-1205.191) * [-1204.245] (-1204.106) (-1202.379) (-1205.224) -- 0:00:36
426500 -- (-1203.446) (-1206.195) (-1203.011) [-1203.936] * (-1204.154) (-1203.468) [-1205.087] (-1203.990) -- 0:00:36
427000 -- (-1204.643) (-1205.962) [-1204.831] (-1201.937) * (-1206.945) (-1204.971) (-1205.914) [-1203.468] -- 0:00:36
427500 -- (-1205.642) (-1205.870) [-1202.342] (-1204.622) * (-1202.145) [-1204.922] (-1203.732) (-1203.988) -- 0:00:36
428000 -- [-1204.564] (-1204.234) (-1201.608) (-1205.518) * (-1202.137) (-1203.364) (-1203.740) [-1205.010] -- 0:00:36
428500 -- [-1202.464] (-1201.777) (-1202.598) (-1206.300) * (-1201.481) (-1202.385) [-1203.038] (-1205.174) -- 0:00:36
429000 -- (-1204.687) (-1202.906) (-1204.493) [-1205.297] * (-1202.977) (-1202.313) [-1202.592] (-1205.874) -- 0:00:35
429500 -- (-1204.277) (-1204.178) (-1201.693) [-1204.065] * [-1201.975] (-1202.463) (-1207.274) (-1204.281) -- 0:00:35
430000 -- [-1202.853] (-1204.149) (-1202.821) (-1206.405) * (-1202.619) (-1202.831) (-1205.245) [-1203.943] -- 0:00:35
Average standard deviation of split frequencies: 0.014938
430500 -- [-1204.913] (-1204.133) (-1202.916) (-1206.250) * (-1204.273) (-1208.526) (-1205.826) [-1203.655] -- 0:00:35
431000 -- (-1205.988) (-1205.339) (-1204.095) [-1204.770] * (-1202.032) (-1205.221) [-1202.789] (-1202.559) -- 0:00:35
431500 -- (-1203.007) (-1205.538) (-1208.055) [-1207.361] * (-1206.378) (-1203.005) (-1202.451) [-1203.894] -- 0:00:35
432000 -- (-1202.273) (-1203.956) (-1204.826) [-1205.541] * (-1206.890) [-1203.237] (-1202.387) (-1205.112) -- 0:00:35
432500 -- (-1203.782) [-1201.935] (-1205.916) (-1206.027) * (-1203.843) [-1204.130] (-1204.954) (-1204.364) -- 0:00:35
433000 -- (-1204.230) (-1204.474) (-1202.819) [-1204.485] * (-1202.321) [-1202.982] (-1206.939) (-1204.216) -- 0:00:35
433500 -- [-1203.513] (-1202.832) (-1203.483) (-1205.789) * (-1204.851) [-1203.454] (-1202.807) (-1202.218) -- 0:00:35
434000 -- [-1202.615] (-1204.068) (-1203.483) (-1202.622) * (-1202.197) (-1204.620) [-1202.757] (-1202.626) -- 0:00:35
434500 -- (-1204.888) (-1204.919) (-1209.635) [-1202.676] * (-1204.293) (-1206.851) [-1202.722] (-1203.006) -- 0:00:35
435000 -- (-1206.398) (-1208.884) [-1205.221] (-1205.899) * (-1203.366) [-1204.111] (-1203.092) (-1203.227) -- 0:00:35
Average standard deviation of split frequencies: 0.014374
435500 -- (-1204.643) (-1203.657) (-1202.847) [-1203.482] * (-1202.955) (-1205.857) (-1204.692) [-1210.127] -- 0:00:34
436000 -- (-1204.478) [-1202.730] (-1203.091) (-1203.477) * (-1203.496) (-1203.557) (-1206.777) [-1205.160] -- 0:00:34
436500 -- (-1210.215) [-1202.819] (-1202.175) (-1202.421) * [-1204.955] (-1203.455) (-1206.084) (-1202.963) -- 0:00:34
437000 -- (-1203.501) [-1201.872] (-1205.051) (-1202.638) * (-1205.524) (-1204.024) [-1202.490] (-1204.570) -- 0:00:34
437500 -- (-1203.088) (-1201.736) [-1207.299] (-1205.905) * (-1204.837) (-1202.380) [-1203.826] (-1203.305) -- 0:00:34
438000 -- (-1205.206) (-1203.626) [-1204.417] (-1205.539) * (-1204.535) (-1205.131) [-1202.814] (-1202.627) -- 0:00:34
438500 -- (-1207.756) (-1201.964) [-1205.542] (-1204.644) * (-1203.778) (-1205.397) [-1203.243] (-1202.093) -- 0:00:34
439000 -- (-1207.795) [-1202.723] (-1203.518) (-1202.006) * [-1204.507] (-1205.646) (-1202.794) (-1202.315) -- 0:00:34
439500 -- (-1205.470) [-1203.516] (-1203.491) (-1201.474) * (-1204.260) (-1202.607) (-1201.934) [-1202.224] -- 0:00:34
440000 -- (-1202.344) [-1207.049] (-1203.593) (-1203.679) * (-1204.100) (-1202.534) [-1202.097] (-1202.467) -- 0:00:34
Average standard deviation of split frequencies: 0.013718
440500 -- (-1205.078) (-1206.043) (-1203.700) [-1205.029] * (-1207.698) [-1203.787] (-1202.088) (-1203.072) -- 0:00:35
441000 -- (-1206.296) [-1206.595] (-1203.346) (-1206.866) * (-1204.078) (-1203.756) [-1203.605] (-1203.814) -- 0:00:35
441500 -- (-1206.118) [-1206.113] (-1204.417) (-1206.730) * (-1207.291) (-1206.033) (-1204.373) [-1204.189] -- 0:00:35
442000 -- (-1207.713) (-1204.954) (-1203.110) [-1203.136] * (-1205.108) [-1207.008] (-1204.330) (-1203.233) -- 0:00:35
442500 -- (-1202.841) [-1203.642] (-1203.895) (-1202.344) * (-1203.025) (-1206.034) (-1203.076) [-1203.434] -- 0:00:35
443000 -- (-1202.772) (-1207.280) [-1203.794] (-1204.295) * (-1203.025) (-1203.536) (-1201.956) [-1203.188] -- 0:00:35
443500 -- (-1202.554) [-1202.289] (-1202.816) (-1201.796) * [-1203.144] (-1202.953) (-1202.489) (-1208.097) -- 0:00:35
444000 -- (-1202.660) [-1202.597] (-1202.938) (-1203.427) * (-1204.001) (-1202.927) (-1206.360) [-1203.331] -- 0:00:35
444500 -- (-1206.469) (-1202.879) (-1204.855) [-1203.217] * (-1205.407) [-1209.304] (-1202.603) (-1202.374) -- 0:00:34
445000 -- (-1202.177) (-1203.171) [-1201.879] (-1203.766) * [-1205.796] (-1204.640) (-1207.597) (-1203.122) -- 0:00:34
Average standard deviation of split frequencies: 0.012551
445500 -- [-1203.489] (-1204.452) (-1201.917) (-1206.554) * (-1206.690) [-1203.168] (-1202.461) (-1205.405) -- 0:00:34
446000 -- [-1204.264] (-1203.902) (-1202.336) (-1203.653) * (-1205.745) [-1202.803] (-1207.324) (-1204.723) -- 0:00:34
446500 -- (-1202.185) [-1202.766] (-1202.339) (-1203.723) * (-1203.659) [-1202.440] (-1206.770) (-1205.970) -- 0:00:34
447000 -- (-1202.488) (-1202.999) [-1202.417] (-1204.311) * (-1202.757) (-1202.168) (-1204.065) [-1204.756] -- 0:00:34
447500 -- (-1205.354) [-1204.402] (-1202.613) (-1204.340) * (-1205.335) [-1202.645] (-1205.876) (-1202.808) -- 0:00:34
448000 -- [-1203.110] (-1201.795) (-1203.849) (-1204.779) * (-1208.298) (-1206.317) (-1205.991) [-1203.043] -- 0:00:34
448500 -- (-1204.190) [-1204.053] (-1202.510) (-1203.384) * (-1204.821) [-1202.697] (-1205.905) (-1203.520) -- 0:00:34
449000 -- (-1203.447) (-1206.839) [-1202.376] (-1201.912) * (-1202.734) (-1204.742) (-1204.055) [-1203.532] -- 0:00:34
449500 -- (-1203.561) [-1204.206] (-1202.977) (-1202.246) * [-1202.175] (-1206.747) (-1204.909) (-1201.955) -- 0:00:34
450000 -- (-1203.143) (-1204.852) [-1206.687] (-1202.246) * (-1202.121) (-1205.785) (-1204.295) [-1205.010] -- 0:00:34
Average standard deviation of split frequencies: 0.013167
450500 -- (-1202.837) [-1202.753] (-1209.628) (-1202.246) * (-1201.903) [-1203.899] (-1204.081) (-1206.076) -- 0:00:34
451000 -- (-1203.851) [-1208.500] (-1204.236) (-1202.091) * (-1208.043) (-1204.327) [-1202.880] (-1204.883) -- 0:00:34
451500 -- [-1204.967] (-1202.809) (-1203.442) (-1203.102) * (-1210.163) (-1205.223) (-1204.380) [-1203.575] -- 0:00:34
452000 -- (-1206.292) [-1204.500] (-1202.303) (-1202.566) * (-1207.327) (-1206.066) [-1202.994] (-1202.925) -- 0:00:33
452500 -- (-1207.067) (-1203.132) [-1205.460] (-1202.936) * [-1205.950] (-1207.724) (-1203.689) (-1201.714) -- 0:00:33
453000 -- (-1203.550) [-1203.337] (-1202.969) (-1208.078) * (-1202.785) (-1203.544) [-1202.521] (-1201.700) -- 0:00:33
453500 -- [-1204.671] (-1203.059) (-1203.866) (-1207.813) * (-1202.487) (-1203.730) [-1202.622] (-1201.683) -- 0:00:33
454000 -- (-1205.510) (-1202.735) [-1203.025] (-1204.038) * (-1205.318) (-1205.822) (-1202.640) [-1202.747] -- 0:00:33
454500 -- (-1204.366) [-1203.235] (-1202.308) (-1204.478) * [-1203.596] (-1208.429) (-1204.463) (-1203.022) -- 0:00:33
455000 -- [-1202.539] (-1204.907) (-1206.365) (-1207.776) * [-1203.807] (-1204.340) (-1203.348) (-1202.902) -- 0:00:33
Average standard deviation of split frequencies: 0.011049
455500 -- (-1202.723) (-1202.627) (-1208.548) [-1206.357] * (-1203.978) [-1207.979] (-1203.164) (-1207.894) -- 0:00:33
456000 -- [-1202.716] (-1202.594) (-1209.084) (-1203.442) * (-1203.953) (-1205.799) [-1204.085] (-1207.593) -- 0:00:33
456500 -- (-1203.012) [-1202.594] (-1202.850) (-1203.558) * [-1204.032] (-1203.550) (-1205.751) (-1203.948) -- 0:00:33
457000 -- (-1207.208) (-1204.321) [-1204.271] (-1204.130) * (-1203.372) (-1206.411) (-1203.964) [-1204.118] -- 0:00:34
457500 -- (-1203.834) (-1201.453) (-1203.885) [-1202.030] * (-1206.189) [-1204.334] (-1202.084) (-1203.485) -- 0:00:34
458000 -- (-1202.403) (-1204.135) (-1205.362) [-1202.973] * (-1204.723) (-1202.340) [-1201.878] (-1205.760) -- 0:00:34
458500 -- (-1202.593) [-1202.363] (-1204.224) (-1205.899) * (-1204.561) [-1201.623] (-1202.616) (-1206.326) -- 0:00:34
459000 -- (-1203.492) (-1204.849) (-1202.766) [-1202.989] * (-1201.989) [-1202.982] (-1204.142) (-1203.140) -- 0:00:34
459500 -- (-1201.805) (-1203.504) [-1203.208] (-1206.068) * (-1204.355) (-1202.264) [-1203.318] (-1202.347) -- 0:00:34
460000 -- (-1203.313) [-1204.318] (-1205.106) (-1203.238) * (-1209.528) [-1204.248] (-1203.901) (-1204.464) -- 0:00:34
Average standard deviation of split frequencies: 0.010617
460500 -- (-1208.425) (-1204.729) (-1208.046) [-1204.159] * [-1204.748] (-1201.640) (-1203.138) (-1203.046) -- 0:00:33
461000 -- (-1204.083) (-1203.077) (-1202.571) [-1203.101] * (-1202.654) [-1203.105] (-1205.169) (-1202.651) -- 0:00:33
461500 -- (-1205.457) (-1203.059) [-1204.161] (-1203.849) * (-1202.135) (-1201.961) [-1204.082] (-1202.937) -- 0:00:33
462000 -- [-1202.946] (-1203.481) (-1206.322) (-1202.488) * (-1202.386) (-1202.539) [-1206.889] (-1201.748) -- 0:00:33
462500 -- (-1203.070) (-1205.300) (-1206.082) [-1202.252] * (-1202.435) (-1202.634) (-1203.916) [-1202.022] -- 0:00:33
463000 -- [-1202.955] (-1205.891) (-1203.869) (-1201.442) * (-1202.067) (-1202.556) [-1204.148] (-1202.915) -- 0:00:33
463500 -- (-1203.158) (-1203.817) (-1204.957) [-1205.029] * (-1201.741) [-1202.979] (-1207.034) (-1206.797) -- 0:00:33
464000 -- (-1203.798) (-1205.796) [-1202.261] (-1202.148) * (-1210.553) [-1206.255] (-1204.159) (-1204.610) -- 0:00:33
464500 -- (-1201.935) (-1208.437) (-1205.949) [-1202.333] * (-1206.813) (-1204.486) (-1204.814) [-1210.212] -- 0:00:33
465000 -- (-1205.232) (-1202.594) (-1205.094) [-1201.947] * (-1203.418) [-1207.596] (-1202.859) (-1205.648) -- 0:00:33
Average standard deviation of split frequencies: 0.011001
465500 -- (-1202.266) (-1203.169) (-1211.414) [-1203.690] * (-1209.143) (-1203.079) (-1202.659) [-1201.906] -- 0:00:33
466000 -- (-1205.412) (-1203.803) (-1202.202) [-1204.778] * (-1204.799) [-1202.296] (-1203.292) (-1201.916) -- 0:00:33
466500 -- (-1207.137) (-1205.892) [-1202.452] (-1202.013) * (-1207.006) [-1203.120] (-1205.091) (-1204.937) -- 0:00:33
467000 -- (-1203.799) (-1203.453) (-1203.797) [-1203.767] * (-1203.032) (-1205.354) [-1203.391] (-1203.125) -- 0:00:33
467500 -- (-1202.334) (-1203.147) (-1203.243) [-1214.497] * (-1205.023) [-1204.143] (-1203.976) (-1202.721) -- 0:00:33
468000 -- (-1202.274) [-1202.997] (-1210.109) (-1203.969) * (-1204.908) [-1203.860] (-1202.930) (-1204.801) -- 0:00:32
468500 -- [-1204.625] (-1201.612) (-1205.794) (-1202.259) * (-1204.554) (-1202.436) [-1203.263] (-1210.579) -- 0:00:32
469000 -- (-1208.960) (-1203.596) [-1202.174] (-1203.718) * [-1204.315] (-1202.699) (-1203.501) (-1205.553) -- 0:00:32
469500 -- [-1203.932] (-1202.700) (-1203.003) (-1211.046) * [-1201.903] (-1202.510) (-1207.323) (-1202.869) -- 0:00:32
470000 -- [-1204.007] (-1203.195) (-1203.129) (-1202.504) * (-1203.845) (-1207.529) (-1205.336) [-1202.696] -- 0:00:32
Average standard deviation of split frequencies: 0.010605
470500 -- (-1204.497) (-1205.402) (-1203.157) [-1202.289] * (-1202.157) (-1213.717) [-1203.791] (-1203.515) -- 0:00:32
471000 -- (-1207.278) (-1204.236) [-1202.928] (-1203.326) * (-1204.415) [-1205.885] (-1202.445) (-1203.515) -- 0:00:32
471500 -- (-1206.699) (-1202.136) [-1203.653] (-1206.359) * [-1203.595] (-1206.617) (-1204.180) (-1207.318) -- 0:00:32
472000 -- (-1206.437) [-1203.093] (-1205.238) (-1204.821) * (-1202.010) (-1205.650) [-1204.988] (-1203.854) -- 0:00:32
472500 -- (-1210.400) (-1204.500) [-1203.699] (-1204.189) * (-1202.064) (-1203.295) (-1204.276) [-1203.380] -- 0:00:32
473000 -- (-1209.268) (-1206.103) (-1203.285) [-1202.717] * [-1202.574] (-1201.711) (-1204.001) (-1203.842) -- 0:00:32
473500 -- (-1206.354) (-1205.058) (-1203.195) [-1204.115] * (-1202.640) (-1201.759) [-1205.533] (-1203.701) -- 0:00:33
474000 -- (-1204.352) (-1206.140) (-1206.820) [-1203.431] * [-1202.693] (-1204.374) (-1204.329) (-1202.081) -- 0:00:33
474500 -- [-1204.820] (-1207.002) (-1202.699) (-1202.180) * (-1202.406) (-1203.674) [-1201.645] (-1202.188) -- 0:00:33
475000 -- [-1202.048] (-1207.572) (-1201.910) (-1202.670) * (-1202.638) (-1208.403) (-1204.537) [-1202.100] -- 0:00:33
Average standard deviation of split frequencies: 0.008975
475500 -- (-1203.014) (-1207.060) [-1204.561] (-1203.449) * (-1203.255) [-1203.900] (-1205.745) (-1203.627) -- 0:00:33
476000 -- (-1202.844) (-1203.207) [-1203.213] (-1203.944) * (-1202.805) (-1204.197) [-1203.608] (-1205.097) -- 0:00:33
476500 -- (-1202.864) (-1204.913) (-1203.364) [-1203.973] * (-1202.397) [-1203.398] (-1207.029) (-1202.629) -- 0:00:32
477000 -- (-1206.166) [-1203.288] (-1202.259) (-1202.101) * (-1205.461) (-1202.809) (-1202.565) [-1204.572] -- 0:00:32
477500 -- (-1203.075) (-1205.248) [-1203.607] (-1202.433) * (-1201.975) (-1202.388) (-1204.020) [-1205.981] -- 0:00:32
478000 -- (-1205.056) (-1202.281) (-1214.820) [-1202.748] * (-1203.783) [-1202.199] (-1202.453) (-1201.861) -- 0:00:32
478500 -- [-1203.735] (-1204.646) (-1206.080) (-1202.898) * (-1203.609) (-1202.120) [-1202.488] (-1203.284) -- 0:00:32
479000 -- [-1206.959] (-1202.394) (-1206.308) (-1204.232) * [-1204.302] (-1203.669) (-1203.193) (-1204.130) -- 0:00:32
479500 -- [-1208.855] (-1205.737) (-1203.620) (-1205.493) * (-1203.828) (-1203.942) (-1207.195) [-1205.271] -- 0:00:32
480000 -- [-1203.326] (-1203.334) (-1204.543) (-1202.058) * (-1202.276) (-1202.945) [-1205.041] (-1203.538) -- 0:00:32
Average standard deviation of split frequencies: 0.008336
480500 -- (-1203.912) (-1202.836) [-1204.544] (-1204.752) * (-1203.362) [-1203.178] (-1203.118) (-1204.955) -- 0:00:32
481000 -- (-1204.678) [-1203.292] (-1202.528) (-1203.563) * (-1203.456) (-1202.092) [-1205.205] (-1205.484) -- 0:00:32
481500 -- (-1202.849) [-1202.355] (-1203.778) (-1202.865) * (-1204.298) (-1203.071) (-1205.446) [-1203.415] -- 0:00:32
482000 -- (-1201.630) (-1205.682) (-1205.736) [-1202.300] * [-1205.842] (-1203.224) (-1204.608) (-1204.208) -- 0:00:32
482500 -- (-1201.699) (-1203.998) (-1202.240) [-1203.521] * (-1204.291) (-1201.732) [-1201.914] (-1205.426) -- 0:00:32
483000 -- (-1203.366) (-1205.300) (-1203.010) [-1203.160] * (-1204.466) [-1201.949] (-1201.780) (-1204.382) -- 0:00:32
483500 -- [-1203.912] (-1202.622) (-1208.221) (-1204.642) * (-1207.186) (-1202.098) (-1203.415) [-1203.882] -- 0:00:32
484000 -- (-1202.758) (-1207.374) [-1204.044] (-1207.277) * (-1203.699) (-1202.121) [-1202.183] (-1203.255) -- 0:00:31
484500 -- (-1202.656) [-1203.655] (-1202.565) (-1202.810) * (-1202.257) (-1202.385) [-1206.344] (-1206.685) -- 0:00:31
485000 -- (-1203.371) (-1205.263) [-1202.492] (-1202.824) * (-1204.650) [-1204.896] (-1208.192) (-1208.544) -- 0:00:31
Average standard deviation of split frequencies: 0.008548
485500 -- (-1205.434) (-1202.889) (-1206.722) [-1203.372] * (-1204.336) (-1204.380) (-1203.527) [-1202.308] -- 0:00:31
486000 -- (-1205.964) (-1204.431) (-1204.292) [-1203.117] * (-1203.436) (-1205.880) [-1202.730] (-1202.384) -- 0:00:31
486500 -- (-1202.686) (-1204.138) [-1208.313] (-1203.315) * (-1202.424) (-1203.197) (-1205.625) [-1203.094] -- 0:00:31
487000 -- (-1206.461) (-1204.472) [-1201.618] (-1202.515) * (-1208.076) (-1204.024) [-1203.123] (-1203.363) -- 0:00:31
487500 -- [-1204.229] (-1207.190) (-1201.899) (-1204.165) * (-1211.016) [-1203.776] (-1204.654) (-1202.591) -- 0:00:31
488000 -- (-1202.716) (-1205.249) (-1205.316) [-1203.323] * (-1205.786) (-1206.179) (-1202.795) [-1202.818] -- 0:00:31
488500 -- [-1201.591] (-1203.859) (-1208.612) (-1202.635) * (-1206.471) [-1201.870] (-1202.748) (-1202.749) -- 0:00:31
489000 -- [-1202.901] (-1202.986) (-1207.304) (-1202.303) * (-1204.524) [-1202.700] (-1203.875) (-1202.401) -- 0:00:31
489500 -- (-1204.108) [-1204.681] (-1203.374) (-1203.319) * (-1203.479) (-1204.344) [-1208.238] (-1204.348) -- 0:00:32
490000 -- (-1202.945) (-1202.523) (-1204.282) [-1205.727] * (-1203.841) [-1203.920] (-1206.111) (-1205.059) -- 0:00:32
Average standard deviation of split frequencies: 0.008647
490500 -- (-1203.030) [-1203.759] (-1204.248) (-1203.870) * (-1206.082) [-1203.601] (-1202.450) (-1202.106) -- 0:00:32
491000 -- (-1205.545) (-1202.850) (-1203.923) [-1203.167] * (-1204.742) (-1204.318) [-1201.923] (-1202.455) -- 0:00:32
491500 -- [-1202.487] (-1203.075) (-1204.289) (-1203.766) * [-1203.208] (-1204.468) (-1206.666) (-1202.138) -- 0:00:32
492000 -- (-1203.057) [-1204.736] (-1203.556) (-1203.053) * (-1204.591) (-1204.714) (-1203.418) [-1202.161] -- 0:00:32
492500 -- (-1204.769) (-1205.535) [-1204.799] (-1205.198) * (-1204.610) [-1203.771] (-1206.026) (-1202.088) -- 0:00:31
493000 -- (-1205.399) (-1202.814) (-1202.263) [-1202.095] * (-1204.250) (-1205.832) (-1203.533) [-1202.738] -- 0:00:31
493500 -- [-1205.130] (-1205.283) (-1202.967) (-1202.302) * [-1201.632] (-1202.603) (-1206.107) (-1202.990) -- 0:00:31
494000 -- [-1204.043] (-1205.355) (-1202.471) (-1203.409) * (-1201.811) (-1204.936) (-1203.877) [-1204.226] -- 0:00:31
494500 -- (-1203.716) [-1204.858] (-1206.370) (-1203.643) * (-1203.466) (-1206.033) (-1202.360) [-1206.709] -- 0:00:31
495000 -- (-1204.117) (-1207.699) [-1202.028] (-1203.760) * (-1205.267) (-1203.986) (-1203.077) [-1204.189] -- 0:00:31
Average standard deviation of split frequencies: 0.007722
495500 -- (-1202.423) (-1203.864) (-1202.195) [-1203.740] * (-1205.267) [-1203.527] (-1202.912) (-1202.967) -- 0:00:31
496000 -- (-1202.976) (-1204.062) (-1202.133) [-1205.324] * (-1202.899) (-1203.388) (-1204.650) [-1202.848] -- 0:00:31
496500 -- (-1205.970) (-1203.220) (-1202.851) [-1202.014] * (-1205.935) (-1202.797) [-1204.003] (-1206.923) -- 0:00:31
497000 -- (-1211.997) (-1207.373) (-1203.090) [-1202.628] * [-1204.127] (-1203.502) (-1203.696) (-1204.442) -- 0:00:31
497500 -- (-1208.683) (-1205.435) (-1204.108) [-1203.243] * (-1203.722) (-1206.764) [-1203.436] (-1203.928) -- 0:00:31
498000 -- (-1202.783) (-1205.684) (-1205.327) [-1203.038] * (-1202.897) (-1206.001) [-1203.698] (-1204.699) -- 0:00:31
498500 -- (-1207.077) (-1204.206) (-1203.636) [-1205.108] * (-1206.032) [-1203.699] (-1202.681) (-1206.239) -- 0:00:31
499000 -- (-1204.814) (-1202.895) [-1203.521] (-1203.798) * (-1203.672) [-1204.554] (-1203.624) (-1204.098) -- 0:00:31
499500 -- [-1204.704] (-1206.242) (-1203.282) (-1204.575) * (-1202.614) (-1205.796) [-1203.751] (-1204.441) -- 0:00:31
500000 -- [-1203.049] (-1206.935) (-1206.623) (-1204.351) * (-1202.339) (-1202.959) [-1203.294] (-1202.853) -- 0:00:31
Average standard deviation of split frequencies: 0.007030
500500 -- (-1202.263) [-1202.994] (-1204.299) (-1204.000) * (-1203.953) [-1202.219] (-1201.888) (-1203.538) -- 0:00:30
501000 -- (-1203.290) (-1205.456) (-1207.497) [-1201.949] * (-1203.247) [-1202.063] (-1205.778) (-1205.585) -- 0:00:30
501500 -- (-1203.101) (-1205.152) (-1213.571) [-1203.234] * (-1204.316) (-1202.894) (-1203.902) [-1203.299] -- 0:00:30
502000 -- (-1203.741) (-1203.657) [-1207.747] (-1202.979) * (-1203.727) (-1203.575) [-1202.681] (-1202.298) -- 0:00:30
502500 -- (-1203.007) (-1205.252) (-1206.572) [-1203.645] * (-1204.581) [-1201.940] (-1205.210) (-1202.272) -- 0:00:30
503000 -- (-1202.530) (-1202.482) (-1202.892) [-1203.643] * (-1205.202) (-1204.154) (-1207.271) [-1204.245] -- 0:00:30
503500 -- (-1202.672) (-1202.425) [-1201.525] (-1206.382) * (-1205.511) (-1204.340) [-1202.621] (-1206.183) -- 0:00:30
504000 -- (-1202.251) (-1204.551) (-1201.545) [-1204.356] * (-1204.096) [-1206.592] (-1204.657) (-1204.174) -- 0:00:30
504500 -- (-1202.683) (-1207.192) [-1203.672] (-1202.753) * [-1205.930] (-1202.340) (-1202.645) (-1202.913) -- 0:00:30
505000 -- (-1204.342) (-1204.502) (-1203.823) [-1202.164] * [-1203.850] (-1202.192) (-1207.189) (-1206.204) -- 0:00:30
Average standard deviation of split frequencies: 0.006459
505500 -- (-1205.473) [-1202.065] (-1203.604) (-1204.033) * (-1203.579) (-1202.445) (-1201.991) [-1202.443] -- 0:00:31
506000 -- (-1202.654) (-1204.725) (-1205.918) [-1203.194] * (-1202.828) (-1201.800) [-1201.925] (-1204.312) -- 0:00:31
506500 -- (-1202.949) (-1202.517) (-1203.073) [-1203.542] * [-1203.416] (-1204.525) (-1202.455) (-1203.251) -- 0:00:31
507000 -- (-1205.905) [-1202.784] (-1205.714) (-1204.352) * (-1204.967) (-1206.300) [-1202.140] (-1204.026) -- 0:00:31
507500 -- (-1203.830) [-1202.948] (-1202.726) (-1205.236) * [-1203.984] (-1206.953) (-1203.426) (-1203.410) -- 0:00:31
508000 -- (-1203.202) (-1204.770) [-1204.402] (-1206.247) * (-1203.746) (-1206.147) (-1208.991) [-1203.973] -- 0:00:30
508500 -- (-1203.317) (-1205.318) [-1201.929] (-1203.727) * (-1205.153) [-1203.289] (-1204.433) (-1204.328) -- 0:00:30
509000 -- (-1204.131) [-1203.815] (-1201.696) (-1205.568) * (-1206.825) (-1202.584) [-1206.513] (-1205.368) -- 0:00:30
509500 -- [-1202.417] (-1207.069) (-1201.718) (-1204.926) * (-1202.843) (-1203.419) (-1207.336) [-1202.149] -- 0:00:30
510000 -- [-1202.148] (-1204.948) (-1203.644) (-1201.666) * (-1203.685) (-1204.954) (-1206.438) [-1202.608] -- 0:00:30
Average standard deviation of split frequencies: 0.006866
510500 -- (-1203.704) (-1205.114) (-1202.818) [-1203.331] * (-1205.121) [-1204.112] (-1202.599) (-1202.947) -- 0:00:30
511000 -- [-1203.775] (-1204.382) (-1202.145) (-1201.760) * (-1203.487) [-1204.211] (-1209.540) (-1206.645) -- 0:00:30
511500 -- (-1204.116) (-1202.856) (-1203.314) [-1203.646] * (-1202.308) (-1205.291) (-1204.256) [-1203.872] -- 0:00:30
512000 -- (-1203.118) (-1202.145) [-1203.031] (-1202.217) * [-1205.609] (-1205.186) (-1203.138) (-1206.955) -- 0:00:30
512500 -- (-1202.376) (-1202.766) [-1204.290] (-1204.902) * (-1204.325) [-1210.443] (-1203.150) (-1204.983) -- 0:00:30
513000 -- (-1202.423) [-1203.116] (-1210.846) (-1202.092) * (-1206.992) [-1203.638] (-1202.754) (-1207.554) -- 0:00:30
513500 -- (-1203.405) [-1203.119] (-1208.469) (-1204.719) * [-1206.719] (-1202.518) (-1202.466) (-1204.249) -- 0:00:30
514000 -- [-1202.818] (-1204.993) (-1203.992) (-1203.016) * (-1208.530) (-1202.403) [-1202.153] (-1203.481) -- 0:00:30
514500 -- [-1202.818] (-1203.455) (-1203.068) (-1204.935) * (-1204.640) (-1202.377) [-1203.657] (-1207.094) -- 0:00:30
515000 -- (-1202.911) (-1205.124) (-1208.244) [-1202.893] * (-1205.102) (-1205.628) (-1211.051) [-1207.754] -- 0:00:30
Average standard deviation of split frequencies: 0.005847
515500 -- (-1203.976) (-1204.174) [-1207.577] (-1205.069) * (-1207.023) (-1206.248) (-1205.783) [-1202.436] -- 0:00:30
516000 -- (-1203.778) [-1203.728] (-1203.737) (-1206.545) * [-1204.747] (-1214.234) (-1205.335) (-1201.936) -- 0:00:30
516500 -- (-1205.260) (-1203.151) [-1203.278] (-1203.654) * (-1203.488) (-1203.267) (-1204.095) [-1204.553] -- 0:00:29
517000 -- (-1204.034) (-1203.720) [-1205.041] (-1203.541) * (-1204.283) (-1201.804) (-1208.365) [-1203.868] -- 0:00:29
517500 -- (-1204.511) [-1203.676] (-1203.828) (-1202.780) * [-1206.913] (-1203.938) (-1204.614) (-1206.426) -- 0:00:29
518000 -- (-1206.705) (-1203.461) (-1203.634) [-1202.632] * (-1213.075) [-1204.234] (-1204.253) (-1204.033) -- 0:00:29
518500 -- (-1204.650) (-1202.736) (-1202.017) [-1205.534] * [-1206.545] (-1204.448) (-1202.303) (-1204.729) -- 0:00:29
519000 -- (-1205.048) [-1203.416] (-1203.093) (-1202.721) * (-1205.344) (-1208.372) [-1202.396] (-1207.846) -- 0:00:29
519500 -- (-1203.174) (-1203.820) (-1203.052) [-1203.788] * (-1201.916) [-1202.927] (-1207.140) (-1204.441) -- 0:00:29
520000 -- (-1204.021) [-1208.696] (-1206.137) (-1204.489) * [-1201.662] (-1202.649) (-1204.100) (-1202.480) -- 0:00:29
Average standard deviation of split frequencies: 0.005191
520500 -- (-1203.996) (-1205.614) [-1203.271] (-1206.973) * [-1203.415] (-1203.420) (-1202.305) (-1205.297) -- 0:00:29
521000 -- (-1202.954) (-1204.116) [-1202.480] (-1202.251) * [-1207.440] (-1207.053) (-1203.991) (-1209.051) -- 0:00:29
521500 -- [-1204.639] (-1204.084) (-1202.480) (-1204.638) * (-1205.646) (-1206.918) [-1204.035] (-1202.722) -- 0:00:29
522000 -- [-1203.332] (-1209.619) (-1203.932) (-1203.545) * (-1203.395) [-1203.926] (-1204.715) (-1204.752) -- 0:00:30
522500 -- (-1203.932) [-1206.708] (-1204.529) (-1203.599) * (-1202.563) [-1204.043] (-1208.724) (-1205.900) -- 0:00:30
523000 -- (-1203.563) [-1204.515] (-1204.391) (-1204.295) * (-1203.411) (-1203.035) (-1204.641) [-1202.127] -- 0:00:30
523500 -- (-1204.130) [-1204.176] (-1204.198) (-1203.254) * [-1202.862] (-1202.776) (-1204.892) (-1202.080) -- 0:00:30
524000 -- (-1204.173) [-1206.117] (-1209.509) (-1204.359) * [-1204.394] (-1206.567) (-1202.295) (-1202.228) -- 0:00:29
524500 -- (-1204.752) [-1202.128] (-1201.825) (-1202.295) * [-1206.273] (-1204.070) (-1202.297) (-1203.724) -- 0:00:29
525000 -- [-1201.715] (-1203.273) (-1202.977) (-1207.944) * (-1204.888) (-1203.709) (-1202.469) [-1204.452] -- 0:00:29
Average standard deviation of split frequencies: 0.005377
525500 -- [-1204.017] (-1203.049) (-1204.928) (-1205.970) * (-1203.614) (-1203.659) [-1203.827] (-1203.942) -- 0:00:29
526000 -- (-1206.507) (-1202.528) [-1204.608] (-1204.844) * [-1203.149] (-1203.294) (-1204.440) (-1201.805) -- 0:00:29
526500 -- (-1203.501) [-1202.655] (-1207.160) (-1204.536) * [-1204.384] (-1202.321) (-1202.644) (-1202.240) -- 0:00:29
527000 -- (-1203.161) (-1203.958) (-1203.623) [-1203.365] * [-1206.790] (-1204.782) (-1210.583) (-1202.281) -- 0:00:29
527500 -- (-1208.210) [-1202.772] (-1202.160) (-1204.313) * [-1207.494] (-1205.166) (-1216.233) (-1203.952) -- 0:00:29
528000 -- (-1204.569) [-1204.404] (-1204.015) (-1206.709) * (-1203.933) (-1206.670) (-1206.009) [-1204.524] -- 0:00:29
528500 -- (-1206.810) (-1203.566) [-1203.059] (-1205.940) * (-1205.813) (-1208.673) [-1203.708] (-1204.525) -- 0:00:29
529000 -- (-1204.609) [-1203.542] (-1201.690) (-1202.799) * (-1202.780) [-1205.171] (-1205.208) (-1202.860) -- 0:00:29
529500 -- (-1206.881) (-1202.072) (-1203.693) [-1201.701] * (-1204.144) (-1207.051) [-1205.104] (-1203.511) -- 0:00:29
530000 -- (-1203.739) [-1204.376] (-1203.357) (-1202.216) * (-1210.605) (-1211.464) (-1202.643) [-1201.876] -- 0:00:29
Average standard deviation of split frequencies: 0.005330
530500 -- (-1202.921) [-1203.050] (-1203.223) (-1204.263) * [-1207.755] (-1205.678) (-1204.697) (-1205.046) -- 0:00:29
531000 -- (-1204.843) (-1207.425) (-1206.072) [-1204.363] * (-1203.721) (-1205.123) (-1201.607) [-1204.046] -- 0:00:29
531500 -- (-1203.379) (-1204.079) [-1207.812] (-1202.363) * (-1206.010) (-1201.855) [-1202.263] (-1205.024) -- 0:00:29
532000 -- (-1203.814) (-1203.773) (-1210.680) [-1203.712] * (-1205.410) (-1204.646) [-1202.265] (-1206.779) -- 0:00:29
532500 -- [-1204.773] (-1202.810) (-1203.267) (-1204.714) * (-1205.903) (-1205.769) [-1202.021] (-1204.474) -- 0:00:28
533000 -- (-1205.275) (-1202.986) [-1202.907] (-1203.343) * (-1207.940) [-1206.440] (-1202.023) (-1202.379) -- 0:00:28
533500 -- (-1203.776) (-1204.619) (-1205.308) [-1202.759] * (-1208.636) [-1204.935] (-1202.023) (-1203.110) -- 0:00:28
534000 -- (-1202.898) [-1202.062] (-1202.533) (-1205.013) * (-1209.724) (-1203.438) (-1205.002) [-1202.858] -- 0:00:28
534500 -- (-1207.061) [-1204.198] (-1204.125) (-1204.240) * (-1206.661) [-1202.506] (-1202.942) (-1203.998) -- 0:00:28
535000 -- [-1206.025] (-1202.621) (-1211.483) (-1202.720) * (-1209.037) [-1206.875] (-1205.830) (-1203.673) -- 0:00:28
Average standard deviation of split frequencies: 0.005101
535500 -- (-1209.673) (-1203.689) [-1207.312] (-1205.332) * (-1204.671) [-1203.253] (-1206.339) (-1204.308) -- 0:00:28
536000 -- (-1205.482) (-1203.120) (-1207.782) [-1207.686] * (-1203.903) [-1202.778] (-1204.944) (-1205.179) -- 0:00:28
536500 -- [-1204.280] (-1203.099) (-1203.565) (-1205.874) * [-1203.877] (-1203.437) (-1205.698) (-1202.978) -- 0:00:28
537000 -- (-1206.530) (-1204.935) (-1203.975) [-1206.164] * (-1203.564) (-1204.293) (-1204.280) [-1203.010] -- 0:00:28
537500 -- (-1203.425) [-1203.332] (-1203.932) (-1205.599) * (-1204.139) [-1203.857] (-1203.681) (-1202.741) -- 0:00:28
538000 -- (-1202.155) (-1202.056) (-1203.177) [-1204.388] * (-1203.322) (-1202.263) (-1205.869) [-1205.282] -- 0:00:29
538500 -- [-1201.829] (-1201.784) (-1202.863) (-1204.128) * [-1210.971] (-1202.980) (-1205.834) (-1203.847) -- 0:00:29
539000 -- [-1207.437] (-1204.421) (-1203.264) (-1205.924) * (-1201.921) [-1203.644] (-1203.329) (-1204.607) -- 0:00:29
539500 -- (-1204.654) (-1205.187) (-1202.927) [-1202.755] * (-1202.543) [-1202.872] (-1203.416) (-1204.292) -- 0:00:29
540000 -- (-1203.910) [-1205.752] (-1203.685) (-1206.767) * [-1205.917] (-1202.356) (-1206.114) (-1205.471) -- 0:00:28
Average standard deviation of split frequencies: 0.005115
540500 -- (-1204.548) [-1203.850] (-1203.290) (-1203.606) * (-1204.889) (-1202.980) (-1205.645) [-1204.653] -- 0:00:28
541000 -- [-1202.659] (-1206.257) (-1202.908) (-1203.923) * (-1204.889) [-1203.145] (-1202.890) (-1203.400) -- 0:00:28
541500 -- (-1202.361) [-1207.229] (-1207.736) (-1205.856) * (-1203.702) (-1202.960) [-1203.181] (-1204.378) -- 0:00:28
542000 -- [-1203.688] (-1204.991) (-1207.671) (-1202.928) * [-1208.091] (-1205.925) (-1203.135) (-1207.950) -- 0:00:28
542500 -- (-1203.269) (-1203.514) (-1207.642) [-1202.764] * (-1205.127) (-1206.889) [-1203.753] (-1203.823) -- 0:00:28
543000 -- (-1203.888) (-1205.586) (-1205.239) [-1203.790] * (-1204.491) [-1202.812] (-1203.537) (-1205.981) -- 0:00:28
543500 -- [-1203.981] (-1205.207) (-1203.352) (-1203.331) * (-1205.513) (-1203.436) (-1205.149) [-1202.048] -- 0:00:28
544000 -- (-1202.830) (-1201.697) (-1204.332) [-1205.494] * [-1206.046] (-1203.789) (-1203.894) (-1206.001) -- 0:00:28
544500 -- [-1204.391] (-1204.169) (-1208.815) (-1205.942) * (-1204.704) (-1206.862) [-1204.578] (-1205.900) -- 0:00:28
545000 -- (-1202.499) [-1205.578] (-1213.079) (-1207.505) * (-1206.164) [-1201.691] (-1204.153) (-1203.999) -- 0:00:28
Average standard deviation of split frequencies: 0.005238
545500 -- [-1202.716] (-1204.675) (-1210.288) (-1207.608) * (-1206.375) (-1202.589) [-1203.955] (-1204.286) -- 0:00:28
546000 -- (-1206.851) [-1203.482] (-1205.479) (-1203.479) * (-1205.012) [-1202.956] (-1205.477) (-1206.905) -- 0:00:28
546500 -- (-1204.227) (-1204.399) (-1203.247) [-1202.917] * (-1203.834) (-1204.051) (-1203.346) [-1207.032] -- 0:00:28
547000 -- (-1202.951) [-1202.911] (-1203.553) (-1204.234) * (-1204.895) [-1202.427] (-1202.585) (-1204.860) -- 0:00:28
547500 -- [-1202.584] (-1207.409) (-1202.875) (-1203.292) * (-1204.558) [-1202.274] (-1203.109) (-1207.482) -- 0:00:28
548000 -- (-1203.692) [-1208.195] (-1205.529) (-1208.395) * (-1207.243) [-1203.401] (-1204.158) (-1206.674) -- 0:00:28
548500 -- (-1202.226) [-1203.120] (-1209.337) (-1203.750) * (-1211.813) [-1203.424] (-1207.753) (-1204.636) -- 0:00:27
549000 -- (-1206.229) (-1206.828) (-1202.953) [-1203.823] * (-1202.045) (-1202.076) (-1204.477) [-1203.282] -- 0:00:27
549500 -- [-1202.734] (-1204.648) (-1205.877) (-1204.449) * [-1203.422] (-1203.013) (-1203.783) (-1204.468) -- 0:00:27
550000 -- (-1202.611) (-1204.307) (-1204.414) [-1207.356] * (-1205.742) (-1203.609) (-1202.369) [-1203.151] -- 0:00:27
Average standard deviation of split frequencies: 0.006206
550500 -- (-1205.565) (-1204.738) [-1204.063] (-1203.432) * (-1206.385) (-1202.705) [-1203.327] (-1205.317) -- 0:00:27
551000 -- (-1203.947) (-1207.929) (-1204.159) [-1212.092] * (-1203.562) (-1202.292) [-1203.325] (-1208.177) -- 0:00:27
551500 -- (-1202.417) (-1203.005) [-1202.926] (-1202.879) * (-1202.343) (-1204.616) [-1201.882] (-1204.776) -- 0:00:27
552000 -- (-1203.661) (-1203.240) (-1203.847) [-1202.556] * (-1206.260) (-1205.151) (-1203.105) [-1202.871] -- 0:00:27
552500 -- (-1205.431) (-1203.395) [-1204.095] (-1204.206) * (-1205.229) (-1210.036) [-1203.759] (-1202.551) -- 0:00:27
553000 -- (-1207.467) (-1203.742) (-1202.873) [-1202.332] * (-1202.510) (-1202.518) (-1202.507) [-1203.175] -- 0:00:27
553500 -- (-1206.359) (-1202.501) (-1203.654) [-1202.959] * [-1202.841] (-1202.721) (-1205.680) (-1204.360) -- 0:00:27
554000 -- [-1204.007] (-1202.981) (-1201.917) (-1203.468) * (-1206.395) (-1204.124) [-1205.680] (-1203.320) -- 0:00:27
554500 -- (-1203.005) (-1207.297) [-1201.916] (-1203.483) * [-1206.495] (-1204.155) (-1203.355) (-1203.874) -- 0:00:28
555000 -- [-1203.589] (-1204.188) (-1206.215) (-1203.889) * (-1211.579) (-1205.354) [-1202.851] (-1205.644) -- 0:00:28
Average standard deviation of split frequencies: 0.004974
555500 -- (-1207.027) (-1203.438) (-1206.372) [-1201.982] * (-1204.088) (-1202.903) (-1203.351) [-1204.919] -- 0:00:28
556000 -- (-1206.656) (-1203.355) (-1204.200) [-1204.086] * (-1212.465) (-1206.458) (-1203.022) [-1203.633] -- 0:00:27
556500 -- (-1203.799) [-1203.077] (-1204.418) (-1206.906) * (-1208.570) (-1205.282) (-1203.169) [-1202.682] -- 0:00:27
557000 -- (-1208.105) [-1202.619] (-1204.304) (-1204.143) * (-1210.080) [-1202.669] (-1206.811) (-1202.781) -- 0:00:27
557500 -- (-1208.767) (-1203.478) [-1202.667] (-1204.372) * (-1207.128) (-1203.261) [-1207.931] (-1203.078) -- 0:00:27
558000 -- (-1205.779) [-1207.060] (-1203.123) (-1206.017) * (-1205.145) [-1203.094] (-1210.220) (-1204.914) -- 0:00:27
558500 -- (-1202.483) (-1205.671) (-1204.658) [-1206.019] * (-1206.659) (-1203.968) (-1213.962) [-1201.968] -- 0:00:27
559000 -- [-1203.408] (-1205.881) (-1203.098) (-1203.036) * (-1206.242) (-1202.834) (-1204.489) [-1202.886] -- 0:00:27
559500 -- [-1201.987] (-1204.145) (-1207.568) (-1204.201) * [-1206.909] (-1203.612) (-1203.489) (-1202.390) -- 0:00:27
560000 -- (-1205.826) (-1203.327) (-1205.366) [-1206.312] * (-1203.631) [-1203.152] (-1203.989) (-1204.594) -- 0:00:27
Average standard deviation of split frequencies: 0.004821
560500 -- [-1204.103] (-1202.408) (-1205.622) (-1207.984) * (-1202.895) (-1202.518) [-1203.580] (-1202.743) -- 0:00:27
561000 -- (-1201.665) [-1201.857] (-1204.340) (-1203.082) * [-1203.429] (-1202.678) (-1204.097) (-1202.377) -- 0:00:27
561500 -- (-1203.820) (-1202.828) [-1203.336] (-1202.564) * (-1206.967) (-1204.752) (-1203.678) [-1205.422] -- 0:00:27
562000 -- (-1204.703) (-1202.011) [-1205.575] (-1203.924) * [-1205.043] (-1204.909) (-1205.354) (-1201.813) -- 0:00:27
562500 -- (-1204.783) (-1202.331) [-1202.928] (-1201.855) * (-1207.334) (-1202.812) [-1203.848] (-1202.771) -- 0:00:27
563000 -- (-1204.710) [-1202.590] (-1205.148) (-1201.564) * (-1203.368) (-1202.870) (-1208.565) [-1206.382] -- 0:00:27
563500 -- (-1205.899) (-1204.121) (-1203.681) [-1202.478] * [-1203.878] (-1204.449) (-1203.642) (-1201.956) -- 0:00:27
564000 -- (-1203.679) (-1202.672) [-1202.638] (-1205.146) * (-1202.099) (-1203.475) (-1214.803) [-1202.645] -- 0:00:27
564500 -- (-1204.170) (-1204.677) (-1202.151) [-1204.651] * [-1204.991] (-1206.158) (-1209.035) (-1203.460) -- 0:00:27
565000 -- [-1204.005] (-1204.304) (-1202.565) (-1202.229) * (-1205.995) (-1206.002) (-1205.635) [-1202.254] -- 0:00:26
Average standard deviation of split frequencies: 0.004664
565500 -- (-1202.352) (-1207.724) [-1202.512] (-1208.297) * [-1205.893] (-1202.666) (-1205.998) (-1202.604) -- 0:00:26
566000 -- (-1207.899) (-1205.776) (-1202.306) [-1202.914] * (-1205.619) [-1203.463] (-1206.703) (-1202.563) -- 0:00:26
566500 -- (-1205.169) (-1203.190) (-1203.467) [-1202.168] * (-1205.514) [-1205.419] (-1205.012) (-1203.174) -- 0:00:26
567000 -- [-1205.111] (-1204.730) (-1203.251) (-1204.117) * [-1203.012] (-1204.491) (-1209.306) (-1204.164) -- 0:00:26
567500 -- (-1202.521) (-1204.251) [-1202.449] (-1202.981) * (-1203.918) (-1204.515) (-1203.686) [-1208.059] -- 0:00:26
568000 -- [-1202.250] (-1206.148) (-1202.802) (-1203.089) * (-1206.764) (-1202.002) [-1202.705] (-1212.081) -- 0:00:26
568500 -- [-1203.505] (-1208.959) (-1203.401) (-1203.673) * (-1205.038) (-1202.448) [-1202.034] (-1203.593) -- 0:00:26
569000 -- (-1202.582) (-1203.534) (-1205.603) [-1205.226] * (-1202.925) (-1203.651) [-1202.225] (-1204.179) -- 0:00:26
569500 -- (-1206.901) [-1203.430] (-1202.032) (-1201.865) * (-1206.857) (-1202.866) (-1209.024) [-1203.909] -- 0:00:26
570000 -- (-1206.491) [-1202.921] (-1207.490) (-1203.687) * (-1203.747) (-1202.892) (-1208.159) [-1205.878] -- 0:00:26
Average standard deviation of split frequencies: 0.004626
570500 -- [-1202.471] (-1203.299) (-1203.556) (-1204.256) * (-1211.709) (-1204.470) (-1207.707) [-1205.185] -- 0:00:27
571000 -- (-1201.710) (-1207.614) [-1203.326] (-1203.131) * (-1208.745) (-1207.449) [-1206.940] (-1207.181) -- 0:00:27
571500 -- (-1204.051) (-1205.574) [-1202.986] (-1206.156) * (-1203.111) (-1211.679) [-1203.262] (-1203.381) -- 0:00:26
572000 -- [-1203.501] (-1205.023) (-1204.190) (-1204.461) * (-1206.429) (-1207.195) (-1206.050) [-1202.044] -- 0:00:26
572500 -- (-1201.718) (-1206.945) [-1205.261] (-1205.295) * (-1203.389) [-1207.959] (-1206.375) (-1203.573) -- 0:00:26
573000 -- [-1201.751] (-1202.242) (-1204.895) (-1206.348) * (-1202.737) [-1206.785] (-1205.523) (-1206.667) -- 0:00:26
573500 -- [-1202.460] (-1201.775) (-1204.926) (-1206.883) * [-1208.481] (-1203.710) (-1204.854) (-1207.558) -- 0:00:26
574000 -- [-1204.722] (-1203.502) (-1204.347) (-1204.144) * (-1210.161) [-1202.599] (-1203.497) (-1206.190) -- 0:00:26
574500 -- (-1204.465) (-1203.092) [-1204.629] (-1209.468) * (-1210.182) (-1203.764) [-1203.186] (-1204.144) -- 0:00:26
575000 -- (-1203.275) [-1203.441] (-1207.427) (-1202.559) * (-1210.790) [-1207.937] (-1202.461) (-1203.566) -- 0:00:26
Average standard deviation of split frequencies: 0.005183
575500 -- [-1205.154] (-1201.941) (-1202.749) (-1202.359) * [-1205.018] (-1206.844) (-1202.220) (-1202.231) -- 0:00:26
576000 -- [-1202.545] (-1201.941) (-1206.622) (-1202.989) * (-1202.645) (-1206.384) (-1201.852) [-1202.553] -- 0:00:26
576500 -- (-1203.235) [-1202.714] (-1203.787) (-1203.836) * (-1202.997) (-1203.936) (-1205.062) [-1206.825] -- 0:00:26
577000 -- (-1207.033) [-1202.660] (-1204.862) (-1205.460) * (-1202.304) (-1204.187) (-1206.803) [-1206.029] -- 0:00:26
577500 -- [-1205.655] (-1203.692) (-1204.835) (-1208.164) * (-1202.426) [-1202.899] (-1204.056) (-1205.907) -- 0:00:26
578000 -- (-1203.110) (-1203.783) [-1205.377] (-1204.534) * [-1204.076] (-1204.829) (-1205.475) (-1204.826) -- 0:00:26
578500 -- (-1206.316) [-1202.401] (-1203.148) (-1202.543) * (-1203.275) (-1204.857) [-1203.698] (-1202.522) -- 0:00:26
579000 -- (-1204.929) [-1204.068] (-1201.748) (-1204.357) * (-1203.045) (-1205.230) [-1203.135] (-1202.876) -- 0:00:26
579500 -- (-1204.130) (-1203.629) (-1201.613) [-1203.898] * [-1203.101] (-1205.415) (-1203.479) (-1203.422) -- 0:00:26
580000 -- (-1205.044) [-1204.272] (-1204.763) (-1205.906) * (-1204.520) [-1203.796] (-1202.454) (-1203.574) -- 0:00:26
Average standard deviation of split frequencies: 0.005033
580500 -- (-1206.358) (-1202.851) [-1204.168] (-1204.087) * (-1206.575) (-1203.847) [-1202.262] (-1203.536) -- 0:00:26
581000 -- (-1205.054) (-1202.468) [-1202.580] (-1203.158) * (-1208.300) (-1204.336) (-1202.426) [-1208.243] -- 0:00:25
581500 -- (-1205.634) (-1204.656) [-1202.443] (-1204.533) * (-1206.879) [-1203.876] (-1202.624) (-1203.303) -- 0:00:25
582000 -- (-1205.710) [-1201.753] (-1202.846) (-1202.175) * [-1204.017] (-1204.396) (-1204.998) (-1202.649) -- 0:00:25
582500 -- (-1204.489) [-1202.666] (-1202.872) (-1202.279) * (-1202.899) [-1205.271] (-1207.780) (-1205.467) -- 0:00:25
583000 -- (-1204.184) (-1202.666) [-1203.386] (-1202.037) * [-1203.227] (-1204.073) (-1203.713) (-1205.093) -- 0:00:25
583500 -- (-1204.348) (-1202.642) [-1205.500] (-1215.336) * (-1202.280) (-1207.510) [-1203.456] (-1202.381) -- 0:00:25
584000 -- (-1203.675) [-1201.614] (-1206.044) (-1211.907) * (-1202.009) [-1203.897] (-1202.965) (-1202.047) -- 0:00:25
584500 -- [-1201.862] (-1202.131) (-1206.526) (-1205.928) * (-1202.798) (-1204.583) [-1205.081] (-1203.074) -- 0:00:25
585000 -- (-1205.027) [-1203.474] (-1207.019) (-1203.298) * (-1203.008) (-1205.494) [-1205.681] (-1203.384) -- 0:00:25
Average standard deviation of split frequencies: 0.004934
585500 -- (-1204.139) (-1203.123) [-1203.618] (-1203.289) * [-1202.304] (-1203.561) (-1205.643) (-1203.405) -- 0:00:25
586000 -- [-1204.192] (-1206.966) (-1204.914) (-1202.646) * (-1204.658) [-1205.386] (-1203.121) (-1202.305) -- 0:00:25
586500 -- (-1207.706) (-1204.012) [-1203.328] (-1203.553) * (-1202.329) (-1203.318) [-1204.060] (-1202.808) -- 0:00:25
587000 -- [-1207.050] (-1202.706) (-1202.460) (-1203.166) * [-1206.771] (-1202.804) (-1203.271) (-1205.898) -- 0:00:26
587500 -- (-1204.305) (-1203.672) [-1202.739] (-1203.900) * (-1203.426) [-1202.006] (-1202.651) (-1202.543) -- 0:00:25
588000 -- [-1204.057] (-1203.328) (-1202.526) (-1203.610) * (-1206.567) (-1202.850) (-1204.600) [-1202.927] -- 0:00:25
588500 -- [-1204.507] (-1204.416) (-1202.583) (-1204.199) * [-1203.701] (-1202.408) (-1203.414) (-1203.898) -- 0:00:25
589000 -- (-1205.501) (-1204.871) (-1202.908) [-1204.106] * [-1204.277] (-1205.396) (-1203.662) (-1202.260) -- 0:00:25
589500 -- (-1202.057) (-1204.459) (-1202.762) [-1204.977] * [-1204.017] (-1206.292) (-1203.588) (-1202.938) -- 0:00:25
590000 -- (-1204.587) (-1203.964) (-1202.500) [-1204.130] * (-1210.261) (-1205.856) [-1202.179] (-1202.602) -- 0:00:25
Average standard deviation of split frequencies: 0.005533
590500 -- (-1204.474) (-1203.283) [-1204.175] (-1203.809) * (-1202.150) [-1204.921] (-1203.046) (-1204.388) -- 0:00:25
591000 -- [-1203.363] (-1202.590) (-1202.220) (-1206.981) * (-1203.257) [-1203.317] (-1202.954) (-1204.059) -- 0:00:25
591500 -- (-1205.091) (-1203.229) (-1201.824) [-1204.268] * [-1204.608] (-1205.278) (-1205.672) (-1202.126) -- 0:00:25
592000 -- (-1202.805) (-1202.576) (-1203.296) [-1202.745] * (-1202.730) (-1207.621) [-1205.114] (-1203.397) -- 0:00:25
592500 -- (-1206.568) (-1201.834) [-1203.219] (-1204.270) * (-1207.604) [-1204.672] (-1203.041) (-1204.973) -- 0:00:25
593000 -- (-1204.867) [-1205.212] (-1204.676) (-1202.854) * (-1207.583) (-1204.848) [-1202.756] (-1205.281) -- 0:00:25
593500 -- (-1203.184) (-1205.494) [-1209.245] (-1206.656) * [-1205.437] (-1205.246) (-1203.291) (-1205.076) -- 0:00:25
594000 -- [-1202.146] (-1202.903) (-1204.627) (-1203.339) * (-1205.655) (-1204.553) [-1201.683] (-1205.474) -- 0:00:25
594500 -- (-1203.994) (-1202.985) [-1204.459] (-1203.000) * (-1206.786) (-1207.247) [-1204.287] (-1203.278) -- 0:00:25
595000 -- (-1202.076) [-1203.100] (-1203.990) (-1203.924) * (-1207.464) [-1206.380] (-1202.585) (-1203.382) -- 0:00:25
Average standard deviation of split frequencies: 0.006011
595500 -- [-1210.703] (-1203.947) (-1202.853) (-1203.854) * [-1203.678] (-1201.768) (-1203.112) (-1208.273) -- 0:00:25
596000 -- (-1210.136) (-1203.511) (-1203.239) [-1202.526] * (-1201.976) (-1202.347) (-1205.252) [-1203.247] -- 0:00:25
596500 -- (-1203.021) (-1205.732) [-1202.570] (-1203.222) * (-1202.532) [-1205.131] (-1203.695) (-1206.955) -- 0:00:25
597000 -- (-1205.454) (-1207.656) (-1202.402) [-1205.611] * (-1201.617) (-1201.836) [-1207.132] (-1206.750) -- 0:00:24
597500 -- [-1203.769] (-1204.424) (-1202.175) (-1204.586) * [-1203.012] (-1203.111) (-1207.162) (-1205.813) -- 0:00:24
598000 -- (-1204.306) (-1203.737) (-1201.973) [-1203.181] * (-1203.802) (-1204.288) (-1202.375) [-1204.137] -- 0:00:24
598500 -- (-1207.508) (-1201.824) [-1201.792] (-1203.038) * [-1204.238] (-1208.832) (-1204.949) (-1203.283) -- 0:00:24
599000 -- [-1202.759] (-1202.671) (-1202.692) (-1202.264) * (-1204.534) (-1203.059) [-1205.340] (-1203.779) -- 0:00:24
599500 -- [-1203.493] (-1203.294) (-1202.547) (-1205.319) * (-1204.756) (-1202.622) [-1202.270] (-1202.838) -- 0:00:24
600000 -- [-1204.978] (-1202.950) (-1201.839) (-1201.604) * (-1207.818) (-1202.921) [-1202.051] (-1202.422) -- 0:00:24
Average standard deviation of split frequencies: 0.004970
600500 -- (-1206.444) [-1203.812] (-1211.541) (-1211.809) * (-1202.552) (-1205.723) [-1202.241] (-1203.474) -- 0:00:24
601000 -- (-1205.302) (-1204.709) (-1206.970) [-1204.675] * (-1202.898) [-1203.351] (-1203.018) (-1204.693) -- 0:00:24
601500 -- [-1202.591] (-1205.002) (-1207.934) (-1205.456) * (-1202.026) [-1202.819] (-1203.598) (-1204.977) -- 0:00:24
602000 -- (-1204.737) (-1203.366) [-1204.792] (-1203.548) * (-1203.262) [-1205.512] (-1204.159) (-1202.949) -- 0:00:24
602500 -- (-1207.314) [-1204.758] (-1202.237) (-1207.751) * [-1208.801] (-1205.439) (-1206.794) (-1208.498) -- 0:00:24
603000 -- (-1203.362) (-1206.831) (-1202.962) [-1204.407] * (-1205.178) (-1203.479) (-1202.877) [-1203.153] -- 0:00:25
603500 -- [-1203.425] (-1202.965) (-1203.349) (-1205.161) * (-1203.792) (-1203.885) [-1202.967] (-1203.870) -- 0:00:24
604000 -- (-1204.489) (-1203.745) (-1204.689) [-1203.802] * (-1204.037) (-1204.591) (-1202.923) [-1205.428] -- 0:00:24
604500 -- (-1204.490) [-1202.314] (-1204.003) (-1206.233) * (-1201.492) (-1204.886) [-1203.005] (-1204.296) -- 0:00:24
605000 -- (-1205.578) [-1204.901] (-1215.750) (-1203.325) * (-1206.109) [-1203.451] (-1204.219) (-1202.289) -- 0:00:24
Average standard deviation of split frequencies: 0.005397
605500 -- (-1203.918) (-1204.988) [-1205.536] (-1202.297) * (-1205.074) (-1206.654) [-1202.799] (-1202.355) -- 0:00:24
606000 -- (-1203.052) (-1203.219) (-1203.651) [-1203.862] * (-1204.937) (-1206.253) (-1207.075) [-1203.184] -- 0:00:24
606500 -- [-1207.661] (-1203.382) (-1204.257) (-1207.687) * (-1204.087) (-1202.627) (-1206.065) [-1201.810] -- 0:00:24
607000 -- (-1202.867) [-1203.506] (-1204.312) (-1203.040) * (-1202.869) [-1203.520] (-1205.837) (-1201.803) -- 0:00:24
607500 -- (-1202.779) [-1203.469] (-1206.037) (-1202.673) * [-1203.949] (-1207.336) (-1204.672) (-1201.686) -- 0:00:24
608000 -- [-1203.957] (-1204.693) (-1206.810) (-1202.280) * (-1206.795) (-1205.393) (-1207.772) [-1202.060] -- 0:00:24
608500 -- (-1204.191) (-1203.953) [-1202.520] (-1204.098) * [-1205.696] (-1205.929) (-1206.086) (-1201.786) -- 0:00:24
609000 -- (-1203.319) (-1205.543) (-1204.961) [-1202.756] * (-1203.026) (-1206.711) (-1204.849) [-1201.809] -- 0:00:24
609500 -- (-1205.716) (-1203.977) (-1202.881) [-1202.955] * [-1203.053] (-1207.599) (-1205.616) (-1202.655) -- 0:00:24
610000 -- (-1203.603) (-1208.093) (-1203.051) [-1205.250] * [-1203.035] (-1205.978) (-1207.162) (-1202.389) -- 0:00:24
Average standard deviation of split frequencies: 0.005500
610500 -- (-1203.508) (-1203.006) [-1206.088] (-1203.523) * (-1202.468) (-1203.916) (-1206.526) [-1203.067] -- 0:00:24
611000 -- [-1202.389] (-1207.807) (-1204.538) (-1204.580) * (-1203.039) (-1202.835) (-1206.814) [-1202.592] -- 0:00:24
611500 -- (-1204.232) (-1206.886) (-1203.788) [-1203.405] * [-1202.700] (-1202.943) (-1206.337) (-1201.806) -- 0:00:24
612000 -- (-1203.662) (-1203.211) [-1203.855] (-1207.779) * [-1203.430] (-1210.670) (-1202.759) (-1203.220) -- 0:00:24
612500 -- (-1202.121) (-1202.232) [-1202.215] (-1202.093) * (-1204.091) (-1204.770) (-1202.921) [-1202.913] -- 0:00:24
613000 -- (-1204.937) (-1202.160) [-1202.240] (-1203.609) * (-1202.452) (-1203.027) [-1203.621] (-1208.989) -- 0:00:23
613500 -- [-1203.755] (-1202.498) (-1201.820) (-1209.518) * [-1203.412] (-1204.322) (-1204.093) (-1207.607) -- 0:00:23
614000 -- (-1203.456) (-1204.357) [-1202.095] (-1203.416) * (-1204.499) (-1205.907) (-1202.956) [-1204.892] -- 0:00:23
614500 -- (-1202.380) [-1202.909] (-1203.597) (-1205.836) * [-1203.123] (-1205.852) (-1204.862) (-1203.917) -- 0:00:23
615000 -- (-1203.943) (-1204.686) (-1204.518) [-1203.563] * (-1203.730) (-1203.447) [-1207.581] (-1204.385) -- 0:00:23
Average standard deviation of split frequencies: 0.005663
615500 -- (-1202.960) [-1202.159] (-1204.369) (-1204.859) * (-1202.920) [-1202.750] (-1209.873) (-1202.060) -- 0:00:23
616000 -- (-1203.568) (-1204.419) [-1202.977] (-1204.132) * (-1205.753) [-1207.612] (-1203.671) (-1204.061) -- 0:00:23
616500 -- [-1204.041] (-1205.985) (-1203.913) (-1209.119) * [-1203.931] (-1205.314) (-1203.773) (-1203.416) -- 0:00:23
617000 -- (-1202.818) (-1205.726) [-1203.335] (-1205.610) * [-1204.537] (-1205.495) (-1204.465) (-1203.461) -- 0:00:23
617500 -- [-1204.921] (-1206.453) (-1203.914) (-1204.423) * (-1203.118) (-1204.590) [-1209.065] (-1203.816) -- 0:00:23
618000 -- [-1203.803] (-1202.392) (-1202.002) (-1202.437) * (-1202.420) [-1204.058] (-1203.532) (-1202.571) -- 0:00:23
618500 -- (-1204.661) (-1201.895) (-1204.616) [-1203.550] * (-1205.654) (-1202.981) [-1202.736] (-1208.318) -- 0:00:23
619000 -- (-1204.919) [-1202.496] (-1203.265) (-1205.258) * [-1208.205] (-1202.589) (-1202.972) (-1204.827) -- 0:00:23
619500 -- [-1208.155] (-1202.643) (-1203.227) (-1205.455) * (-1209.269) (-1205.711) [-1202.578] (-1208.550) -- 0:00:23
620000 -- (-1205.766) (-1207.498) [-1203.299] (-1205.749) * (-1207.719) [-1205.315] (-1202.157) (-1206.096) -- 0:00:23
Average standard deviation of split frequencies: 0.005519
620500 -- (-1203.204) [-1203.414] (-1201.859) (-1204.329) * (-1204.193) (-1203.728) [-1201.705] (-1205.037) -- 0:00:23
621000 -- (-1205.727) [-1202.111] (-1201.918) (-1203.524) * (-1204.630) [-1202.357] (-1202.412) (-1203.697) -- 0:00:23
621500 -- (-1203.304) (-1201.788) (-1203.026) [-1203.705] * (-1204.003) (-1203.349) (-1203.286) [-1203.462] -- 0:00:23
622000 -- (-1202.691) (-1201.769) [-1203.136] (-1203.881) * [-1204.695] (-1204.590) (-1203.033) (-1204.041) -- 0:00:23
622500 -- (-1206.641) (-1204.887) (-1204.370) [-1203.726] * (-1206.164) (-1204.247) [-1202.631] (-1204.025) -- 0:00:23
623000 -- [-1202.122] (-1204.921) (-1205.387) (-1205.401) * (-1204.953) (-1202.603) (-1203.562) [-1203.649] -- 0:00:23
623500 -- [-1204.820] (-1203.372) (-1203.522) (-1205.669) * [-1203.139] (-1203.843) (-1203.782) (-1206.423) -- 0:00:23
624000 -- [-1205.834] (-1205.970) (-1202.104) (-1202.404) * (-1202.656) (-1202.178) [-1203.822] (-1204.819) -- 0:00:23
624500 -- (-1208.125) (-1205.790) [-1205.010] (-1204.801) * (-1202.694) [-1203.047] (-1202.527) (-1204.230) -- 0:00:23
625000 -- (-1202.002) (-1208.509) (-1203.291) [-1202.918] * (-1206.541) [-1202.574] (-1203.391) (-1205.852) -- 0:00:23
Average standard deviation of split frequencies: 0.006401
625500 -- (-1201.740) (-1208.764) (-1203.191) [-1204.268] * (-1205.604) (-1204.695) [-1202.863] (-1204.988) -- 0:00:23
626000 -- (-1201.650) (-1202.763) (-1202.619) [-1204.773] * [-1202.232] (-1213.119) (-1202.886) (-1202.176) -- 0:00:23
626500 -- [-1203.683] (-1205.321) (-1203.965) (-1205.994) * [-1201.972] (-1203.857) (-1203.765) (-1202.396) -- 0:00:23
627000 -- (-1206.970) (-1204.750) [-1203.708] (-1201.940) * (-1201.834) (-1206.481) (-1207.270) [-1203.096] -- 0:00:23
627500 -- (-1204.605) (-1204.412) (-1204.402) [-1201.868] * [-1205.503] (-1204.648) (-1203.878) (-1203.263) -- 0:00:23
628000 -- (-1203.720) (-1203.399) [-1204.594] (-1202.222) * (-1204.155) (-1206.990) (-1205.225) [-1205.211] -- 0:00:23
628500 -- (-1203.188) [-1204.164] (-1202.943) (-1202.001) * (-1206.079) (-1206.489) (-1204.493) [-1204.417] -- 0:00:23
629000 -- (-1204.356) [-1203.570] (-1204.660) (-1201.931) * (-1203.256) (-1203.860) (-1204.704) [-1206.934] -- 0:00:23
629500 -- (-1202.634) (-1204.622) (-1204.500) [-1204.043] * (-1203.499) [-1202.921] (-1202.316) (-1203.311) -- 0:00:22
630000 -- [-1203.241] (-1202.453) (-1203.494) (-1202.208) * (-1204.242) (-1203.440) [-1201.642] (-1204.849) -- 0:00:22
Average standard deviation of split frequencies: 0.006540
630500 -- [-1207.205] (-1202.362) (-1202.838) (-1203.375) * (-1204.280) (-1202.900) [-1203.256] (-1203.030) -- 0:00:22
631000 -- (-1209.215) (-1203.712) (-1203.711) [-1202.677] * [-1202.701] (-1206.392) (-1204.961) (-1202.664) -- 0:00:22
631500 -- (-1204.766) (-1203.344) [-1202.404] (-1203.602) * (-1202.687) [-1210.302] (-1204.728) (-1202.157) -- 0:00:22
632000 -- (-1204.073) (-1210.332) (-1203.404) [-1202.068] * (-1204.249) (-1203.481) (-1205.110) [-1202.936] -- 0:00:22
632500 -- (-1205.516) (-1205.458) [-1204.650] (-1203.004) * (-1203.505) (-1204.714) [-1205.563] (-1204.543) -- 0:00:22
633000 -- (-1208.914) [-1205.086] (-1202.251) (-1204.270) * [-1203.541] (-1204.768) (-1203.542) (-1207.501) -- 0:00:22
633500 -- (-1203.929) (-1204.146) [-1203.105] (-1203.250) * (-1203.920) (-1202.349) [-1204.720] (-1203.743) -- 0:00:22
634000 -- [-1206.283] (-1202.825) (-1203.587) (-1205.268) * (-1203.290) [-1201.869] (-1205.959) (-1202.374) -- 0:00:22
634500 -- [-1203.779] (-1201.882) (-1202.568) (-1207.404) * [-1203.413] (-1202.950) (-1202.777) (-1203.165) -- 0:00:22
635000 -- (-1203.519) (-1204.596) [-1204.384] (-1204.011) * [-1204.655] (-1203.943) (-1202.916) (-1205.507) -- 0:00:22
Average standard deviation of split frequencies: 0.006902
635500 -- (-1203.133) [-1206.492] (-1204.389) (-1202.222) * (-1205.426) (-1206.499) (-1204.613) [-1205.822] -- 0:00:22
636000 -- (-1202.063) [-1204.959] (-1203.222) (-1205.084) * (-1205.768) (-1203.769) [-1202.968] (-1206.329) -- 0:00:22
636500 -- (-1205.345) (-1204.044) [-1203.431] (-1213.766) * (-1205.758) (-1204.733) [-1203.148] (-1205.570) -- 0:00:22
637000 -- (-1204.793) (-1205.003) [-1201.914] (-1205.873) * (-1204.383) [-1203.431] (-1204.415) (-1202.999) -- 0:00:22
637500 -- [-1203.862] (-1203.246) (-1202.704) (-1203.496) * [-1205.124] (-1202.105) (-1203.211) (-1202.817) -- 0:00:22
638000 -- (-1204.403) [-1203.366] (-1202.791) (-1203.496) * (-1206.384) (-1202.226) [-1201.710] (-1203.734) -- 0:00:22
638500 -- (-1205.514) (-1202.075) (-1203.839) [-1203.844] * (-1204.254) [-1202.359] (-1202.245) (-1203.424) -- 0:00:22
639000 -- (-1203.163) (-1202.030) (-1202.286) [-1202.552] * (-1205.667) (-1203.333) (-1203.761) [-1206.021] -- 0:00:22
639500 -- (-1204.439) [-1207.702] (-1202.058) (-1206.468) * (-1204.594) (-1204.600) [-1203.119] (-1205.857) -- 0:00:22
640000 -- (-1203.580) [-1203.130] (-1203.910) (-1204.044) * (-1207.092) (-1208.538) [-1206.302] (-1206.144) -- 0:00:22
Average standard deviation of split frequencies: 0.006867
640500 -- [-1202.327] (-1205.691) (-1207.230) (-1206.072) * (-1206.028) (-1203.859) [-1205.191] (-1203.089) -- 0:00:22
641000 -- (-1202.772) [-1205.926] (-1206.849) (-1206.349) * (-1207.964) (-1203.880) [-1205.010] (-1205.799) -- 0:00:22
641500 -- (-1207.525) (-1203.300) [-1204.205] (-1206.193) * (-1207.718) (-1206.661) (-1202.560) [-1202.658] -- 0:00:22
642000 -- (-1202.292) (-1202.307) [-1202.982] (-1208.571) * (-1205.075) (-1202.495) [-1202.831] (-1203.580) -- 0:00:22
642500 -- [-1201.657] (-1203.312) (-1204.022) (-1203.473) * (-1205.066) (-1203.689) [-1204.248] (-1213.568) -- 0:00:22
643000 -- (-1202.633) (-1208.961) (-1203.549) [-1210.176] * (-1202.934) (-1203.429) [-1201.954] (-1204.148) -- 0:00:22
643500 -- (-1203.135) [-1202.568] (-1205.028) (-1211.440) * [-1204.198] (-1203.895) (-1202.556) (-1205.726) -- 0:00:22
644000 -- (-1205.293) (-1204.352) [-1202.176] (-1206.272) * [-1203.007] (-1203.787) (-1208.856) (-1203.149) -- 0:00:22
644500 -- (-1205.667) (-1205.468) [-1201.732] (-1202.067) * (-1204.426) [-1209.726] (-1205.665) (-1206.217) -- 0:00:22
645000 -- [-1205.854] (-1203.905) (-1205.198) (-1202.026) * (-1203.220) [-1201.834] (-1204.505) (-1206.440) -- 0:00:22
Average standard deviation of split frequencies: 0.007512
645500 -- [-1204.686] (-1205.797) (-1204.522) (-1202.982) * [-1202.148] (-1201.870) (-1204.296) (-1206.594) -- 0:00:21
646000 -- [-1204.236] (-1203.740) (-1202.388) (-1202.259) * [-1210.529] (-1207.697) (-1204.363) (-1203.502) -- 0:00:21
646500 -- (-1205.535) [-1203.453] (-1203.340) (-1201.755) * (-1205.313) (-1209.293) [-1204.977] (-1202.934) -- 0:00:21
647000 -- (-1202.603) (-1207.160) [-1203.176] (-1202.756) * (-1205.148) (-1203.731) (-1211.296) [-1203.232] -- 0:00:21
647500 -- [-1202.355] (-1204.689) (-1202.214) (-1203.201) * (-1204.588) [-1203.964] (-1207.001) (-1203.797) -- 0:00:21
648000 -- (-1203.949) (-1206.556) (-1205.786) [-1204.057] * (-1203.909) (-1205.662) (-1207.633) [-1205.588] -- 0:00:21
648500 -- (-1204.454) (-1202.684) (-1205.845) [-1203.031] * (-1202.590) (-1207.543) (-1204.128) [-1202.325] -- 0:00:21
649000 -- (-1202.222) (-1206.324) (-1204.008) [-1202.006] * [-1201.870] (-1209.190) (-1203.972) (-1202.468) -- 0:00:21
649500 -- (-1201.867) (-1201.974) [-1203.116] (-1203.695) * (-1201.895) (-1206.774) (-1205.823) [-1203.035] -- 0:00:21
650000 -- [-1202.706] (-1201.950) (-1204.323) (-1202.369) * (-1202.851) [-1204.366] (-1202.933) (-1204.308) -- 0:00:21
Average standard deviation of split frequencies: 0.007471
650500 -- (-1206.939) (-1202.503) (-1203.639) [-1203.276] * (-1206.884) (-1204.731) [-1202.363] (-1203.465) -- 0:00:21
651000 -- [-1203.461] (-1202.486) (-1203.742) (-1203.281) * (-1206.081) (-1205.459) [-1201.970] (-1210.693) -- 0:00:21
651500 -- (-1204.080) [-1202.606] (-1203.344) (-1203.017) * [-1205.833] (-1203.374) (-1203.773) (-1202.728) -- 0:00:21
652000 -- (-1205.380) (-1206.523) (-1205.913) [-1205.685] * [-1206.063] (-1206.595) (-1203.406) (-1202.877) -- 0:00:21
652500 -- (-1201.891) [-1205.010] (-1203.992) (-1202.280) * (-1207.456) [-1203.148] (-1204.309) (-1203.997) -- 0:00:21
653000 -- (-1202.917) (-1202.994) [-1203.904] (-1203.529) * (-1208.347) [-1204.818] (-1204.429) (-1204.641) -- 0:00:21
653500 -- (-1204.049) (-1202.550) [-1203.368] (-1203.132) * [-1203.028] (-1205.079) (-1203.005) (-1204.024) -- 0:00:21
654000 -- (-1205.216) [-1202.526] (-1202.304) (-1203.726) * (-1202.868) (-1203.595) [-1204.505] (-1203.651) -- 0:00:21
654500 -- (-1204.598) [-1201.968] (-1202.629) (-1202.330) * (-1202.910) [-1202.881] (-1203.920) (-1204.646) -- 0:00:21
655000 -- (-1204.168) (-1202.750) [-1203.209] (-1201.920) * (-1203.860) (-1205.171) [-1203.394] (-1204.362) -- 0:00:21
Average standard deviation of split frequencies: 0.007186
655500 -- (-1203.763) (-1203.527) [-1202.901] (-1203.285) * (-1207.656) (-1203.262) [-1203.211] (-1204.684) -- 0:00:21
656000 -- (-1204.504) [-1203.510] (-1202.648) (-1206.405) * (-1204.667) (-1203.884) (-1203.319) [-1202.970] -- 0:00:21
656500 -- (-1204.341) [-1203.971] (-1203.879) (-1207.374) * (-1206.875) [-1203.108] (-1204.761) (-1201.876) -- 0:00:21
657000 -- (-1207.153) (-1202.368) (-1202.803) [-1202.113] * (-1205.361) (-1202.067) [-1203.515] (-1203.659) -- 0:00:21
657500 -- (-1204.093) (-1202.689) (-1204.947) [-1202.673] * (-1204.998) (-1202.940) (-1203.346) [-1204.258] -- 0:00:21
658000 -- (-1206.266) (-1204.296) [-1202.177] (-1202.806) * [-1203.297] (-1205.843) (-1205.622) (-1202.588) -- 0:00:21
658500 -- [-1205.553] (-1204.578) (-1202.995) (-1204.569) * (-1204.348) (-1203.319) [-1208.852] (-1202.994) -- 0:00:21
659000 -- (-1203.830) (-1203.852) [-1204.098] (-1207.856) * (-1203.116) [-1204.847] (-1204.547) (-1205.877) -- 0:00:21
659500 -- [-1203.055] (-1203.676) (-1204.550) (-1203.263) * (-1204.412) (-1207.729) [-1205.704] (-1205.779) -- 0:00:21
660000 -- (-1203.355) (-1204.250) [-1204.063] (-1203.463) * (-1202.316) (-1207.593) (-1203.706) [-1205.255] -- 0:00:21
Average standard deviation of split frequencies: 0.007492
660500 -- (-1202.856) (-1206.900) (-1204.631) [-1203.289] * (-1203.473) [-1205.122] (-1203.813) (-1205.746) -- 0:00:21
661000 -- (-1202.251) [-1203.620] (-1202.353) (-1202.314) * (-1202.850) (-1201.717) (-1203.508) [-1205.093] -- 0:00:21
661500 -- (-1202.708) (-1202.347) (-1202.573) [-1202.093] * [-1205.923] (-1202.028) (-1204.251) (-1205.568) -- 0:00:20
662000 -- (-1207.787) [-1204.192] (-1203.507) (-1204.075) * (-1202.386) [-1201.995] (-1206.072) (-1206.047) -- 0:00:20
662500 -- (-1202.907) (-1207.280) (-1203.595) [-1203.141] * (-1202.022) (-1204.300) [-1206.755] (-1202.326) -- 0:00:20
663000 -- (-1202.977) [-1202.328] (-1204.920) (-1203.127) * (-1202.814) [-1202.879] (-1203.045) (-1204.457) -- 0:00:20
663500 -- (-1204.982) (-1202.770) (-1202.681) [-1203.444] * [-1202.555] (-1203.636) (-1203.486) (-1204.360) -- 0:00:20
664000 -- [-1202.988] (-1209.998) (-1203.527) (-1203.703) * [-1202.896] (-1202.894) (-1203.573) (-1207.771) -- 0:00:20
664500 -- (-1202.894) (-1205.870) [-1203.556] (-1207.170) * (-1203.918) (-1208.514) (-1204.188) [-1203.841] -- 0:00:20
665000 -- [-1203.716] (-1204.940) (-1207.708) (-1203.294) * [-1202.061] (-1205.946) (-1205.182) (-1202.414) -- 0:00:20
Average standard deviation of split frequencies: 0.007299
665500 -- (-1204.975) [-1205.931] (-1211.310) (-1203.607) * [-1202.995] (-1205.900) (-1203.763) (-1201.801) -- 0:00:20
666000 -- [-1205.673] (-1205.919) (-1201.672) (-1204.154) * (-1204.739) [-1203.921] (-1204.451) (-1201.728) -- 0:00:20
666500 -- [-1206.278] (-1203.680) (-1203.289) (-1204.900) * [-1203.812] (-1205.323) (-1205.009) (-1204.390) -- 0:00:20
667000 -- [-1202.656] (-1209.454) (-1202.077) (-1204.201) * (-1202.670) (-1205.846) [-1202.825] (-1208.729) -- 0:00:20
667500 -- (-1210.592) (-1209.501) (-1202.776) [-1203.720] * (-1203.457) [-1202.592] (-1203.406) (-1206.629) -- 0:00:20
668000 -- (-1206.699) (-1204.047) [-1202.950] (-1201.929) * (-1203.350) (-1203.063) (-1204.550) [-1204.480] -- 0:00:20
668500 -- (-1203.427) [-1202.775] (-1204.212) (-1202.442) * (-1205.016) (-1202.653) [-1203.447] (-1204.256) -- 0:00:20
669000 -- [-1203.735] (-1203.870) (-1202.995) (-1203.019) * (-1207.724) [-1202.769] (-1208.493) (-1206.243) -- 0:00:20
669500 -- (-1202.164) [-1202.063] (-1202.424) (-1202.936) * [-1204.008] (-1202.648) (-1203.443) (-1208.102) -- 0:00:20
670000 -- [-1203.158] (-1202.417) (-1204.022) (-1202.198) * [-1203.545] (-1203.883) (-1203.243) (-1211.489) -- 0:00:20
Average standard deviation of split frequencies: 0.007161
670500 -- (-1209.790) (-1202.981) [-1204.721] (-1204.843) * (-1205.065) (-1204.384) [-1201.903] (-1207.610) -- 0:00:20
671000 -- (-1202.908) (-1205.892) [-1202.040] (-1206.311) * (-1210.411) [-1201.937] (-1202.112) (-1203.423) -- 0:00:20
671500 -- (-1202.760) (-1206.057) (-1201.857) [-1204.116] * [-1204.388] (-1204.097) (-1202.416) (-1203.616) -- 0:00:20
672000 -- (-1207.918) (-1203.892) [-1202.057] (-1206.934) * (-1202.472) (-1205.098) [-1201.842] (-1202.641) -- 0:00:20
672500 -- (-1202.228) [-1204.658] (-1203.435) (-1204.115) * (-1203.470) (-1203.282) (-1203.807) [-1204.094] -- 0:00:20
673000 -- (-1205.283) (-1205.909) (-1203.168) [-1208.213] * (-1203.714) [-1205.410] (-1208.209) (-1206.779) -- 0:00:20
673500 -- (-1202.878) (-1202.417) [-1203.310] (-1206.481) * (-1202.668) [-1201.766] (-1204.846) (-1206.769) -- 0:00:20
674000 -- (-1201.916) (-1202.018) (-1207.526) [-1202.997] * (-1204.626) (-1202.237) (-1204.188) [-1204.795] -- 0:00:20
674500 -- (-1203.238) (-1203.850) [-1207.051] (-1204.565) * (-1203.755) [-1202.592] (-1204.983) (-1203.093) -- 0:00:20
675000 -- (-1202.022) [-1202.567] (-1202.556) (-1205.142) * (-1203.466) [-1202.407] (-1204.065) (-1203.734) -- 0:00:20
Average standard deviation of split frequencies: 0.007235
675500 -- (-1202.647) (-1204.964) [-1202.680] (-1204.605) * (-1204.986) [-1203.079] (-1203.943) (-1202.934) -- 0:00:20
676000 -- [-1202.937] (-1203.525) (-1207.089) (-1205.957) * (-1201.910) [-1206.376] (-1204.376) (-1204.083) -- 0:00:20
676500 -- (-1203.868) [-1204.835] (-1205.678) (-1204.095) * (-1201.937) [-1202.382] (-1203.459) (-1206.562) -- 0:00:20
677000 -- (-1203.212) (-1202.208) (-1205.769) [-1202.208] * (-1204.627) (-1203.035) (-1207.096) [-1204.432] -- 0:00:20
677500 -- (-1204.677) (-1204.533) (-1210.544) [-1203.429] * (-1203.300) (-1203.217) [-1203.346] (-1208.895) -- 0:00:19
678000 -- (-1208.024) [-1204.694] (-1203.598) (-1202.515) * (-1202.608) [-1202.131] (-1202.598) (-1208.937) -- 0:00:19
678500 -- (-1204.994) [-1206.471] (-1202.363) (-1203.600) * [-1201.990] (-1202.193) (-1204.182) (-1204.203) -- 0:00:19
679000 -- [-1204.556] (-1206.465) (-1207.301) (-1204.754) * (-1202.670) [-1204.258] (-1205.593) (-1203.578) -- 0:00:19
679500 -- (-1208.817) (-1203.479) (-1203.269) [-1208.204] * [-1206.705] (-1202.006) (-1204.132) (-1203.159) -- 0:00:19
680000 -- (-1206.468) (-1205.688) (-1202.647) [-1202.986] * (-1205.288) (-1203.394) [-1207.470] (-1203.013) -- 0:00:19
Average standard deviation of split frequencies: 0.007532
680500 -- [-1202.274] (-1204.789) (-1205.953) (-1204.441) * (-1204.735) (-1202.885) (-1204.084) [-1202.125] -- 0:00:19
681000 -- (-1203.170) [-1204.700] (-1207.255) (-1203.340) * (-1205.529) [-1204.792] (-1202.995) (-1205.370) -- 0:00:19
681500 -- (-1208.318) [-1203.048] (-1207.794) (-1203.665) * (-1203.100) [-1205.663] (-1201.961) (-1203.255) -- 0:00:19
682000 -- (-1208.007) (-1203.455) (-1204.974) [-1205.336] * (-1202.143) [-1205.619] (-1205.969) (-1201.885) -- 0:00:19
682500 -- (-1204.886) [-1204.469] (-1202.807) (-1204.678) * [-1202.718] (-1210.798) (-1205.215) (-1204.731) -- 0:00:19
683000 -- [-1206.855] (-1207.532) (-1204.289) (-1205.035) * (-1203.179) [-1206.340] (-1203.605) (-1205.610) -- 0:00:19
683500 -- (-1206.725) (-1205.029) [-1204.419] (-1205.144) * (-1204.006) (-1203.830) (-1206.023) [-1204.504] -- 0:00:19
684000 -- (-1204.709) [-1205.718] (-1205.999) (-1202.363) * [-1205.900] (-1204.993) (-1205.866) (-1201.543) -- 0:00:19
684500 -- [-1204.320] (-1203.930) (-1210.687) (-1204.841) * (-1204.955) (-1203.828) [-1204.341] (-1204.029) -- 0:00:19
685000 -- (-1205.567) (-1206.911) [-1206.267] (-1203.261) * (-1206.352) [-1202.996] (-1204.539) (-1203.665) -- 0:00:19
Average standard deviation of split frequencies: 0.007001
685500 -- (-1202.989) (-1208.009) (-1203.173) [-1204.085] * [-1204.254] (-1201.893) (-1201.859) (-1205.123) -- 0:00:19
686000 -- [-1202.932] (-1202.006) (-1205.082) (-1203.687) * (-1204.756) (-1202.438) (-1202.728) [-1203.214] -- 0:00:19
686500 -- (-1204.589) (-1203.524) (-1203.369) [-1202.336] * [-1203.779] (-1202.233) (-1203.646) (-1204.639) -- 0:00:19
687000 -- [-1205.402] (-1203.557) (-1203.247) (-1203.441) * (-1202.853) [-1202.303] (-1203.745) (-1204.502) -- 0:00:19
687500 -- (-1205.444) (-1207.590) [-1202.538] (-1202.476) * (-1202.926) (-1204.221) (-1207.014) [-1203.580] -- 0:00:19
688000 -- (-1203.644) (-1204.781) (-1203.318) [-1202.410] * (-1203.266) (-1204.836) (-1203.250) [-1206.656] -- 0:00:19
688500 -- (-1203.898) (-1203.730) [-1205.766] (-1203.508) * (-1204.108) [-1201.960] (-1202.308) (-1202.315) -- 0:00:19
689000 -- (-1202.976) (-1203.573) [-1205.263] (-1205.503) * (-1203.169) (-1202.145) (-1205.974) [-1204.080] -- 0:00:19
689500 -- (-1203.293) (-1204.148) (-1202.532) [-1202.655] * (-1201.644) (-1202.122) (-1202.282) [-1203.033] -- 0:00:19
690000 -- [-1202.907] (-1205.785) (-1206.342) (-1202.766) * [-1202.989] (-1202.247) (-1204.431) (-1201.774) -- 0:00:19
Average standard deviation of split frequencies: 0.006953
690500 -- (-1202.668) (-1204.059) [-1206.105] (-1206.425) * (-1202.778) [-1202.736] (-1204.348) (-1205.518) -- 0:00:19
691000 -- (-1202.076) (-1204.729) [-1203.117] (-1202.546) * [-1203.852] (-1206.192) (-1202.098) (-1204.469) -- 0:00:19
691500 -- [-1202.068] (-1201.914) (-1204.349) (-1206.925) * (-1204.002) (-1205.376) (-1202.105) [-1203.438] -- 0:00:19
692000 -- [-1203.011] (-1205.393) (-1204.397) (-1203.511) * (-1204.424) (-1205.576) [-1202.226] (-1202.981) -- 0:00:19
692500 -- (-1206.154) (-1204.665) (-1202.593) [-1202.233] * (-1204.605) (-1205.716) (-1203.677) [-1202.702] -- 0:00:19
693000 -- (-1202.828) (-1207.935) [-1203.465] (-1202.897) * (-1207.870) (-1204.513) (-1204.457) [-1203.533] -- 0:00:19
693500 -- (-1206.016) (-1205.575) (-1206.118) [-1203.427] * (-1204.620) (-1208.253) [-1204.567] (-1204.790) -- 0:00:19
694000 -- (-1205.414) (-1205.685) [-1204.043] (-1202.249) * [-1203.834] (-1208.868) (-1203.517) (-1202.487) -- 0:00:18
694500 -- [-1207.557] (-1203.806) (-1204.449) (-1203.883) * (-1205.182) (-1208.688) (-1203.662) [-1203.044] -- 0:00:18
695000 -- (-1209.051) (-1203.360) (-1203.118) [-1203.165] * (-1203.208) (-1206.592) (-1207.199) [-1203.213] -- 0:00:18
Average standard deviation of split frequencies: 0.007704
695500 -- (-1206.323) (-1203.606) [-1203.898] (-1205.409) * (-1204.223) (-1206.354) [-1202.878] (-1203.492) -- 0:00:18
696000 -- (-1204.492) [-1206.400] (-1203.955) (-1205.654) * (-1208.424) [-1203.080] (-1202.677) (-1204.645) -- 0:00:18
696500 -- (-1206.592) [-1205.804] (-1202.677) (-1201.941) * (-1208.908) (-1203.701) [-1202.932] (-1204.288) -- 0:00:18
697000 -- [-1203.703] (-1204.353) (-1207.138) (-1201.897) * (-1204.055) [-1202.974] (-1204.038) (-1203.861) -- 0:00:18
697500 -- (-1203.646) [-1201.781] (-1205.412) (-1204.006) * (-1202.964) [-1204.467] (-1202.759) (-1203.306) -- 0:00:18
698000 -- (-1205.259) (-1204.052) (-1203.574) [-1201.592] * (-1202.184) (-1202.356) (-1203.722) [-1204.823] -- 0:00:18
698500 -- (-1214.509) (-1205.360) (-1205.606) [-1201.521] * [-1203.406] (-1202.491) (-1203.580) (-1211.100) -- 0:00:18
699000 -- [-1203.390] (-1203.231) (-1203.995) (-1202.856) * [-1204.371] (-1202.163) (-1202.564) (-1208.710) -- 0:00:18
699500 -- (-1202.531) (-1207.945) (-1208.662) [-1205.371] * (-1204.469) (-1205.861) [-1202.201] (-1207.743) -- 0:00:18
700000 -- [-1203.046] (-1204.752) (-1203.723) (-1206.625) * (-1202.511) (-1203.654) [-1203.525] (-1206.277) -- 0:00:18
Average standard deviation of split frequencies: 0.006997
700500 -- (-1202.428) (-1207.227) (-1202.006) [-1201.703] * (-1202.272) (-1203.091) [-1207.427] (-1208.069) -- 0:00:18
701000 -- (-1205.808) [-1209.102] (-1203.571) (-1205.138) * (-1203.071) (-1204.059) (-1202.212) [-1202.863] -- 0:00:18
701500 -- (-1204.574) (-1203.808) (-1203.282) [-1208.856] * (-1202.003) [-1202.564] (-1203.092) (-1205.647) -- 0:00:18
702000 -- [-1204.708] (-1202.636) (-1203.255) (-1209.517) * [-1205.775] (-1201.769) (-1203.875) (-1202.718) -- 0:00:18
702500 -- (-1207.109) (-1203.138) [-1203.478] (-1205.676) * (-1205.838) (-1202.190) (-1202.290) [-1204.259] -- 0:00:18
703000 -- (-1204.948) (-1203.496) (-1203.478) [-1203.092] * (-1204.952) (-1203.511) (-1201.826) [-1201.977] -- 0:00:18
703500 -- [-1206.097] (-1204.684) (-1204.796) (-1201.572) * (-1203.696) (-1202.244) (-1205.840) [-1202.491] -- 0:00:18
704000 -- (-1205.938) (-1203.810) [-1203.972] (-1201.918) * (-1204.638) (-1201.890) [-1203.617] (-1203.903) -- 0:00:18
704500 -- (-1209.064) (-1203.497) (-1204.426) [-1201.970] * (-1202.760) (-1202.024) [-1206.936] (-1207.338) -- 0:00:18
705000 -- (-1204.912) (-1204.684) [-1202.652] (-1209.674) * [-1203.891] (-1202.637) (-1202.761) (-1203.677) -- 0:00:18
Average standard deviation of split frequencies: 0.007434
705500 -- (-1203.551) (-1205.383) [-1205.697] (-1204.934) * (-1204.251) (-1202.195) (-1206.571) [-1203.397] -- 0:00:18
706000 -- (-1204.914) (-1204.948) [-1203.718] (-1204.034) * (-1203.081) (-1202.646) [-1203.961] (-1206.644) -- 0:00:18
706500 -- (-1203.899) (-1205.544) (-1206.523) [-1202.071] * (-1202.044) (-1202.471) (-1203.817) [-1203.779] -- 0:00:18
707000 -- (-1207.928) [-1204.811] (-1204.821) (-1202.661) * (-1202.273) (-1203.471) [-1202.015] (-1205.438) -- 0:00:18
707500 -- (-1204.818) (-1203.844) [-1204.567] (-1202.797) * (-1203.009) (-1203.914) (-1202.925) [-1204.294] -- 0:00:18
708000 -- [-1203.449] (-1203.635) (-1201.593) (-1203.236) * (-1204.925) (-1206.398) [-1202.180] (-1205.082) -- 0:00:18
708500 -- [-1203.047] (-1204.115) (-1202.804) (-1203.378) * (-1209.709) (-1210.195) [-1206.407] (-1204.663) -- 0:00:18
709000 -- [-1208.069] (-1205.822) (-1201.616) (-1203.433) * (-1207.981) (-1203.168) [-1205.704] (-1205.559) -- 0:00:18
709500 -- [-1204.073] (-1202.803) (-1204.222) (-1205.285) * (-1203.338) [-1203.179] (-1203.139) (-1203.136) -- 0:00:18
710000 -- (-1203.529) (-1202.142) (-1204.246) [-1202.870] * (-1203.643) [-1208.245] (-1204.049) (-1203.052) -- 0:00:17
Average standard deviation of split frequencies: 0.007562
710500 -- (-1206.973) (-1203.941) (-1202.144) [-1205.467] * (-1205.296) [-1204.677] (-1203.641) (-1203.513) -- 0:00:17
711000 -- (-1206.127) (-1209.389) (-1203.920) [-1203.368] * (-1204.788) (-1205.092) [-1206.688] (-1205.691) -- 0:00:17
711500 -- (-1203.374) (-1205.730) (-1203.484) [-1202.994] * (-1203.508) [-1207.255] (-1202.090) (-1205.181) -- 0:00:17
712000 -- (-1203.334) [-1205.008] (-1203.770) (-1204.249) * (-1204.955) (-1208.090) (-1207.137) [-1203.107] -- 0:00:17
712500 -- (-1204.333) (-1202.101) (-1203.075) [-1209.785] * (-1203.265) (-1203.724) (-1204.282) [-1204.398] -- 0:00:17
713000 -- [-1205.582] (-1205.035) (-1204.037) (-1207.632) * [-1202.497] (-1207.321) (-1206.002) (-1204.317) -- 0:00:17
713500 -- (-1207.874) [-1205.286] (-1204.052) (-1205.933) * (-1207.119) (-1202.810) [-1202.861] (-1201.951) -- 0:00:17
714000 -- (-1203.043) (-1204.373) [-1204.160] (-1206.966) * (-1206.731) [-1203.606] (-1202.890) (-1203.952) -- 0:00:17
714500 -- [-1204.529] (-1203.724) (-1202.680) (-1211.326) * (-1204.348) (-1204.918) [-1203.729] (-1204.294) -- 0:00:17
715000 -- (-1206.116) (-1206.064) [-1203.711] (-1204.655) * [-1202.799] (-1206.612) (-1205.302) (-1203.212) -- 0:00:17
Average standard deviation of split frequencies: 0.008394
715500 -- [-1205.404] (-1208.323) (-1205.162) (-1204.065) * (-1203.535) [-1204.927] (-1203.465) (-1204.204) -- 0:00:17
716000 -- [-1204.463] (-1203.746) (-1204.262) (-1207.068) * (-1203.617) (-1207.639) (-1202.462) [-1203.064] -- 0:00:17
716500 -- (-1204.825) (-1202.375) (-1202.293) [-1203.206] * [-1204.672] (-1206.466) (-1202.688) (-1202.676) -- 0:00:17
717000 -- (-1203.927) [-1203.315] (-1202.356) (-1208.208) * (-1205.236) [-1203.879] (-1202.100) (-1202.094) -- 0:00:17
717500 -- (-1206.692) (-1203.281) [-1206.671] (-1203.207) * (-1202.516) (-1204.012) (-1204.715) [-1202.096] -- 0:00:17
718000 -- (-1203.069) (-1203.513) (-1208.471) [-1202.918] * [-1204.135] (-1201.800) (-1203.987) (-1202.875) -- 0:00:17
718500 -- (-1204.826) [-1204.555] (-1205.429) (-1204.204) * [-1205.456] (-1202.907) (-1202.956) (-1203.697) -- 0:00:17
719000 -- (-1203.351) (-1203.009) (-1205.496) [-1203.175] * (-1205.907) [-1204.194] (-1203.112) (-1203.330) -- 0:00:17
719500 -- (-1205.966) (-1202.659) (-1204.460) [-1203.414] * (-1205.938) (-1204.627) (-1203.041) [-1202.090] -- 0:00:17
720000 -- [-1203.126] (-1206.380) (-1203.780) (-1203.865) * (-1203.817) [-1204.594] (-1203.812) (-1203.577) -- 0:00:17
Average standard deviation of split frequencies: 0.007675
720500 -- (-1202.426) (-1202.570) (-1206.737) [-1203.617] * [-1205.324] (-1202.306) (-1205.355) (-1205.726) -- 0:00:17
721000 -- (-1204.713) (-1203.816) (-1202.982) [-1202.563] * (-1205.563) [-1204.749] (-1203.409) (-1204.093) -- 0:00:17
721500 -- (-1207.570) (-1202.783) [-1202.894] (-1202.288) * (-1211.987) [-1203.124] (-1202.401) (-1203.092) -- 0:00:17
722000 -- [-1203.661] (-1203.387) (-1202.603) (-1203.234) * (-1207.278) [-1203.475] (-1204.940) (-1203.075) -- 0:00:17
722500 -- (-1203.520) (-1207.251) [-1204.219] (-1203.264) * [-1203.021] (-1204.574) (-1202.465) (-1202.235) -- 0:00:17
723000 -- (-1206.072) [-1204.441] (-1203.632) (-1207.438) * (-1203.416) (-1203.799) [-1202.625] (-1202.849) -- 0:00:17
723500 -- (-1205.137) (-1203.806) [-1203.869] (-1205.078) * [-1202.003] (-1202.608) (-1201.930) (-1202.595) -- 0:00:17
724000 -- (-1211.296) (-1205.706) (-1202.144) [-1205.179] * (-1203.899) [-1203.693] (-1204.308) (-1202.847) -- 0:00:17
724500 -- [-1203.480] (-1208.521) (-1204.626) (-1202.703) * [-1204.459] (-1203.315) (-1202.867) (-1206.076) -- 0:00:17
725000 -- [-1203.272] (-1207.760) (-1204.368) (-1203.575) * (-1203.277) [-1202.769] (-1203.622) (-1205.414) -- 0:00:17
Average standard deviation of split frequencies: 0.007792
725500 -- (-1203.417) (-1203.832) (-1204.662) [-1204.031] * (-1205.034) [-1204.817] (-1202.399) (-1216.136) -- 0:00:17
726000 -- (-1210.460) [-1201.925] (-1208.856) (-1202.004) * (-1202.643) [-1204.556] (-1205.101) (-1202.586) -- 0:00:16
726500 -- (-1207.297) [-1202.841] (-1202.884) (-1201.953) * [-1203.838] (-1204.990) (-1208.087) (-1201.753) -- 0:00:16
727000 -- (-1205.369) (-1206.486) (-1203.635) [-1201.875] * [-1203.801] (-1204.712) (-1204.641) (-1202.268) -- 0:00:16
727500 -- (-1203.045) (-1207.121) [-1206.529] (-1209.926) * [-1205.167] (-1204.454) (-1206.497) (-1202.004) -- 0:00:16
728000 -- (-1203.243) (-1204.291) (-1205.953) [-1203.458] * (-1202.866) (-1202.699) [-1202.336] (-1204.577) -- 0:00:16
728500 -- [-1209.256] (-1205.509) (-1205.115) (-1205.710) * [-1202.436] (-1202.226) (-1204.168) (-1206.850) -- 0:00:16
729000 -- (-1204.890) (-1203.991) [-1206.267] (-1202.138) * (-1204.127) [-1206.649] (-1203.278) (-1202.998) -- 0:00:16
729500 -- (-1204.381) [-1201.989] (-1202.828) (-1203.337) * (-1203.303) (-1204.754) (-1203.299) [-1204.821] -- 0:00:16
730000 -- [-1203.180] (-1201.942) (-1203.589) (-1206.679) * (-1203.736) (-1203.250) (-1205.235) [-1202.703] -- 0:00:16
Average standard deviation of split frequencies: 0.007226
730500 -- (-1201.856) (-1204.903) [-1203.000] (-1202.931) * (-1203.397) (-1202.586) [-1206.215] (-1204.425) -- 0:00:16
731000 -- [-1201.663] (-1205.258) (-1203.546) (-1204.895) * (-1207.144) (-1203.144) (-1206.936) [-1202.703] -- 0:00:16
731500 -- (-1202.284) (-1204.657) (-1204.948) [-1204.096] * (-1204.233) (-1202.295) [-1205.576] (-1205.714) -- 0:00:16
732000 -- (-1203.867) [-1202.407] (-1207.289) (-1203.139) * [-1204.896] (-1203.132) (-1201.851) (-1203.133) -- 0:00:16
732500 -- (-1204.267) (-1207.284) [-1204.075] (-1201.626) * (-1210.066) (-1201.792) (-1205.435) [-1202.122] -- 0:00:16
733000 -- [-1201.672] (-1203.182) (-1202.924) (-1209.324) * (-1207.278) (-1206.786) [-1202.825] (-1202.391) -- 0:00:16
733500 -- (-1201.777) (-1205.666) (-1203.496) [-1204.227] * (-1204.848) (-1204.685) (-1201.997) [-1204.412] -- 0:00:16
734000 -- (-1203.867) (-1206.250) (-1204.260) [-1202.397] * [-1202.072] (-1202.964) (-1202.950) (-1203.608) -- 0:00:16
734500 -- [-1202.162] (-1201.575) (-1204.578) (-1203.039) * [-1203.016] (-1203.997) (-1201.573) (-1203.551) -- 0:00:16
735000 -- (-1203.592) [-1202.964] (-1201.676) (-1201.807) * (-1202.887) (-1203.343) (-1206.114) [-1202.229] -- 0:00:16
Average standard deviation of split frequencies: 0.007174
735500 -- (-1202.634) [-1203.149] (-1203.906) (-1203.194) * (-1202.433) (-1201.943) (-1205.216) [-1202.615] -- 0:00:16
736000 -- (-1204.549) [-1203.109] (-1207.632) (-1202.020) * (-1203.798) [-1202.457] (-1210.095) (-1203.771) -- 0:00:16
736500 -- (-1203.398) [-1203.547] (-1205.195) (-1202.116) * [-1202.454] (-1203.778) (-1209.304) (-1204.118) -- 0:00:16
737000 -- (-1204.695) [-1206.868] (-1205.914) (-1203.165) * (-1205.009) [-1204.686] (-1202.977) (-1201.998) -- 0:00:16
737500 -- (-1204.453) (-1205.253) (-1205.149) [-1203.746] * (-1202.367) [-1206.642] (-1203.252) (-1203.248) -- 0:00:16
738000 -- (-1205.087) (-1208.478) [-1206.759] (-1205.540) * (-1202.227) (-1205.097) (-1204.164) [-1203.576] -- 0:00:16
738500 -- (-1205.199) (-1208.030) (-1202.750) [-1202.536] * (-1203.183) [-1206.767] (-1204.554) (-1204.353) -- 0:00:16
739000 -- (-1206.273) (-1203.332) [-1204.268] (-1203.188) * [-1204.587] (-1211.576) (-1202.086) (-1202.929) -- 0:00:16
739500 -- (-1202.917) (-1203.611) (-1207.523) [-1202.672] * (-1205.456) (-1209.167) (-1203.103) [-1203.967] -- 0:00:16
740000 -- [-1202.873] (-1207.174) (-1202.166) (-1202.708) * (-1205.537) (-1205.109) (-1206.800) [-1204.111] -- 0:00:16
Average standard deviation of split frequencies: 0.006831
740500 -- [-1202.210] (-1201.916) (-1205.103) (-1204.667) * (-1206.761) [-1206.427] (-1203.562) (-1202.249) -- 0:00:16
741000 -- (-1202.756) [-1203.424] (-1204.478) (-1206.495) * (-1206.579) (-1202.653) (-1203.231) [-1203.956] -- 0:00:16
741500 -- (-1204.533) (-1203.246) [-1204.965] (-1206.729) * (-1208.419) [-1203.685] (-1203.383) (-1206.553) -- 0:00:16
742000 -- (-1205.516) [-1202.344] (-1204.544) (-1203.483) * (-1205.942) [-1202.235] (-1203.119) (-1203.587) -- 0:00:15
742500 -- (-1204.818) [-1203.763] (-1204.568) (-1203.688) * (-1204.709) [-1204.962] (-1204.814) (-1206.263) -- 0:00:15
743000 -- (-1205.879) (-1202.325) [-1202.922] (-1205.552) * (-1204.841) (-1204.694) [-1204.837] (-1204.762) -- 0:00:15
743500 -- (-1202.799) [-1206.422] (-1202.368) (-1203.079) * (-1202.892) (-1203.163) (-1206.736) [-1203.990] -- 0:00:15
744000 -- (-1202.823) (-1204.199) (-1202.335) [-1202.498] * (-1203.658) (-1202.915) (-1204.036) [-1203.122] -- 0:00:15
744500 -- (-1202.103) (-1205.526) (-1204.137) [-1203.661] * (-1202.892) [-1204.317] (-1203.524) (-1204.120) -- 0:00:15
745000 -- (-1202.511) [-1203.065] (-1205.010) (-1205.451) * (-1204.825) (-1203.414) [-1203.005] (-1208.476) -- 0:00:15
Average standard deviation of split frequencies: 0.006319
745500 -- (-1202.853) (-1203.675) (-1203.578) [-1204.524] * (-1202.867) (-1202.685) [-1202.618] (-1202.168) -- 0:00:15
746000 -- (-1204.939) (-1203.274) (-1203.392) [-1203.081] * (-1203.946) [-1208.129] (-1203.562) (-1202.460) -- 0:00:15
746500 -- (-1203.758) (-1203.421) (-1206.027) [-1202.680] * (-1206.611) (-1202.738) [-1204.929] (-1204.259) -- 0:00:15
747000 -- (-1205.526) [-1204.646] (-1204.684) (-1203.609) * (-1204.566) (-1204.948) [-1203.403] (-1202.502) -- 0:00:15
747500 -- (-1204.435) (-1203.669) (-1203.760) [-1202.523] * (-1204.232) (-1202.089) [-1203.975] (-1205.197) -- 0:00:15
748000 -- (-1204.282) (-1206.373) (-1202.007) [-1202.891] * (-1202.181) [-1204.763] (-1204.483) (-1203.021) -- 0:00:15
748500 -- (-1204.956) (-1202.655) (-1202.771) [-1202.211] * [-1203.045] (-1206.680) (-1204.585) (-1204.129) -- 0:00:15
749000 -- (-1207.693) (-1203.828) [-1203.513] (-1202.279) * (-1202.381) (-1203.623) [-1203.068] (-1206.000) -- 0:00:15
749500 -- (-1204.653) (-1203.844) [-1202.653] (-1203.502) * (-1205.100) (-1204.357) (-1202.790) [-1202.510] -- 0:00:15
750000 -- (-1204.912) (-1205.139) [-1202.534] (-1203.593) * (-1207.781) (-1204.399) [-1204.078] (-1206.116) -- 0:00:15
Average standard deviation of split frequencies: 0.005861
750500 -- (-1202.077) (-1205.263) [-1203.800] (-1204.475) * (-1205.595) (-1206.451) [-1202.901] (-1204.548) -- 0:00:15
751000 -- [-1202.625] (-1204.269) (-1202.882) (-1202.209) * (-1204.357) [-1203.568] (-1205.851) (-1205.249) -- 0:00:15
751500 -- [-1202.839] (-1204.472) (-1203.653) (-1203.030) * (-1202.259) [-1203.259] (-1203.141) (-1203.018) -- 0:00:15
752000 -- (-1202.551) [-1204.002] (-1202.603) (-1204.496) * (-1203.028) (-1202.369) [-1205.751] (-1202.806) -- 0:00:15
752500 -- (-1201.773) (-1201.843) (-1206.813) [-1202.271] * (-1203.001) (-1203.026) [-1204.326] (-1208.758) -- 0:00:15
753000 -- (-1203.263) [-1202.606] (-1205.659) (-1202.274) * [-1202.860] (-1207.279) (-1204.737) (-1213.113) -- 0:00:15
753500 -- (-1202.228) (-1204.192) (-1204.021) [-1202.400] * [-1202.929] (-1203.258) (-1207.529) (-1203.970) -- 0:00:15
754000 -- (-1204.361) (-1205.581) [-1205.678] (-1203.435) * (-1205.718) (-1202.968) [-1207.010] (-1206.570) -- 0:00:15
754500 -- (-1205.132) (-1204.181) [-1205.620] (-1203.548) * (-1203.357) [-1205.714] (-1205.452) (-1206.025) -- 0:00:15
755000 -- (-1203.354) [-1204.062] (-1203.368) (-1203.520) * [-1203.980] (-1204.166) (-1204.197) (-1205.635) -- 0:00:15
Average standard deviation of split frequencies: 0.006152
755500 -- (-1204.452) (-1206.970) (-1202.221) [-1206.617] * (-1204.833) (-1209.048) (-1205.363) [-1206.712] -- 0:00:15
756000 -- (-1201.943) [-1204.493] (-1205.711) (-1207.207) * [-1203.881] (-1203.870) (-1202.184) (-1205.482) -- 0:00:15
756500 -- (-1202.768) (-1203.729) (-1203.146) [-1202.982] * [-1203.216] (-1204.092) (-1203.414) (-1201.852) -- 0:00:15
757000 -- (-1203.588) [-1202.581] (-1202.177) (-1203.027) * (-1203.783) (-1202.996) [-1203.654] (-1203.480) -- 0:00:15
757500 -- (-1203.398) (-1210.687) [-1202.152] (-1202.276) * [-1204.550] (-1203.532) (-1202.926) (-1203.323) -- 0:00:15
758000 -- [-1202.245] (-1206.051) (-1203.738) (-1203.763) * (-1205.138) [-1203.558] (-1209.295) (-1204.235) -- 0:00:15
758500 -- (-1207.678) (-1210.523) (-1205.672) [-1202.502] * (-1205.999) [-1203.484] (-1204.334) (-1203.995) -- 0:00:14
759000 -- (-1203.297) [-1204.937] (-1204.237) (-1202.420) * (-1203.047) (-1202.562) (-1204.953) [-1202.539] -- 0:00:14
759500 -- (-1203.297) (-1209.685) (-1205.215) [-1201.675] * [-1203.777] (-1205.234) (-1202.735) (-1202.503) -- 0:00:14
760000 -- (-1202.857) [-1206.031] (-1202.921) (-1204.934) * [-1202.280] (-1202.438) (-1202.972) (-1206.928) -- 0:00:14
Average standard deviation of split frequencies: 0.006280
760500 -- (-1203.337) (-1205.637) (-1205.216) [-1203.004] * [-1202.936] (-1203.805) (-1201.923) (-1203.887) -- 0:00:14
761000 -- (-1203.341) [-1201.684] (-1204.908) (-1203.847) * (-1207.711) (-1207.469) [-1204.401] (-1201.695) -- 0:00:14
761500 -- [-1201.959] (-1202.708) (-1202.638) (-1205.914) * (-1207.549) (-1204.381) (-1203.602) [-1203.321] -- 0:00:14
762000 -- [-1204.308] (-1203.896) (-1203.414) (-1205.625) * [-1204.824] (-1204.014) (-1204.439) (-1203.355) -- 0:00:14
762500 -- (-1204.913) [-1203.570] (-1203.292) (-1208.264) * [-1202.648] (-1207.091) (-1204.652) (-1203.110) -- 0:00:14
763000 -- [-1203.017] (-1203.150) (-1202.708) (-1203.496) * [-1202.231] (-1203.703) (-1205.154) (-1201.909) -- 0:00:14
763500 -- [-1202.352] (-1207.450) (-1205.625) (-1203.132) * (-1207.378) [-1204.435] (-1204.432) (-1204.213) -- 0:00:14
764000 -- (-1205.466) (-1204.864) [-1204.458] (-1203.642) * (-1201.892) (-1204.818) (-1204.977) [-1202.862] -- 0:00:14
764500 -- (-1204.883) [-1205.161] (-1203.155) (-1208.823) * (-1202.449) (-1204.448) [-1204.967] (-1204.426) -- 0:00:14
765000 -- (-1204.925) [-1209.622] (-1203.326) (-1203.997) * [-1201.893] (-1206.447) (-1205.466) (-1205.560) -- 0:00:14
Average standard deviation of split frequencies: 0.006072
765500 -- (-1204.512) (-1205.294) (-1204.928) [-1203.093] * (-1202.409) [-1203.450] (-1205.712) (-1202.691) -- 0:00:14
766000 -- (-1203.887) (-1205.825) (-1206.020) [-1201.825] * (-1202.212) (-1202.207) [-1204.178] (-1202.690) -- 0:00:14
766500 -- (-1205.273) (-1203.664) [-1203.518] (-1201.825) * (-1203.816) (-1203.255) (-1203.546) [-1202.395] -- 0:00:14
767000 -- (-1202.056) (-1205.550) [-1204.830] (-1201.754) * (-1203.109) (-1205.251) [-1205.737] (-1204.028) -- 0:00:14
767500 -- (-1202.146) (-1207.518) (-1203.609) [-1202.393] * [-1205.228] (-1205.871) (-1205.596) (-1202.753) -- 0:00:14
768000 -- (-1203.550) (-1206.823) (-1209.241) [-1203.140] * (-1203.363) (-1204.214) [-1202.865] (-1203.510) -- 0:00:14
768500 -- (-1202.436) (-1209.620) (-1207.041) [-1204.493] * (-1202.310) (-1204.657) (-1203.050) [-1202.821] -- 0:00:14
769000 -- (-1205.386) [-1204.145] (-1207.548) (-1204.721) * (-1203.523) (-1205.289) (-1206.348) [-1205.441] -- 0:00:14
769500 -- (-1205.770) [-1201.672] (-1203.080) (-1208.428) * (-1202.861) (-1204.535) [-1203.922] (-1203.347) -- 0:00:14
770000 -- (-1202.576) (-1203.464) (-1206.576) [-1202.635] * (-1202.238) [-1202.667] (-1205.474) (-1206.801) -- 0:00:14
Average standard deviation of split frequencies: 0.006158
770500 -- [-1203.524] (-1203.245) (-1205.454) (-1201.586) * (-1203.820) (-1205.430) (-1206.063) [-1203.194] -- 0:00:14
771000 -- (-1202.293) [-1205.348] (-1204.473) (-1201.620) * (-1204.671) (-1202.566) [-1202.667] (-1204.320) -- 0:00:14
771500 -- (-1203.327) (-1206.260) [-1203.599] (-1202.269) * (-1208.856) (-1202.423) [-1204.849] (-1205.387) -- 0:00:14
772000 -- (-1205.928) (-1202.325) (-1202.879) [-1201.843] * (-1203.578) (-1202.389) [-1205.867] (-1202.916) -- 0:00:14
772500 -- (-1205.315) [-1202.833] (-1203.999) (-1204.361) * [-1203.697] (-1202.451) (-1204.111) (-1202.748) -- 0:00:14
773000 -- (-1205.275) [-1205.836] (-1203.084) (-1206.122) * (-1206.239) [-1204.982] (-1205.245) (-1202.463) -- 0:00:14
773500 -- [-1205.322] (-1204.748) (-1205.677) (-1206.814) * (-1204.380) [-1204.088] (-1203.072) (-1203.601) -- 0:00:14
774000 -- (-1204.629) [-1203.791] (-1204.608) (-1206.584) * (-1202.667) (-1203.366) (-1202.747) [-1202.682] -- 0:00:14
774500 -- [-1202.474] (-1203.515) (-1204.026) (-1204.861) * (-1203.239) (-1204.837) [-1205.192] (-1204.880) -- 0:00:13
775000 -- (-1205.820) (-1206.142) [-1205.300] (-1204.819) * (-1202.648) (-1202.900) [-1203.854] (-1204.950) -- 0:00:13
Average standard deviation of split frequencies: 0.006480
775500 -- [-1202.353] (-1204.685) (-1204.157) (-1204.701) * [-1203.851] (-1202.715) (-1203.208) (-1204.399) -- 0:00:13
776000 -- (-1203.590) (-1207.097) [-1203.775] (-1206.169) * (-1203.752) [-1202.919] (-1207.095) (-1204.292) -- 0:00:13
776500 -- (-1201.766) (-1204.744) [-1202.468] (-1206.679) * (-1207.040) [-1204.146] (-1203.801) (-1206.870) -- 0:00:13
777000 -- [-1202.560] (-1203.527) (-1203.696) (-1204.411) * (-1202.904) [-1202.650] (-1203.981) (-1207.407) -- 0:00:13
777500 -- (-1202.893) (-1201.958) [-1202.492] (-1204.347) * (-1203.867) (-1204.671) [-1204.227] (-1202.706) -- 0:00:13
778000 -- (-1203.921) [-1202.385] (-1206.911) (-1210.280) * [-1203.572] (-1203.614) (-1202.395) (-1202.568) -- 0:00:13
778500 -- [-1203.243] (-1202.936) (-1205.294) (-1204.694) * (-1203.666) (-1204.633) (-1203.446) [-1203.549] -- 0:00:13
779000 -- [-1203.851] (-1202.682) (-1202.004) (-1204.950) * (-1204.644) (-1203.087) (-1204.595) [-1203.842] -- 0:00:13
779500 -- [-1209.874] (-1203.825) (-1203.170) (-1202.413) * [-1203.688] (-1203.502) (-1202.918) (-1203.998) -- 0:00:13
780000 -- (-1203.975) (-1202.310) (-1202.383) [-1202.307] * (-1204.304) [-1206.518] (-1203.425) (-1204.487) -- 0:00:13
Average standard deviation of split frequencies: 0.006642
780500 -- (-1206.692) [-1202.650] (-1202.254) (-1202.523) * (-1202.806) [-1207.523] (-1206.141) (-1203.158) -- 0:00:13
781000 -- (-1205.676) (-1203.728) [-1204.582] (-1201.929) * [-1204.355] (-1204.281) (-1202.959) (-1202.139) -- 0:00:13
781500 -- (-1202.144) (-1203.618) [-1204.850] (-1203.782) * (-1206.259) [-1204.832] (-1206.103) (-1203.887) -- 0:00:13
782000 -- (-1203.917) (-1205.700) [-1204.900] (-1204.632) * (-1202.658) [-1202.587] (-1203.314) (-1202.702) -- 0:00:13
782500 -- (-1205.801) (-1203.107) [-1202.442] (-1204.096) * [-1203.029] (-1202.746) (-1202.248) (-1203.077) -- 0:00:13
783000 -- [-1204.146] (-1201.934) (-1202.307) (-1205.855) * (-1202.865) [-1203.195] (-1205.400) (-1203.424) -- 0:00:13
783500 -- (-1205.311) (-1204.188) [-1207.213] (-1203.867) * (-1207.030) (-1205.087) [-1207.013] (-1202.975) -- 0:00:13
784000 -- [-1204.144] (-1201.885) (-1204.553) (-1204.643) * (-1207.174) (-1203.814) (-1206.064) [-1202.375] -- 0:00:13
784500 -- (-1204.906) (-1203.510) (-1202.041) [-1204.966] * (-1204.793) (-1205.019) [-1205.713] (-1202.563) -- 0:00:13
785000 -- (-1205.412) [-1203.045] (-1205.557) (-1205.720) * (-1207.518) (-1202.556) [-1202.845] (-1202.266) -- 0:00:13
Average standard deviation of split frequencies: 0.006437
785500 -- (-1209.565) (-1203.035) [-1202.619] (-1207.410) * (-1204.225) (-1202.330) (-1205.374) [-1203.109] -- 0:00:13
786000 -- [-1205.719] (-1203.439) (-1203.176) (-1208.156) * [-1202.732] (-1202.169) (-1202.027) (-1202.456) -- 0:00:13
786500 -- (-1203.569) (-1205.025) [-1202.369] (-1203.030) * [-1203.434] (-1202.724) (-1203.897) (-1202.846) -- 0:00:13
787000 -- (-1204.365) (-1203.546) [-1202.508] (-1203.698) * [-1202.278] (-1203.543) (-1203.651) (-1202.773) -- 0:00:13
787500 -- (-1201.492) [-1208.488] (-1201.633) (-1202.382) * (-1202.783) [-1203.516] (-1203.996) (-1205.258) -- 0:00:13
788000 -- [-1205.160] (-1209.863) (-1201.751) (-1202.548) * (-1201.490) (-1202.921) (-1202.529) [-1203.908] -- 0:00:13
788500 -- (-1202.724) (-1203.556) [-1204.284] (-1202.517) * (-1202.666) [-1202.689] (-1202.529) (-1203.951) -- 0:00:13
789000 -- (-1206.713) [-1205.207] (-1202.665) (-1203.010) * [-1203.355] (-1201.847) (-1205.601) (-1205.159) -- 0:00:13
789500 -- [-1203.613] (-1203.851) (-1203.433) (-1203.111) * (-1204.525) (-1207.326) (-1204.104) [-1202.520] -- 0:00:13
790000 -- [-1204.075] (-1204.074) (-1204.811) (-1202.468) * (-1202.039) [-1204.349] (-1204.181) (-1206.010) -- 0:00:13
Average standard deviation of split frequencies: 0.005883
790500 -- [-1204.240] (-1205.454) (-1203.801) (-1202.986) * (-1205.582) [-1202.727] (-1203.880) (-1202.598) -- 0:00:12
791000 -- [-1204.594] (-1204.216) (-1204.742) (-1207.874) * (-1204.993) (-1203.624) [-1206.513] (-1205.593) -- 0:00:12
791500 -- (-1202.574) (-1202.493) [-1204.722] (-1205.262) * [-1203.531] (-1206.809) (-1203.471) (-1204.441) -- 0:00:12
792000 -- [-1203.070] (-1202.390) (-1203.309) (-1203.746) * [-1201.947] (-1202.301) (-1205.312) (-1204.959) -- 0:00:12
792500 -- (-1202.344) (-1203.353) (-1203.309) [-1205.147] * (-1202.860) (-1203.005) [-1205.320] (-1203.128) -- 0:00:12
793000 -- (-1203.871) (-1202.777) [-1207.567] (-1201.787) * (-1204.265) (-1202.109) [-1202.687] (-1207.718) -- 0:00:12
793500 -- (-1209.065) (-1202.239) (-1206.008) [-1202.348] * (-1204.522) (-1202.346) (-1205.233) [-1204.990] -- 0:00:12
794000 -- (-1204.955) (-1204.688) (-1206.871) [-1203.492] * (-1204.020) [-1204.135] (-1204.981) (-1204.294) -- 0:00:12
794500 -- (-1202.122) [-1205.019] (-1207.487) (-1206.708) * (-1202.283) (-1205.747) (-1205.132) [-1202.862] -- 0:00:12
795000 -- (-1206.167) (-1203.896) (-1204.346) [-1204.637] * (-1203.992) [-1202.103] (-1204.352) (-1203.300) -- 0:00:12
Average standard deviation of split frequencies: 0.005843
795500 -- (-1203.997) (-1203.356) [-1204.558] (-1209.063) * (-1203.457) (-1203.066) [-1201.905] (-1206.594) -- 0:00:12
796000 -- (-1203.773) [-1203.994] (-1202.455) (-1203.060) * [-1206.151] (-1203.769) (-1202.890) (-1209.895) -- 0:00:12
796500 -- [-1203.953] (-1206.071) (-1204.710) (-1201.963) * (-1202.719) (-1202.797) (-1205.016) [-1201.916] -- 0:00:12
797000 -- (-1202.950) (-1203.943) [-1204.696] (-1203.039) * (-1203.520) (-1202.757) (-1203.489) [-1202.547] -- 0:00:12
797500 -- (-1201.955) [-1205.298] (-1203.137) (-1203.574) * (-1204.334) [-1205.008] (-1203.889) (-1203.902) -- 0:00:12
798000 -- (-1202.110) (-1204.055) (-1205.983) [-1202.879] * (-1202.964) (-1204.846) [-1204.907] (-1205.055) -- 0:00:12
798500 -- (-1202.044) (-1202.695) [-1204.324] (-1203.488) * [-1203.181] (-1205.419) (-1203.833) (-1205.078) -- 0:00:12
799000 -- [-1203.556] (-1203.709) (-1208.530) (-1202.029) * (-1202.714) (-1202.788) (-1202.901) [-1205.526] -- 0:00:12
799500 -- [-1204.135] (-1203.058) (-1204.753) (-1202.621) * (-1203.767) (-1202.837) (-1206.189) [-1204.959] -- 0:00:12
800000 -- [-1204.824] (-1204.730) (-1206.847) (-1201.916) * (-1202.448) (-1204.241) [-1204.187] (-1206.148) -- 0:00:12
Average standard deviation of split frequencies: 0.005495
800500 -- (-1204.639) (-1203.355) (-1207.135) [-1202.333] * (-1203.443) (-1206.830) [-1202.726] (-1204.679) -- 0:00:12
801000 -- (-1204.484) (-1202.628) [-1202.429] (-1204.708) * (-1205.301) [-1201.948] (-1201.992) (-1203.705) -- 0:00:12
801500 -- (-1203.480) [-1202.726] (-1202.357) (-1205.059) * (-1205.674) [-1203.072] (-1204.827) (-1204.126) -- 0:00:12
802000 -- (-1204.227) [-1206.890] (-1204.294) (-1204.254) * (-1204.098) (-1202.102) (-1205.123) [-1205.068] -- 0:00:12
802500 -- (-1203.324) (-1207.226) [-1205.088] (-1202.004) * [-1206.586] (-1204.657) (-1204.757) (-1205.666) -- 0:00:12
803000 -- (-1203.492) (-1206.427) (-1204.247) [-1202.778] * [-1203.835] (-1203.064) (-1202.548) (-1205.135) -- 0:00:12
803500 -- [-1205.606] (-1202.626) (-1203.359) (-1207.020) * (-1203.490) (-1206.204) (-1202.136) [-1202.828] -- 0:00:12
804000 -- (-1204.374) [-1204.575] (-1204.215) (-1203.232) * (-1204.603) (-1206.914) [-1204.205] (-1201.823) -- 0:00:12
804500 -- (-1204.763) (-1204.727) [-1204.984] (-1202.747) * [-1209.138] (-1204.636) (-1205.035) (-1201.641) -- 0:00:12
805000 -- [-1204.223] (-1202.186) (-1206.456) (-1206.949) * (-1212.168) (-1204.448) (-1202.861) [-1204.566] -- 0:00:12
Average standard deviation of split frequencies: 0.005498
805500 -- (-1203.024) (-1202.454) (-1204.881) [-1208.149] * [-1203.385] (-1206.010) (-1204.277) (-1206.077) -- 0:00:12
806000 -- (-1205.101) (-1203.338) (-1207.091) [-1203.272] * [-1202.182] (-1205.521) (-1204.894) (-1204.495) -- 0:00:12
806500 -- (-1204.385) (-1203.501) [-1206.392] (-1202.637) * (-1201.880) [-1202.470] (-1202.596) (-1203.613) -- 0:00:11
807000 -- (-1203.982) [-1202.728] (-1205.615) (-1203.549) * (-1202.012) (-1203.477) (-1205.015) [-1202.751] -- 0:00:11
807500 -- (-1203.088) (-1202.573) (-1205.060) [-1204.142] * (-1202.013) [-1201.773] (-1203.364) (-1203.628) -- 0:00:11
808000 -- (-1202.459) [-1207.966] (-1211.198) (-1206.867) * (-1204.568) [-1203.917] (-1204.704) (-1202.881) -- 0:00:11
808500 -- (-1204.458) [-1203.624] (-1202.724) (-1202.585) * (-1209.639) (-1202.187) (-1205.022) [-1202.446] -- 0:00:11
809000 -- (-1202.808) [-1202.317] (-1202.617) (-1204.560) * (-1207.622) (-1202.318) (-1207.271) [-1204.176] -- 0:00:11
809500 -- (-1208.523) (-1202.462) [-1205.458] (-1205.556) * (-1203.668) [-1203.496] (-1206.101) (-1204.143) -- 0:00:11
810000 -- [-1207.094] (-1203.063) (-1204.078) (-1205.128) * [-1203.163] (-1203.880) (-1206.075) (-1202.245) -- 0:00:11
Average standard deviation of split frequencies: 0.006086
810500 -- (-1203.978) (-1202.320) (-1203.127) [-1203.409] * [-1202.424] (-1203.738) (-1203.994) (-1203.597) -- 0:00:11
811000 -- [-1204.117] (-1203.078) (-1203.172) (-1202.827) * [-1203.346] (-1202.694) (-1210.403) (-1205.008) -- 0:00:11
811500 -- [-1204.555] (-1204.562) (-1208.040) (-1203.713) * (-1203.499) (-1204.450) [-1203.178] (-1204.620) -- 0:00:11
812000 -- (-1205.342) [-1205.437] (-1202.655) (-1201.632) * (-1204.319) (-1203.272) (-1203.505) [-1203.065] -- 0:00:11
812500 -- (-1204.188) [-1204.742] (-1203.907) (-1201.928) * (-1204.280) (-1205.037) [-1202.310] (-1205.361) -- 0:00:11
813000 -- (-1203.676) [-1205.506] (-1204.565) (-1202.160) * (-1202.029) [-1203.734] (-1203.602) (-1206.975) -- 0:00:11
813500 -- (-1203.208) (-1207.744) (-1209.561) [-1202.902] * [-1205.888] (-1212.168) (-1208.195) (-1202.961) -- 0:00:11
814000 -- (-1202.765) (-1203.374) [-1206.914] (-1203.818) * [-1203.530] (-1207.880) (-1202.873) (-1204.017) -- 0:00:11
814500 -- [-1204.333] (-1205.978) (-1206.014) (-1205.391) * [-1202.633] (-1206.605) (-1202.281) (-1206.206) -- 0:00:11
815000 -- (-1207.893) (-1204.507) [-1203.684] (-1205.171) * (-1204.416) (-1204.744) (-1202.203) [-1205.379] -- 0:00:11
Average standard deviation of split frequencies: 0.005507
815500 -- (-1203.265) (-1205.708) (-1204.196) [-1203.613] * (-1203.689) (-1202.809) (-1203.178) [-1209.024] -- 0:00:11
816000 -- [-1205.827] (-1205.218) (-1207.352) (-1202.011) * (-1204.650) (-1204.506) (-1203.855) [-1202.626] -- 0:00:11
816500 -- [-1202.968] (-1202.609) (-1204.254) (-1202.396) * [-1203.169] (-1204.515) (-1203.454) (-1202.309) -- 0:00:11
817000 -- (-1204.646) (-1203.087) [-1203.599] (-1204.202) * (-1204.023) (-1210.796) (-1208.049) [-1202.590] -- 0:00:11
817500 -- (-1205.163) (-1202.649) [-1203.906] (-1205.055) * [-1202.866] (-1203.408) (-1203.768) (-1204.894) -- 0:00:11
818000 -- (-1203.832) [-1202.078] (-1205.337) (-1207.027) * (-1204.239) (-1203.516) [-1206.108] (-1204.645) -- 0:00:11
818500 -- [-1203.333] (-1202.170) (-1202.616) (-1207.241) * [-1202.457] (-1201.971) (-1204.027) (-1205.808) -- 0:00:11
819000 -- (-1203.904) (-1204.930) [-1202.320] (-1205.078) * (-1202.884) (-1203.376) [-1205.452] (-1203.090) -- 0:00:11
819500 -- (-1204.290) (-1202.490) [-1203.052] (-1202.327) * (-1208.613) (-1205.319) [-1206.313] (-1203.068) -- 0:00:11
820000 -- (-1204.354) (-1204.778) [-1206.104] (-1203.118) * (-1203.008) (-1202.591) (-1202.222) [-1203.351] -- 0:00:11
Average standard deviation of split frequencies: 0.005093
820500 -- (-1204.220) (-1203.096) [-1202.070] (-1202.832) * [-1203.134] (-1207.584) (-1203.045) (-1205.885) -- 0:00:11
821000 -- (-1202.383) (-1202.927) (-1201.420) [-1204.382] * (-1206.825) (-1207.061) [-1203.567] (-1204.374) -- 0:00:11
821500 -- [-1201.425] (-1206.291) (-1203.978) (-1203.656) * [-1203.626] (-1204.167) (-1203.710) (-1203.992) -- 0:00:11
822000 -- [-1204.617] (-1204.356) (-1205.194) (-1204.111) * (-1202.878) (-1214.131) [-1206.118] (-1205.794) -- 0:00:11
822500 -- (-1205.759) (-1204.788) (-1203.623) [-1203.330] * [-1202.486] (-1208.575) (-1210.145) (-1203.355) -- 0:00:11
823000 -- (-1203.012) (-1203.864) (-1202.968) [-1207.368] * [-1205.507] (-1204.959) (-1204.485) (-1202.483) -- 0:00:10
823500 -- (-1204.474) (-1204.500) [-1202.072] (-1210.720) * [-1204.892] (-1202.536) (-1202.557) (-1202.981) -- 0:00:10
824000 -- (-1205.456) (-1203.347) [-1202.115] (-1205.930) * (-1203.678) [-1203.907] (-1202.451) (-1206.083) -- 0:00:10
824500 -- (-1203.789) [-1202.419] (-1202.107) (-1202.330) * [-1203.760] (-1203.184) (-1202.819) (-1205.530) -- 0:00:10
825000 -- (-1203.766) (-1206.455) (-1203.010) [-1203.198] * (-1202.845) [-1203.296] (-1203.744) (-1202.546) -- 0:00:10
Average standard deviation of split frequencies: 0.004984
825500 -- (-1202.615) (-1203.234) (-1204.144) [-1202.941] * [-1203.498] (-1202.106) (-1206.647) (-1202.272) -- 0:00:10
826000 -- [-1204.881] (-1203.652) (-1204.729) (-1202.412) * [-1203.157] (-1203.613) (-1205.953) (-1202.760) -- 0:00:10
826500 -- (-1204.980) [-1204.837] (-1202.926) (-1203.794) * (-1202.182) (-1203.563) [-1202.272] (-1204.194) -- 0:00:10
827000 -- (-1203.155) (-1204.561) [-1205.649] (-1204.183) * [-1202.110] (-1203.979) (-1203.828) (-1204.508) -- 0:00:10
827500 -- [-1203.913] (-1208.051) (-1202.392) (-1204.486) * (-1202.786) (-1204.941) [-1204.388] (-1211.677) -- 0:00:10
828000 -- (-1204.505) (-1205.891) [-1203.005] (-1202.859) * [-1202.833] (-1204.206) (-1204.951) (-1206.373) -- 0:00:10
828500 -- (-1202.849) (-1202.980) [-1201.970] (-1202.816) * (-1204.870) [-1204.312] (-1208.048) (-1203.552) -- 0:00:10
829000 -- (-1204.073) (-1204.460) (-1202.382) [-1203.186] * [-1203.454] (-1202.365) (-1204.222) (-1206.068) -- 0:00:10
829500 -- [-1203.775] (-1205.389) (-1205.093) (-1201.893) * (-1203.659) [-1204.021] (-1204.528) (-1204.262) -- 0:00:10
830000 -- [-1204.713] (-1204.446) (-1207.090) (-1203.671) * (-1204.423) (-1202.845) (-1201.841) [-1204.126] -- 0:00:10
Average standard deviation of split frequencies: 0.005221
830500 -- (-1203.348) (-1206.502) [-1205.793] (-1205.040) * (-1204.405) (-1202.789) (-1202.993) [-1203.277] -- 0:00:10
831000 -- (-1204.821) (-1202.139) [-1204.976] (-1203.901) * (-1205.780) (-1204.613) (-1203.194) [-1203.535] -- 0:00:10
831500 -- (-1202.578) (-1205.339) (-1205.995) [-1209.831] * (-1206.253) (-1202.599) (-1203.333) [-1202.340] -- 0:00:10
832000 -- (-1205.701) (-1205.741) [-1202.677] (-1204.257) * [-1202.509] (-1205.249) (-1203.807) (-1202.431) -- 0:00:10
832500 -- (-1202.852) (-1203.773) (-1203.149) [-1203.164] * (-1201.639) (-1203.438) (-1203.409) [-1202.489] -- 0:00:10
833000 -- (-1202.055) (-1204.535) [-1204.653] (-1205.752) * (-1206.540) (-1202.575) [-1202.313] (-1202.387) -- 0:00:10
833500 -- (-1203.718) [-1202.241] (-1202.962) (-1205.089) * (-1204.494) (-1202.236) (-1203.812) [-1203.642] -- 0:00:10
834000 -- (-1205.647) [-1204.625] (-1202.799) (-1205.906) * (-1204.052) (-1203.121) (-1203.598) [-1203.366] -- 0:00:10
834500 -- [-1202.170] (-1204.373) (-1202.135) (-1211.282) * (-1206.920) (-1204.365) [-1204.205] (-1205.374) -- 0:00:10
835000 -- (-1203.419) (-1202.884) [-1202.626] (-1204.457) * (-1206.567) (-1202.557) [-1204.437] (-1203.707) -- 0:00:10
Average standard deviation of split frequencies: 0.005225
835500 -- [-1204.197] (-1204.515) (-1201.668) (-1207.241) * (-1202.310) (-1202.965) [-1203.625] (-1203.538) -- 0:00:10
836000 -- (-1206.942) [-1203.721] (-1203.362) (-1207.219) * (-1206.292) (-1203.486) [-1203.931] (-1206.927) -- 0:00:10
836500 -- (-1204.598) (-1203.320) (-1207.259) [-1211.066] * (-1202.613) (-1204.513) [-1205.698] (-1204.925) -- 0:00:10
837000 -- (-1203.661) (-1203.567) (-1203.645) [-1205.049] * (-1203.184) [-1202.089] (-1203.512) (-1203.259) -- 0:00:10
837500 -- (-1204.768) (-1205.206) (-1207.124) [-1202.319] * (-1211.933) [-1206.570] (-1202.033) (-1203.981) -- 0:00:10
838000 -- [-1204.461] (-1202.640) (-1204.418) (-1203.597) * [-1203.735] (-1202.347) (-1204.425) (-1203.588) -- 0:00:10
838500 -- (-1203.470) (-1202.083) [-1203.106] (-1201.545) * [-1204.920] (-1203.906) (-1206.693) (-1202.521) -- 0:00:10
839000 -- (-1205.715) [-1204.500] (-1210.553) (-1204.189) * (-1206.506) [-1208.568] (-1203.450) (-1202.855) -- 0:00:09
839500 -- (-1205.270) (-1202.957) (-1202.585) [-1201.839] * (-1206.951) [-1203.904] (-1204.661) (-1210.531) -- 0:00:09
840000 -- (-1203.953) (-1203.587) [-1205.163] (-1201.775) * [-1202.872] (-1205.152) (-1203.396) (-1201.734) -- 0:00:09
Average standard deviation of split frequencies: 0.005271
840500 -- (-1203.659) (-1203.129) [-1202.844] (-1205.548) * (-1202.667) (-1207.874) (-1204.256) [-1201.851] -- 0:00:09
841000 -- (-1205.138) (-1202.192) [-1206.234] (-1203.196) * (-1204.864) (-1207.500) [-1202.718] (-1202.630) -- 0:00:09
841500 -- [-1204.231] (-1202.371) (-1203.833) (-1203.326) * (-1203.076) (-1206.654) [-1202.197] (-1203.376) -- 0:00:09
842000 -- (-1202.901) (-1202.592) (-1204.997) [-1202.769] * (-1203.821) (-1205.906) [-1202.015] (-1202.243) -- 0:00:09
842500 -- (-1203.444) [-1204.502] (-1203.372) (-1206.490) * [-1206.964] (-1203.974) (-1203.746) (-1202.928) -- 0:00:09
843000 -- [-1204.430] (-1204.793) (-1203.032) (-1205.107) * [-1201.965] (-1202.187) (-1203.404) (-1203.090) -- 0:00:09
843500 -- (-1204.759) (-1204.436) [-1202.626] (-1202.789) * [-1204.531] (-1203.244) (-1202.726) (-1205.713) -- 0:00:09
844000 -- (-1207.978) (-1204.708) [-1202.641] (-1204.058) * (-1204.099) (-1203.241) [-1203.690] (-1202.599) -- 0:00:09
844500 -- (-1209.861) (-1204.707) (-1202.559) [-1201.774] * (-1206.561) [-1209.234] (-1202.764) (-1202.938) -- 0:00:09
845000 -- (-1204.574) (-1201.753) [-1204.295] (-1205.311) * (-1206.990) (-1204.830) [-1202.772] (-1203.034) -- 0:00:09
Average standard deviation of split frequencies: 0.004941
845500 -- [-1202.752] (-1202.160) (-1204.407) (-1203.209) * (-1202.758) (-1202.502) [-1202.035] (-1209.132) -- 0:00:09
846000 -- (-1204.267) (-1201.841) [-1207.914] (-1203.572) * (-1207.429) (-1201.720) [-1202.141] (-1202.783) -- 0:00:09
846500 -- (-1205.475) [-1203.828] (-1202.085) (-1202.525) * (-1203.297) (-1203.253) (-1203.404) [-1203.590] -- 0:00:09
847000 -- (-1207.243) (-1205.179) [-1202.416] (-1203.007) * (-1205.314) (-1204.761) (-1205.783) [-1202.295] -- 0:00:09
847500 -- (-1203.882) (-1205.003) (-1207.612) [-1204.711] * [-1202.848] (-1204.590) (-1205.838) (-1202.404) -- 0:00:09
848000 -- [-1202.891] (-1202.980) (-1206.525) (-1202.141) * (-1202.991) [-1203.457] (-1202.283) (-1202.773) -- 0:00:09
848500 -- (-1203.640) (-1209.919) (-1203.516) [-1202.843] * (-1205.254) (-1204.606) (-1202.269) [-1202.504] -- 0:00:09
849000 -- [-1202.767] (-1204.744) (-1204.132) (-1202.457) * [-1203.695] (-1207.430) (-1202.792) (-1202.910) -- 0:00:09
849500 -- [-1202.225] (-1207.286) (-1202.255) (-1202.472) * [-1204.397] (-1209.183) (-1204.020) (-1202.790) -- 0:00:09
850000 -- [-1203.445] (-1206.834) (-1203.134) (-1204.394) * [-1205.990] (-1205.164) (-1203.715) (-1202.643) -- 0:00:09
Average standard deviation of split frequencies: 0.005135
850500 -- (-1205.629) (-1203.950) (-1203.946) [-1205.440] * [-1203.721] (-1206.945) (-1205.275) (-1202.777) -- 0:00:09
851000 -- (-1201.712) [-1202.511] (-1204.040) (-1203.539) * (-1205.007) [-1202.739] (-1207.137) (-1204.263) -- 0:00:09
851500 -- [-1202.987] (-1206.427) (-1206.167) (-1203.181) * (-1204.894) (-1201.879) [-1205.745] (-1203.007) -- 0:00:09
852000 -- (-1205.480) (-1205.257) (-1205.468) [-1203.609] * (-1203.655) [-1202.435] (-1204.894) (-1206.071) -- 0:00:09
852500 -- (-1207.061) [-1204.791] (-1209.474) (-1205.877) * [-1202.126] (-1202.499) (-1205.792) (-1205.730) -- 0:00:09
853000 -- (-1206.076) (-1204.376) (-1206.117) [-1203.653] * [-1202.129] (-1202.358) (-1203.564) (-1202.140) -- 0:00:09
853500 -- (-1202.180) [-1204.199] (-1204.483) (-1206.564) * (-1206.606) [-1203.926] (-1203.281) (-1202.609) -- 0:00:09
854000 -- (-1203.623) (-1203.036) [-1202.844] (-1205.413) * (-1206.941) (-1202.192) (-1203.222) [-1202.603] -- 0:00:09
854500 -- (-1202.448) [-1203.107] (-1202.941) (-1203.799) * (-1201.970) [-1203.639] (-1202.580) (-1203.921) -- 0:00:09
855000 -- (-1207.381) (-1204.221) (-1201.651) [-1202.971] * (-1202.291) (-1204.578) (-1201.454) [-1204.018] -- 0:00:08
Average standard deviation of split frequencies: 0.005580
855500 -- (-1205.137) [-1205.317] (-1204.120) (-1204.368) * (-1212.524) [-1204.319] (-1201.640) (-1204.484) -- 0:00:08
856000 -- (-1203.998) (-1203.963) (-1206.131) [-1203.570] * [-1204.038] (-1204.451) (-1201.732) (-1204.681) -- 0:00:08
856500 -- (-1203.544) [-1206.415] (-1203.612) (-1203.345) * (-1203.374) (-1204.087) (-1202.173) [-1203.582] -- 0:00:08
857000 -- (-1206.118) (-1211.013) (-1203.561) [-1202.616] * [-1205.135] (-1203.646) (-1203.077) (-1205.513) -- 0:00:08
857500 -- (-1203.039) (-1207.691) (-1204.274) [-1203.798] * [-1203.026] (-1203.437) (-1206.613) (-1203.298) -- 0:00:08
858000 -- [-1203.289] (-1205.240) (-1204.040) (-1204.805) * (-1203.160) [-1202.083] (-1206.963) (-1202.766) -- 0:00:08
858500 -- (-1211.920) [-1203.686] (-1202.521) (-1205.099) * (-1202.950) [-1202.043] (-1205.620) (-1202.081) -- 0:00:08
859000 -- (-1203.257) (-1210.456) [-1203.515] (-1203.716) * (-1203.383) (-1202.631) [-1204.120] (-1203.430) -- 0:00:08
859500 -- (-1202.760) (-1205.215) (-1203.215) [-1203.155] * (-1202.882) (-1204.040) [-1203.470] (-1204.860) -- 0:00:08
860000 -- [-1205.514] (-1203.267) (-1205.995) (-1205.743) * (-1205.362) [-1204.414] (-1202.894) (-1207.017) -- 0:00:08
Average standard deviation of split frequencies: 0.005879
860500 -- (-1204.500) (-1204.890) (-1204.054) [-1204.225] * (-1203.233) (-1201.855) (-1203.759) [-1203.381] -- 0:00:08
861000 -- (-1205.619) (-1205.993) [-1207.881] (-1202.155) * (-1204.813) [-1202.708] (-1203.721) (-1208.301) -- 0:00:08
861500 -- (-1206.661) (-1206.149) (-1204.629) [-1202.807] * (-1203.334) (-1208.165) [-1202.530] (-1203.557) -- 0:00:08
862000 -- (-1202.515) (-1203.616) (-1204.439) [-1204.232] * (-1205.149) (-1202.972) [-1203.167] (-1204.703) -- 0:00:08
862500 -- (-1202.740) [-1202.359] (-1205.993) (-1206.275) * [-1203.584] (-1204.204) (-1209.040) (-1210.947) -- 0:00:08
863000 -- (-1202.179) (-1204.588) (-1203.241) [-1202.367] * (-1206.194) (-1202.395) [-1205.653] (-1202.924) -- 0:00:08
863500 -- [-1205.029] (-1205.140) (-1205.415) (-1204.234) * (-1206.340) (-1202.517) (-1203.638) [-1202.149] -- 0:00:08
864000 -- (-1203.883) [-1203.278] (-1203.128) (-1211.482) * (-1204.173) (-1204.531) (-1203.000) [-1204.171] -- 0:00:08
864500 -- [-1204.033] (-1204.204) (-1204.830) (-1202.879) * (-1212.119) (-1207.578) [-1206.260] (-1204.248) -- 0:00:08
865000 -- [-1201.885] (-1205.001) (-1202.833) (-1202.712) * (-1203.142) [-1204.512] (-1205.461) (-1202.655) -- 0:00:08
Average standard deviation of split frequencies: 0.005843
865500 -- (-1203.033) [-1203.044] (-1202.340) (-1205.285) * [-1204.138] (-1205.910) (-1205.507) (-1201.872) -- 0:00:08
866000 -- [-1203.385] (-1203.884) (-1204.174) (-1202.969) * (-1204.927) [-1206.644] (-1203.561) (-1201.908) -- 0:00:08
866500 -- [-1202.431] (-1203.521) (-1202.439) (-1202.565) * (-1202.743) (-1203.906) (-1205.570) [-1203.307] -- 0:00:08
867000 -- [-1204.185] (-1203.165) (-1204.993) (-1205.069) * [-1203.403] (-1210.654) (-1202.180) (-1202.003) -- 0:00:08
867500 -- [-1205.273] (-1204.985) (-1202.658) (-1204.779) * (-1203.713) (-1204.694) [-1204.102] (-1201.933) -- 0:00:08
868000 -- (-1206.081) [-1207.446] (-1201.938) (-1204.401) * [-1203.657] (-1204.120) (-1202.422) (-1202.261) -- 0:00:08
868500 -- [-1202.528] (-1203.560) (-1203.582) (-1207.142) * (-1204.369) [-1204.344] (-1203.438) (-1203.956) -- 0:00:08
869000 -- (-1205.738) [-1205.555] (-1207.526) (-1205.605) * (-1207.743) [-1204.092] (-1205.319) (-1202.477) -- 0:00:08
869500 -- (-1202.088) (-1204.901) [-1203.782] (-1201.673) * (-1204.133) (-1203.056) [-1203.374] (-1202.731) -- 0:00:08
870000 -- [-1203.486] (-1202.563) (-1207.054) (-1201.471) * (-1204.106) (-1205.079) (-1206.010) [-1204.862] -- 0:00:08
Average standard deviation of split frequencies: 0.005956
870500 -- (-1204.104) [-1202.076] (-1204.713) (-1205.616) * (-1204.186) [-1202.564] (-1205.426) (-1206.775) -- 0:00:08
871000 -- (-1202.154) [-1203.269] (-1204.703) (-1205.005) * (-1204.664) (-1202.663) [-1204.824] (-1204.729) -- 0:00:07
871500 -- (-1208.532) (-1202.802) (-1204.645) [-1202.846] * (-1203.871) [-1206.412] (-1201.628) (-1203.938) -- 0:00:07
872000 -- (-1204.378) (-1203.184) [-1202.992] (-1203.731) * (-1206.058) (-1205.834) [-1201.433] (-1207.764) -- 0:00:07
872500 -- (-1206.060) (-1204.027) (-1203.010) [-1203.002] * (-1207.631) [-1201.773] (-1203.310) (-1205.767) -- 0:00:07
873000 -- (-1206.847) [-1202.948] (-1202.600) (-1202.237) * (-1204.895) [-1202.645] (-1208.526) (-1203.636) -- 0:00:07
873500 -- [-1202.415] (-1201.986) (-1208.932) (-1202.045) * [-1204.112] (-1205.026) (-1202.652) (-1203.545) -- 0:00:07
874000 -- (-1202.091) [-1203.052] (-1204.358) (-1203.019) * (-1204.173) [-1202.615] (-1204.277) (-1205.561) -- 0:00:07
874500 -- (-1204.343) (-1205.761) (-1203.035) [-1204.351] * (-1203.593) (-1202.121) [-1203.409] (-1204.038) -- 0:00:07
875000 -- [-1204.598] (-1203.487) (-1205.418) (-1204.929) * [-1203.416] (-1202.009) (-1205.375) (-1202.129) -- 0:00:07
Average standard deviation of split frequencies: 0.006135
875500 -- (-1204.247) [-1202.785] (-1207.289) (-1205.867) * [-1206.400] (-1202.122) (-1203.738) (-1203.686) -- 0:00:07
876000 -- (-1202.722) (-1203.171) (-1205.233) [-1204.824] * (-1206.123) [-1205.009] (-1204.626) (-1205.516) -- 0:00:07
876500 -- (-1202.017) [-1207.962] (-1202.695) (-1202.060) * [-1202.056] (-1207.631) (-1205.072) (-1204.975) -- 0:00:07
877000 -- [-1202.324] (-1208.093) (-1209.119) (-1201.952) * [-1202.104] (-1204.324) (-1204.490) (-1202.781) -- 0:00:07
877500 -- (-1203.512) (-1204.845) (-1202.242) [-1207.021] * [-1202.998] (-1204.248) (-1205.298) (-1202.695) -- 0:00:07
878000 -- (-1206.713) (-1207.133) [-1202.511] (-1206.330) * (-1202.631) (-1204.373) (-1204.113) [-1202.672] -- 0:00:07
878500 -- (-1204.839) (-1212.216) [-1205.131] (-1209.386) * (-1204.988) (-1202.951) (-1204.575) [-1205.010] -- 0:00:07
879000 -- (-1202.614) (-1202.462) [-1204.494] (-1208.669) * (-1203.543) [-1208.728] (-1204.753) (-1202.158) -- 0:00:07
879500 -- (-1201.960) (-1202.989) [-1206.855] (-1203.261) * [-1204.038] (-1204.373) (-1206.230) (-1202.544) -- 0:00:07
880000 -- (-1201.958) (-1204.227) [-1204.808] (-1203.275) * (-1204.867) [-1203.362] (-1205.687) (-1201.987) -- 0:00:07
Average standard deviation of split frequencies: 0.006067
880500 -- [-1202.688] (-1203.093) (-1207.094) (-1204.453) * (-1206.379) (-1202.379) [-1202.432] (-1202.267) -- 0:00:07
881000 -- (-1204.264) (-1206.779) [-1203.032] (-1202.654) * [-1205.102] (-1204.317) (-1205.394) (-1206.045) -- 0:00:07
881500 -- [-1203.355] (-1205.269) (-1203.009) (-1203.068) * (-1207.973) (-1201.973) (-1204.964) [-1202.188] -- 0:00:07
882000 -- (-1202.466) [-1203.606] (-1202.826) (-1208.448) * [-1206.315] (-1204.200) (-1203.065) (-1204.906) -- 0:00:07
882500 -- (-1203.600) (-1202.737) [-1202.742] (-1204.828) * (-1208.916) (-1206.759) (-1202.604) [-1203.497] -- 0:00:07
883000 -- (-1205.180) (-1202.708) (-1204.595) [-1201.634] * (-1206.787) [-1202.573] (-1203.758) (-1203.488) -- 0:00:07
883500 -- [-1203.936] (-1202.169) (-1212.487) (-1205.131) * [-1206.626] (-1203.276) (-1209.496) (-1203.580) -- 0:00:07
884000 -- (-1204.166) (-1203.681) (-1207.799) [-1202.528] * (-1204.610) [-1202.884] (-1206.414) (-1205.839) -- 0:00:07
884500 -- (-1204.673) [-1203.514] (-1202.512) (-1204.728) * (-1202.995) [-1204.867] (-1202.878) (-1205.395) -- 0:00:07
885000 -- [-1206.131] (-1207.095) (-1203.119) (-1202.751) * [-1203.547] (-1203.428) (-1203.131) (-1201.829) -- 0:00:07
Average standard deviation of split frequencies: 0.005924
885500 -- (-1205.595) (-1204.164) (-1206.362) [-1202.288] * (-1204.309) [-1205.614] (-1203.101) (-1204.075) -- 0:00:07
886000 -- (-1205.009) [-1202.445] (-1208.615) (-1202.957) * (-1210.072) [-1207.228] (-1202.508) (-1205.344) -- 0:00:07
886500 -- (-1204.077) (-1204.109) (-1204.331) [-1203.000] * (-1203.253) (-1204.188) [-1204.094] (-1204.709) -- 0:00:07
887000 -- [-1202.305] (-1203.498) (-1206.702) (-1203.376) * (-1204.270) (-1202.454) [-1204.433] (-1203.433) -- 0:00:07
887500 -- (-1203.892) (-1205.159) (-1205.440) [-1203.434] * [-1203.424] (-1204.847) (-1203.191) (-1201.953) -- 0:00:06
888000 -- (-1204.102) (-1207.542) [-1203.989] (-1202.919) * (-1202.788) [-1205.780] (-1202.977) (-1202.594) -- 0:00:06
888500 -- (-1203.862) [-1203.480] (-1202.779) (-1203.119) * (-1202.089) [-1202.534] (-1202.149) (-1203.198) -- 0:00:06
889000 -- (-1202.508) [-1201.923] (-1202.993) (-1202.982) * (-1208.551) (-1205.035) (-1206.277) [-1203.489] -- 0:00:06
889500 -- (-1202.678) [-1203.803] (-1202.663) (-1203.125) * (-1203.072) [-1204.346] (-1202.987) (-1203.463) -- 0:00:06
890000 -- (-1201.750) (-1202.906) (-1205.140) [-1202.819] * (-1206.576) (-1203.247) [-1204.418] (-1202.426) -- 0:00:06
Average standard deviation of split frequencies: 0.005787
890500 -- (-1205.365) [-1204.426] (-1203.081) (-1203.464) * (-1202.637) (-1202.256) [-1202.613] (-1202.075) -- 0:00:06
891000 -- (-1207.642) (-1203.571) (-1202.886) [-1207.669] * (-1204.164) (-1203.403) (-1205.446) [-1201.948] -- 0:00:06
891500 -- (-1206.467) (-1211.622) (-1206.967) [-1203.330] * (-1203.272) (-1209.193) (-1203.581) [-1202.363] -- 0:00:06
892000 -- (-1202.749) (-1209.046) [-1211.891] (-1206.762) * (-1202.365) [-1208.502] (-1204.342) (-1202.568) -- 0:00:06
892500 -- [-1203.945] (-1203.894) (-1205.647) (-1208.274) * (-1205.246) [-1203.974] (-1202.478) (-1204.766) -- 0:00:06
893000 -- (-1203.845) [-1203.624] (-1205.208) (-1204.302) * [-1205.961] (-1202.606) (-1201.797) (-1211.847) -- 0:00:06
893500 -- (-1202.602) [-1201.966] (-1204.676) (-1204.655) * (-1203.446) [-1205.431] (-1203.667) (-1204.330) -- 0:00:06
894000 -- (-1202.019) (-1204.721) [-1202.923] (-1206.910) * (-1208.712) [-1204.986] (-1202.362) (-1205.216) -- 0:00:06
894500 -- (-1203.098) (-1203.291) [-1203.070] (-1206.951) * [-1204.198] (-1203.927) (-1203.324) (-1202.571) -- 0:00:06
895000 -- (-1203.920) (-1202.970) (-1205.339) [-1205.531] * (-1202.059) (-1208.977) (-1203.813) [-1203.492] -- 0:00:06
Average standard deviation of split frequencies: 0.006384
895500 -- [-1206.459] (-1206.608) (-1202.901) (-1205.515) * [-1203.331] (-1203.094) (-1205.597) (-1203.222) -- 0:00:06
896000 -- (-1206.646) (-1207.300) [-1203.145] (-1207.003) * [-1205.546] (-1203.909) (-1205.791) (-1202.949) -- 0:00:06
896500 -- (-1206.096) (-1205.195) (-1208.230) [-1203.576] * (-1203.318) [-1201.770] (-1205.126) (-1201.966) -- 0:00:06
897000 -- (-1204.001) [-1204.587] (-1210.227) (-1203.082) * (-1202.749) [-1202.790] (-1205.132) (-1202.428) -- 0:00:06
897500 -- (-1206.695) [-1202.251] (-1206.574) (-1203.075) * (-1202.544) (-1205.452) [-1203.241] (-1202.823) -- 0:00:06
898000 -- (-1205.206) (-1202.675) [-1202.502] (-1207.489) * (-1205.287) [-1202.555] (-1201.802) (-1211.032) -- 0:00:06
898500 -- [-1204.378] (-1202.603) (-1201.818) (-1206.829) * [-1205.062] (-1202.671) (-1203.413) (-1205.978) -- 0:00:06
899000 -- (-1204.718) [-1202.555] (-1203.711) (-1202.928) * (-1203.653) (-1203.307) (-1203.525) [-1204.876] -- 0:00:06
899500 -- (-1203.252) (-1203.753) [-1203.321] (-1202.811) * (-1204.857) [-1203.277] (-1203.276) (-1203.534) -- 0:00:06
900000 -- (-1203.944) [-1203.225] (-1202.431) (-1206.218) * (-1207.121) (-1202.536) [-1204.448] (-1205.650) -- 0:00:06
Average standard deviation of split frequencies: 0.006560
900500 -- (-1204.109) (-1205.106) [-1204.090] (-1202.137) * (-1204.145) [-1202.819] (-1203.108) (-1204.065) -- 0:00:06
901000 -- (-1204.866) (-1206.436) [-1204.483] (-1203.200) * (-1204.035) (-1206.544) [-1204.369] (-1204.982) -- 0:00:06
901500 -- (-1204.199) [-1203.255] (-1205.907) (-1204.571) * (-1204.817) (-1202.412) (-1203.826) [-1203.951] -- 0:00:06
902000 -- (-1202.842) (-1203.079) (-1202.981) [-1202.153] * (-1202.424) (-1202.466) [-1202.714] (-1204.024) -- 0:00:06
902500 -- (-1203.404) (-1203.600) [-1203.499] (-1203.335) * (-1206.940) (-1201.914) [-1202.532] (-1206.068) -- 0:00:06
903000 -- (-1203.686) [-1204.225] (-1204.285) (-1207.794) * [-1205.997] (-1203.059) (-1202.919) (-1205.061) -- 0:00:06
903500 -- (-1202.469) (-1202.868) (-1206.725) [-1205.707] * (-1204.174) [-1205.092] (-1204.754) (-1207.880) -- 0:00:05
904000 -- (-1203.219) (-1204.978) [-1204.859] (-1210.124) * (-1207.368) [-1213.405] (-1202.455) (-1202.877) -- 0:00:05
904500 -- (-1205.221) (-1204.059) [-1205.756] (-1204.156) * (-1202.532) (-1208.364) (-1204.607) [-1206.650] -- 0:00:05
905000 -- (-1210.114) (-1206.817) [-1207.294] (-1202.995) * (-1203.346) (-1205.170) (-1202.123) [-1203.320] -- 0:00:05
Average standard deviation of split frequencies: 0.006695
905500 -- (-1204.235) [-1206.777] (-1205.264) (-1202.766) * (-1203.324) (-1202.304) (-1209.178) [-1202.326] -- 0:00:05
906000 -- (-1203.389) (-1202.906) [-1204.766] (-1205.556) * (-1203.916) (-1206.979) (-1205.009) [-1201.909] -- 0:00:05
906500 -- (-1202.776) (-1203.527) [-1204.040] (-1202.225) * [-1203.650] (-1204.512) (-1203.696) (-1202.228) -- 0:00:05
907000 -- (-1201.975) [-1203.161] (-1207.224) (-1205.208) * [-1202.125] (-1201.604) (-1208.338) (-1202.699) -- 0:00:05
907500 -- (-1203.175) (-1203.118) [-1203.769] (-1204.096) * (-1202.101) (-1202.553) [-1208.838] (-1202.480) -- 0:00:05
908000 -- (-1204.097) [-1201.732] (-1201.758) (-1203.077) * (-1204.654) (-1203.055) [-1202.585] (-1203.501) -- 0:00:05
908500 -- (-1203.534) [-1204.834] (-1204.815) (-1205.321) * (-1207.029) [-1203.028] (-1202.731) (-1205.581) -- 0:00:05
909000 -- (-1204.021) (-1208.328) (-1215.340) [-1207.205] * (-1204.878) [-1203.278] (-1203.956) (-1204.759) -- 0:00:05
909500 -- (-1203.855) [-1204.456] (-1211.452) (-1206.925) * (-1207.862) (-1203.049) [-1203.158] (-1203.330) -- 0:00:05
910000 -- (-1203.266) [-1204.748] (-1203.794) (-1202.933) * (-1208.141) (-1204.490) [-1203.252] (-1210.701) -- 0:00:05
Average standard deviation of split frequencies: 0.006764
910500 -- [-1202.802] (-1202.110) (-1204.857) (-1204.796) * (-1203.601) (-1208.735) [-1203.898] (-1214.758) -- 0:00:05
911000 -- [-1206.643] (-1202.517) (-1203.831) (-1202.905) * [-1202.849] (-1207.822) (-1205.545) (-1207.433) -- 0:00:05
911500 -- (-1206.810) (-1205.497) (-1206.158) [-1202.572] * (-1203.896) (-1201.644) [-1205.178] (-1202.506) -- 0:00:05
912000 -- (-1202.928) (-1202.544) [-1203.141] (-1207.405) * [-1205.113] (-1205.657) (-1204.679) (-1206.225) -- 0:00:05
912500 -- (-1202.748) (-1205.801) [-1203.702] (-1204.837) * (-1206.367) [-1201.575] (-1203.740) (-1203.244) -- 0:00:05
913000 -- (-1201.971) [-1207.938] (-1202.236) (-1204.170) * [-1203.371] (-1201.662) (-1203.984) (-1203.800) -- 0:00:05
913500 -- (-1202.683) (-1203.722) (-1205.311) [-1203.709] * (-1203.307) (-1202.664) [-1202.911] (-1201.995) -- 0:00:05
914000 -- (-1203.152) [-1204.353] (-1205.826) (-1204.759) * (-1202.038) [-1202.018] (-1203.711) (-1202.549) -- 0:00:05
914500 -- (-1202.597) [-1204.185] (-1203.715) (-1203.569) * (-1202.041) (-1206.595) [-1202.155] (-1201.912) -- 0:00:05
915000 -- [-1202.923] (-1203.849) (-1203.777) (-1207.528) * (-1203.140) [-1206.466] (-1205.277) (-1203.084) -- 0:00:05
Average standard deviation of split frequencies: 0.006759
915500 -- (-1205.479) (-1203.684) (-1202.475) [-1204.824] * (-1205.618) (-1204.976) [-1202.682] (-1206.028) -- 0:00:05
916000 -- (-1206.590) (-1203.888) [-1203.892] (-1203.618) * (-1206.101) [-1203.791] (-1204.850) (-1206.988) -- 0:00:05
916500 -- (-1207.499) [-1202.861] (-1203.346) (-1203.987) * (-1208.059) (-1203.997) [-1204.231] (-1207.060) -- 0:00:05
917000 -- (-1202.791) (-1203.097) [-1205.114] (-1204.657) * (-1202.016) [-1204.508] (-1202.059) (-1202.999) -- 0:00:05
917500 -- (-1201.730) (-1203.502) (-1204.368) [-1205.570] * [-1208.854] (-1202.672) (-1202.271) (-1202.620) -- 0:00:05
918000 -- (-1202.620) (-1205.621) (-1205.576) [-1205.770] * (-1206.998) (-1202.406) [-1201.864] (-1204.050) -- 0:00:05
918500 -- (-1206.605) (-1203.253) (-1205.798) [-1209.295] * (-1203.657) (-1203.347) (-1203.234) [-1203.005] -- 0:00:05
919000 -- (-1206.051) (-1203.674) (-1201.871) [-1204.829] * (-1204.323) (-1202.274) [-1204.720] (-1203.620) -- 0:00:05
919500 -- [-1206.460] (-1204.933) (-1202.867) (-1206.370) * (-1202.938) [-1202.055] (-1203.587) (-1202.092) -- 0:00:04
920000 -- [-1204.155] (-1206.728) (-1204.095) (-1203.345) * (-1203.257) [-1201.725] (-1202.735) (-1205.746) -- 0:00:04
Average standard deviation of split frequencies: 0.006895
920500 -- (-1202.703) (-1205.383) [-1202.998] (-1202.710) * [-1202.063] (-1202.101) (-1201.964) (-1207.105) -- 0:00:04
921000 -- [-1202.101] (-1204.651) (-1201.919) (-1202.676) * (-1202.913) (-1203.906) (-1205.346) [-1201.917] -- 0:00:04
921500 -- (-1205.327) [-1206.705] (-1204.174) (-1204.803) * (-1201.685) [-1204.669] (-1206.761) (-1204.575) -- 0:00:04
922000 -- (-1207.772) (-1205.340) [-1203.230] (-1203.979) * (-1203.085) [-1204.220] (-1203.988) (-1202.367) -- 0:00:04
922500 -- (-1205.667) [-1204.622] (-1203.199) (-1203.977) * [-1208.406] (-1204.068) (-1202.350) (-1206.212) -- 0:00:04
923000 -- (-1209.503) [-1203.192] (-1202.447) (-1205.494) * (-1202.998) (-1203.768) [-1202.406] (-1208.365) -- 0:00:04
923500 -- (-1206.652) [-1204.487] (-1204.889) (-1203.005) * (-1202.839) [-1203.464] (-1201.902) (-1205.940) -- 0:00:04
924000 -- (-1204.768) [-1204.187] (-1202.195) (-1203.439) * (-1203.807) [-1206.069] (-1204.810) (-1207.315) -- 0:00:04
924500 -- (-1202.660) [-1204.726] (-1202.798) (-1202.983) * [-1203.065] (-1210.178) (-1206.268) (-1202.627) -- 0:00:04
925000 -- (-1203.089) (-1202.304) (-1201.735) [-1203.854] * (-1203.316) (-1202.889) [-1203.253] (-1202.319) -- 0:00:04
Average standard deviation of split frequencies: 0.006482
925500 -- (-1203.821) [-1203.478] (-1201.734) (-1203.422) * (-1202.684) (-1202.813) [-1205.297] (-1209.299) -- 0:00:04
926000 -- (-1203.692) (-1207.038) (-1202.393) [-1203.521] * (-1202.564) [-1203.018] (-1207.288) (-1207.395) -- 0:00:04
926500 -- [-1207.683] (-1204.754) (-1202.755) (-1203.366) * [-1203.905] (-1203.504) (-1206.653) (-1202.186) -- 0:00:04
927000 -- (-1203.384) [-1203.032] (-1203.356) (-1207.213) * (-1205.013) (-1205.041) [-1208.041] (-1202.097) -- 0:00:04
927500 -- (-1202.599) (-1204.251) (-1202.958) [-1202.608] * [-1202.822] (-1205.564) (-1203.930) (-1208.245) -- 0:00:04
928000 -- (-1204.619) (-1202.163) (-1202.637) [-1205.400] * (-1203.336) (-1202.300) (-1202.753) [-1203.205] -- 0:00:04
928500 -- [-1202.834] (-1203.087) (-1202.378) (-1205.403) * (-1202.919) (-1204.365) (-1201.581) [-1202.608] -- 0:00:04
929000 -- [-1201.595] (-1202.716) (-1204.496) (-1208.386) * (-1201.880) (-1203.857) [-1202.253] (-1203.021) -- 0:00:04
929500 -- (-1203.848) [-1202.628] (-1202.384) (-1203.737) * [-1204.290] (-1203.022) (-1204.387) (-1202.490) -- 0:00:04
930000 -- [-1203.405] (-1203.703) (-1202.439) (-1203.407) * (-1204.250) (-1202.454) [-1203.672] (-1202.650) -- 0:00:04
Average standard deviation of split frequencies: 0.006382
930500 -- [-1201.644] (-1202.311) (-1202.851) (-1205.651) * (-1205.495) (-1201.807) [-1207.274] (-1202.446) -- 0:00:04
931000 -- (-1202.220) (-1203.585) [-1202.464] (-1206.025) * (-1204.569) (-1201.819) (-1206.183) [-1201.926] -- 0:00:04
931500 -- (-1202.488) [-1204.254] (-1202.010) (-1205.946) * [-1204.334] (-1202.022) (-1209.873) (-1207.691) -- 0:00:04
932000 -- [-1203.523] (-1203.817) (-1202.172) (-1202.258) * (-1205.750) (-1201.658) [-1202.213] (-1202.783) -- 0:00:04
932500 -- (-1202.956) [-1203.139] (-1202.791) (-1204.463) * [-1202.710] (-1203.426) (-1202.677) (-1204.697) -- 0:00:04
933000 -- (-1202.389) (-1203.621) (-1203.911) [-1203.869] * [-1203.125] (-1205.950) (-1203.612) (-1203.776) -- 0:00:04
933500 -- (-1205.434) (-1204.574) [-1206.394] (-1202.858) * (-1202.035) (-1205.125) (-1204.529) [-1205.965] -- 0:00:04
934000 -- (-1204.417) [-1202.188] (-1203.714) (-1203.156) * (-1203.348) (-1203.347) (-1205.160) [-1204.158] -- 0:00:04
934500 -- [-1204.625] (-1205.973) (-1203.001) (-1203.322) * (-1202.474) (-1202.336) (-1203.432) [-1205.129] -- 0:00:04
935000 -- [-1205.948] (-1206.610) (-1203.696) (-1201.760) * [-1202.314] (-1210.942) (-1203.732) (-1205.374) -- 0:00:04
Average standard deviation of split frequencies: 0.006547
935500 -- (-1209.885) (-1206.977) (-1205.015) [-1203.260] * (-1202.135) (-1207.399) (-1202.755) [-1206.737] -- 0:00:03
936000 -- (-1209.132) (-1204.060) (-1205.603) [-1203.808] * (-1202.628) (-1206.228) [-1202.506] (-1203.117) -- 0:00:03
936500 -- [-1202.219] (-1204.489) (-1204.622) (-1203.492) * (-1203.201) (-1203.646) [-1202.388] (-1203.356) -- 0:00:03
937000 -- (-1204.138) (-1203.083) (-1204.434) [-1203.219] * (-1202.302) (-1201.978) (-1204.339) [-1201.868] -- 0:00:03
937500 -- (-1206.890) (-1203.055) (-1203.680) [-1202.678] * (-1201.665) (-1203.551) (-1205.368) [-1202.750] -- 0:00:03
938000 -- (-1203.407) [-1204.043] (-1202.218) (-1206.979) * (-1202.771) [-1202.748] (-1205.671) (-1203.405) -- 0:00:03
938500 -- [-1202.540] (-1206.244) (-1204.032) (-1203.343) * (-1205.945) (-1202.613) (-1209.786) [-1203.454] -- 0:00:03
939000 -- (-1202.134) (-1202.561) (-1202.541) [-1203.553] * (-1202.348) (-1204.193) (-1205.226) [-1207.010] -- 0:00:03
939500 -- (-1202.637) (-1201.833) [-1205.406] (-1204.268) * (-1203.789) (-1205.808) [-1203.122] (-1202.512) -- 0:00:03
940000 -- (-1202.850) [-1203.467] (-1204.974) (-1203.143) * [-1204.544] (-1204.354) (-1206.739) (-1205.552) -- 0:00:03
Average standard deviation of split frequencies: 0.006815
940500 -- (-1202.394) (-1203.688) [-1202.509] (-1210.931) * (-1204.934) (-1204.170) [-1204.709] (-1206.388) -- 0:00:03
941000 -- [-1202.746] (-1204.825) (-1204.382) (-1203.472) * (-1203.153) (-1203.067) (-1203.354) [-1206.746] -- 0:00:03
941500 -- (-1206.730) (-1204.502) [-1202.951] (-1203.480) * [-1208.907] (-1206.349) (-1211.351) (-1203.536) -- 0:00:03
942000 -- [-1203.977] (-1202.879) (-1202.143) (-1203.748) * (-1204.644) [-1202.326] (-1204.818) (-1204.320) -- 0:00:03
942500 -- (-1203.678) (-1202.371) (-1203.786) [-1205.190] * (-1203.526) (-1207.923) [-1202.484] (-1205.161) -- 0:00:03
943000 -- [-1203.705] (-1202.656) (-1207.965) (-1202.432) * [-1205.458] (-1202.536) (-1204.299) (-1202.974) -- 0:00:03
943500 -- (-1204.033) [-1203.328] (-1203.907) (-1207.206) * (-1208.544) [-1201.762] (-1205.406) (-1216.698) -- 0:00:03
944000 -- [-1202.584] (-1204.074) (-1203.107) (-1206.742) * (-1204.607) [-1201.675] (-1204.427) (-1206.629) -- 0:00:03
944500 -- (-1209.803) (-1204.239) [-1201.712] (-1202.901) * (-1203.585) (-1201.780) (-1205.306) [-1204.164] -- 0:00:03
945000 -- (-1204.193) (-1202.919) [-1203.498] (-1206.545) * (-1202.909) [-1201.773] (-1205.021) (-1202.583) -- 0:00:03
Average standard deviation of split frequencies: 0.006578
945500 -- [-1206.049] (-1206.655) (-1202.252) (-1204.122) * [-1203.389] (-1204.271) (-1203.944) (-1202.629) -- 0:00:03
946000 -- [-1203.119] (-1202.407) (-1201.684) (-1205.129) * (-1202.220) (-1205.775) (-1203.284) [-1203.389] -- 0:00:03
946500 -- [-1204.347] (-1202.809) (-1203.811) (-1203.434) * (-1205.975) [-1203.809] (-1204.250) (-1204.407) -- 0:00:03
947000 -- (-1206.992) (-1206.638) (-1202.546) [-1202.449] * (-1206.906) [-1202.524] (-1204.490) (-1201.964) -- 0:00:03
947500 -- (-1203.265) (-1202.314) (-1204.361) [-1203.315] * [-1202.488] (-1202.441) (-1203.739) (-1202.040) -- 0:00:03
948000 -- [-1203.282] (-1203.951) (-1206.351) (-1203.394) * [-1205.556] (-1202.844) (-1207.421) (-1202.508) -- 0:00:03
948500 -- (-1203.906) (-1201.677) [-1205.651] (-1204.266) * [-1205.435] (-1208.135) (-1205.343) (-1203.293) -- 0:00:03
949000 -- (-1202.949) [-1202.085] (-1207.474) (-1203.974) * (-1203.629) (-1204.084) (-1204.604) [-1201.854] -- 0:00:03
949500 -- (-1203.438) [-1203.400] (-1203.360) (-1211.507) * (-1204.329) [-1203.150] (-1209.783) (-1202.585) -- 0:00:03
950000 -- (-1204.951) (-1205.818) [-1203.073] (-1207.359) * [-1204.685] (-1203.102) (-1208.197) (-1204.547) -- 0:00:03
Average standard deviation of split frequencies: 0.006909
950500 -- (-1202.859) [-1204.795] (-1206.124) (-1204.026) * (-1205.043) (-1205.207) [-1205.016] (-1206.576) -- 0:00:03
951000 -- [-1203.783] (-1203.209) (-1203.840) (-1205.129) * [-1205.662] (-1201.737) (-1204.130) (-1202.966) -- 0:00:03
951500 -- (-1203.577) (-1203.982) [-1202.226] (-1202.156) * (-1203.920) (-1207.167) [-1203.047] (-1202.170) -- 0:00:03
952000 -- (-1205.532) (-1204.838) (-1211.984) [-1203.340] * (-1201.545) [-1203.219] (-1202.361) (-1205.799) -- 0:00:02
952500 -- [-1204.273] (-1202.437) (-1210.446) (-1204.135) * (-1201.560) [-1204.445] (-1207.459) (-1206.366) -- 0:00:02
953000 -- (-1203.627) (-1204.061) (-1204.672) [-1202.961] * (-1202.660) [-1202.828] (-1203.652) (-1202.735) -- 0:00:02
953500 -- (-1202.522) [-1204.444] (-1206.910) (-1206.708) * [-1202.808] (-1201.985) (-1202.108) (-1206.338) -- 0:00:02
954000 -- [-1205.691] (-1206.131) (-1203.772) (-1203.487) * (-1206.678) (-1206.282) [-1202.007] (-1204.818) -- 0:00:02
954500 -- [-1204.097] (-1204.840) (-1206.973) (-1203.732) * (-1203.178) (-1206.019) [-1201.836] (-1204.042) -- 0:00:02
955000 -- (-1207.737) (-1206.694) [-1206.355] (-1206.621) * (-1204.493) (-1206.400) (-1207.318) [-1203.869] -- 0:00:02
Average standard deviation of split frequencies: 0.006706
955500 -- (-1210.939) (-1203.785) [-1202.242] (-1202.171) * (-1207.891) (-1202.777) (-1208.098) [-1202.183] -- 0:00:02
956000 -- (-1203.994) [-1204.084] (-1205.154) (-1202.607) * (-1208.729) (-1204.380) (-1206.716) [-1206.548] -- 0:00:02
956500 -- [-1202.023] (-1203.803) (-1202.742) (-1203.675) * (-1204.984) (-1205.289) (-1202.707) [-1204.595] -- 0:00:02
957000 -- (-1203.394) [-1203.482] (-1201.848) (-1202.744) * (-1206.818) (-1203.078) [-1203.781] (-1205.785) -- 0:00:02
957500 -- (-1202.981) (-1206.049) (-1202.811) [-1203.037] * [-1204.691] (-1203.433) (-1204.095) (-1205.288) -- 0:00:02
958000 -- (-1202.136) (-1203.986) [-1203.789] (-1203.010) * [-1204.676] (-1203.361) (-1202.319) (-1204.178) -- 0:00:02
958500 -- (-1204.449) (-1201.755) [-1202.781] (-1204.925) * (-1206.195) (-1203.070) (-1203.797) [-1202.528] -- 0:00:02
959000 -- [-1203.762] (-1205.570) (-1202.053) (-1205.075) * [-1203.980] (-1203.063) (-1205.732) (-1206.550) -- 0:00:02
959500 -- (-1204.958) (-1203.481) [-1204.175] (-1205.426) * (-1202.461) (-1203.531) [-1203.950] (-1204.095) -- 0:00:02
960000 -- (-1208.074) (-1202.623) (-1202.782) [-1202.170] * (-1203.200) (-1204.433) [-1204.044] (-1203.484) -- 0:00:02
Average standard deviation of split frequencies: 0.006903
960500 -- (-1205.298) (-1202.099) [-1202.891] (-1202.455) * (-1204.456) [-1205.342] (-1203.585) (-1202.704) -- 0:00:02
961000 -- [-1204.422] (-1204.764) (-1202.938) (-1203.923) * (-1207.906) (-1203.020) [-1206.597] (-1207.645) -- 0:00:02
961500 -- (-1202.356) (-1205.301) (-1203.546) [-1201.870] * (-1203.004) (-1204.454) (-1204.818) [-1204.118] -- 0:00:02
962000 -- (-1204.347) (-1203.377) (-1203.116) [-1203.265] * (-1208.874) [-1203.692] (-1203.932) (-1206.496) -- 0:00:02
962500 -- [-1203.466] (-1203.680) (-1202.295) (-1206.385) * [-1203.553] (-1202.014) (-1209.411) (-1205.522) -- 0:00:02
963000 -- [-1205.036] (-1203.590) (-1206.654) (-1206.417) * (-1204.667) [-1202.348] (-1204.882) (-1202.329) -- 0:00:02
963500 -- (-1204.837) [-1202.832] (-1205.068) (-1203.668) * (-1202.903) (-1203.378) (-1205.959) [-1202.333] -- 0:00:02
964000 -- [-1203.273] (-1204.029) (-1208.133) (-1202.432) * (-1202.690) (-1202.603) (-1206.087) [-1202.207] -- 0:00:02
964500 -- [-1203.020] (-1202.517) (-1205.443) (-1209.945) * (-1202.394) [-1203.639] (-1204.230) (-1204.228) -- 0:00:02
965000 -- [-1203.489] (-1203.079) (-1204.982) (-1209.824) * (-1205.023) (-1202.033) (-1205.983) [-1204.390] -- 0:00:02
Average standard deviation of split frequencies: 0.006930
965500 -- (-1203.301) [-1204.276] (-1202.743) (-1206.065) * (-1201.711) (-1204.515) [-1204.950] (-1203.505) -- 0:00:02
966000 -- (-1204.560) [-1204.842] (-1203.313) (-1203.103) * (-1206.010) (-1202.502) [-1203.784] (-1205.522) -- 0:00:02
966500 -- (-1206.379) (-1202.735) (-1202.400) [-1205.017] * (-1205.144) [-1204.636] (-1202.817) (-1209.967) -- 0:00:02
967000 -- (-1202.778) (-1204.090) (-1202.166) [-1202.913] * (-1204.291) (-1204.835) (-1202.173) [-1203.403] -- 0:00:02
967500 -- (-1204.262) (-1204.217) [-1202.257] (-1203.212) * (-1205.451) (-1202.146) (-1203.922) [-1203.376] -- 0:00:02
968000 -- (-1203.304) (-1207.710) [-1202.489] (-1205.404) * (-1203.501) (-1202.843) (-1204.997) [-1201.657] -- 0:00:01
968500 -- (-1204.050) (-1205.405) (-1202.001) [-1204.239] * (-1202.336) (-1203.676) [-1205.201] (-1202.238) -- 0:00:01
969000 -- [-1204.906] (-1202.710) (-1203.970) (-1209.954) * (-1203.243) [-1203.850] (-1203.932) (-1203.334) -- 0:00:01
969500 -- (-1205.671) (-1202.773) (-1203.381) [-1205.631] * (-1203.362) (-1203.892) (-1202.309) [-1203.414] -- 0:00:01
970000 -- [-1202.895] (-1205.126) (-1205.532) (-1202.674) * (-1204.514) [-1202.685] (-1203.024) (-1203.589) -- 0:00:01
Average standard deviation of split frequencies: 0.007058
970500 -- (-1203.747) (-1204.764) [-1204.380] (-1203.600) * [-1204.525] (-1204.759) (-1203.146) (-1202.802) -- 0:00:01
971000 -- (-1205.463) (-1203.781) [-1203.725] (-1203.627) * (-1202.801) (-1204.310) [-1202.091] (-1202.147) -- 0:00:01
971500 -- (-1204.951) (-1203.990) [-1202.924] (-1206.286) * (-1205.356) [-1202.916] (-1202.837) (-1204.267) -- 0:00:01
972000 -- (-1204.963) [-1206.186] (-1202.547) (-1205.333) * (-1203.880) (-1203.860) [-1203.798] (-1203.735) -- 0:00:01
972500 -- [-1204.012] (-1204.242) (-1203.411) (-1202.956) * [-1203.091] (-1204.329) (-1204.928) (-1206.102) -- 0:00:01
973000 -- (-1205.666) (-1202.737) (-1202.721) [-1203.611] * (-1203.498) (-1203.965) (-1204.392) [-1204.290] -- 0:00:01
973500 -- (-1203.523) (-1202.513) (-1202.333) [-1202.648] * (-1205.344) (-1203.857) [-1202.581] (-1203.070) -- 0:00:01
974000 -- (-1204.196) (-1203.864) (-1202.838) [-1201.745] * (-1205.280) [-1203.864] (-1201.940) (-1203.229) -- 0:00:01
974500 -- (-1205.538) [-1206.640] (-1202.982) (-1203.788) * (-1201.912) (-1209.105) [-1206.222] (-1206.664) -- 0:00:01
975000 -- (-1203.963) [-1205.464] (-1203.707) (-1206.330) * (-1205.410) (-1203.725) [-1202.910] (-1204.273) -- 0:00:01
Average standard deviation of split frequencies: 0.006955
975500 -- (-1203.989) (-1208.110) (-1203.730) [-1201.951] * [-1207.491] (-1203.725) (-1205.441) (-1203.731) -- 0:00:01
976000 -- [-1202.021] (-1202.231) (-1203.195) (-1203.526) * (-1206.543) (-1204.241) (-1206.865) [-1203.017] -- 0:00:01
976500 -- (-1202.926) [-1202.212] (-1204.941) (-1205.699) * (-1202.721) [-1204.998] (-1203.158) (-1203.411) -- 0:00:01
977000 -- (-1204.530) (-1207.001) (-1210.573) [-1203.458] * [-1204.644] (-1202.670) (-1203.184) (-1203.763) -- 0:00:01
977500 -- (-1202.941) [-1203.208] (-1204.870) (-1204.415) * [-1205.943] (-1203.940) (-1206.012) (-1202.289) -- 0:00:01
978000 -- (-1202.387) [-1204.229] (-1202.878) (-1202.476) * (-1204.341) (-1202.684) [-1202.203] (-1202.548) -- 0:00:01
978500 -- [-1201.959] (-1203.609) (-1202.213) (-1205.110) * (-1204.725) (-1203.036) (-1202.634) [-1204.758] -- 0:00:01
979000 -- (-1203.163) (-1204.279) [-1202.014] (-1201.901) * (-1203.715) (-1204.550) [-1203.507] (-1204.421) -- 0:00:01
979500 -- (-1202.630) [-1204.660] (-1201.800) (-1202.855) * (-1203.632) [-1202.940] (-1202.625) (-1202.852) -- 0:00:01
980000 -- [-1202.143] (-1205.364) (-1202.374) (-1201.895) * (-1204.444) (-1201.828) (-1202.236) [-1201.866] -- 0:00:01
Average standard deviation of split frequencies: 0.006954
980500 -- [-1202.238] (-1203.500) (-1208.128) (-1203.137) * (-1202.107) (-1201.871) [-1203.828] (-1202.378) -- 0:00:01
981000 -- (-1206.149) (-1204.666) (-1203.926) [-1202.497] * (-1202.037) (-1202.421) [-1202.558] (-1202.454) -- 0:00:01
981500 -- (-1204.636) (-1204.265) [-1204.772] (-1203.263) * (-1202.350) (-1203.261) [-1202.884] (-1203.091) -- 0:00:01
982000 -- [-1203.946] (-1202.087) (-1203.357) (-1201.789) * [-1205.099] (-1204.040) (-1202.329) (-1203.780) -- 0:00:01
982500 -- (-1202.199) [-1202.982] (-1202.603) (-1201.567) * (-1204.104) [-1201.919] (-1201.716) (-1204.977) -- 0:00:01
983000 -- [-1203.797] (-1203.529) (-1202.928) (-1207.408) * (-1204.055) [-1201.804] (-1202.497) (-1205.029) -- 0:00:01
983500 -- (-1203.371) (-1202.913) (-1204.279) [-1207.093] * [-1205.996] (-1202.693) (-1202.135) (-1202.437) -- 0:00:01
984000 -- [-1203.472] (-1202.029) (-1203.688) (-1204.765) * (-1203.792) (-1205.761) [-1202.431] (-1202.078) -- 0:00:00
984500 -- (-1206.331) (-1202.751) (-1202.766) [-1203.332] * (-1203.045) (-1205.662) (-1202.568) [-1203.490] -- 0:00:00
985000 -- (-1207.245) (-1201.950) [-1202.388] (-1205.697) * (-1202.799) (-1204.951) (-1203.116) [-1204.660] -- 0:00:00
Average standard deviation of split frequencies: 0.007140
985500 -- (-1203.218) (-1203.416) (-1205.529) [-1202.463] * (-1204.786) [-1204.061] (-1202.969) (-1204.108) -- 0:00:00
986000 -- [-1204.737] (-1203.368) (-1204.350) (-1203.261) * (-1205.638) [-1205.697] (-1203.628) (-1205.925) -- 0:00:00
986500 -- (-1204.421) (-1202.481) [-1203.228] (-1202.817) * (-1202.917) (-1203.513) [-1203.864] (-1205.345) -- 0:00:00
987000 -- (-1206.164) (-1203.150) (-1203.379) [-1205.372] * [-1203.218] (-1202.682) (-1207.393) (-1206.030) -- 0:00:00
987500 -- (-1204.351) [-1204.272] (-1205.346) (-1203.825) * (-1203.928) (-1204.709) [-1203.645] (-1203.408) -- 0:00:00
988000 -- (-1204.832) [-1202.014] (-1206.542) (-1204.061) * [-1202.369] (-1205.206) (-1203.910) (-1203.438) -- 0:00:00
988500 -- [-1202.204] (-1203.660) (-1206.065) (-1202.806) * (-1202.464) (-1204.188) (-1203.711) [-1204.212] -- 0:00:00
989000 -- (-1205.441) (-1203.482) (-1203.181) [-1202.314] * (-1202.331) (-1204.056) [-1201.762] (-1204.238) -- 0:00:00
989500 -- (-1209.072) (-1204.361) [-1203.545] (-1204.717) * (-1202.977) (-1203.431) (-1202.893) [-1201.565] -- 0:00:00
990000 -- (-1201.976) (-1204.989) [-1202.070] (-1203.920) * (-1203.119) [-1203.199] (-1204.287) (-1203.109) -- 0:00:00
Average standard deviation of split frequencies: 0.007169
990500 -- (-1203.086) [-1208.784] (-1206.261) (-1206.741) * (-1203.112) (-1202.913) (-1204.406) [-1201.992] -- 0:00:00
991000 -- (-1203.513) (-1204.704) [-1206.883] (-1208.060) * (-1205.070) (-1204.729) [-1204.253] (-1205.313) -- 0:00:00
991500 -- (-1204.837) (-1204.841) [-1206.708] (-1205.414) * (-1208.355) (-1203.510) (-1207.709) [-1203.171] -- 0:00:00
992000 -- (-1203.247) (-1211.358) [-1208.210] (-1204.086) * [-1202.878] (-1203.114) (-1210.882) (-1202.532) -- 0:00:00
992500 -- (-1209.549) (-1202.280) (-1204.193) [-1202.457] * [-1202.795] (-1202.381) (-1209.033) (-1202.433) -- 0:00:00
993000 -- (-1208.480) [-1204.408] (-1204.137) (-1202.649) * (-1207.022) (-1204.438) [-1203.686] (-1204.268) -- 0:00:00
993500 -- (-1208.813) (-1202.949) (-1207.002) [-1201.977] * [-1201.572] (-1203.531) (-1203.731) (-1202.657) -- 0:00:00
994000 -- (-1205.996) (-1206.354) [-1204.651] (-1203.268) * (-1202.593) (-1206.991) (-1203.731) [-1203.201] -- 0:00:00
994500 -- (-1206.148) (-1205.326) (-1204.889) [-1203.022] * (-1203.986) (-1209.316) [-1205.188] (-1202.203) -- 0:00:00
995000 -- (-1202.077) (-1203.117) (-1207.261) [-1204.098] * (-1202.654) (-1204.104) (-1202.800) [-1204.230] -- 0:00:00
Average standard deviation of split frequencies: 0.007163
995500 -- (-1205.938) [-1203.906] (-1206.011) (-1204.040) * (-1206.232) (-1202.654) [-1202.045] (-1201.899) -- 0:00:00
996000 -- (-1205.725) [-1204.989] (-1203.878) (-1206.855) * [-1203.366] (-1204.433) (-1204.964) (-1201.529) -- 0:00:00
996500 -- (-1206.906) (-1204.738) [-1204.268] (-1202.227) * (-1204.421) (-1207.182) (-1202.479) [-1201.899] -- 0:00:00
997000 -- (-1203.317) [-1204.681] (-1204.774) (-1205.289) * (-1203.307) (-1204.552) [-1201.681] (-1203.700) -- 0:00:00
997500 -- (-1203.200) (-1210.208) [-1202.333] (-1206.273) * (-1205.896) [-1203.417] (-1202.148) (-1205.563) -- 0:00:00
998000 -- (-1205.312) (-1203.040) [-1202.278] (-1209.081) * (-1207.685) [-1203.538] (-1201.716) (-1204.209) -- 0:00:00
998500 -- (-1202.940) (-1202.243) [-1202.728] (-1204.036) * [-1201.784] (-1203.982) (-1202.832) (-1208.009) -- 0:00:00
999000 -- (-1204.205) [-1203.585] (-1202.974) (-1202.138) * (-1202.715) (-1203.335) (-1204.767) [-1207.197] -- 0:00:00
999500 -- (-1202.325) (-1203.104) (-1202.855) [-1202.404] * (-1203.357) [-1202.598] (-1204.797) (-1202.558) -- 0:00:00
1000000 -- [-1202.245] (-1203.019) (-1205.545) (-1201.471) * (-1203.668) [-1202.135] (-1203.594) (-1202.876) -- 0:00:00
Average standard deviation of split frequencies: 0.006847
Analysis completed in 1 mins 2 seconds
Analysis used 60.43 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1201.42
Likelihood of best state for "cold" chain of run 2 was -1201.42
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 71 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.6 % ( 20 %) Dirichlet(Pi{all})
28.2 % ( 24 %) Slider(Pi{all})
78.6 % ( 51 %) Multiplier(Alpha{1,2})
77.9 % ( 50 %) Multiplier(Alpha{3})
19.1 % ( 32 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 60 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
30.5 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 67 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
26.3 % ( 22 %) Dirichlet(Pi{all})
28.0 % ( 25 %) Slider(Pi{all})
78.0 % ( 46 %) Multiplier(Alpha{1,2})
77.5 % ( 52 %) Multiplier(Alpha{3})
18.6 % ( 23 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.5 % ( 63 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 27 %) Multiplier(V{all})
97.3 % ( 98 %) Nodeslider(V{all})
30.5 % ( 32 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166663 0.82 0.67
3 | 166777 166620 0.84
4 | 166630 166598 166712
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166397 0.82 0.67
3 | 166617 166974 0.84
4 | 166870 166827 166315
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1203.05
| 2|
| 1 1 |
| 1 2 12 1 2 1 |
| 2 2 1 2 2 1 21 1 2 |
| 1 2 22 1 1 21 2 1 1 1 |
| 2 1 2 12 121 1 1 2 * 2 1 222 |
| 22 2 *21 2 2 1 * 2 21 121|
| 1* 1 1 1 1 2 1 2 1 * 2 |
|2 12 *1 1 1121 11 2 2 2 |
| 2 2 2 1 11 2 2 2 |
| 2 2 1 1 |
|1 2 22 1 |
| 1 1 1 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1204.95
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1203.13 -1207.55
2 -1203.12 -1206.92
--------------------------------------
TOTAL -1203.13 -1207.29
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897846 0.090886 0.363820 1.491893 0.860474 1497.45 1499.22 1.000
r(A<->C){all} 0.164309 0.018541 0.000050 0.444030 0.130548 241.23 266.88 1.001
r(A<->G){all} 0.171245 0.019153 0.000008 0.436048 0.140841 161.88 197.20 1.000
r(A<->T){all} 0.174831 0.023566 0.000033 0.485621 0.130292 255.06 298.70 1.000
r(C<->G){all} 0.149775 0.017908 0.000170 0.425154 0.110637 190.49 273.12 1.000
r(C<->T){all} 0.154773 0.019709 0.000102 0.438677 0.109364 180.79 189.70 1.001
r(G<->T){all} 0.185068 0.022997 0.000186 0.486709 0.146725 118.01 203.85 1.007
pi(A){all} 0.207948 0.000191 0.181807 0.235247 0.207892 1055.70 1145.00 1.000
pi(C){all} 0.312390 0.000247 0.281849 0.344025 0.312190 1215.26 1282.55 1.000
pi(G){all} 0.283503 0.000230 0.253346 0.313025 0.283190 1152.62 1171.59 1.000
pi(T){all} 0.196159 0.000182 0.170457 0.223346 0.195769 1254.12 1257.63 1.000
alpha{1,2} 0.433008 0.242571 0.000116 1.377535 0.255982 1100.57 1180.10 1.000
alpha{3} 0.468558 0.239355 0.000368 1.426095 0.311343 1303.79 1343.59 1.000
pinvar{all} 0.998340 0.000004 0.994738 1.000000 0.999012 1177.94 1256.00 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- ..**..
9 -- .***.*
10 -- ..****
11 -- .*..*.
12 -- .*.***
13 -- .**.**
14 -- ....**
15 -- .*.*..
16 -- .****.
17 -- ..*.*.
18 -- ..*..*
19 -- .*...*
20 -- ...**.
21 -- .**...
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 461 0.153564 0.003298 0.151233 0.155896 2
8 457 0.152232 0.021199 0.137242 0.167222 2
9 450 0.149900 0.000000 0.149900 0.149900 2
10 449 0.149567 0.015546 0.138574 0.160560 2
11 447 0.148901 0.011777 0.140573 0.157229 2
12 438 0.145903 0.006595 0.141239 0.150566 2
13 433 0.144237 0.003298 0.141905 0.146569 2
14 432 0.143904 0.003769 0.141239 0.146569 2
15 430 0.143238 0.015075 0.132578 0.153897 2
16 430 0.143238 0.002827 0.141239 0.145237 2
17 420 0.139907 0.005653 0.135909 0.143904 2
18 416 0.138574 0.002827 0.136576 0.140573 2
19 410 0.136576 0.005653 0.132578 0.140573 2
20 402 0.133911 0.000000 0.133911 0.133911 2
21 391 0.130247 0.005182 0.126582 0.133911 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/mmpS3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101269 0.010406 0.000054 0.313510 0.069277 1.000 2
length{all}[2] 0.101378 0.010315 0.000005 0.299904 0.069542 1.000 2
length{all}[3] 0.099338 0.009793 0.000125 0.298513 0.067601 1.000 2
length{all}[4] 0.100547 0.009888 0.000030 0.299667 0.069710 1.000 2
length{all}[5] 0.097789 0.009032 0.000056 0.281766 0.070294 1.001 2
length{all}[6] 0.098428 0.009410 0.000026 0.298274 0.068991 1.000 2
length{all}[7] 0.103257 0.010410 0.000812 0.291587 0.070020 1.000 2
length{all}[8] 0.103197 0.010847 0.000130 0.309593 0.073406 1.000 2
length{all}[9] 0.089359 0.006784 0.000472 0.248304 0.067570 0.999 2
length{all}[10] 0.107884 0.011692 0.000699 0.307921 0.078634 0.998 2
length{all}[11] 0.097111 0.009490 0.000474 0.290681 0.067421 1.000 2
length{all}[12] 0.101740 0.009378 0.000192 0.289815 0.070694 0.999 2
length{all}[13] 0.098068 0.010115 0.000007 0.296828 0.069628 0.998 2
length{all}[14] 0.105221 0.011817 0.000369 0.309186 0.068981 0.998 2
length{all}[15] 0.093898 0.007760 0.000133 0.275700 0.073205 1.000 2
length{all}[16] 0.103140 0.011874 0.000450 0.312036 0.068597 1.007 2
length{all}[17] 0.090413 0.008212 0.000051 0.258043 0.061918 0.998 2
length{all}[18] 0.094738 0.008202 0.000052 0.257298 0.070257 0.998 2
length{all}[19] 0.111665 0.010945 0.000128 0.321918 0.084053 1.008 2
length{all}[20] 0.099894 0.008032 0.000497 0.289823 0.075204 0.998 2
length{all}[21] 0.104865 0.009493 0.000279 0.294918 0.079425 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006847
Maximum standard deviation of split frequencies = 0.021199
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 879
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 293 / 293 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 293 / 293 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.036404 0.106656 0.021666 0.048729 0.072843 0.024887 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1250.995128
Iterating by ming2
Initial: fx= 1250.995128
x= 0.03640 0.10666 0.02167 0.04873 0.07284 0.02489 0.30000 1.30000
1 h-m-p 0.0000 0.0001 705.2316 ++ 1213.702226 m 0.0001 13 | 1/8
2 h-m-p 0.0007 0.0194 67.2800 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 645.5361 ++ 1209.059835 m 0.0000 44 | 2/8
4 h-m-p 0.0001 0.0231 56.9985 ----------.. | 2/8
5 h-m-p 0.0000 0.0000 576.8725 ++ 1195.770970 m 0.0000 74 | 3/8
6 h-m-p 0.0004 0.0289 45.5784 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 499.7198 ++ 1185.075266 m 0.0000 105 | 4/8
8 h-m-p 0.0005 0.0385 34.4588 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 407.9163 ++ 1171.057237 m 0.0001 136 | 5/8
10 h-m-p 0.0010 0.0574 23.3692 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 288.8004 ++ 1161.136762 m 0.0001 167 | 6/8
12 h-m-p 0.7926 8.0000 0.0000 ++ 1161.136762 m 8.0000 178 | 6/8
13 h-m-p 0.0158 7.9054 0.0403 -------C 1161.136762 0 0.0000 198 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 +++++ 1161.136762 m 8.0000 214 | 6/8
15 h-m-p 0.0015 0.7522 0.4234 -----------.. | 6/8
16 h-m-p 0.0160 8.0000 0.0001 +++++ 1161.136762 m 8.0000 252 | 6/8
17 h-m-p 0.0005 0.2550 5.9218 +++++ 1161.136537 m 0.2550 268 | 7/8
18 h-m-p 0.4214 2.1071 0.5074 ++ 1161.136439 m 2.1071 279 | 8/8
19 h-m-p 0.0160 8.0000 0.0000 Y 1161.136439 0 0.0160 291
Out..
lnL = -1161.136439
292 lfun, 292 eigenQcodon, 1752 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.067177 0.091327 0.086924 0.076476 0.021719 0.023762 0.000100 0.880360 0.440035
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.766633
np = 9
lnL0 = -1264.799815
Iterating by ming2
Initial: fx= 1264.799815
x= 0.06718 0.09133 0.08692 0.07648 0.02172 0.02376 0.00011 0.88036 0.44003
1 h-m-p 0.0000 0.0000 681.5323 ++ 1262.929503 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0001 650.7807 ++ 1228.139940 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0000 255.5002 ++ 1225.890603 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0003 685.8789 +++ 1171.967709 m 0.0003 51 | 4/9
5 h-m-p 0.0000 0.0000 44227.3044 ++ 1165.949607 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 9094.9504 ++ 1161.901691 m 0.0000 75 | 6/9
7 h-m-p 0.0000 0.0000 1039.9434 ++ 1161.136583 m 0.0000 87 | 7/9
8 h-m-p 1.6000 8.0000 0.0000 ++ 1161.136583 m 8.0000 99 | 7/9
9 h-m-p 0.0008 0.2044 0.4927 +++++ 1161.136497 m 0.2044 116 | 8/9
10 h-m-p 0.4426 4.7411 0.1988 ---------------C 1161.136497 0 0.0000 145 | 8/9
11 h-m-p 0.0012 0.5971 1.5784 ----------Y 1161.136497 0 0.0000 168 | 8/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 1161.136497 m 8.0000 183 | 8/9
13 h-m-p 0.0160 8.0000 0.0008 +++++ 1161.136491 m 8.0000 199 | 8/9
14 h-m-p 0.0284 4.4408 0.2136 -----------C 1161.136491 0 0.0000 223 | 8/9
15 h-m-p 0.0160 8.0000 0.0001 --------Y 1161.136491 0 0.0000 244 | 8/9
16 h-m-p 0.0160 8.0000 0.0000 --------C 1161.136491 0 0.0000 265
Out..
lnL = -1161.136491
266 lfun, 798 eigenQcodon, 3192 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.083055 0.026912 0.011470 0.023835 0.076749 0.072668 0.000100 1.704839 0.268949 0.224574 2.041188
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.610253
np = 11
lnL0 = -1239.700503
Iterating by ming2
Initial: fx= 1239.700503
x= 0.08305 0.02691 0.01147 0.02383 0.07675 0.07267 0.00011 1.70484 0.26895 0.22457 2.04119
1 h-m-p 0.0000 0.0000 611.4073 ++ 1238.468513 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 275.4528 +++ 1220.451157 m 0.0003 31 | 2/11
3 h-m-p 0.0000 0.0001 189.4913 ++ 1207.806724 m 0.0001 45 | 3/11
4 h-m-p 0.0000 0.0002 84.5246 ++ 1205.599098 m 0.0002 59 | 4/11
5 h-m-p 0.0000 0.0004 323.5440 ++ 1169.461716 m 0.0004 73 | 5/11
6 h-m-p 0.0001 0.0004 170.2203 ++ 1165.502589 m 0.0004 87 | 6/11
7 h-m-p 0.0000 0.0000 1144507670.6166
h-m-p: 8.14306714e-13 4.07153357e-12 1.14450767e+09 1165.502589
.. | 6/11
8 h-m-p 0.0000 0.0001 279.9169 ++ 1161.136661 m 0.0001 112 | 7/11
9 h-m-p 0.3546 8.0000 0.0000 +++ 1161.136661 m 8.0000 127 | 7/11
10 h-m-p 0.0042 0.2584 0.0789 ------------.. | 7/11
11 h-m-p 0.0160 8.0000 0.0002 +++++ 1161.136660 m 8.0000 176 | 7/11
12 h-m-p 0.0049 2.4392 0.4478 -----------Y 1161.136660 0 0.0000 205 | 7/11
13 h-m-p 0.0160 8.0000 0.0002 +++++ 1161.136660 m 8.0000 226 | 7/11
14 h-m-p 0.0056 2.8160 0.7653 ----------Y 1161.136660 0 0.0000 254 | 7/11
15 h-m-p 0.0160 8.0000 0.0003 +++++ 1161.136660 m 8.0000 275 | 7/11
16 h-m-p 0.0087 4.3582 1.1228 -------------.. | 7/11
17 h-m-p 0.0085 4.2276 0.0002 +++++ 1161.136660 m 4.2276 321 | 8/11
18 h-m-p 0.0160 8.0000 0.2173 ---------Y 1161.136660 0 0.0000 348 | 8/11
19 h-m-p 0.0160 8.0000 0.0002 +++++ 1161.136660 m 8.0000 368 | 8/11
20 h-m-p 0.0160 8.0000 4.0695 ------------C 1161.136660 0 0.0000 397 | 8/11
21 h-m-p 0.0160 8.0000 0.0008 +++++ 1161.136659 m 8.0000 414 | 8/11
22 h-m-p 0.0031 1.5325 2.9542 -----------Y 1161.136659 0 0.0000 442 | 8/11
23 h-m-p 0.0160 8.0000 0.0001 +++++ 1161.136659 m 8.0000 459 | 8/11
24 h-m-p 0.0160 8.0000 3.9923 -----------C 1161.136659 0 0.0000 487 | 8/11
25 h-m-p 0.0160 8.0000 0.0000 +++++ 1161.136659 m 8.0000 504 | 8/11
26 h-m-p 0.0160 8.0000 0.0029 +++++ 1161.136657 m 8.0000 524 | 8/11
27 h-m-p 0.0160 8.0000 3.6586 -----------C 1161.136657 0 0.0000 552 | 8/11
28 h-m-p 0.0160 8.0000 0.0000 +++++ 1161.136657 m 8.0000 569 | 8/11
29 h-m-p 0.0160 8.0000 0.0074 +++++ 1161.136653 m 8.0000 589 | 8/11
30 h-m-p 0.0160 8.0000 3.7945 -------------.. | 8/11
31 h-m-p 0.0160 8.0000 0.0001 +++++ 1161.136653 m 8.0000 634 | 8/11
32 h-m-p 0.0160 8.0000 0.3112 ----------C 1161.136653 0 0.0000 661 | 8/11
33 h-m-p 0.0160 8.0000 0.0000 ---------Y 1161.136653 0 0.0000 687 | 8/11
34 h-m-p 0.0160 8.0000 0.0001 +++++ 1161.136653 m 8.0000 707 | 8/11
35 h-m-p 0.0160 8.0000 4.8715 -------------.. | 8/11
36 h-m-p 0.0160 8.0000 0.0001 +++++ 1161.136652 m 8.0000 752 | 8/11
37 h-m-p 0.0043 2.1650 1.2261 +++++ 1161.136463 m 2.1650 772 | 9/11
38 h-m-p 1.6000 8.0000 1.0084 ++ 1161.136439 m 8.0000 786 | 9/11
39 h-m-p 1.6000 8.0000 0.0000 N 1161.136439 0 1.6000 800
Out..
lnL = -1161.136439
801 lfun, 3204 eigenQcodon, 14418 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1161.184157 S = -1161.137404 -0.018048
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:05
did 20 / 57 patterns 0:05
did 30 / 57 patterns 0:05
did 40 / 57 patterns 0:05
did 50 / 57 patterns 0:05
did 57 / 57 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.092820 0.033727 0.083972 0.106056 0.021008 0.088571 0.000100 0.258194 1.398462
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 23.157103
np = 9
lnL0 = -1274.374829
Iterating by ming2
Initial: fx= 1274.374829
x= 0.09282 0.03373 0.08397 0.10606 0.02101 0.08857 0.00011 0.25819 1.39846
1 h-m-p 0.0000 0.0000 618.7289 ++ 1273.978856 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0095 42.1342 +++++ 1268.543983 m 0.0095 29 | 2/9
3 h-m-p 0.0000 0.0000 196957888.7583 ++ 1266.118455 m 0.0000 41 | 3/9
4 h-m-p 0.0001 0.0135 1361.9569 +
QuantileBeta(0.15, 0.00500, 3.03636) = 8.066317e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 9.26148) = 2.350251e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 19.28836) = 1.096611e-161 2000 rounds
+ 1211.017289 m 0.0135 55
QuantileBeta(0.15, 0.00500, 19.28836) = 1.096611e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.28836) = 1.096611e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.28836) = 1.096611e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.28836) = 1.096611e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.28836) = 1.096611e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.28836) = 1.096611e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.28836) = 1.096611e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.28836) = 1.134893e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.28837) = 1.096610e-161 2000 rounds
| 4/9
5 h-m-p 0.0001 0.0004 24257.4921
QuantileBeta(0.15, 0.00500, 21.24638) = 9.931475e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 27.12045) = 7.740496e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
+ 1181.718067 m 0.0004 67
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.461975e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07849) = 7.210263e-162 2000 rounds
| 5/9
6 h-m-p 0.0126 0.0630 461.3734
QuantileBeta(0.15, 0.00500, 23.26378) = 9.051562e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 27.62480) = 7.596601e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 28.71506) = 7.303119e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 28.98762) = 7.233257e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.05576) = 7.216000e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07280) = 7.211699e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07706) = 7.210625e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07812) = 7.210356e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07839) = 7.210289e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07845) = 7.210272e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07847) = 7.210268e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07847) = 7.210267e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.461975e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07849) = 7.210263e-162 2000 rounds
| 5/9
7 h-m-p 0.0000 0.0000 468.9768
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
+ 1173.564504 m 0.0000 102
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.461975e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07849) = 7.210263e-162 2000 rounds
| 6/9
8 h-m-p 0.0160 8.0000 1.5790
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.461975e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07849) = 7.210263e-162 2000 rounds
| 6/9
9 h-m-p 0.0000 0.0000 383.7633
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
+ 1168.957510 m 0.0000 137
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.461975e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07849) = 7.210263e-162 2000 rounds
| 7/9
10 h-m-p 0.0160 8.0000 1.0762
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.461975e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07849) = 7.210263e-162 2000 rounds
| 7/9
11 h-m-p 0.0000 0.0001 269.8701
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
+ 1161.136439 m 0.0001 172
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.461975e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07849) = 7.210263e-162 2000 rounds
| 8/9
12 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
Y 1161.136439 0 0.0640 185
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.461975e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07902) = 7.210128e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07793) = 7.210404e-162 2000 rounds
| 7/9
13 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 29.07848) = 7.218892e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.244832e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.210266e-162 2000 rounds
Y 1161.136439 0 0.0160 198
QuantileBeta(0.15, 0.00500, 29.07848) = 7.218892e-162 2000 rounds
Out..
lnL = -1161.136439
199 lfun, 2189 eigenQcodon, 11940 P(t)
QuantileBeta(0.15, 0.00500, 29.07848) = 7.218892e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.07848) = 7.218892e-162 2000 rounds
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.047386 0.029535 0.101371 0.083310 0.036013 0.018918 0.000100 0.900000 0.774201 1.463600 2.377201
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.151930
np = 11
lnL0 = -1244.108982
Iterating by ming2
Initial: fx= 1244.108982
x= 0.04739 0.02954 0.10137 0.08331 0.03601 0.01892 0.00011 0.90000 0.77420 1.46360 2.37720
1 h-m-p 0.0000 0.0000 594.7540 ++ 1243.160571 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 414.3675 +++ 1214.868323 m 0.0002 31 | 2/11
3 h-m-p 0.0000 0.0001 574.9989 ++ 1201.306350 m 0.0001 45 | 3/11
4 h-m-p 0.0006 0.0107 53.4087 +++ 1175.453463 m 0.0107 60 | 4/11
5 h-m-p 0.0000 0.0001 5780.2544 ++ 1166.605775 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0002 391.4416 ++ 1166.308080 m 0.0002 88 | 6/11
7 h-m-p 0.0000 0.0002 900.1682 ++ 1165.028263 m 0.0002 102 | 7/11
8 h-m-p 0.0011 0.0328 197.1480 -----------.. | 7/11
9 h-m-p 0.0000 0.0000 284.8805 ++ 1161.136767 m 0.0000 139 | 8/11
10 h-m-p 0.5792 8.0000 0.0000 ++ 1161.136767 m 8.0000 153 | 8/11
11 h-m-p 0.0218 8.0000 0.0063 +++++ 1161.136766 m 8.0000 173 | 8/11
12 h-m-p 0.0323 6.1350 1.5539 ---------C 1161.136766 0 0.0000 199 | 8/11
13 h-m-p 0.0212 8.0000 0.0000 +++++ 1161.136766 m 8.0000 216 | 7/11
14 h-m-p 0.0160 8.0000 0.0028 +++++ 1161.136765 m 8.0000 236 | 7/11
15 h-m-p 0.0012 0.0059 3.8489 ----------N 1161.136765 0 0.0000 264 | 7/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 1161.136765 m 8.0000 281 | 7/11
17 h-m-p 0.0002 0.0031 1.0533 ----------.. | 7/11
18 h-m-p 0.0160 8.0000 0.0002 +++++ 1161.136765 m 8.0000 324 | 7/11
19 h-m-p 0.0096 0.0744 0.1632 -------------.. | 7/11
20 h-m-p 0.0160 8.0000 0.0002 +++++ 1161.136765 m 8.0000 374 | 7/11
21 h-m-p 0.0054 0.0445 0.2918 ---------C 1161.136765 0 0.0000 401 | 7/11
22 h-m-p 0.0160 8.0000 0.0003 +++++ 1161.136764 m 8.0000 422 | 7/11
23 h-m-p 0.0007 0.0036 1.5920 -----------.. | 7/11
24 h-m-p 0.0160 8.0000 0.0002 +++++ 1161.136764 m 8.0000 466 | 7/11
25 h-m-p 0.0082 0.1164 0.1957 ---------N 1161.136764 0 0.0000 493 | 7/11
26 h-m-p 0.0160 8.0000 0.0008 +++++ 1161.136763 m 8.0000 514 | 7/11
27 h-m-p 0.0251 2.6024 0.2440 -----------N 1161.136763 0 0.0000 543 | 7/11
28 h-m-p 0.0020 0.9859 0.0093 +++++ 1161.136761 m 0.9859 564 | 7/11
29 h-m-p 0.0380 2.7097 0.2400 -----------C 1161.136761 0 0.0000 593 | 7/11
30 h-m-p 0.0160 8.0000 0.0002 +++++ 1161.136761 m 8.0000 614 | 7/11
31 h-m-p 0.0008 0.0041 0.4591 ---------C 1161.136761 0 0.0000 641 | 7/11
32 h-m-p 0.0160 8.0000 0.0001 +++++ 1161.136761 m 8.0000 662 | 7/11
33 h-m-p 0.0034 1.6900 1.3702 --------C 1161.136761 0 0.0000 688 | 7/11
34 h-m-p 0.0160 8.0000 0.0000 -----Y 1161.136761 0 0.0000 707 | 7/11
35 h-m-p 0.0160 8.0000 0.0008 +++++ 1161.136761 m 8.0000 728 | 7/11
36 h-m-p 0.0019 0.0096 0.7601 -----------C 1161.136761 0 0.0000 757 | 7/11
37 h-m-p 0.0160 8.0000 0.0000 +++++ 1161.136761 m 8.0000 778 | 7/11
38 h-m-p 0.0006 0.0127 0.3419 ---------N 1161.136761 0 0.0000 805 | 7/11
39 h-m-p 0.0005 0.2512 0.0170 ------N 1161.136761 0 0.0000 829 | 7/11
40 h-m-p 0.0160 8.0000 0.0121 +++++ 1161.136739 m 8.0000 850 | 7/11
41 h-m-p 0.0565 0.2827 0.3565 ------------Y 1161.136739 0 0.0000 880 | 7/11
42 h-m-p 0.0160 8.0000 0.0000 +++++ 1161.136739 m 8.0000 901 | 7/11
43 h-m-p 0.0008 0.3613 0.2813 -----------.. | 7/11
44 h-m-p 0.0160 8.0000 0.0003 +++++ 1161.136738 m 8.0000 949 | 7/11
45 h-m-p 0.0111 1.6670 0.2170 -----------Y 1161.136738 0 0.0000 978 | 7/11
46 h-m-p 0.0047 2.3512 0.1250 +++++ 1161.136443 m 2.3512 999 | 8/11
47 h-m-p 1.6000 8.0000 0.0159 ++ 1161.136439 m 8.0000 1017 | 8/11
48 h-m-p 0.0316 0.5241 4.0294 ------------C 1161.136439 0 0.0000 1046 | 8/11
49 h-m-p 0.0160 8.0000 0.0000 +++++ 1161.136439 m 8.0000 1063 | 8/11
50 h-m-p 0.0000 0.0055 4.6885 ++++ 1161.136439 m 0.0055 1082 | 9/11
51 h-m-p 1.0140 8.0000 0.0250 ---------N 1161.136439 0 0.0000 1105 | 9/11
52 h-m-p 1.6000 8.0000 0.0000 ------Y 1161.136439 0 0.0001 1127
Out..
lnL = -1161.136439
1128 lfun, 13536 eigenQcodon, 74448 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1161.198198 S = -1161.137403 -0.027022
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:27
did 20 / 57 patterns 0:27
did 30 / 57 patterns 0:27
did 40 / 57 patterns 0:28
did 50 / 57 patterns 0:28
did 57 / 57 patterns 0:28
Time used: 0:28
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/10res/mmpS3/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 293
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 6 6 6 6 6 6 | TAC 6 6 6 6 6 6 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 4 4 4 4 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 6 6 6 6 6 6 | TCG 14 14 14 14 14 14 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 4 4 4 4 4 4 | His CAT 3 3 3 3 3 3 | Arg CGT 1 1 1 1 1 1
CTC 5 5 5 5 5 5 | CCC 5 5 5 5 5 5 | CAC 1 1 1 1 1 1 | CGC 1 1 1 1 1 1
CTA 0 0 0 0 0 0 | CCA 7 7 7 7 7 7 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 3 3 3 3 3 3 | CCG 19 19 19 19 19 19 | CAG 5 5 5 5 5 5 | CGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 8 8 8 8 8 8 | Asn AAT 3 3 3 3 3 3 | Ser AGT 3 3 3 3 3 3
ATC 6 6 6 6 6 6 | ACC 14 14 14 14 14 14 | AAC 5 5 5 5 5 5 | AGC 10 10 10 10 10 10
ATA 0 0 0 0 0 0 | ACA 5 5 5 5 5 5 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 15 15 15 15 15 15 | AAG 1 1 1 1 1 1 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 8 8 8 8 8 8 | Ala GCT 5 5 5 5 5 5 | Asp GAT 8 8 8 8 8 8 | Gly GGT 5 5 5 5 5 5
GTC 7 7 7 7 7 7 | GCC 5 5 5 5 5 5 | GAC 9 9 9 9 9 9 | GGC 5 5 5 5 5 5
GTA 6 6 6 6 6 6 | GCA 2 2 2 2 2 2 | Glu GAA 5 5 5 5 5 5 | GGA 3 3 3 3 3 3
GTG 12 12 12 12 12 12 | GCG 7 7 7 7 7 7 | GAG 12 12 12 12 12 12 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907987_1_916_MLBR_RS04315
position 1: T:0.17065 C:0.22184 A:0.26621 G:0.34130
position 2: T:0.21843 C:0.41297 A:0.22526 G:0.14334
position 3: T:0.19795 C:0.30375 A:0.13311 G:0.36519
Average T:0.19568 C:0.31286 A:0.20819 G:0.28328
#2: NC_002677_1_NP_301663_1_535_mmpS3
position 1: T:0.17065 C:0.22184 A:0.26621 G:0.34130
position 2: T:0.21843 C:0.41297 A:0.22526 G:0.14334
position 3: T:0.19795 C:0.30375 A:0.13311 G:0.36519
Average T:0.19568 C:0.31286 A:0.20819 G:0.28328
#3: NZ_LVXE01000007_1_WP_010907987_1_2552_A3216_RS04155
position 1: T:0.17065 C:0.22184 A:0.26621 G:0.34130
position 2: T:0.21843 C:0.41297 A:0.22526 G:0.14334
position 3: T:0.19795 C:0.30375 A:0.13311 G:0.36519
Average T:0.19568 C:0.31286 A:0.20819 G:0.28328
#4: NZ_LYPH01000011_1_WP_010907987_1_374_A8144_RS01785
position 1: T:0.17065 C:0.22184 A:0.26621 G:0.34130
position 2: T:0.21843 C:0.41297 A:0.22526 G:0.14334
position 3: T:0.19795 C:0.30375 A:0.13311 G:0.36519
Average T:0.19568 C:0.31286 A:0.20819 G:0.28328
#5: NZ_CP029543_1_WP_010907987_1_934_DIJ64_RS04745
position 1: T:0.17065 C:0.22184 A:0.26621 G:0.34130
position 2: T:0.21843 C:0.41297 A:0.22526 G:0.14334
position 3: T:0.19795 C:0.30375 A:0.13311 G:0.36519
Average T:0.19568 C:0.31286 A:0.20819 G:0.28328
#6: NZ_AP014567_1_WP_010907987_1_951_JK2ML_RS04830
position 1: T:0.17065 C:0.22184 A:0.26621 G:0.34130
position 2: T:0.21843 C:0.41297 A:0.22526 G:0.14334
position 3: T:0.19795 C:0.30375 A:0.13311 G:0.36519
Average T:0.19568 C:0.31286 A:0.20819 G:0.28328
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 6 | Tyr Y TAT 18 | Cys C TGT 0
TTC 12 | TCC 36 | TAC 36 | TGC 12
Leu L TTA 6 | TCA 24 | *** * TAA 0 | *** * TGA 0
TTG 36 | TCG 84 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 24 | His H CAT 18 | Arg R CGT 6
CTC 30 | CCC 30 | CAC 6 | CGC 6
CTA 0 | CCA 42 | Gln Q CAA 12 | CGA 6
CTG 18 | CCG 114 | CAG 30 | CGG 36
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 48 | Asn N AAT 18 | Ser S AGT 18
ATC 36 | ACC 84 | AAC 30 | AGC 60
ATA 0 | ACA 30 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 12 | ACG 90 | AAG 6 | AGG 6
------------------------------------------------------------------------------
Val V GTT 48 | Ala A GCT 30 | Asp D GAT 48 | Gly G GGT 30
GTC 42 | GCC 30 | GAC 54 | GGC 30
GTA 36 | GCA 12 | Glu E GAA 30 | GGA 18
GTG 72 | GCG 42 | GAG 72 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17065 C:0.22184 A:0.26621 G:0.34130
position 2: T:0.21843 C:0.41297 A:0.22526 G:0.14334
position 3: T:0.19795 C:0.30375 A:0.13311 G:0.36519
Average T:0.19568 C:0.31286 A:0.20819 G:0.28328
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1161.136439 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907987_1_916_MLBR_RS04315: 0.000004, NC_002677_1_NP_301663_1_535_mmpS3: 0.000004, NZ_LVXE01000007_1_WP_010907987_1_2552_A3216_RS04155: 0.000004, NZ_LYPH01000011_1_WP_010907987_1_374_A8144_RS01785: 0.000004, NZ_CP029543_1_WP_010907987_1_934_DIJ64_RS04745: 0.000004, NZ_AP014567_1_WP_010907987_1_951_JK2ML_RS04830: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 643.2 235.8 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 643.2 235.8 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 643.2 235.8 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 643.2 235.8 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 643.2 235.8 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 643.2 235.8 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1161.136491 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.051467
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907987_1_916_MLBR_RS04315: 0.000004, NC_002677_1_NP_301663_1_535_mmpS3: 0.000004, NZ_LVXE01000007_1_WP_010907987_1_2552_A3216_RS04155: 0.000004, NZ_LYPH01000011_1_WP_010907987_1_374_A8144_RS01785: 0.000004, NZ_CP029543_1_WP_010907987_1_934_DIJ64_RS04745: 0.000004, NZ_AP014567_1_WP_010907987_1_951_JK2ML_RS04830: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.05147 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 643.2 235.8 0.0515 0.0000 0.0000 0.0 0.0
7..2 0.000 643.2 235.8 0.0515 0.0000 0.0000 0.0 0.0
7..3 0.000 643.2 235.8 0.0515 0.0000 0.0000 0.0 0.0
7..4 0.000 643.2 235.8 0.0515 0.0000 0.0000 0.0 0.0
7..5 0.000 643.2 235.8 0.0515 0.0000 0.0000 0.0 0.0
7..6 0.000 643.2 235.8 0.0515 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1161.136439 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999992 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907987_1_916_MLBR_RS04315: 0.000004, NC_002677_1_NP_301663_1_535_mmpS3: 0.000004, NZ_LVXE01000007_1_WP_010907987_1_2552_A3216_RS04155: 0.000004, NZ_LYPH01000011_1_WP_010907987_1_374_A8144_RS01785: 0.000004, NZ_CP029543_1_WP_010907987_1_934_DIJ64_RS04745: 0.000004, NZ_AP014567_1_WP_010907987_1_951_JK2ML_RS04830: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99999 0.00000 0.00001
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907987_1_916_MLBR_RS04315)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1161.136439 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 29.078476
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907987_1_916_MLBR_RS04315: 0.000004, NC_002677_1_NP_301663_1_535_mmpS3: 0.000004, NZ_LVXE01000007_1_WP_010907987_1_2552_A3216_RS04155: 0.000004, NZ_LYPH01000011_1_WP_010907987_1_374_A8144_RS01785: 0.000004, NZ_CP029543_1_WP_010907987_1_934_DIJ64_RS04745: 0.000004, NZ_AP014567_1_WP_010907987_1_951_JK2ML_RS04830: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 29.07848
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1161.136439 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.994077 3.042300
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907987_1_916_MLBR_RS04315: 0.000004, NC_002677_1_NP_301663_1_535_mmpS3: 0.000004, NZ_LVXE01000007_1_WP_010907987_1_2552_A3216_RS04155: 0.000004, NZ_LYPH01000011_1_WP_010907987_1_374_A8144_RS01785: 0.000004, NZ_CP029543_1_WP_010907987_1_934_DIJ64_RS04745: 0.000004, NZ_AP014567_1_WP_010907987_1_951_JK2ML_RS04830: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.99408
(p1 = 0.00001) w = 3.04230
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 3.04230
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 643.2 235.8 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907987_1_916_MLBR_RS04315)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.100 0.102 0.103 0.104 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.099 0.099 0.098 0.097 0.096
Time used: 0:28