--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Nov 10 10:57:27 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/187/CG7787-PA/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -989.69 -1000.18 2 -989.69 -1005.95 -------------------------------------- TOTAL -989.69 -1005.26 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.502640 0.006819 0.350610 0.662763 0.495768 973.99 1177.79 1.000 r(A<->C){all} 0.085149 0.001040 0.025399 0.144695 0.082751 689.28 725.95 1.000 r(A<->G){all} 0.213591 0.002693 0.118886 0.317510 0.209635 513.55 567.93 1.000 r(A<->T){all} 0.124657 0.002129 0.046321 0.221326 0.120679 583.33 631.22 1.001 r(C<->G){all} 0.047780 0.000457 0.012457 0.092048 0.044890 720.65 803.32 1.000 r(C<->T){all} 0.504052 0.005507 0.356224 0.640697 0.504914 505.67 507.53 1.000 r(G<->T){all} 0.024770 0.000375 0.000013 0.063040 0.020486 639.27 740.12 1.001 pi(A){all} 0.276425 0.000482 0.237161 0.322955 0.275207 1202.09 1208.53 1.000 pi(C){all} 0.245294 0.000436 0.203830 0.284975 0.245152 1068.52 1113.89 1.000 pi(G){all} 0.290386 0.000478 0.248135 0.333666 0.290106 1070.03 1198.75 1.000 pi(T){all} 0.187895 0.000373 0.152645 0.227427 0.187187 956.08 1032.48 1.000 alpha{1,2} 0.111209 0.005437 0.000352 0.238301 0.103786 912.97 1000.81 1.003 alpha{3} 1.632596 0.477607 0.627431 3.068261 1.490353 1181.74 1341.37 1.000 pinvar{all} 0.157514 0.011390 0.000023 0.355689 0.142369 1025.40 1028.99 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -932.121409 Model 2: PositiveSelection -930.554639 Model 0: one-ratio -950.499344 Model 3: discrete -930.55464 Model 7: beta -935.494437 Model 8: beta&w>1 -930.626396 Model 0 vs 1 36.75586999999996 Model 2 vs 1 3.133540000000039 Model 8 vs 7 9.736081999999897 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG7787-PA) Pr(w>1) post mean +- SE for w 12 T 1.000** 4.325 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG7787-PA) Pr(w>1) post mean +- SE for w 12 T 0.978* 4.945 +- 2.835
>C1 MTEEADFSEQITDGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCYLALKRVVHKDT >C2 MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK QDRSADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCYLALKRVVHKDT >C3 MTEEADFSEQIVDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTLDGRKFLVCADCERGPV GYHDLSTRHCFLALKRVVHKDT >C4 MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGAYNQEKVDVPLMMQK QDQTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCFLALQRVVHKDT >C5 MTEVTDFSEQISNGKNILNVRCQFCNSLMLKAQEGTYSQEEVEVPLMMQK QDRTADSLNSEPLKDFWLVKDMMMFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCFLALKRVVHKDS >C6 MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV GYHDLTTRHCFLALKRVVHKDS >C7 MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV GYHDLTTRHCFLALKRVVHKDS CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=122 C1 MTEEADFSEQITDGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQK C2 MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK C3 MTEEADFSEQIVDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK C4 MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGAYNQEKVDVPLMMQK C5 MTEVTDFSEQISNGKNILNVRCQFCNSLMLKAQEGTYSQEEVEVPLMMQK C6 MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK C7 MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK *** :***:** :*** ********.********::. *:*:**** ** C1 QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV C2 QDRSADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV C3 QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTLDGRKFLVCADCERGPV C4 QDQTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV C5 QDRTADSLNSEPLKDFWLVKDMMMFENIGFSNTVDGRKFLVCADCERGPV C6 QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV C7 QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV **::******************* *******:*:**************** C1 GYHDLSTRHCYLALKRVVHKDT C2 GYHDLSTRHCYLALKRVVHKDT C3 GYHDLSTRHCFLALKRVVHKDT C4 GYHDLSTRHCFLALQRVVHKDT C5 GYHDLSTRHCFLALKRVVHKDS C6 GYHDLTTRHCFLALKRVVHKDS C7 GYHDLTTRHCFLALKRVVHKDS *****:****:***:******: PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5124] Library Relaxation: Multi_proc [72] Relaxation Summary: [5124]--->[5124] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.355 Mb, Max= 30.570 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MTEEADFSEQITDGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCYLALKRVVHKDT >C2 MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK QDRSADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCYLALKRVVHKDT >C3 MTEEADFSEQIVDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTLDGRKFLVCADCERGPV GYHDLSTRHCFLALKRVVHKDT >C4 MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGAYNQEKVDVPLMMQK QDQTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCFLALQRVVHKDT >C5 MTEVTDFSEQISNGKNILNVRCQFCNSLMLKAQEGTYSQEEVEVPLMMQK QDRTADSLNSEPLKDFWLVKDMMMFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCFLALKRVVHKDS >C6 MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV GYHDLTTRHCFLALKRVVHKDS >C7 MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV GYHDLTTRHCFLALKRVVHKDS FORMAT of file /tmp/tmp5157648480891349101aln Not Supported[FATAL:T-COFFEE] >C1 MTEEADFSEQITDGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCYLALKRVVHKDT >C2 MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK QDRSADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCYLALKRVVHKDT >C3 MTEEADFSEQIVDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTLDGRKFLVCADCERGPV GYHDLSTRHCFLALKRVVHKDT >C4 MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGAYNQEKVDVPLMMQK QDQTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCFLALQRVVHKDT >C5 MTEVTDFSEQISNGKNILNVRCQFCNSLMLKAQEGTYSQEEVEVPLMMQK QDRTADSLNSEPLKDFWLVKDMMMFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCFLALKRVVHKDS >C6 MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV GYHDLTTRHCFLALKRVVHKDS >C7 MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV GYHDLTTRHCFLALKRVVHKDS input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:122 S:100 BS:122 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # SEQ_INDEX C7 6 # PW_SEQ_DISTANCES BOT 0 1 97.54 C1 C2 97.54 TOP 1 0 97.54 C2 C1 97.54 BOT 0 2 95.90 C1 C3 95.90 TOP 2 0 95.90 C3 C1 95.90 BOT 0 3 94.26 C1 C4 94.26 TOP 3 0 94.26 C4 C1 94.26 BOT 0 4 89.34 C1 C5 89.34 TOP 4 0 89.34 C5 C1 89.34 BOT 0 5 90.16 C1 C6 90.16 TOP 5 0 90.16 C6 C1 90.16 BOT 0 6 90.16 C1 C7 90.16 TOP 6 0 90.16 C7 C1 90.16 BOT 1 2 96.72 C2 C3 96.72 TOP 2 1 96.72 C3 C2 96.72 BOT 1 3 95.08 C2 C4 95.08 TOP 3 1 95.08 C4 C2 95.08 BOT 1 4 90.16 C2 C5 90.16 TOP 4 1 90.16 C5 C2 90.16 BOT 1 5 90.98 C2 C6 90.98 TOP 5 1 90.98 C6 C2 90.98 BOT 1 6 90.98 C2 C7 90.98 TOP 6 1 90.98 C7 C2 90.98 BOT 2 3 95.08 C3 C4 95.08 TOP 3 2 95.08 C4 C3 95.08 BOT 2 4 90.98 C3 C5 90.98 TOP 4 2 90.98 C5 C3 90.98 BOT 2 5 92.62 C3 C6 92.62 TOP 5 2 92.62 C6 C3 92.62 BOT 2 6 92.62 C3 C7 92.62 TOP 6 2 92.62 C7 C3 92.62 BOT 3 4 88.52 C4 C5 88.52 TOP 4 3 88.52 C5 C4 88.52 BOT 3 5 89.34 C4 C6 89.34 TOP 5 3 89.34 C6 C4 89.34 BOT 3 6 89.34 C4 C7 89.34 TOP 6 3 89.34 C7 C4 89.34 BOT 4 5 90.16 C5 C6 90.16 TOP 5 4 90.16 C6 C5 90.16 BOT 4 6 90.16 C5 C7 90.16 TOP 6 4 90.16 C7 C5 90.16 BOT 5 6 100.00 C6 C7 100.00 TOP 6 5 100.00 C7 C6 100.00 AVG 0 C1 * 92.90 AVG 1 C2 * 93.58 AVG 2 C3 * 93.99 AVG 3 C4 * 91.94 AVG 4 C5 * 89.89 AVG 5 C6 * 92.21 AVG 6 C7 * 92.21 TOT TOT * 92.39 CLUSTAL W (1.83) multiple sequence alignment C1 ATGACAGAGGAAGCTGATTTTAGCGAGCAAATCACCGATGGGAAAAACAA C2 ATGACAGAGGAAGCTGATTTTAGCGAGCAAATCACCGATGGGAAAAACAA C3 ATGACCGAGGAAGCTGATTTCAGCGAGCAAATCGTTGATGGAAAAAACAA C4 ATGACAGAGGAAGCCGATTTTAGCGAGCAAATCACAGATGGAAAAAACAA C5 ATGACGGAGGTTACTGATTTTAGTGAGCAAATATCCAATGGAAAGAACAT C6 ATGACAGAAGAGGCTGATTTTAGTGACCAAATAGTTGATGGAAAGAACAA C7 ATGACAGAAGAGGCTGATTTTAGTGACCAAATAGTTGATGGAAAGAACAA ***** **.*: .* ***** ** ** *****. .****.**.****: C1 ATCAAATGTGCGCTGCCAGTTTTGCAACTGTTTGATGCTGAAAGCACAAG C2 ATCAAATGTGCGCTGCCAGTTTTGCAACAGCTTGATGCTGAAAGCCCAAG C3 ATCAAATGTGCGCTGCCAGTTCTGCAACAGTTTGATGCTGAAAGCCCAAG C4 ATCAAATGTGCGCTGCCAGTTCTGCAACAGTTTGATGCTGAAAGCCCAGG C5 ATTAAATGTGCGCTGCCAGTTCTGCAATAGTTTGATGCTCAAGGCCCAAG C6 ATCAAATGTGCGCTGCCAGTTCTGCAATAGTTTGATGCTCAAGGCTCAGG C7 ATCAAATGTGCGCTGCCAGTTCTGCAATAGTTTGATGCTCAAGGCTCAGG ** ****************** ***** :* ******** **.** **.* C1 AGGGCACCTACAACCAGGAGGAGGTGGATGTGCCACTGATGACGCAGAAG C2 AGGGCACCTACAATCAGGAGGAGGTGGATGTGCCGCTGATGATGCAGAAG C3 AGGGCACCTACAACCAGGAGGAGGTGGATGTGCCACTGATGATGCAGAAG C4 AGGGCGCCTACAACCAGGAGAAGGTGGATGTGCCACTGATGATGCAGAAA C5 AGGGAACCTACAGCCAGGAGGAAGTGGAAGTGCCCCTGATGATGCAAAAA C6 AGGGCACCTTCAGCGCGGAGGAAGTGGAAGTGCCCCTGATGATGCAAAAA C7 AGGGCACCTTCAGCGCGGAGGAAGTGGAAGTGCCCCTGATGATGCAAAAA ****..***:**. .****.*.*****:***** ******* ***.**. C1 CAGGATCGAACGGCGGACAGCCTAAACAGCGAGCCACTGAAAGACTTCTG C2 CAGGATCGATCGGCGGACAGCCTAAACAGCGAGCCACTGAAGGACTTCTG C3 CAGGACCGAACAGCGGACAGCCTAAACAGCGAGCCACTGAAGGACTTCTG C4 CAGGACCAAACGGCGGACAGCCTGAACAGCGAGCCACTGAAGGACTTCTG C5 CAGGACAGGACGGCGGACAGTCTGAACAGCGAGCCACTGAAGGACTTTTG C6 CAGGACAGAACGGCGGACAGTCTGAACAGCGAGCCATTGAAGGACTTCTG C7 CAGGACAGAACGGCGGACAGTCTGAACAGCGAGCCATTGAAGGACTTCTG ***** ...:*.******** **.************ ****.***** ** C1 GCTGGTCAAGGACATGATGACATTCGAGAACATCGGGTTCTCCAACACGG C2 GCTGGTCAAGGACATGATGACGTTCGAGAACATCGGCTTCTCCAATACGG C3 GCTGGTTAAGGACATGATGACGTTCGAGAACATCGGCTTCTCCAACACGC C4 GCTGGTCAAGGACATGATGACGTTCGAGAACATCGGGTTCTCCAACACGG C5 GCTGGTCAAGGACATGATGATGTTCGAGAATATTGGATTCTCCAACACGG C6 GCTGGTCAAGGACATGATGACGTTCGAGAATATCGGATTCTCCCACACAG C7 GCTGGTCAAGGACATGATGACGTTCGAGAATATCGGATTCTCCCACACAG ****** ************* .******** ** ** ******.* **. C1 TGGACGGCAGAAAGTTTCTGGTTTGCGCGGACTGCGAGCGAGGACCTGTG C2 TGGACGGCAGAAAGTTCCTGGTTTGCGCGGACTGCGAGCGAGGACCCGTG C3 TGGACGGCAGGAAGTTCCTGGTTTGTGCGGACTGCGAGCGAGGACCCGTG C4 TGGACGGCAGAAAGTTCCTGGTTTGTGCAGACTGCGAGCGAGGACCCGTG C5 TGGATGGCAGGAAGTTCCTGGTTTGTGCGGATTGCGAGCGAGGACCAGTG C6 TGGACGGCAGGAAGTTCCTGGTTTGTGCGGATTGCGAGCGAGGACCCGTT C7 TGGACGGCAGGAAGTTCCTGGTTTGTGCGGATTGCGAGCGAGGACCCGTT **** *****.***** ******** **.** ************** ** C1 GGCTACCATGATCTGAGCACCCGCCACTGCTATCTGGCCCTCAAGAGGGT C2 GGCTACCATGATCTGAGCACCCGACACTGCTACCTGGCCCTCAAGAGGGT C3 GGCTACCATGATCTGAGCACCCGCCACTGCTTCCTGGCCCTCAAGAGGGT C4 GGCTACCATGATCTGAGCACCCGCCACTGCTTCCTGGCCCTCCAAAGGGT C5 GGCTATCATGATCTGAGCACCCGCCACTGTTTCCTGGCCCTCAAAAGAGT C6 GGCTATCATGATCTGACCACCCGCCACTGCTTCCTGGCCCTCAAGAGGGT C7 GGCTATCATGATCTGACCACCCGCCACTGCTTCCTGGCCCTCAAGAGGGT ***** ********** ******.***** *: *********.*.**.** C1 GGTGCACAAGGACACC C2 GGTGCACAAGGACACC C3 GGTCCACAAGGACACC C4 GGTTCACAAGGACACC C5 GGTCCACAAGGACTCC C6 GGTCCACAAGGACTCC C7 GGTCCACAAGGACTCC *** *********:** >C1 ATGACAGAGGAAGCTGATTTTAGCGAGCAAATCACCGATGGGAAAAACAA ATCAAATGTGCGCTGCCAGTTTTGCAACTGTTTGATGCTGAAAGCACAAG AGGGCACCTACAACCAGGAGGAGGTGGATGTGCCACTGATGACGCAGAAG CAGGATCGAACGGCGGACAGCCTAAACAGCGAGCCACTGAAAGACTTCTG GCTGGTCAAGGACATGATGACATTCGAGAACATCGGGTTCTCCAACACGG TGGACGGCAGAAAGTTTCTGGTTTGCGCGGACTGCGAGCGAGGACCTGTG GGCTACCATGATCTGAGCACCCGCCACTGCTATCTGGCCCTCAAGAGGGT GGTGCACAAGGACACC >C2 ATGACAGAGGAAGCTGATTTTAGCGAGCAAATCACCGATGGGAAAAACAA ATCAAATGTGCGCTGCCAGTTTTGCAACAGCTTGATGCTGAAAGCCCAAG AGGGCACCTACAATCAGGAGGAGGTGGATGTGCCGCTGATGATGCAGAAG CAGGATCGATCGGCGGACAGCCTAAACAGCGAGCCACTGAAGGACTTCTG GCTGGTCAAGGACATGATGACGTTCGAGAACATCGGCTTCTCCAATACGG TGGACGGCAGAAAGTTCCTGGTTTGCGCGGACTGCGAGCGAGGACCCGTG GGCTACCATGATCTGAGCACCCGACACTGCTACCTGGCCCTCAAGAGGGT GGTGCACAAGGACACC >C3 ATGACCGAGGAAGCTGATTTCAGCGAGCAAATCGTTGATGGAAAAAACAA ATCAAATGTGCGCTGCCAGTTCTGCAACAGTTTGATGCTGAAAGCCCAAG AGGGCACCTACAACCAGGAGGAGGTGGATGTGCCACTGATGATGCAGAAG CAGGACCGAACAGCGGACAGCCTAAACAGCGAGCCACTGAAGGACTTCTG GCTGGTTAAGGACATGATGACGTTCGAGAACATCGGCTTCTCCAACACGC TGGACGGCAGGAAGTTCCTGGTTTGTGCGGACTGCGAGCGAGGACCCGTG GGCTACCATGATCTGAGCACCCGCCACTGCTTCCTGGCCCTCAAGAGGGT GGTCCACAAGGACACC >C4 ATGACAGAGGAAGCCGATTTTAGCGAGCAAATCACAGATGGAAAAAACAA ATCAAATGTGCGCTGCCAGTTCTGCAACAGTTTGATGCTGAAAGCCCAGG AGGGCGCCTACAACCAGGAGAAGGTGGATGTGCCACTGATGATGCAGAAA CAGGACCAAACGGCGGACAGCCTGAACAGCGAGCCACTGAAGGACTTCTG GCTGGTCAAGGACATGATGACGTTCGAGAACATCGGGTTCTCCAACACGG TGGACGGCAGAAAGTTCCTGGTTTGTGCAGACTGCGAGCGAGGACCCGTG GGCTACCATGATCTGAGCACCCGCCACTGCTTCCTGGCCCTCCAAAGGGT GGTTCACAAGGACACC >C5 ATGACGGAGGTTACTGATTTTAGTGAGCAAATATCCAATGGAAAGAACAT ATTAAATGTGCGCTGCCAGTTCTGCAATAGTTTGATGCTCAAGGCCCAAG AGGGAACCTACAGCCAGGAGGAAGTGGAAGTGCCCCTGATGATGCAAAAA CAGGACAGGACGGCGGACAGTCTGAACAGCGAGCCACTGAAGGACTTTTG GCTGGTCAAGGACATGATGATGTTCGAGAATATTGGATTCTCCAACACGG TGGATGGCAGGAAGTTCCTGGTTTGTGCGGATTGCGAGCGAGGACCAGTG GGCTATCATGATCTGAGCACCCGCCACTGTTTCCTGGCCCTCAAAAGAGT GGTCCACAAGGACTCC >C6 ATGACAGAAGAGGCTGATTTTAGTGACCAAATAGTTGATGGAAAGAACAA ATCAAATGTGCGCTGCCAGTTCTGCAATAGTTTGATGCTCAAGGCTCAGG AGGGCACCTTCAGCGCGGAGGAAGTGGAAGTGCCCCTGATGATGCAAAAA CAGGACAGAACGGCGGACAGTCTGAACAGCGAGCCATTGAAGGACTTCTG GCTGGTCAAGGACATGATGACGTTCGAGAATATCGGATTCTCCCACACAG TGGACGGCAGGAAGTTCCTGGTTTGTGCGGATTGCGAGCGAGGACCCGTT GGCTATCATGATCTGACCACCCGCCACTGCTTCCTGGCCCTCAAGAGGGT GGTCCACAAGGACTCC >C7 ATGACAGAAGAGGCTGATTTTAGTGACCAAATAGTTGATGGAAAGAACAA ATCAAATGTGCGCTGCCAGTTCTGCAATAGTTTGATGCTCAAGGCTCAGG AGGGCACCTTCAGCGCGGAGGAAGTGGAAGTGCCCCTGATGATGCAAAAA CAGGACAGAACGGCGGACAGTCTGAACAGCGAGCCATTGAAGGACTTCTG GCTGGTCAAGGACATGATGACGTTCGAGAATATCGGATTCTCCCACACAG TGGACGGCAGGAAGTTCCTGGTTTGTGCGGATTGCGAGCGAGGACCCGTT GGCTATCATGATCTGACCACCCGCCACTGCTTCCTGGCCCTCAAGAGGGT GGTCCACAAGGACTCC >C1 MTEEADFSEQITDGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCYLALKRVVHKDT >C2 MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK QDRSADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCYLALKRVVHKDT >C3 MTEEADFSEQIVDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTLDGRKFLVCADCERGPV GYHDLSTRHCFLALKRVVHKDT >C4 MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGAYNQEKVDVPLMMQK QDQTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCFLALQRVVHKDT >C5 MTEVTDFSEQISNGKNILNVRCQFCNSLMLKAQEGTYSQEEVEVPLMMQK QDRTADSLNSEPLKDFWLVKDMMMFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCFLALKRVVHKDS >C6 MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV GYHDLTTRHCFLALKRVVHKDS >C7 MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV GYHDLTTRHCFLALKRVVHKDS MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 7 taxa and 366 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1478775110 Setting output file names to "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 2099514477 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 4142185320 Seed = 1559530778 Swapseed = 1478775110 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 17 unique site patterns Division 2 has 14 unique site patterns Division 3 has 43 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1316.477238 -- -24.557203 Chain 2 -- -1358.999396 -- -24.557203 Chain 3 -- -1393.932731 -- -24.557203 Chain 4 -- -1350.636919 -- -24.557203 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1341.889675 -- -24.557203 Chain 2 -- -1289.728641 -- -24.557203 Chain 3 -- -1395.006030 -- -24.557203 Chain 4 -- -1400.197194 -- -24.557203 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1316.477] (-1358.999) (-1393.933) (-1350.637) * [-1341.890] (-1289.729) (-1395.006) (-1400.197) 500 -- (-1025.745) [-1026.530] (-1041.995) (-1031.986) * (-1023.180) (-1012.641) [-1030.839] (-1030.749) -- 0:00:00 1000 -- (-1014.265) [-1014.790] (-1020.709) (-1024.957) * (-1019.701) [-1009.815] (-1015.426) (-1016.929) -- 0:00:00 1500 -- [-1006.329] (-1005.621) (-1019.313) (-1019.434) * [-1018.069] (-1010.728) (-1012.621) (-1016.983) -- 0:00:00 2000 -- (-1013.390) (-1006.425) [-1015.741] (-1023.388) * (-1012.331) (-1002.383) (-1004.985) [-1006.445] -- 0:08:19 2500 -- (-1001.348) [-1004.873] (-1012.079) (-1001.750) * (-1006.227) (-1007.042) [-995.519] (-1002.191) -- 0:06:39 3000 -- (-1010.077) (-998.343) (-1010.424) [-998.800] * (-999.550) (-999.395) [-991.015] (-1006.613) -- 0:05:32 3500 -- (-994.891) (-998.322) (-1006.687) [-1007.862] * (-1001.419) (-1000.335) [-990.596] (-1004.093) -- 0:04:44 4000 -- (-1001.014) [-990.912] (-1005.838) (-996.697) * (-1008.175) (-1007.110) [-993.522] (-997.832) -- 0:04:09 4500 -- [-993.889] (-999.579) (-997.312) (-1005.633) * (-999.691) [-997.705] (-998.758) (-994.486) -- 0:03:41 5000 -- [-995.155] (-998.642) (-993.352) (-1006.012) * (-1009.841) (-1000.760) [-989.857] (-993.256) -- 0:03:19 Average standard deviation of split frequencies: 0.000000 5500 -- (-992.315) (-988.963) (-997.214) [-990.695] * (-1000.464) [-999.471] (-992.459) (-990.354) -- 0:03:00 6000 -- [-988.688] (-1002.402) (-999.048) (-995.408) * (-1005.431) (-1000.370) (-999.431) [-993.553] -- 0:02:45 6500 -- (-994.210) (-1000.312) [-999.207] (-993.819) * (-1000.122) (-996.861) [-992.603] (-992.113) -- 0:05:05 7000 -- [-992.889] (-999.065) (-1000.820) (-988.789) * [-1005.744] (-992.890) (-996.916) (-990.536) -- 0:04:43 7500 -- (-998.899) (-996.641) [-998.824] (-997.162) * (-998.819) (-1001.377) [-991.564] (-991.153) -- 0:04:24 8000 -- (-997.707) (-990.107) (-993.437) [-991.694] * (-997.299) (-997.728) [-989.906] (-998.434) -- 0:04:08 8500 -- (-992.207) [-993.769] (-993.243) (-993.614) * (-989.442) (-995.275) [-997.126] (-1003.717) -- 0:03:53 9000 -- (-992.073) (-994.724) [-994.689] (-991.652) * (-992.921) [-995.909] (-992.651) (-996.701) -- 0:03:40 9500 -- [-992.350] (-998.476) (-990.570) (-991.099) * (-996.595) [-997.630] (-994.213) (-997.238) -- 0:03:28 10000 -- [-995.667] (-1001.952) (-994.807) (-994.079) * [-992.784] (-995.513) (-1003.056) (-994.976) -- 0:03:18 Average standard deviation of split frequencies: 0.008839 10500 -- [-991.166] (-993.940) (-994.095) (-992.081) * (-992.788) [-998.443] (-996.987) (-998.321) -- 0:03:08 11000 -- (-990.093) (-994.265) [-997.031] (-995.972) * (-995.133) (-991.701) (-997.331) [-993.380] -- 0:04:29 11500 -- (-995.838) [-986.719] (-995.315) (-992.037) * (-991.219) (-995.566) [-994.505] (-992.580) -- 0:04:17 12000 -- (-998.801) (-990.984) (-992.248) [-996.187] * (-993.229) [-990.979] (-987.018) (-992.086) -- 0:04:07 12500 -- (-999.881) [-993.835] (-1001.058) (-994.250) * (-994.892) (-996.326) [-989.826] (-999.385) -- 0:03:57 13000 -- (-1001.642) (-996.354) [-993.230] (-994.016) * (-994.458) [-995.947] (-992.915) (-995.164) -- 0:03:47 13500 -- (-1001.462) (-993.479) [-994.295] (-994.212) * [-997.247] (-1002.667) (-992.966) (-1001.041) -- 0:03:39 14000 -- [-996.111] (-995.836) (-987.956) (-992.201) * (-992.140) (-994.194) [-992.490] (-999.666) -- 0:03:31 14500 -- (-1001.080) [-987.906] (-989.614) (-1003.104) * (-994.213) [-994.468] (-993.903) (-990.348) -- 0:03:23 15000 -- (-1002.004) (-994.024) [-994.909] (-1000.683) * (-995.908) [-996.913] (-997.004) (-1000.497) -- 0:03:17 Average standard deviation of split frequencies: 0.029463 15500 -- (-996.683) [-992.174] (-1002.494) (-998.666) * (-994.729) (-993.215) [-989.704] (-1001.050) -- 0:04:14 16000 -- (-990.015) (-999.150) [-990.086] (-996.480) * (-990.806) (-994.552) (-996.874) [-994.897] -- 0:04:06 16500 -- [-990.085] (-991.932) (-991.035) (-1005.005) * [-991.263] (-997.127) (-1003.349) (-990.371) -- 0:03:58 17000 -- [-991.240] (-996.564) (-996.262) (-1001.489) * (-990.868) (-997.517) [-995.775] (-993.573) -- 0:03:51 17500 -- (-988.477) [-990.749] (-996.058) (-992.998) * (-1000.016) (-994.754) [-991.358] (-988.349) -- 0:03:44 18000 -- [-992.912] (-989.537) (-990.381) (-1008.015) * [-990.157] (-1001.641) (-991.142) (-1005.389) -- 0:03:38 18500 -- (-992.114) [-990.141] (-990.972) (-1003.520) * [-988.464] (-994.192) (-989.699) (-999.215) -- 0:03:32 19000 -- (-999.820) (-989.167) (-989.929) [-1000.819] * (-992.166) (-999.791) [-1001.512] (-997.165) -- 0:03:26 19500 -- [-992.356] (-995.714) (-998.788) (-998.635) * (-994.605) (-997.074) (-992.685) [-997.319] -- 0:04:11 20000 -- (-989.921) [-993.369] (-999.898) (-997.896) * [-995.221] (-999.714) (-990.999) (-996.117) -- 0:04:05 Average standard deviation of split frequencies: 0.018248 20500 -- (-1006.733) (-991.793) [-992.806] (-1000.329) * (-996.753) [-995.791] (-1000.730) (-995.868) -- 0:03:58 21000 -- [-988.482] (-988.097) (-994.529) (-1001.591) * [-996.637] (-997.030) (-1002.393) (-996.435) -- 0:03:53 21500 -- (-991.308) [-993.356] (-989.919) (-990.045) * (-998.202) [-990.969] (-992.512) (-996.938) -- 0:03:47 22000 -- (-992.454) (-1003.663) [-991.199] (-988.471) * [-992.197] (-997.110) (-994.362) (-997.628) -- 0:03:42 22500 -- (-988.359) (-1000.855) (-992.273) [-995.374] * [-990.249] (-994.340) (-1011.188) (-998.655) -- 0:03:37 23000 -- (-996.987) (-993.766) [-994.329] (-1003.334) * (-1004.094) (-992.063) (-992.112) [-992.203] -- 0:03:32 23500 -- (-994.855) [-994.176] (-994.161) (-992.312) * (-997.638) [-993.563] (-988.895) (-997.273) -- 0:03:27 24000 -- (-996.014) [-991.353] (-994.017) (-993.468) * (-1000.805) [-995.098] (-995.955) (-992.781) -- 0:04:04 24500 -- (-997.339) (-1002.416) [-991.278] (-998.177) * (-996.644) (-987.893) [-991.817] (-996.367) -- 0:03:58 25000 -- (-997.663) (-993.134) [-996.885] (-998.084) * (-991.608) (-992.050) [-990.376] (-991.652) -- 0:03:54 Average standard deviation of split frequencies: 0.007252 25500 -- (-993.949) (-994.783) [-991.474] (-993.487) * [-994.017] (-999.792) (-998.587) (-998.678) -- 0:03:49 26000 -- (-1004.296) (-998.603) [-993.150] (-991.776) * (-992.905) [-992.674] (-1000.359) (-988.006) -- 0:03:44 26500 -- [-1001.136] (-996.158) (-993.013) (-995.374) * (-989.878) (-997.667) (-994.522) [-995.420] -- 0:03:40 27000 -- (-996.765) (-994.782) (-996.369) [-998.857] * (-992.252) [-994.254] (-991.402) (-997.176) -- 0:03:36 27500 -- (-997.875) (-998.030) (-995.632) [-993.822] * [-990.308] (-990.543) (-990.973) (-1000.937) -- 0:03:32 28000 -- (-1003.682) (-995.184) [-1001.384] (-990.995) * (-988.037) (-995.310) [-991.659] (-992.445) -- 0:03:28 28500 -- (-1000.349) (-993.063) (-996.077) [-992.194] * [-991.871] (-998.074) (-990.668) (-996.912) -- 0:03:58 29000 -- (-995.565) (-993.196) [-997.916] (-995.559) * (-991.886) (-993.828) (-993.024) [-994.930] -- 0:03:54 29500 -- (-995.193) [-988.883] (-991.094) (-994.426) * (-992.227) (-999.195) [-995.912] (-996.875) -- 0:03:50 30000 -- (-992.048) [-989.450] (-994.192) (-998.600) * (-996.956) (-1000.490) [-993.976] (-1005.651) -- 0:03:46 Average standard deviation of split frequencies: 0.020496 30500 -- (-991.986) [-991.306] (-1000.591) (-992.068) * (-993.758) (-995.373) (-1001.074) [-994.282] -- 0:03:42 31000 -- [-998.880] (-992.561) (-987.666) (-993.075) * (-1001.983) (-1003.717) [-992.727] (-1003.376) -- 0:03:38 31500 -- (-993.214) [-989.761] (-991.813) (-996.792) * (-996.629) (-990.425) (-995.860) [-995.190] -- 0:03:35 32000 -- (-1004.399) (-989.999) [-990.989] (-996.193) * [-992.578] (-991.695) (-996.382) (-994.580) -- 0:03:31 32500 -- (-991.969) (-995.355) (-997.095) [-996.090] * [-992.501] (-998.116) (-996.425) (-994.130) -- 0:03:28 33000 -- (-993.462) [-995.422] (-989.884) (-996.122) * (-991.384) (-993.240) [-993.712] (-992.692) -- 0:03:54 33500 -- (-994.134) (-1000.662) [-996.215] (-997.375) * [-991.003] (-994.042) (-991.462) (-988.010) -- 0:03:50 34000 -- [-991.008] (-998.481) (-990.793) (-998.310) * (-995.389) (-992.599) (-991.745) [-997.787] -- 0:03:47 34500 -- (-989.526) (-994.174) [-991.000] (-1000.311) * (-992.920) (-1001.177) [-987.236] (-1000.810) -- 0:03:43 35000 -- (-999.069) [-995.505] (-992.673) (-1002.589) * (-995.010) (-993.884) [-987.367] (-999.985) -- 0:03:40 Average standard deviation of split frequencies: 0.013095 35500 -- (-994.361) [-995.417] (-993.583) (-997.987) * (-996.737) (-998.126) [-991.212] (-994.026) -- 0:03:37 36000 -- (-998.929) (-995.586) [-995.181] (-996.699) * (-1002.734) (-991.730) [-988.764] (-998.206) -- 0:03:34 36500 -- (-996.499) [-993.798] (-992.681) (-991.538) * (-989.963) (-995.533) [-992.595] (-997.471) -- 0:03:31 37000 -- (-990.915) [-994.535] (-996.001) (-996.157) * (-989.084) (-994.686) (-994.909) [-994.326] -- 0:03:28 37500 -- (-998.374) [-989.925] (-989.820) (-992.613) * (-990.974) (-995.065) (-994.894) [-994.074] -- 0:03:51 38000 -- [-991.223] (-992.591) (-991.455) (-998.320) * (-994.213) [-997.565] (-997.374) (-1003.259) -- 0:03:47 38500 -- (-992.022) (-996.875) (-1002.317) [-990.407] * [-992.809] (-994.719) (-1008.829) (-1000.910) -- 0:03:44 39000 -- (-993.671) [-989.409] (-1000.540) (-995.802) * (-990.151) [-993.210] (-1011.615) (-997.629) -- 0:03:41 39500 -- (-992.497) [-992.320] (-1004.645) (-999.899) * (-993.746) (-992.210) (-1005.934) [-1001.302] -- 0:03:38 40000 -- [-992.499] (-997.839) (-1002.687) (-994.348) * (-995.698) (-986.560) [-996.383] (-999.447) -- 0:03:36 Average standard deviation of split frequencies: 0.015456 40500 -- (-993.156) [-998.188] (-998.440) (-993.937) * (-999.505) [-993.406] (-1002.411) (-996.163) -- 0:03:33 41000 -- (-989.298) (-999.149) (-984.929) [-990.709] * (-1015.083) [-993.647] (-989.520) (-993.417) -- 0:03:30 41500 -- (-988.171) [-990.415] (-994.850) (-998.119) * (-998.479) (-994.045) (-996.219) [-995.777] -- 0:03:27 42000 -- (-992.456) [-993.646] (-999.141) (-992.833) * (-997.621) (-997.618) (-992.503) [-989.407] -- 0:03:48 42500 -- [-990.281] (-996.948) (-996.482) (-992.980) * (-1003.502) (-995.180) [-992.961] (-1001.369) -- 0:03:45 43000 -- (-992.402) (-1004.894) [-994.855] (-990.587) * (-1008.349) (-996.341) (-1000.073) [-992.989] -- 0:03:42 43500 -- [-987.477] (-990.048) (-992.304) (-996.744) * (-993.633) (-992.666) [-991.130] (-990.010) -- 0:03:39 44000 -- [-986.977] (-999.095) (-990.964) (-990.651) * (-996.594) [-1000.553] (-1003.331) (-996.425) -- 0:03:37 44500 -- (-991.718) [-994.382] (-990.376) (-997.226) * (-993.434) (-995.799) [-993.838] (-993.387) -- 0:03:34 45000 -- [-989.508] (-994.307) (-987.870) (-992.195) * (-998.094) [-993.448] (-994.364) (-997.306) -- 0:03:32 Average standard deviation of split frequencies: 0.023912 45500 -- (-993.431) (-991.022) [-987.962] (-991.789) * (-991.400) [-993.704] (-994.547) (-996.695) -- 0:03:29 46000 -- (-995.803) (-998.039) [-989.242] (-999.438) * (-992.956) (-993.101) (-993.835) [-992.660] -- 0:03:27 46500 -- (-996.971) (-1001.079) [-989.899] (-997.890) * (-1000.214) (-1003.287) (-997.595) [-991.947] -- 0:03:45 47000 -- (-992.310) [-993.475] (-1003.270) (-992.308) * (-995.828) (-992.734) (-993.156) [-992.128] -- 0:03:43 47500 -- (-992.909) [-992.884] (-990.361) (-992.479) * (-995.660) (-989.890) [-988.736] (-990.756) -- 0:03:40 48000 -- (-995.460) (-999.293) (-993.764) [-997.186] * (-994.152) (-1001.235) (-995.444) [-988.730] -- 0:03:38 48500 -- [-989.461] (-1002.384) (-996.154) (-998.959) * (-994.666) (-997.355) (-996.064) [-994.388] -- 0:03:35 49000 -- [-994.384] (-1004.082) (-989.725) (-995.691) * (-994.881) [-993.232] (-998.954) (-993.801) -- 0:03:33 49500 -- (-997.377) (-991.124) [-993.280] (-995.699) * (-993.483) [-995.573] (-990.322) (-1002.053) -- 0:03:31 50000 -- [-989.275] (-993.697) (-995.372) (-990.052) * (-998.292) (-997.837) [-992.218] (-992.522) -- 0:03:29 Average standard deviation of split frequencies: 0.020469 50500 -- (-999.934) (-994.014) (-994.129) [-1002.982] * (-999.092) (-991.408) [-991.098] (-993.750) -- 0:03:26 51000 -- [-996.710] (-996.375) (-992.943) (-993.028) * (-996.079) [-991.029] (-991.588) (-994.801) -- 0:03:43 51500 -- (-987.593) (-999.334) [-1000.950] (-1000.103) * [-994.133] (-989.673) (-993.664) (-995.551) -- 0:03:41 52000 -- (-997.067) [-994.517] (-997.964) (-993.143) * (-996.397) (-989.797) (-993.006) [-1001.718] -- 0:03:38 52500 -- (-994.878) [-988.701] (-995.137) (-997.398) * (-999.538) [-996.103] (-996.323) (-998.294) -- 0:03:36 53000 -- (-994.617) (-991.074) [-989.536] (-995.875) * [-993.053] (-998.294) (-999.878) (-991.537) -- 0:03:34 53500 -- [-995.622] (-988.819) (-987.362) (-997.551) * (-998.056) (-999.551) (-998.891) [-990.407] -- 0:03:32 54000 -- (-993.150) [-987.632] (-993.048) (-997.261) * (-996.783) [-999.946] (-1002.117) (-998.969) -- 0:03:30 54500 -- (-990.054) [-998.642] (-993.295) (-989.117) * (-998.391) [-997.976] (-990.691) (-997.009) -- 0:03:28 55000 -- (-996.612) [-994.647] (-990.095) (-988.263) * (-994.727) [-988.059] (-1000.056) (-994.178) -- 0:03:43 Average standard deviation of split frequencies: 0.011785 55500 -- (-993.977) [-992.250] (-992.572) (-1001.074) * (-994.709) [-992.005] (-992.289) (-991.133) -- 0:03:41 56000 -- [-991.694] (-993.494) (-999.650) (-991.885) * (-995.819) (-996.906) (-990.672) [-989.735] -- 0:03:39 56500 -- (-991.040) [-992.557] (-993.577) (-992.990) * (-1002.033) (-1001.825) [-995.441] (-999.119) -- 0:03:37 57000 -- (-994.887) (-1002.358) (-989.450) [-994.547] * (-990.646) [-992.400] (-994.632) (-995.805) -- 0:03:35 57500 -- (-985.667) (-993.942) (-988.422) [-988.890] * [-989.222] (-994.226) (-998.460) (-997.147) -- 0:03:33 58000 -- (-996.484) (-996.169) [-990.318] (-994.653) * (-996.029) (-993.100) (-991.683) [-994.095] -- 0:03:31 58500 -- [-989.834] (-992.786) (-995.489) (-995.914) * (-995.259) (-995.721) (-991.486) [-990.772] -- 0:03:29 59000 -- [-994.033] (-992.344) (-994.117) (-994.531) * (-992.182) (-993.274) [-992.231] (-994.658) -- 0:03:27 59500 -- (-988.819) (-992.424) [-988.916] (-994.532) * (-993.760) [-993.174] (-1007.604) (-993.279) -- 0:03:41 60000 -- (-995.790) [-992.234] (-998.413) (-998.450) * (-993.520) [-986.003] (-992.573) (-998.532) -- 0:03:39 Average standard deviation of split frequencies: 0.020203 60500 -- (-1002.983) [-993.051] (-992.960) (-993.896) * [-988.841] (-991.088) (-993.754) (-994.047) -- 0:03:37 61000 -- [-986.549] (-989.906) (-994.831) (-996.283) * [-997.828] (-987.228) (-996.234) (-991.754) -- 0:03:35 61500 -- (-989.606) [-988.701] (-996.243) (-999.792) * (-991.596) (-997.692) [-991.595] (-997.916) -- 0:03:33 62000 -- (-997.274) [-991.401] (-990.082) (-990.488) * (-1000.687) (-996.876) (-991.252) [-989.541] -- 0:03:31 62500 -- (-991.421) [-996.271] (-990.840) (-991.893) * (-993.412) (-994.614) [-994.739] (-992.894) -- 0:03:30 63000 -- (-995.612) (-994.564) [-990.954] (-990.229) * (-1000.424) [-994.031] (-993.158) (-995.005) -- 0:03:28 63500 -- [-989.883] (-994.737) (-994.488) (-998.412) * (-997.442) (-997.617) (-990.493) [-993.235] -- 0:03:26 64000 -- (-991.776) (-998.009) (-995.103) [-987.357] * [-994.161] (-995.930) (-998.152) (-992.981) -- 0:03:39 64500 -- [-986.467] (-1002.793) (-995.614) (-995.470) * (-989.413) [-988.460] (-993.571) (-990.211) -- 0:03:37 65000 -- (-995.675) (-993.267) [-992.037] (-994.575) * (-1002.203) (-998.352) [-995.863] (-998.077) -- 0:03:35 Average standard deviation of split frequencies: 0.015713 65500 -- (-991.054) [-986.629] (-999.002) (-987.126) * (-996.006) (-992.473) (-991.450) [-990.016] -- 0:03:34 66000 -- (-992.413) [-991.020] (-992.976) (-991.885) * (-995.764) (-1003.351) [-995.918] (-999.098) -- 0:03:32 66500 -- (-990.490) (-993.684) [-999.619] (-994.247) * (-992.178) (-1000.976) [-992.375] (-993.135) -- 0:03:30 67000 -- [-991.520] (-1003.090) (-1004.950) (-996.841) * (-999.283) (-994.832) (-997.554) [-991.095] -- 0:03:28 67500 -- (-1000.832) (-995.620) [-994.667] (-1003.060) * (-991.472) (-1009.995) (-1004.062) [-991.883] -- 0:03:27 68000 -- (-996.284) [-995.048] (-990.724) (-994.174) * (-989.265) (-1005.128) [-994.279] (-992.345) -- 0:03:25 68500 -- (-989.328) (-995.880) [-994.131] (-993.431) * [-992.311] (-992.835) (-1003.485) (-1006.249) -- 0:03:37 69000 -- (-992.826) (-997.045) (-994.522) [-992.220] * (-1005.058) (-996.661) (-998.263) [-999.427] -- 0:03:35 69500 -- (-993.627) (-999.767) (-992.523) [-990.678] * (-993.876) [-995.977] (-989.921) (-997.179) -- 0:03:34 70000 -- [-991.974] (-996.595) (-991.517) (-1006.874) * (-994.325) [-991.298] (-1004.211) (-992.524) -- 0:03:32 Average standard deviation of split frequencies: 0.014676 70500 -- [-993.219] (-993.520) (-992.936) (-997.172) * (-993.906) [-993.319] (-999.952) (-995.559) -- 0:03:30 71000 -- (-1002.087) (-990.459) [-996.352] (-994.672) * (-996.176) (-987.222) [-989.161] (-1005.120) -- 0:03:29 71500 -- [-992.876] (-988.098) (-999.040) (-1005.504) * (-994.264) (-991.419) [-989.726] (-994.688) -- 0:03:27 72000 -- [-993.081] (-997.259) (-992.471) (-998.687) * (-993.957) [-991.012] (-1001.183) (-991.430) -- 0:03:26 72500 -- (-1002.446) (-991.063) [-995.617] (-998.983) * (-993.533) [-991.744] (-995.250) (-994.472) -- 0:03:24 73000 -- (-999.431) [-994.484] (-1000.691) (-1005.976) * (-993.480) [-999.382] (-999.482) (-996.921) -- 0:03:35 73500 -- (-995.035) (-996.250) (-994.204) [-994.237] * (-995.741) [-993.327] (-991.069) (-1002.026) -- 0:03:34 74000 -- (-1002.052) (-996.473) [-996.415] (-991.993) * (-996.532) (-990.482) [-990.796] (-1002.229) -- 0:03:32 74500 -- (-995.743) [-991.727] (-992.495) (-999.355) * (-992.986) (-995.611) [-990.738] (-993.908) -- 0:03:31 75000 -- (-1002.028) (-995.848) [-988.303] (-1001.956) * (-996.005) [-989.549] (-992.441) (-1001.161) -- 0:03:29 Average standard deviation of split frequencies: 0.019849 75500 -- (-994.841) [-994.747] (-998.102) (-998.644) * [-1000.388] (-994.649) (-991.909) (-999.013) -- 0:03:28 76000 -- (-990.530) (-1001.287) (-990.159) [-995.942] * [-995.635] (-991.841) (-994.990) (-1001.775) -- 0:03:26 76500 -- (-991.278) (-1003.022) [-995.719] (-992.289) * (-993.049) (-994.366) (-997.287) [-993.792] -- 0:03:25 77000 -- (-995.508) (-994.369) [-989.361] (-994.234) * (-994.832) (-991.813) (-995.973) [-994.912] -- 0:03:35 77500 -- (-994.641) (-1003.734) (-994.348) [-992.672] * (-999.876) [-989.762] (-996.936) (-990.027) -- 0:03:34 78000 -- (-990.982) (-988.485) [-994.160] (-995.946) * (-1005.325) (-991.268) (-996.405) [-991.916] -- 0:03:32 78500 -- (-994.018) [-992.057] (-990.189) (-999.616) * (-998.302) (-996.328) [-990.385] (-995.378) -- 0:03:31 79000 -- (-995.051) (-993.934) [-995.673] (-991.838) * (-995.794) (-993.710) (-997.316) [-994.249] -- 0:03:29 79500 -- (-997.908) (-993.194) [-996.639] (-1005.676) * (-995.925) [-990.667] (-994.411) (-993.565) -- 0:03:28 80000 -- (-1002.102) [-993.796] (-995.447) (-1007.538) * (-1000.953) [-992.853] (-996.938) (-993.791) -- 0:03:27 Average standard deviation of split frequencies: 0.008181 80500 -- (-1002.824) [-995.561] (-1003.508) (-988.792) * (-997.579) (-1002.046) [-994.922] (-994.155) -- 0:03:25 81000 -- [-997.038] (-995.336) (-995.203) (-997.958) * (-999.228) (-999.329) (-990.944) [-990.275] -- 0:03:24 81500 -- (-992.089) (-998.333) (-993.288) [-993.496] * [-997.843] (-1004.358) (-993.554) (-988.551) -- 0:03:34 82000 -- (-992.443) (-995.206) (-992.535) [-996.081] * (-1000.654) (-992.767) [-993.079] (-992.708) -- 0:03:32 82500 -- [-997.017] (-992.552) (-997.738) (-998.782) * (-1005.267) (-998.878) [-991.233] (-993.520) -- 0:03:31 83000 -- (-997.319) (-991.303) (-1004.004) [-996.957] * (-1004.873) (-1000.712) [-992.924] (-993.760) -- 0:03:29 83500 -- (-997.270) (-991.965) (-997.308) [-989.957] * (-997.490) (-1001.145) (-997.134) [-998.258] -- 0:03:28 84000 -- (-995.918) (-993.310) (-1001.554) [-991.181] * (-996.152) (-998.493) [-990.808] (-994.584) -- 0:03:27 84500 -- (-996.379) (-996.945) (-992.982) [-990.002] * (-993.436) (-989.777) (-993.478) [-994.149] -- 0:03:25 85000 -- (-988.162) (-997.711) [-991.280] (-1002.518) * (-1003.576) (-995.482) (-991.286) [-991.859] -- 0:03:24 Average standard deviation of split frequencies: 0.008770 85500 -- [-993.334] (-996.448) (-997.214) (-992.752) * (-999.057) [-989.833] (-993.960) (-998.597) -- 0:03:23 86000 -- [-996.022] (-1002.281) (-992.079) (-991.401) * [-1003.146] (-995.233) (-991.580) (-998.204) -- 0:03:32 86500 -- [-990.155] (-995.689) (-994.149) (-991.237) * (-1010.394) (-996.788) [-998.057] (-993.859) -- 0:03:31 87000 -- (-992.142) (-994.473) (-998.552) [-997.203] * (-998.861) (-993.705) [-995.956] (-994.446) -- 0:03:29 87500 -- [-989.712] (-1000.618) (-995.677) (-993.909) * (-1002.813) (-998.345) (-996.947) [-1004.612] -- 0:03:28 88000 -- (-989.987) (-991.748) [-996.898] (-991.526) * (-995.382) [-991.360] (-995.011) (-1001.700) -- 0:03:27 88500 -- [-994.442] (-994.045) (-997.533) (-993.622) * (-1003.578) (-997.612) [-989.573] (-997.295) -- 0:03:25 89000 -- [-989.779] (-992.191) (-999.655) (-991.462) * (-1003.290) (-1000.541) [-993.417] (-989.654) -- 0:03:24 89500 -- (-996.526) (-996.747) (-994.807) [-989.246] * (-996.473) (-991.078) (-994.112) [-989.375] -- 0:03:23 90000 -- [-999.060] (-995.508) (-994.614) (-991.323) * (-996.460) (-999.945) [-988.126] (-987.315) -- 0:03:22 Average standard deviation of split frequencies: 0.009359 90500 -- (-993.622) [-999.001] (-993.497) (-1000.222) * (-999.848) (-1000.689) (-999.225) [-998.138] -- 0:03:20 91000 -- [-998.869] (-996.383) (-994.065) (-996.170) * (-992.902) [-991.838] (-997.490) (-995.993) -- 0:03:29 91500 -- (-997.478) (-988.528) [-988.134] (-992.255) * (-1001.628) (-997.335) [-991.088] (-992.689) -- 0:03:28 92000 -- (-996.157) (-990.932) [-990.495] (-1000.997) * [-994.889] (-996.144) (-992.369) (-994.888) -- 0:03:27 92500 -- (-995.164) (-995.451) (-992.714) [-991.980] * (-994.672) (-1000.364) (-991.382) [-992.552] -- 0:03:26 93000 -- (-993.417) [-986.914] (-1004.980) (-990.546) * (-989.239) [-995.812] (-996.485) (-998.403) -- 0:03:24 93500 -- (-996.093) (-990.647) (-996.355) [-991.371] * (-991.551) (-998.583) (-995.866) [-994.820] -- 0:03:23 94000 -- (-993.746) (-992.715) [-1001.528] (-991.217) * (-993.473) (-996.998) [-995.814] (-995.991) -- 0:03:22 94500 -- (-1002.308) (-990.841) [-1002.233] (-990.483) * [-996.142] (-1001.587) (-993.313) (-993.480) -- 0:03:21 95000 -- (-990.908) (-999.071) (-994.037) [-990.292] * (-994.774) (-995.791) [-991.232] (-994.081) -- 0:03:29 Average standard deviation of split frequencies: 0.009821 95500 -- (-990.424) (-996.248) (-994.798) [-992.147] * [-992.287] (-996.395) (-997.148) (-993.406) -- 0:03:28 96000 -- (-992.206) (-995.191) (-1002.747) [-987.533] * (-993.800) (-990.119) [-993.679] (-999.904) -- 0:03:27 96500 -- [-991.344] (-991.802) (-989.957) (-990.038) * (-995.971) (-996.193) [-990.342] (-1000.895) -- 0:03:25 97000 -- (-991.774) [-993.444] (-995.848) (-988.742) * (-995.616) [-993.900] (-998.532) (-1000.572) -- 0:03:24 97500 -- (-994.707) (-991.345) (-993.165) [-990.695] * (-996.406) (-988.937) [-992.820] (-989.264) -- 0:03:23 98000 -- (-1002.075) (-992.383) [-990.179] (-995.896) * (-998.416) (-1002.127) [-988.789] (-992.433) -- 0:03:22 98500 -- [-992.674] (-991.224) (-1000.126) (-998.027) * (-991.486) (-991.658) [-993.709] (-1001.813) -- 0:03:21 99000 -- [-993.545] (-994.071) (-998.333) (-1000.366) * (-995.387) (-995.490) (-1004.812) [-997.911] -- 0:03:20 99500 -- [-990.316] (-994.947) (-999.874) (-1005.426) * (-993.328) [-996.061] (-991.511) (-996.499) -- 0:03:28 100000 -- [-992.587] (-997.272) (-987.156) (-1005.004) * (-1001.139) (-994.324) [-992.340] (-1003.912) -- 0:03:27 Average standard deviation of split frequencies: 0.014985 100500 -- (-993.488) (-1000.191) [-991.081] (-1000.506) * (-992.791) (-995.306) [-997.784] (-998.482) -- 0:03:25 101000 -- (-992.517) (-989.528) (-999.850) [-990.601] * (-989.820) (-997.332) [-994.563] (-996.001) -- 0:03:24 101500 -- (-997.421) [-994.025] (-990.061) (-991.289) * (-996.979) (-995.096) (-1000.969) [-992.456] -- 0:03:23 102000 -- [-990.443] (-996.154) (-995.224) (-998.884) * (-997.274) (-993.513) [-994.381] (-998.557) -- 0:03:22 102500 -- [-987.875] (-1004.677) (-992.655) (-1003.285) * [-996.844] (-992.717) (-999.443) (-997.770) -- 0:03:21 103000 -- [-996.066] (-992.423) (-999.283) (-998.950) * [-995.946] (-989.810) (-991.502) (-994.039) -- 0:03:20 103500 -- (-996.213) (-992.770) [-996.348] (-992.150) * [-990.472] (-994.101) (-996.412) (-998.099) -- 0:03:19 104000 -- [-988.631] (-991.472) (-995.968) (-998.054) * (-991.345) [-996.330] (-990.059) (-991.508) -- 0:03:26 104500 -- (-992.211) (-994.951) (-996.238) [-991.006] * [-995.275] (-998.603) (-990.015) (-993.282) -- 0:03:25 105000 -- (-999.397) (-996.938) (-997.089) [-987.634] * [-993.155] (-996.320) (-991.054) (-994.288) -- 0:03:24 Average standard deviation of split frequencies: 0.014231 105500 -- (-993.074) (-998.172) (-994.487) [-992.106] * (-994.732) [-995.551] (-996.114) (-996.027) -- 0:03:23 106000 -- (-990.121) (-1000.763) (-998.052) [-986.808] * [-988.698] (-991.547) (-996.165) (-996.583) -- 0:03:22 106500 -- (-991.111) (-998.276) (-992.692) [-990.500] * (-991.276) (-996.842) [-995.051] (-1006.295) -- 0:03:21 107000 -- (-999.943) (-1001.655) (-998.478) [-993.723] * (-992.062) (-996.031) [-1001.721] (-1001.981) -- 0:03:20 107500 -- (-992.486) (-995.594) (-997.432) [-990.000] * (-992.567) (-995.414) (-995.310) [-1002.263] -- 0:03:19 108000 -- [-992.932] (-997.323) (-992.518) (-990.488) * (-997.681) (-991.305) [-996.288] (-990.622) -- 0:03:26 108500 -- (-990.093) [-992.202] (-988.554) (-993.423) * (-995.789) [-993.271] (-992.202) (-995.904) -- 0:03:25 109000 -- (-992.806) [-994.510] (-994.878) (-987.550) * (-992.365) (-995.450) [-989.613] (-992.952) -- 0:03:24 109500 -- [-989.063] (-989.674) (-992.103) (-997.748) * (-989.305) (-1000.969) [-995.825] (-992.064) -- 0:03:23 110000 -- (-990.977) (-993.427) [-995.315] (-992.676) * (-998.634) [-991.385] (-989.990) (-993.644) -- 0:03:22 Average standard deviation of split frequencies: 0.014483 110500 -- [-992.803] (-1002.439) (-991.106) (-995.270) * (-990.999) [-988.922] (-992.351) (-994.540) -- 0:03:21 111000 -- (-988.668) (-994.540) (-996.073) [-992.829] * [-993.444] (-992.235) (-996.048) (-993.772) -- 0:03:20 111500 -- (-994.877) (-997.787) [-995.216] (-997.460) * (-990.235) [-998.620] (-989.091) (-992.963) -- 0:03:19 112000 -- (-992.394) (-990.512) (-1000.022) [-994.126] * [-988.887] (-991.169) (-989.842) (-999.561) -- 0:03:18 112500 -- (-994.344) (-997.252) [-998.042] (-989.815) * (-992.036) [-993.471] (-993.052) (-997.022) -- 0:03:25 113000 -- (-994.651) [-993.768] (-995.919) (-998.146) * [-988.152] (-991.488) (-991.976) (-996.791) -- 0:03:24 113500 -- (-995.722) (-996.828) (-992.854) [-999.310] * (-991.278) (-991.741) (-1000.406) [-992.546] -- 0:03:23 114000 -- (-993.010) (-995.397) [-997.159] (-996.172) * [-989.619] (-996.292) (-996.471) (-990.532) -- 0:03:22 114500 -- (-998.181) (-997.412) (-995.238) [-995.028] * [-988.402] (-996.248) (-996.033) (-998.830) -- 0:03:21 115000 -- (-996.080) (-998.639) [-991.298] (-995.414) * [-997.099] (-993.148) (-997.532) (-997.625) -- 0:03:20 Average standard deviation of split frequencies: 0.021132 115500 -- (-993.995) (-995.561) [-990.470] (-993.875) * (-995.679) [-994.068] (-995.109) (-993.135) -- 0:03:19 116000 -- (-995.215) [-992.645] (-994.318) (-996.342) * (-994.148) (-991.128) (-993.851) [-1000.239] -- 0:03:18 116500 -- (-995.701) (-992.839) [-989.879] (-994.073) * (-1000.855) (-997.307) (-990.403) [-1000.725] -- 0:03:17 117000 -- (-994.065) [-993.861] (-994.347) (-995.251) * [-990.291] (-994.003) (-992.338) (-991.129) -- 0:03:23 117500 -- (-993.044) (-992.352) [-992.900] (-996.203) * (-996.215) (-997.612) [-987.368] (-991.365) -- 0:03:22 118000 -- (-1002.946) (-998.556) (-993.486) [-994.093] * [-995.826] (-1001.562) (-996.422) (-992.654) -- 0:03:21 118500 -- (-1000.047) (-998.605) (-993.828) [-1001.545] * (-996.799) [-992.462] (-988.038) (-995.289) -- 0:03:20 119000 -- [-993.242] (-994.386) (-990.405) (-998.724) * (-997.320) [-998.182] (-994.708) (-988.757) -- 0:03:19 119500 -- (-990.958) (-989.669) (-1001.314) [-993.448] * (-987.847) (-997.758) [-991.027] (-999.425) -- 0:03:18 120000 -- (-997.461) (-998.340) (-998.580) [-992.423] * (-989.910) (-997.099) (-992.071) [-990.320] -- 0:03:18 Average standard deviation of split frequencies: 0.017971 120500 -- (-997.493) (-994.995) [-990.023] (-995.575) * (-992.717) (-998.158) (-986.718) [-991.860] -- 0:03:17 121000 -- (-995.179) [-989.694] (-994.889) (-996.160) * (-999.762) (-996.369) [-994.320] (-995.453) -- 0:03:16 121500 -- (-995.427) (-992.722) [-990.574] (-992.515) * (-1000.754) [-996.656] (-990.581) (-991.957) -- 0:03:22 122000 -- [-991.473] (-998.781) (-1001.091) (-993.699) * (-992.530) (-998.068) [-988.684] (-994.624) -- 0:03:21 122500 -- [-986.553] (-992.378) (-989.727) (-994.322) * (-1001.953) (-992.798) (-988.442) [-990.260] -- 0:03:20 123000 -- (-988.293) (-991.898) (-1001.233) [-994.033] * (-1002.112) [-988.070] (-996.054) (-994.237) -- 0:03:19 123500 -- (-991.045) (-991.404) (-993.924) [-992.091] * (-993.002) (-993.475) (-990.590) [-986.815] -- 0:03:18 124000 -- (-988.104) (-998.158) (-1000.515) [-991.338] * (-1001.813) (-992.839) [-987.235] (-990.514) -- 0:03:17 124500 -- (-990.378) (-994.226) (-1007.950) [-993.192] * (-996.001) [-994.902] (-998.319) (-993.106) -- 0:03:16 125000 -- [-992.584] (-993.719) (-999.869) (-997.999) * [-994.845] (-991.548) (-993.216) (-998.033) -- 0:03:16 Average standard deviation of split frequencies: 0.014965 125500 -- (-996.930) (-997.643) (-996.882) [-995.070] * (-996.532) [-990.377] (-991.454) (-997.333) -- 0:03:15 126000 -- (-995.419) (-997.610) (-999.642) [-989.360] * (-1003.115) (-996.716) [-992.884] (-994.557) -- 0:03:21 126500 -- (-994.799) [-993.278] (-997.276) (-994.419) * (-992.884) (-999.483) (-998.254) [-991.032] -- 0:03:20 127000 -- (-992.741) [-992.929] (-997.886) (-999.209) * (-997.063) (-992.648) [-992.874] (-997.617) -- 0:03:19 127500 -- (-993.475) (-999.981) [-993.635] (-991.720) * (-998.656) [-995.465] (-994.956) (-999.644) -- 0:03:18 128000 -- (-999.293) [-990.342] (-994.587) (-993.617) * [-1001.393] (-991.299) (-988.518) (-996.762) -- 0:03:17 128500 -- (-995.153) (-994.528) [-995.347] (-990.322) * [-991.733] (-992.667) (-992.378) (-989.849) -- 0:03:16 129000 -- [-992.120] (-998.837) (-993.803) (-992.995) * [-987.219] (-1005.923) (-988.634) (-1000.461) -- 0:03:15 129500 -- (-989.172) (-1000.066) (-1007.263) [-996.650] * (-992.261) (-993.364) [-991.877] (-996.191) -- 0:03:14 130000 -- (-994.088) (-996.878) [-993.488] (-991.068) * (-990.733) (-997.178) (-999.812) [-994.243] -- 0:03:20 Average standard deviation of split frequencies: 0.013709 130500 -- [-1001.534] (-997.545) (-996.033) (-993.579) * (-990.596) (-992.862) [-988.371] (-994.215) -- 0:03:19 131000 -- (-998.802) (-995.344) [-992.159] (-993.103) * (-991.313) [-996.033] (-998.896) (-996.324) -- 0:03:19 131500 -- (-1001.832) (-995.618) (-996.112) [-990.033] * (-993.474) (-1000.922) [-992.175] (-998.705) -- 0:03:18 132000 -- (-997.931) [-989.127] (-1002.625) (-991.869) * (-1000.514) [-998.589] (-990.181) (-998.921) -- 0:03:17 132500 -- [-997.863] (-992.131) (-998.037) (-995.255) * (-997.122) (-992.509) [-989.321] (-997.251) -- 0:03:16 133000 -- [-993.844] (-996.389) (-994.632) (-997.120) * [-1000.287] (-996.611) (-992.400) (-986.680) -- 0:03:15 133500 -- (-993.500) (-996.875) (-993.383) [-990.264] * (-1000.805) [-990.465] (-1000.138) (-991.489) -- 0:03:14 134000 -- [-994.512] (-993.321) (-997.572) (-994.483) * (-990.610) [-986.391] (-986.174) (-989.906) -- 0:03:13 134500 -- [-993.102] (-996.809) (-996.082) (-993.251) * (-995.236) [-994.471] (-989.754) (-991.678) -- 0:03:19 135000 -- (-998.987) [-993.426] (-993.396) (-992.370) * (-996.084) (-1007.285) [-990.204] (-996.272) -- 0:03:18 Average standard deviation of split frequencies: 0.012478 135500 -- (-991.451) (-996.593) (-993.482) [-992.307] * (-993.645) (-995.933) (-999.635) [-990.270] -- 0:03:17 136000 -- (-1003.566) [-990.124] (-998.208) (-995.691) * (-992.562) (-992.101) (-998.738) [-993.009] -- 0:03:16 136500 -- (-993.272) [-992.132] (-1001.236) (-990.502) * [-994.231] (-994.790) (-996.032) (-988.684) -- 0:03:16 137000 -- (-1000.103) (-996.553) (-997.972) [-994.991] * (-991.348) (-995.596) (-996.088) [-989.515] -- 0:03:15 137500 -- (-990.735) (-1002.388) [-995.856] (-993.798) * [-995.094] (-993.358) (-998.304) (-992.734) -- 0:03:14 138000 -- [-990.129] (-1003.165) (-995.560) (-996.541) * (-994.122) [-991.098] (-1001.937) (-994.994) -- 0:03:13 138500 -- (-994.659) (-999.328) (-991.343) [-995.512] * (-995.645) (-989.048) (-996.903) [-991.390] -- 0:03:12 139000 -- [-1002.233] (-1000.490) (-994.650) (-990.774) * (-992.562) [-991.603] (-991.202) (-993.396) -- 0:03:18 139500 -- (-990.497) [-995.472] (-998.826) (-989.710) * [-995.289] (-991.746) (-994.777) (-997.986) -- 0:03:17 140000 -- [-991.732] (-989.074) (-994.466) (-1004.631) * (-999.729) [-989.412] (-989.024) (-993.640) -- 0:03:16 Average standard deviation of split frequencies: 0.012064 140500 -- (-996.367) [-992.783] (-994.563) (-990.906) * (-993.287) [-991.399] (-992.203) (-988.832) -- 0:03:15 141000 -- (-993.755) [-996.373] (-1001.436) (-993.937) * (-994.134) (-992.222) [-993.233] (-991.978) -- 0:03:14 141500 -- (-991.129) (-994.503) [-990.682] (-1004.554) * [-994.600] (-999.786) (-1003.878) (-993.798) -- 0:03:14 142000 -- (-996.991) [-989.301] (-992.196) (-992.917) * [-993.624] (-995.259) (-1005.883) (-1007.972) -- 0:03:13 142500 -- (-991.365) (-1002.611) [-989.105] (-994.473) * (-988.191) [-988.471] (-991.767) (-1002.695) -- 0:03:12 143000 -- [-992.958] (-995.737) (-991.008) (-996.237) * (-1005.797) (-1005.697) (-997.199) [-995.475] -- 0:03:11 143500 -- [-994.756] (-994.880) (-989.426) (-989.926) * (-993.319) (-1000.506) [-990.431] (-998.530) -- 0:03:16 144000 -- (-999.071) (-998.685) (-993.025) [-994.066] * (-988.782) (-996.822) (-995.041) [-990.600] -- 0:03:16 144500 -- (-993.638) [-988.194] (-995.805) (-994.234) * (-993.004) (-994.555) [-988.353] (-989.855) -- 0:03:15 145000 -- (-991.735) (-993.781) [-992.178] (-989.772) * (-999.225) (-997.758) (-990.684) [-995.231] -- 0:03:14 Average standard deviation of split frequencies: 0.013561 145500 -- (-994.240) (-987.579) (-999.584) [-989.914] * (-995.529) (-1002.774) [-990.127] (-992.218) -- 0:03:13 146000 -- [-992.993] (-995.445) (-990.673) (-990.950) * (-1006.091) (-1002.537) (-994.026) [-988.923] -- 0:03:13 146500 -- (-992.147) (-1002.639) (-1000.417) [-987.556] * [-1003.417] (-1000.436) (-1001.296) (-1000.593) -- 0:03:12 147000 -- (-997.012) (-991.010) (-996.566) [-989.097] * (-996.748) (-1001.433) [-992.755] (-998.512) -- 0:03:11 147500 -- (-996.745) (-990.310) [-996.970] (-993.509) * (-997.702) [-997.439] (-995.743) (-999.017) -- 0:03:16 148000 -- [-993.757] (-988.001) (-997.164) (-990.780) * (-1000.951) [-996.053] (-997.157) (-998.543) -- 0:03:15 148500 -- (-992.445) (-993.708) (-989.638) [-997.193] * (-999.196) [-993.025] (-993.545) (-995.304) -- 0:03:14 149000 -- (-994.093) [-990.134] (-992.079) (-997.445) * [-995.732] (-995.664) (-994.469) (-993.006) -- 0:03:14 149500 -- (-990.573) (-988.651) [-990.986] (-1001.307) * (-994.655) (-995.155) [-990.816] (-1001.166) -- 0:03:13 150000 -- [-991.033] (-991.847) (-996.563) (-998.772) * (-990.779) (-990.683) (-996.648) [-991.678] -- 0:03:12 Average standard deviation of split frequencies: 0.014392 150500 -- (-996.053) [-991.236] (-993.622) (-989.944) * (-993.396) (-996.256) [-993.166] (-996.620) -- 0:03:11 151000 -- (-999.767) (-990.775) [-992.797] (-993.715) * (-989.802) [-994.077] (-990.369) (-999.184) -- 0:03:11 151500 -- (-992.692) (-991.764) (-995.466) [-996.519] * [-992.618] (-993.511) (-995.480) (-997.933) -- 0:03:10 152000 -- [-993.249] (-995.800) (-999.313) (-990.397) * (-993.926) [-999.357] (-992.971) (-997.100) -- 0:03:15 152500 -- (-994.927) [-990.412] (-993.171) (-991.554) * (-989.569) (-989.829) [-992.466] (-997.355) -- 0:03:14 153000 -- (-990.129) [-989.048] (-993.292) (-999.053) * (-997.114) [-988.875] (-997.565) (-1009.838) -- 0:03:13 153500 -- (-994.330) [-998.133] (-991.483) (-995.819) * (-994.881) (-986.159) [-992.920] (-995.090) -- 0:03:13 154000 -- (-990.081) [-991.518] (-1000.437) (-998.047) * (-991.678) (-997.068) (-992.031) [-988.972] -- 0:03:12 154500 -- (-995.174) (-992.839) [-994.701] (-995.850) * (-991.376) [-986.100] (-999.927) (-1000.855) -- 0:03:11 155000 -- (-996.726) (-995.799) [-991.033] (-998.557) * (-993.551) [-991.962] (-989.240) (-997.736) -- 0:03:10 Average standard deviation of split frequencies: 0.012087 155500 -- (-996.571) (-993.007) [-994.562] (-994.936) * (-993.650) [-990.224] (-990.958) (-992.710) -- 0:03:10 156000 -- (-999.257) [-997.972] (-993.905) (-1005.237) * (-997.258) (-999.584) [-990.505] (-991.319) -- 0:03:09 156500 -- [-1001.231] (-991.968) (-998.495) (-993.825) * (-994.717) (-996.770) [-990.391] (-988.799) -- 0:03:14 157000 -- (-988.023) [-993.150] (-991.908) (-996.147) * (-991.814) (-992.301) [-993.085] (-997.001) -- 0:03:13 157500 -- (-992.341) (-1001.397) (-1002.731) [-993.558] * (-997.891) (-997.474) (-991.672) [-998.736] -- 0:03:12 158000 -- (-998.654) (-991.713) (-997.050) [-1000.341] * [-990.802] (-998.792) (-993.704) (-989.030) -- 0:03:11 158500 -- (-992.460) (-993.445) [-993.726] (-990.780) * (-998.638) (-999.299) [-992.235] (-993.286) -- 0:03:11 159000 -- (-995.941) (-1001.696) [-995.198] (-992.281) * [-996.719] (-994.384) (-990.012) (-997.720) -- 0:03:10 159500 -- [-996.177] (-1001.515) (-998.520) (-998.140) * (-999.180) (-992.519) (-991.471) [-994.377] -- 0:03:09 160000 -- [-994.570] (-1000.070) (-997.727) (-995.824) * (-1001.443) [-988.548] (-1004.472) (-989.842) -- 0:03:09 Average standard deviation of split frequencies: 0.011149 160500 -- (-996.472) [-994.602] (-988.451) (-995.673) * (-992.980) (-997.049) [-987.611] (-1002.131) -- 0:03:08 161000 -- [-993.295] (-998.151) (-994.640) (-988.358) * (-1000.016) [-1000.819] (-994.007) (-992.189) -- 0:03:12 161500 -- [-991.712] (-997.493) (-994.424) (-992.379) * [-994.792] (-993.078) (-991.992) (-991.868) -- 0:03:12 162000 -- [-991.392] (-995.180) (-996.220) (-990.191) * (-992.514) (-1004.342) (-996.453) [-1001.817] -- 0:03:11 162500 -- (-994.995) [-997.324] (-992.741) (-991.534) * [-993.803] (-993.220) (-989.538) (-996.704) -- 0:03:10 163000 -- (-991.752) (-993.046) (-990.992) [-994.566] * (-997.616) [-994.814] (-989.922) (-992.121) -- 0:03:09 163500 -- (-1004.466) (-995.016) (-999.404) [-990.064] * [-994.350] (-996.761) (-995.974) (-990.755) -- 0:03:09 164000 -- (-994.238) [-995.341] (-988.811) (-990.851) * (-992.516) [-987.450] (-996.654) (-1011.131) -- 0:03:08 164500 -- (-1005.244) (-1000.294) [-994.406] (-1001.653) * (-1001.349) [-992.209] (-998.439) (-1000.229) -- 0:03:07 165000 -- (-996.585) [-995.306] (-987.532) (-991.068) * (-992.581) [-995.712] (-999.534) (-1003.505) -- 0:03:07 Average standard deviation of split frequencies: 0.011927 165500 -- (-998.788) (-1003.123) (-992.309) [-994.794] * (-1003.226) (-993.959) (-994.740) [-999.301] -- 0:03:11 166000 -- (-999.222) [-989.883] (-988.031) (-995.187) * (-1002.930) [-996.680] (-992.878) (-998.957) -- 0:03:10 166500 -- (-1004.991) [-987.357] (-995.632) (-991.245) * (-1000.713) (-994.567) [-992.422] (-1000.377) -- 0:03:10 167000 -- (-1004.104) (-994.101) (-1003.147) [-998.462] * (-991.682) (-992.338) (-989.238) [-990.847] -- 0:03:09 167500 -- (-1004.974) [-987.731] (-990.131) (-996.122) * (-992.932) (-1008.354) [-991.406] (-990.078) -- 0:03:08 168000 -- [-1003.865] (-994.698) (-988.440) (-999.239) * (-1002.129) (-995.777) (-994.823) [-995.210] -- 0:03:08 168500 -- (-997.108) (-1003.591) [-992.216] (-998.202) * (-995.979) [-994.544] (-993.406) (-998.839) -- 0:03:07 169000 -- (-996.776) (-998.935) [-992.238] (-1002.097) * (-996.930) (-995.339) [-991.190] (-999.053) -- 0:03:06 169500 -- (-992.423) (-997.799) [-1000.162] (-992.587) * (-993.577) [-992.689] (-1003.065) (-988.718) -- 0:03:06 170000 -- (-993.260) (-1000.238) [-997.096] (-993.934) * (-998.590) [-989.976] (-996.138) (-999.260) -- 0:03:10 Average standard deviation of split frequencies: 0.010496 170500 -- [-991.068] (-997.410) (-998.347) (-995.685) * (-998.826) [-990.348] (-986.673) (-996.843) -- 0:03:09 171000 -- [-997.948] (-997.002) (-993.661) (-991.358) * (-997.593) [-990.666] (-994.178) (-990.529) -- 0:03:09 171500 -- [-988.673] (-996.244) (-992.558) (-995.854) * (-994.822) [-996.112] (-991.697) (-993.679) -- 0:03:08 172000 -- [-993.620] (-991.687) (-997.669) (-1002.564) * (-999.318) (-987.518) [-996.161] (-994.841) -- 0:03:07 172500 -- [-993.272] (-990.820) (-998.558) (-996.566) * (-985.595) (-995.472) [-991.773] (-993.276) -- 0:03:07 173000 -- (-1002.671) (-991.980) [-991.665] (-996.303) * (-992.279) (-997.638) (-991.069) [-998.931] -- 0:03:06 173500 -- (-990.209) [-991.942] (-998.596) (-1002.553) * (-996.377) (-996.754) (-989.424) [-987.754] -- 0:03:05 174000 -- (-990.976) [-991.053] (-991.693) (-999.542) * [-998.455] (-993.737) (-999.587) (-996.264) -- 0:03:05 174500 -- (-999.541) [-986.974] (-990.239) (-992.073) * (-1002.527) (-990.649) (-1002.890) [-998.421] -- 0:03:09 175000 -- (-994.499) (-989.326) [-993.584] (-994.378) * (-1006.460) [-995.830] (-997.799) (-994.986) -- 0:03:08 Average standard deviation of split frequencies: 0.010178 175500 -- (-996.921) (-988.506) (-986.832) [-996.383] * (-999.893) (-990.872) [-999.435] (-992.916) -- 0:03:07 176000 -- (-996.510) (-991.508) (-998.320) [-989.491] * (-1003.874) (-987.894) [-994.797] (-1005.943) -- 0:03:07 176500 -- (-992.179) (-997.893) [-997.264] (-993.414) * (-1000.464) (-991.599) (-993.450) [-999.542] -- 0:03:06 177000 -- (-996.775) [-992.170] (-1002.331) (-995.758) * [-1000.942] (-991.389) (-996.979) (-997.766) -- 0:03:05 177500 -- (-1004.300) (-999.399) (-993.306) [-992.978] * (-989.260) [-1002.706] (-1001.887) (-1002.391) -- 0:03:05 178000 -- (-1002.621) (-993.213) [-991.929] (-987.616) * (-997.708) (-999.802) [-994.698] (-998.632) -- 0:03:04 178500 -- (-1001.158) (-996.863) (-995.574) [-999.394] * (-993.932) [-990.102] (-998.655) (-995.902) -- 0:03:08 179000 -- (-997.015) (-999.826) [-992.939] (-997.252) * [-990.177] (-996.494) (-992.510) (-994.584) -- 0:03:08 179500 -- [-997.861] (-996.033) (-1001.854) (-1000.648) * (-998.927) [-993.171] (-990.913) (-1005.770) -- 0:03:07 180000 -- (-993.898) (-1002.016) (-996.771) [-990.765] * (-999.016) (-998.507) [-1001.821] (-1002.315) -- 0:03:06 Average standard deviation of split frequencies: 0.010437 180500 -- [-999.060] (-998.214) (-999.075) (-991.885) * (-999.785) (-996.448) (-995.567) [-987.574] -- 0:03:06 181000 -- [-996.960] (-1006.211) (-1002.321) (-992.889) * (-997.655) (-994.107) [-990.847] (-996.846) -- 0:03:05 181500 -- (-994.272) (-992.471) (-994.868) [-990.930] * (-992.276) [-993.930] (-998.138) (-996.889) -- 0:03:04 182000 -- (-990.544) (-993.410) (-1004.883) [-992.115] * (-994.218) [-992.502] (-996.229) (-992.355) -- 0:03:04 182500 -- (-991.729) (-996.611) (-1008.736) [-996.941] * (-991.810) (-993.906) (-993.720) [-993.314] -- 0:03:03 183000 -- [-989.503] (-1006.115) (-1001.418) (-988.242) * (-995.812) (-994.667) [-998.042] (-996.332) -- 0:03:07 183500 -- (-993.133) (-991.309) [-990.437] (-987.944) * (-997.495) [-993.823] (-996.007) (-994.207) -- 0:03:06 184000 -- [-990.898] (-1000.123) (-992.911) (-1000.329) * (-997.197) [-992.294] (-999.744) (-992.063) -- 0:03:06 184500 -- (-992.143) [-990.850] (-993.963) (-991.985) * [-992.317] (-992.642) (-997.700) (-989.731) -- 0:03:05 185000 -- [-991.766] (-996.712) (-995.966) (-999.837) * (-1000.404) [-999.432] (-993.488) (-992.374) -- 0:03:05 Average standard deviation of split frequencies: 0.013179 185500 -- (-999.247) [-993.281] (-998.350) (-998.016) * (-994.612) (-1002.140) [-994.861] (-994.883) -- 0:03:04 186000 -- [-993.341] (-994.739) (-992.609) (-998.803) * (-992.029) [-995.937] (-991.878) (-991.625) -- 0:03:03 186500 -- (-1001.565) (-994.656) [-994.779] (-988.887) * (-995.697) [-992.627] (-990.997) (-1000.465) -- 0:03:03 187000 -- [-987.317] (-992.007) (-992.113) (-1000.584) * (-1002.390) (-989.036) (-995.800) [-991.799] -- 0:03:02 187500 -- (-996.540) (-988.563) [-994.211] (-1005.310) * (-996.635) [-990.404] (-993.446) (-994.768) -- 0:03:06 188000 -- (-989.895) (-991.605) [-997.063] (-996.349) * (-994.280) (-1000.555) (-1000.057) [-988.459] -- 0:03:05 188500 -- (-992.723) (-991.639) (-996.046) [-995.825] * (-999.249) [-992.468] (-998.362) (-995.354) -- 0:03:05 189000 -- (-1005.435) [-998.608] (-992.267) (-1003.516) * [-995.996] (-993.784) (-994.096) (-994.407) -- 0:03:04 189500 -- (-995.864) (-994.595) [-988.923] (-995.997) * (-995.089) (-1004.118) [-1001.555] (-998.797) -- 0:03:03 190000 -- [-998.473] (-997.495) (-994.300) (-1009.084) * (-992.010) [-991.238] (-990.880) (-993.035) -- 0:03:03 Average standard deviation of split frequencies: 0.012856 190500 -- (-999.810) (-994.663) [-998.933] (-1006.720) * [-992.770] (-986.255) (-992.928) (-995.081) -- 0:03:02 191000 -- (-989.872) (-992.130) [-990.714] (-1004.917) * (-998.395) (-998.674) [-990.164] (-996.130) -- 0:03:02 191500 -- (-995.087) (-1001.317) (-999.617) [-1000.981] * (-1007.882) (-994.983) [-995.398] (-989.147) -- 0:03:01 192000 -- (-996.734) (-994.340) [-1005.793] (-1004.375) * (-996.556) (-991.557) [-996.886] (-993.690) -- 0:03:05 192500 -- (-1002.898) [-998.165] (-996.843) (-998.613) * [-994.216] (-996.162) (-991.245) (-995.383) -- 0:03:04 193000 -- (-1002.171) [-996.880] (-999.022) (-994.450) * (-992.642) (-991.027) [-994.210] (-996.439) -- 0:03:03 193500 -- (-1004.780) (-989.450) (-993.534) [-1006.213] * [-993.153] (-997.204) (-990.369) (-995.204) -- 0:03:03 194000 -- (-995.250) (-995.715) [-993.826] (-990.411) * [-997.259] (-991.398) (-992.066) (-989.518) -- 0:03:02 194500 -- (-1000.133) (-992.301) (-994.429) [-990.758] * (-1006.371) [-989.242] (-992.763) (-999.611) -- 0:03:02 195000 -- (-999.978) [-989.175] (-993.421) (-992.019) * (-996.106) (-994.339) (-988.875) [-990.608] -- 0:03:01 Average standard deviation of split frequencies: 0.013469 195500 -- (-999.321) [-988.093] (-994.206) (-992.324) * (-1003.095) (-991.897) [-993.225] (-999.877) -- 0:03:01 196000 -- (-1005.319) (-993.289) [-995.840] (-995.746) * (-1003.875) (-992.822) [-988.926] (-1001.131) -- 0:03:00 196500 -- (-1006.760) [-1001.956] (-993.393) (-990.752) * (-998.265) [-995.885] (-996.964) (-992.334) -- 0:03:04 197000 -- (-1005.739) [-995.511] (-997.192) (-994.343) * (-1001.910) [-995.320] (-997.249) (-996.473) -- 0:03:03 197500 -- (-992.213) (-1006.858) (-992.059) [-994.757] * (-1001.991) [-994.184] (-988.906) (-1004.197) -- 0:03:02 198000 -- (-991.284) (-1003.058) (-992.518) [-988.071] * (-993.888) [-988.684] (-1007.382) (-1000.793) -- 0:03:02 198500 -- (-999.285) (-1003.986) [-994.571] (-996.371) * (-994.160) (-991.326) [-994.924] (-1008.584) -- 0:03:01 199000 -- (-994.650) (-996.456) [-995.070] (-994.894) * [-989.186] (-998.222) (-995.437) (-1001.850) -- 0:03:01 199500 -- [-998.693] (-993.655) (-994.708) (-997.089) * [-995.143] (-991.953) (-992.005) (-996.598) -- 0:03:00 200000 -- (-991.884) [-1000.692] (-997.257) (-1000.109) * [-994.155] (-1001.222) (-992.689) (-1000.851) -- 0:03:00 Average standard deviation of split frequencies: 0.013625 200500 -- (-993.958) (-993.777) [-993.637] (-1003.299) * (-993.540) [-992.990] (-988.811) (-1002.038) -- 0:03:03 201000 -- [-990.478] (-995.454) (-995.579) (-1010.260) * (-992.042) [-997.788] (-988.573) (-998.374) -- 0:03:02 201500 -- [-993.920] (-999.884) (-999.634) (-997.391) * (-989.960) [-992.888] (-992.711) (-997.943) -- 0:03:02 202000 -- (-992.835) (-1002.076) [-1002.593] (-991.983) * [-992.694] (-1001.034) (-990.419) (-1005.517) -- 0:03:01 202500 -- [-995.377] (-997.708) (-992.746) (-995.642) * (-995.537) (-999.419) (-992.314) [-998.221] -- 0:03:01 203000 -- (-994.253) (-1000.159) (-997.903) [-994.052] * [-992.049] (-996.592) (-991.640) (-1001.796) -- 0:03:00 203500 -- [-992.543] (-1000.227) (-994.394) (-994.569) * (-992.051) (-998.918) (-999.475) [-994.227] -- 0:03:00 204000 -- (-997.109) (-1002.281) [-1000.469] (-1000.690) * (-997.142) (-1001.687) (-991.452) [-999.346] -- 0:02:59 204500 -- (-1000.238) (-996.316) [-987.429] (-997.417) * (-995.854) (-996.754) [-995.679] (-998.049) -- 0:02:58 205000 -- (-1001.352) (-997.630) [-992.550] (-994.123) * (-997.392) (-988.021) (-1000.839) [-992.791] -- 0:03:02 Average standard deviation of split frequencies: 0.010984 205500 -- (-999.230) (-1001.366) [-994.909] (-999.225) * (-993.790) [-991.386] (-1010.045) (-992.627) -- 0:03:01 206000 -- [-999.343] (-996.367) (-994.109) (-996.182) * (-1010.682) (-1000.396) [-996.513] (-994.970) -- 0:03:01 206500 -- (-995.414) [-1001.048] (-1004.023) (-992.856) * (-999.836) [-994.677] (-993.642) (-996.996) -- 0:03:00 207000 -- (-994.405) (-1004.802) (-998.968) [-997.215] * (-990.093) (-988.965) [-997.211] (-988.797) -- 0:03:00 207500 -- (-1002.582) (-1000.378) [-996.329] (-993.042) * [-991.329] (-993.275) (-1002.175) (-998.204) -- 0:02:59 208000 -- [-991.831] (-999.035) (-985.465) (-990.521) * (-1006.601) (-991.450) [-996.699] (-998.259) -- 0:02:58 208500 -- (-992.204) (-1001.835) [-990.122] (-991.519) * (-993.130) (-998.040) [-997.265] (-1001.416) -- 0:02:58 209000 -- (-995.232) [-1001.667] (-990.444) (-1000.573) * (-1008.668) [-998.341] (-1005.001) (-994.902) -- 0:02:57 209500 -- (-993.591) (-997.856) [-991.072] (-994.227) * (-1001.077) (-992.073) (-1000.851) [-990.781] -- 0:03:01 210000 -- (-998.550) (-997.952) [-988.604] (-1000.696) * (-996.659) [-993.267] (-1001.488) (-1001.641) -- 0:03:00 Average standard deviation of split frequencies: 0.011188 210500 -- (-988.412) [-997.311] (-993.603) (-993.746) * (-1001.038) [-992.172] (-996.690) (-989.845) -- 0:03:00 211000 -- (-995.181) (-995.032) (-990.871) [-989.967] * (-995.337) (-996.013) [-994.628] (-997.317) -- 0:02:59 211500 -- (-1003.389) (-997.903) (-1002.690) [-990.604] * (-990.761) [-998.074] (-997.444) (-992.344) -- 0:02:58 212000 -- (-997.934) (-995.685) [-992.188] (-1000.169) * (-993.211) (-992.396) [-988.144] (-996.512) -- 0:02:58 212500 -- [-1003.174] (-1000.237) (-993.134) (-998.296) * (-986.765) [-990.230] (-998.834) (-993.070) -- 0:02:57 213000 -- (-990.935) [-994.702] (-1001.374) (-1002.476) * (-995.175) [-989.679] (-1006.047) (-992.337) -- 0:02:57 213500 -- (-991.337) (-1002.470) [-998.213] (-993.503) * [-993.190] (-1000.018) (-1000.540) (-993.185) -- 0:02:56 214000 -- (-992.819) (-997.785) (-994.350) [-993.635] * (-994.849) (-995.103) (-994.966) [-998.181] -- 0:02:59 214500 -- [-989.636] (-997.278) (-995.159) (-995.006) * (-998.695) (-993.292) [-994.355] (-991.808) -- 0:02:59 215000 -- (-994.351) (-999.338) [-1000.174] (-989.964) * (-997.881) (-994.192) (-993.643) [-997.776] -- 0:02:58 Average standard deviation of split frequencies: 0.014841 215500 -- (-991.808) (-998.204) (-997.264) [-996.052] * (-996.301) [-997.415] (-991.700) (-992.253) -- 0:02:58 216000 -- (-989.526) (-1001.147) (-1005.842) [-989.130] * (-993.431) (-994.913) (-992.927) [-996.854] -- 0:02:57 216500 -- [-996.708] (-993.873) (-998.861) (-994.335) * (-1001.310) [-988.054] (-993.273) (-992.565) -- 0:02:57 217000 -- (-990.451) (-991.010) [-999.134] (-995.589) * (-997.450) (-1003.297) (-996.937) [-990.029] -- 0:02:56 217500 -- (-998.745) (-992.640) [-1003.818] (-994.304) * [-989.264] (-995.496) (-989.856) (-988.259) -- 0:02:56 218000 -- (-995.722) (-997.738) (-997.396) [-994.377] * [-999.592] (-999.515) (-993.814) (-988.553) -- 0:02:55 218500 -- (-1000.498) [-990.942] (-995.213) (-992.180) * [-991.555] (-996.446) (-994.995) (-997.164) -- 0:02:58 219000 -- (-997.713) (-999.881) (-1006.270) [-997.174] * (-992.076) [-994.755] (-996.457) (-990.299) -- 0:02:58 219500 -- (-990.737) [-1001.569] (-992.955) (-993.551) * (-994.767) (-992.075) [-997.560] (-992.740) -- 0:02:57 220000 -- (-994.843) (-994.946) [-989.842] (-999.446) * (-989.997) [-998.698] (-992.923) (-993.863) -- 0:02:57 Average standard deviation of split frequencies: 0.016236 220500 -- (-999.255) (-996.214) (-990.936) [-997.039] * (-998.162) (-996.899) (-1001.021) [-990.418] -- 0:02:56 221000 -- [-992.326] (-996.811) (-999.918) (-991.812) * (-992.541) (-1002.480) [-994.491] (-999.322) -- 0:02:56 221500 -- (-1002.034) [-993.457] (-990.919) (-995.686) * (-994.841) (-1006.376) [-995.138] (-988.095) -- 0:02:55 222000 -- (-998.441) [-988.808] (-996.323) (-994.775) * (-1001.879) [-993.503] (-1001.785) (-992.389) -- 0:02:55 222500 -- (-996.233) (-995.832) [-992.595] (-991.889) * [-995.713] (-993.726) (-990.483) (-992.414) -- 0:02:54 223000 -- (-992.686) (-992.485) (-1002.876) [-995.698] * (-993.364) (-1000.588) [-991.930] (-988.639) -- 0:02:57 223500 -- (-992.127) (-997.818) [-990.489] (-988.555) * (-999.545) [-988.547] (-994.175) (-992.371) -- 0:02:57 224000 -- (-994.791) [-991.492] (-991.907) (-992.754) * (-1003.538) (-994.172) (-994.877) [-989.734] -- 0:02:56 224500 -- (-994.204) (-990.356) (-993.296) [-988.165] * (-998.324) (-989.548) (-1002.082) [-993.356] -- 0:02:56 225000 -- [-990.509] (-993.528) (-1003.983) (-991.792) * (-1003.493) [-993.285] (-995.779) (-993.679) -- 0:02:55 Average standard deviation of split frequencies: 0.016270 225500 -- (-991.231) (-995.624) [-991.483] (-996.200) * (-995.829) [-992.577] (-995.247) (-1002.290) -- 0:02:55 226000 -- (-994.158) (-997.626) (-995.309) [-993.134] * (-996.403) (-1000.385) (-993.266) [-993.260] -- 0:02:54 226500 -- (-998.221) [-994.527] (-989.713) (-996.036) * (-993.970) [-989.894] (-990.338) (-992.975) -- 0:02:54 227000 -- (-997.982) [-994.223] (-990.227) (-994.317) * (-1001.480) (-993.388) [-990.227] (-992.931) -- 0:02:53 227500 -- [-992.456] (-995.151) (-994.628) (-994.310) * (-990.314) (-991.279) [-991.198] (-994.341) -- 0:02:56 228000 -- (-992.005) (-998.454) (-991.140) [-991.441] * (-999.057) (-993.907) (-995.069) [-990.109] -- 0:02:56 228500 -- (-993.661) (-999.476) [-999.767] (-994.284) * (-995.750) (-990.050) [-993.747] (-993.722) -- 0:02:55 229000 -- (-995.963) (-1002.198) [-993.145] (-989.663) * (-993.808) (-990.945) [-993.145] (-992.274) -- 0:02:55 229500 -- [-992.597] (-995.268) (-998.218) (-992.136) * (-1007.119) [-990.187] (-993.056) (-1004.736) -- 0:02:54 230000 -- (-997.978) (-998.642) [-992.044] (-997.550) * (-1002.915) (-991.991) [-990.347] (-993.164) -- 0:02:54 Average standard deviation of split frequencies: 0.017167 230500 -- (-990.122) [-994.562] (-995.336) (-998.904) * (-990.270) (-990.701) [-991.662] (-1002.535) -- 0:02:53 231000 -- (-1008.578) (-993.794) (-996.395) [-992.025] * [-993.557] (-995.658) (-995.379) (-998.955) -- 0:02:53 231500 -- [-991.556] (-994.543) (-995.258) (-996.402) * (-990.724) (-991.997) (-995.030) [-994.210] -- 0:02:55 232000 -- (-996.705) (-991.590) (-997.282) [-995.140] * (-993.905) [-992.923] (-993.741) (-1000.496) -- 0:02:55 232500 -- (-993.212) (-996.569) (-997.093) [-997.341] * (-986.854) [-995.253] (-989.685) (-999.698) -- 0:02:54 233000 -- (-990.849) (-997.754) [-991.694] (-989.607) * [-989.434] (-1001.367) (-999.850) (-1004.012) -- 0:02:54 233500 -- (-989.139) (-995.035) (-995.231) [-992.845] * (-990.966) (-989.703) [-992.783] (-997.918) -- 0:02:53 234000 -- (-992.593) (-997.489) (-990.224) [-991.506] * (-1002.056) (-997.346) [-989.710] (-995.867) -- 0:02:53 234500 -- [-990.983] (-994.203) (-993.957) (-997.033) * (-997.660) (-998.970) [-992.276] (-991.632) -- 0:02:53 235000 -- (-991.898) [-995.856] (-993.805) (-1002.111) * (-1003.893) (-993.526) (-991.984) [-995.502] -- 0:02:52 Average standard deviation of split frequencies: 0.016379 235500 -- (-994.589) (-993.169) [-991.015] (-991.610) * (-994.539) (-988.704) [-993.667] (-1001.606) -- 0:02:52 236000 -- (-1002.984) (-1002.413) [-991.484] (-994.524) * [-1000.052] (-1000.609) (-999.335) (-1000.046) -- 0:02:54 236500 -- (-994.210) [-998.168] (-994.226) (-999.823) * (-994.589) [-996.616] (-1000.612) (-997.006) -- 0:02:54 237000 -- [-993.428] (-996.128) (-989.604) (-994.828) * [-989.748] (-998.837) (-994.726) (-997.549) -- 0:02:53 237500 -- (-999.015) (-1007.187) (-996.210) [-998.451] * (-990.230) (-996.017) (-990.489) [-991.188] -- 0:02:53 238000 -- (-993.235) (-1004.683) (-993.311) [-994.476] * (-994.974) (-992.325) [-991.780] (-994.209) -- 0:02:52 238500 -- (-991.633) (-1000.391) [-991.575] (-999.192) * (-992.766) (-994.638) (-999.251) [-993.583] -- 0:02:52 239000 -- [-992.770] (-999.366) (-997.838) (-993.888) * (-992.216) [-1002.020] (-994.446) (-995.369) -- 0:02:51 239500 -- (-992.609) (-1000.537) [-995.289] (-995.020) * (-992.725) [-995.472] (-995.288) (-995.902) -- 0:02:51 240000 -- (-994.080) (-994.771) [-989.675] (-994.061) * (-993.198) (-992.105) (-995.448) [-988.769] -- 0:02:51 Average standard deviation of split frequencies: 0.015278 240500 -- (-995.357) (-998.925) [-990.701] (-991.589) * (-996.308) (-994.481) [-992.051] (-990.921) -- 0:02:53 241000 -- (-999.417) (-991.905) [-991.990] (-993.958) * (-993.530) (-998.254) (-990.200) [-993.295] -- 0:02:53 241500 -- (-999.371) (-1006.850) (-987.626) [-991.678] * [-997.998] (-1004.916) (-997.828) (-999.265) -- 0:02:52 242000 -- (-989.048) (-995.570) [-991.686] (-995.737) * [-988.558] (-1000.575) (-994.652) (-988.511) -- 0:02:52 242500 -- (-996.622) [-997.243] (-989.232) (-997.960) * (-1002.551) (-1002.917) [-991.666] (-993.049) -- 0:02:51 243000 -- (-995.570) (-999.243) (-993.053) [-996.472] * (-994.723) (-995.441) [-994.540] (-994.386) -- 0:02:51 243500 -- (-989.393) [-998.221] (-992.538) (-991.540) * (-995.679) (-991.612) [-990.072] (-997.317) -- 0:02:50 244000 -- (-993.783) (-993.456) [-1004.085] (-991.899) * (-999.032) (-996.743) [-995.201] (-993.687) -- 0:02:50 244500 -- (-988.726) [-994.671] (-993.858) (-998.017) * (-1001.591) (-992.658) [-993.808] (-998.105) -- 0:02:49 245000 -- (-988.128) [-988.798] (-998.296) (-994.542) * (-997.458) [-993.457] (-995.359) (-993.380) -- 0:02:52 Average standard deviation of split frequencies: 0.014564 245500 -- (-989.495) [-993.446] (-991.118) (-994.045) * (-998.638) (-992.916) (-991.974) [-988.907] -- 0:02:52 246000 -- (-990.708) [-992.075] (-996.962) (-990.051) * [-996.385] (-998.538) (-997.888) (-1007.372) -- 0:02:51 246500 -- (-996.354) (-996.297) [-996.675] (-996.862) * (-1000.978) (-993.955) [-994.290] (-997.893) -- 0:02:51 247000 -- (-992.442) [-992.676] (-992.259) (-997.750) * (-998.857) [-989.421] (-995.836) (-1000.973) -- 0:02:50 247500 -- (-999.131) (-993.077) (-996.681) [-990.065] * (-997.806) (-987.876) (-1001.363) [-999.047] -- 0:02:50 248000 -- (-998.440) (-987.627) (-999.707) [-993.207] * (-1006.612) (-987.493) (-994.439) [-993.427] -- 0:02:49 248500 -- (-999.684) [-990.625] (-992.442) (-1004.589) * (-995.682) (-995.673) [-989.914] (-1006.643) -- 0:02:49 249000 -- [-991.346] (-990.974) (-1001.147) (-990.698) * (-991.176) (-990.516) (-1001.959) [-995.985] -- 0:02:48 249500 -- (-994.376) (-1000.830) (-1002.132) [-995.675] * (-998.223) [-994.217] (-999.796) (-995.194) -- 0:02:51 250000 -- (-993.798) (-997.070) (-997.054) [-991.835] * (-994.974) [-989.288] (-1000.336) (-1000.822) -- 0:02:51 Average standard deviation of split frequencies: 0.014293 250500 -- (-992.510) [-999.309] (-992.496) (-991.930) * [-993.420] (-991.892) (-999.167) (-992.490) -- 0:02:50 251000 -- (-998.711) [-995.306] (-1002.141) (-996.533) * (-993.721) [-993.043] (-996.385) (-990.319) -- 0:02:50 251500 -- (-999.982) (-992.447) (-994.065) [-994.934] * (-993.185) (-1000.221) [-996.695] (-991.898) -- 0:02:49 252000 -- (-991.734) [-990.736] (-992.425) (-998.597) * [-1006.177] (-996.102) (-993.768) (-989.223) -- 0:02:49 252500 -- (-997.161) (-992.002) [-990.918] (-994.653) * (-993.178) (-996.921) (-995.062) [-992.251] -- 0:02:48 253000 -- (-990.956) (-994.153) [-1000.543] (-995.032) * (-991.044) (-1000.509) (-1001.873) [-1000.391] -- 0:02:48 253500 -- (-993.720) (-990.822) (-997.343) [-998.245] * (-1001.582) [-991.040] (-1000.304) (-997.588) -- 0:02:47 254000 -- [-990.286] (-994.497) (-996.271) (-995.791) * [-1000.360] (-994.368) (-997.299) (-1005.392) -- 0:02:50 254500 -- (-997.286) (-999.732) (-991.940) [-994.782] * [-994.754] (-997.416) (-992.826) (-1004.400) -- 0:02:49 255000 -- [-990.498] (-994.373) (-994.343) (-1003.992) * [-987.966] (-993.470) (-1000.700) (-990.609) -- 0:02:49 Average standard deviation of split frequencies: 0.012890 255500 -- [-994.849] (-993.901) (-998.553) (-997.037) * (-996.879) (-990.616) (-997.957) [-996.969] -- 0:02:49 256000 -- (-994.293) [-1000.510] (-998.687) (-1002.891) * (-998.080) [-990.369] (-992.906) (-991.927) -- 0:02:48 256500 -- (-994.040) [-994.988] (-998.288) (-997.522) * [-989.249] (-991.617) (-995.384) (-993.234) -- 0:02:48 257000 -- [-989.806] (-993.377) (-993.733) (-995.981) * (-998.020) (-997.638) [-989.704] (-1004.153) -- 0:02:47 257500 -- (-990.590) (-997.511) [-992.630] (-999.169) * (-999.774) [-991.465] (-988.864) (-991.368) -- 0:02:47 258000 -- (-999.430) [-991.316] (-999.393) (-998.713) * [-996.321] (-990.914) (-992.617) (-992.324) -- 0:02:46 258500 -- (-996.554) [-991.665] (-996.221) (-994.498) * [-991.986] (-993.100) (-995.602) (-990.195) -- 0:02:49 259000 -- (-993.659) [-996.078] (-990.044) (-992.265) * (-991.064) (-989.500) (-994.835) [-992.027] -- 0:02:48 259500 -- (-994.773) [-992.440] (-988.145) (-1005.888) * (-994.401) [-991.065] (-991.744) (-995.954) -- 0:02:48 260000 -- (-996.111) (-996.499) [-997.812] (-999.187) * [-991.440] (-998.763) (-990.206) (-1000.002) -- 0:02:47 Average standard deviation of split frequencies: 0.013021 260500 -- [-987.486] (-1000.093) (-1000.813) (-988.579) * (-992.491) [-990.322] (-994.456) (-988.720) -- 0:02:47 261000 -- (-993.529) [-1006.807] (-993.900) (-990.570) * [-992.529] (-990.015) (-993.535) (-993.986) -- 0:02:47 261500 -- (-991.625) [-993.764] (-994.034) (-997.968) * (-994.579) (-995.841) (-996.314) [-993.387] -- 0:02:46 262000 -- (-999.217) (-991.609) [-988.921] (-993.034) * [-987.926] (-993.827) (-993.256) (-987.582) -- 0:02:46 262500 -- [-1000.294] (-995.909) (-995.408) (-997.164) * (-993.689) (-994.312) (-989.541) [-997.935] -- 0:02:48 263000 -- [-999.123] (-994.771) (-996.882) (-997.186) * (-999.138) (-1000.214) (-996.672) [-990.408] -- 0:02:48 263500 -- (-1001.890) (-997.722) (-999.261) [-989.965] * (-993.073) (-994.795) (-997.563) [-992.078] -- 0:02:47 264000 -- (-994.164) [-995.161] (-997.832) (-999.787) * (-995.176) [-989.588] (-990.253) (-996.131) -- 0:02:47 264500 -- [-992.765] (-993.245) (-998.013) (-1001.490) * (-994.607) [-991.646] (-1004.302) (-991.101) -- 0:02:46 265000 -- [-992.009] (-992.573) (-995.573) (-999.340) * (-1002.111) [-995.360] (-1000.759) (-990.494) -- 0:02:46 Average standard deviation of split frequencies: 0.012760 265500 -- (-993.511) (-993.540) (-995.433) [-997.501] * (-995.146) [-1002.408] (-991.305) (-996.819) -- 0:02:45 266000 -- (-992.262) (-1002.151) [-1004.571] (-1007.428) * (-998.296) (-990.416) (-996.679) [-989.585] -- 0:02:45 266500 -- [-995.211] (-991.742) (-993.692) (-1002.158) * (-986.916) (-992.854) (-1000.172) [-988.365] -- 0:02:45 267000 -- (-991.315) (-994.718) [-993.817] (-992.975) * (-992.163) (-990.537) (-997.709) [-990.460] -- 0:02:47 267500 -- [-987.410] (-987.762) (-992.604) (-999.909) * (-993.226) [-997.012] (-993.171) (-993.697) -- 0:02:47 268000 -- (-990.092) [-992.140] (-1001.196) (-994.051) * [-989.282] (-1004.098) (-997.601) (-995.679) -- 0:02:46 268500 -- [-997.159] (-991.594) (-993.687) (-989.420) * (-995.825) (-1001.137) (-998.553) [-991.226] -- 0:02:46 269000 -- [-994.210] (-987.029) (-1003.916) (-994.962) * (-993.172) (-988.728) (-991.526) [-989.872] -- 0:02:45 269500 -- (-989.125) [-989.272] (-998.268) (-992.601) * (-994.249) (-991.166) [-995.138] (-989.177) -- 0:02:45 270000 -- [-991.834] (-988.807) (-1003.788) (-994.643) * [-990.548] (-990.952) (-988.839) (-1002.253) -- 0:02:44 Average standard deviation of split frequencies: 0.010102 270500 -- (-994.480) (-986.833) [-995.285] (-990.654) * (-993.045) (-996.803) (-990.015) [-998.031] -- 0:02:44 271000 -- (-997.044) (-999.064) (-998.654) [-991.039] * [-1001.007] (-994.659) (-994.656) (-995.886) -- 0:02:44 271500 -- (-994.370) [-999.114] (-997.880) (-988.511) * [-997.635] (-1001.751) (-998.821) (-994.785) -- 0:02:46 272000 -- (-995.361) (-997.447) [-993.306] (-992.662) * (-995.345) (-996.804) (-994.758) [-994.238] -- 0:02:45 272500 -- (-989.550) (-998.809) [-1000.683] (-990.230) * (-996.051) [-992.910] (-996.523) (-996.940) -- 0:02:45 273000 -- [-989.972] (-993.290) (-1002.179) (-991.889) * (-991.693) (-996.133) [-989.019] (-1000.960) -- 0:02:45 273500 -- (-997.230) [-993.184] (-997.961) (-999.338) * (-993.574) (-995.590) (-996.655) [-993.906] -- 0:02:44 274000 -- [-992.143] (-997.116) (-998.234) (-993.919) * (-994.292) (-993.333) [-995.099] (-996.144) -- 0:02:44 274500 -- [-987.976] (-998.736) (-999.985) (-990.886) * (-997.596) (-995.178) [-995.325] (-988.284) -- 0:02:43 275000 -- [-997.855] (-1001.929) (-995.536) (-993.126) * (-996.603) (-1002.077) (-997.171) [-995.784] -- 0:02:43 Average standard deviation of split frequencies: 0.010931 275500 -- (-989.713) [-990.153] (-1002.054) (-988.227) * (-996.305) (-991.596) (-994.279) [-990.991] -- 0:02:43 276000 -- [-988.971] (-994.774) (-996.730) (-990.398) * (-988.347) (-996.488) (-1001.916) [-994.770] -- 0:02:45 276500 -- (-1005.008) (-1007.738) (-996.485) [-994.785] * (-990.874) (-989.265) [-993.061] (-999.032) -- 0:02:44 277000 -- (-996.284) [-998.046] (-996.783) (-1003.871) * [-993.442] (-989.144) (-995.454) (-991.474) -- 0:02:44 277500 -- (-997.493) (-994.502) [-1002.836] (-998.558) * (-996.933) [-992.996] (-992.411) (-994.249) -- 0:02:44 278000 -- (-1000.610) (-999.005) (-1005.316) [-990.748] * (-998.126) (-1001.769) [-997.559] (-989.310) -- 0:02:43 278500 -- (-991.809) (-997.349) (-994.306) [-996.432] * (-1008.646) (-989.516) [-996.397] (-992.115) -- 0:02:43 279000 -- [-991.173] (-998.514) (-1001.772) (-989.590) * (-999.706) (-989.758) (-1006.209) [-994.911] -- 0:02:42 279500 -- (-1003.499) (-995.437) (-996.115) [-998.042] * (-991.598) [-995.590] (-998.732) (-991.862) -- 0:02:42 280000 -- (-999.508) (-1005.047) (-992.655) [-986.572] * (-998.125) (-1001.092) (-997.996) [-994.315] -- 0:02:44 Average standard deviation of split frequencies: 0.011085 280500 -- (-999.284) [-998.427] (-993.342) (-997.755) * [-993.733] (-1002.583) (-1002.125) (-993.924) -- 0:02:44 281000 -- (-996.192) (-997.564) [-992.673] (-992.159) * [-988.893] (-995.917) (-999.289) (-1000.591) -- 0:02:43 281500 -- (-994.852) [-990.123] (-994.450) (-987.844) * (-1002.841) (-992.893) [-991.614] (-992.227) -- 0:02:43 282000 -- (-1001.997) [-995.002] (-998.374) (-992.011) * (-1001.300) (-995.176) (-998.689) [-990.757] -- 0:02:42 282500 -- (-995.738) [-991.870] (-997.296) (-998.835) * (-995.271) (-1005.233) (-992.484) [-991.348] -- 0:02:42 283000 -- (-993.621) (-995.341) [-996.763] (-994.481) * [-991.835] (-993.344) (-996.640) (-1004.074) -- 0:02:42 283500 -- (-992.005) [-992.350] (-997.934) (-998.855) * (-993.908) [-994.947] (-991.848) (-993.913) -- 0:02:41 284000 -- [-990.941] (-991.663) (-999.215) (-995.995) * [-993.490] (-996.224) (-989.090) (-991.937) -- 0:02:41 284500 -- [-989.245] (-996.559) (-997.971) (-1002.723) * (-999.173) [-994.428] (-995.207) (-994.270) -- 0:02:43 285000 -- [-989.704] (-990.463) (-992.555) (-997.300) * (-993.855) [-997.729] (-1000.346) (-994.034) -- 0:02:43 Average standard deviation of split frequencies: 0.007582 285500 -- (-991.827) (-993.580) (-1006.124) [-993.309] * [-992.425] (-994.204) (-1004.287) (-994.957) -- 0:02:42 286000 -- (-991.995) (-987.869) (-995.595) [-992.341] * (-992.170) (-999.965) (-995.249) [-994.610] -- 0:02:42 286500 -- (-989.870) (-1002.472) [-994.540] (-996.161) * (-997.122) (-998.859) [-993.289] (-990.069) -- 0:02:41 287000 -- (-990.456) [-994.415] (-995.783) (-996.125) * (-991.486) (-998.251) (-992.871) [-997.167] -- 0:02:41 287500 -- (-994.272) (-1000.293) [-989.829] (-997.207) * [-986.344] (-998.532) (-995.932) (-989.381) -- 0:02:41 288000 -- [-992.276] (-993.521) (-1002.632) (-997.276) * (-997.133) [-993.303] (-996.795) (-991.013) -- 0:02:40 288500 -- [-997.351] (-993.862) (-999.748) (-993.215) * (-989.079) [-990.612] (-991.703) (-996.543) -- 0:02:40 289000 -- (-989.718) [-986.680] (-994.111) (-989.289) * (-989.751) (-994.337) [-994.828] (-999.053) -- 0:02:42 289500 -- [-987.392] (-996.755) (-998.162) (-989.841) * [-994.201] (-988.593) (-1004.335) (-998.950) -- 0:02:41 290000 -- (-995.444) (-995.489) (-1000.455) [-988.115] * (-1002.783) [-989.392] (-995.965) (-993.403) -- 0:02:41 Average standard deviation of split frequencies: 0.008758 290500 -- (-997.397) (-997.913) [-994.992] (-990.558) * [-995.119] (-993.753) (-993.549) (-995.380) -- 0:02:41 291000 -- [-990.378] (-1013.888) (-994.203) (-997.956) * [-998.280] (-992.193) (-994.697) (-1000.066) -- 0:02:40 291500 -- (-996.368) (-993.380) [-993.506] (-996.504) * (-1000.364) (-1004.295) (-996.831) [-994.341] -- 0:02:40 292000 -- (-996.799) (-992.101) [-990.803] (-990.918) * (-1000.588) [-991.796] (-989.814) (-998.476) -- 0:02:40 292500 -- (-999.032) [-994.719] (-995.640) (-992.107) * (-995.193) (-993.027) [-991.073] (-990.683) -- 0:02:39 293000 -- (-989.947) (-998.263) (-993.956) [-990.512] * [-999.368] (-992.220) (-994.175) (-992.574) -- 0:02:39 293500 -- (-991.554) (-997.079) [-990.621] (-1010.920) * [-994.652] (-989.596) (-991.455) (-993.098) -- 0:02:41 294000 -- (-994.217) (-998.111) [-999.318] (-993.618) * (-998.821) (-991.757) (-990.864) [-1003.299] -- 0:02:40 294500 -- [-993.308] (-1003.930) (-1001.229) (-990.800) * (-993.739) [-989.671] (-991.953) (-1001.742) -- 0:02:40 295000 -- (-998.528) (-996.603) [-991.755] (-995.099) * (-997.830) [-989.730] (-990.087) (-994.842) -- 0:02:40 Average standard deviation of split frequencies: 0.006689 295500 -- (-1000.205) (-994.203) [-993.071] (-995.216) * (-987.513) [-988.194] (-999.477) (-996.894) -- 0:02:39 296000 -- (-990.840) (-993.588) [-993.199] (-1001.800) * (-995.696) [-994.361] (-995.722) (-998.552) -- 0:02:39 296500 -- [-990.976] (-992.327) (-995.438) (-1000.211) * (-989.608) (-1003.606) [-994.386] (-998.362) -- 0:02:38 297000 -- [-993.718] (-995.961) (-991.760) (-997.609) * [-991.483] (-995.572) (-1000.108) (-990.182) -- 0:02:38 297500 -- (-995.362) (-996.268) (-992.272) [-989.201] * (-993.713) (-997.956) (-1000.166) [-996.335] -- 0:02:38 298000 -- [-992.891] (-994.626) (-999.040) (-1002.648) * [-992.638] (-998.302) (-997.380) (-993.352) -- 0:02:40 298500 -- (-996.708) (-991.960) [-992.688] (-998.428) * (-995.011) (-994.943) (-999.655) [-991.246] -- 0:02:39 299000 -- (-993.946) (-995.706) [-994.931] (-994.262) * (-996.430) (-996.153) [-988.937] (-1000.970) -- 0:02:39 299500 -- (-993.457) (-996.816) (-991.015) [-998.655] * (-998.769) [-991.296] (-990.313) (-994.467) -- 0:02:39 300000 -- (-996.976) (-999.762) [-988.837] (-992.353) * (-992.919) (-991.188) (-997.381) [-997.503] -- 0:02:38 Average standard deviation of split frequencies: 0.006899 300500 -- (-994.154) (-1005.774) [-989.553] (-996.707) * [-99