--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Nov 10 10:57:27 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/187/CG7787-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -989.69 -1000.18
2 -989.69 -1005.95
--------------------------------------
TOTAL -989.69 -1005.26
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.502640 0.006819 0.350610 0.662763 0.495768 973.99 1177.79 1.000
r(A<->C){all} 0.085149 0.001040 0.025399 0.144695 0.082751 689.28 725.95 1.000
r(A<->G){all} 0.213591 0.002693 0.118886 0.317510 0.209635 513.55 567.93 1.000
r(A<->T){all} 0.124657 0.002129 0.046321 0.221326 0.120679 583.33 631.22 1.001
r(C<->G){all} 0.047780 0.000457 0.012457 0.092048 0.044890 720.65 803.32 1.000
r(C<->T){all} 0.504052 0.005507 0.356224 0.640697 0.504914 505.67 507.53 1.000
r(G<->T){all} 0.024770 0.000375 0.000013 0.063040 0.020486 639.27 740.12 1.001
pi(A){all} 0.276425 0.000482 0.237161 0.322955 0.275207 1202.09 1208.53 1.000
pi(C){all} 0.245294 0.000436 0.203830 0.284975 0.245152 1068.52 1113.89 1.000
pi(G){all} 0.290386 0.000478 0.248135 0.333666 0.290106 1070.03 1198.75 1.000
pi(T){all} 0.187895 0.000373 0.152645 0.227427 0.187187 956.08 1032.48 1.000
alpha{1,2} 0.111209 0.005437 0.000352 0.238301 0.103786 912.97 1000.81 1.003
alpha{3} 1.632596 0.477607 0.627431 3.068261 1.490353 1181.74 1341.37 1.000
pinvar{all} 0.157514 0.011390 0.000023 0.355689 0.142369 1025.40 1028.99 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -932.121409
Model 2: PositiveSelection -930.554639
Model 0: one-ratio -950.499344
Model 3: discrete -930.55464
Model 7: beta -935.494437
Model 8: beta&w>1 -930.626396
Model 0 vs 1 36.75586999999996
Model 2 vs 1 3.133540000000039
Model 8 vs 7 9.736081999999897
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG7787-PA)
Pr(w>1) post mean +- SE for w
12 T 1.000** 4.325
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG7787-PA)
Pr(w>1) post mean +- SE for w
12 T 0.978* 4.945 +- 2.835
>C1
MTEEADFSEQITDGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCYLALKRVVHKDT
>C2
MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK
QDRSADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCYLALKRVVHKDT
>C3
MTEEADFSEQIVDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTLDGRKFLVCADCERGPV
GYHDLSTRHCFLALKRVVHKDT
>C4
MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGAYNQEKVDVPLMMQK
QDQTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCFLALQRVVHKDT
>C5
MTEVTDFSEQISNGKNILNVRCQFCNSLMLKAQEGTYSQEEVEVPLMMQK
QDRTADSLNSEPLKDFWLVKDMMMFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCFLALKRVVHKDS
>C6
MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV
GYHDLTTRHCFLALKRVVHKDS
>C7
MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV
GYHDLTTRHCFLALKRVVHKDS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=122
C1 MTEEADFSEQITDGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQK
C2 MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK
C3 MTEEADFSEQIVDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK
C4 MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGAYNQEKVDVPLMMQK
C5 MTEVTDFSEQISNGKNILNVRCQFCNSLMLKAQEGTYSQEEVEVPLMMQK
C6 MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK
C7 MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK
*** :***:** :*** ********.********::. *:*:**** **
C1 QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
C2 QDRSADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
C3 QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTLDGRKFLVCADCERGPV
C4 QDQTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
C5 QDRTADSLNSEPLKDFWLVKDMMMFENIGFSNTVDGRKFLVCADCERGPV
C6 QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV
C7 QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV
**::******************* *******:*:****************
C1 GYHDLSTRHCYLALKRVVHKDT
C2 GYHDLSTRHCYLALKRVVHKDT
C3 GYHDLSTRHCFLALKRVVHKDT
C4 GYHDLSTRHCFLALQRVVHKDT
C5 GYHDLSTRHCFLALKRVVHKDS
C6 GYHDLTTRHCFLALKRVVHKDS
C7 GYHDLTTRHCFLALKRVVHKDS
*****:****:***:******:
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5124]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [5124]--->[5124]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/187/CG7787-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.355 Mb, Max= 30.570 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MTEEADFSEQITDGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCYLALKRVVHKDT
>C2
MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK
QDRSADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCYLALKRVVHKDT
>C3
MTEEADFSEQIVDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTLDGRKFLVCADCERGPV
GYHDLSTRHCFLALKRVVHKDT
>C4
MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGAYNQEKVDVPLMMQK
QDQTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCFLALQRVVHKDT
>C5
MTEVTDFSEQISNGKNILNVRCQFCNSLMLKAQEGTYSQEEVEVPLMMQK
QDRTADSLNSEPLKDFWLVKDMMMFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCFLALKRVVHKDS
>C6
MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV
GYHDLTTRHCFLALKRVVHKDS
>C7
MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV
GYHDLTTRHCFLALKRVVHKDS
FORMAT of file /tmp/tmp5157648480891349101aln Not Supported[FATAL:T-COFFEE]
>C1
MTEEADFSEQITDGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCYLALKRVVHKDT
>C2
MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK
QDRSADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCYLALKRVVHKDT
>C3
MTEEADFSEQIVDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTLDGRKFLVCADCERGPV
GYHDLSTRHCFLALKRVVHKDT
>C4
MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGAYNQEKVDVPLMMQK
QDQTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCFLALQRVVHKDT
>C5
MTEVTDFSEQISNGKNILNVRCQFCNSLMLKAQEGTYSQEEVEVPLMMQK
QDRTADSLNSEPLKDFWLVKDMMMFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCFLALKRVVHKDS
>C6
MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV
GYHDLTTRHCFLALKRVVHKDS
>C7
MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV
GYHDLTTRHCFLALKRVVHKDS
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:122 S:100 BS:122
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# PW_SEQ_DISTANCES
BOT 0 1 97.54 C1 C2 97.54
TOP 1 0 97.54 C2 C1 97.54
BOT 0 2 95.90 C1 C3 95.90
TOP 2 0 95.90 C3 C1 95.90
BOT 0 3 94.26 C1 C4 94.26
TOP 3 0 94.26 C4 C1 94.26
BOT 0 4 89.34 C1 C5 89.34
TOP 4 0 89.34 C5 C1 89.34
BOT 0 5 90.16 C1 C6 90.16
TOP 5 0 90.16 C6 C1 90.16
BOT 0 6 90.16 C1 C7 90.16
TOP 6 0 90.16 C7 C1 90.16
BOT 1 2 96.72 C2 C3 96.72
TOP 2 1 96.72 C3 C2 96.72
BOT 1 3 95.08 C2 C4 95.08
TOP 3 1 95.08 C4 C2 95.08
BOT 1 4 90.16 C2 C5 90.16
TOP 4 1 90.16 C5 C2 90.16
BOT 1 5 90.98 C2 C6 90.98
TOP 5 1 90.98 C6 C2 90.98
BOT 1 6 90.98 C2 C7 90.98
TOP 6 1 90.98 C7 C2 90.98
BOT 2 3 95.08 C3 C4 95.08
TOP 3 2 95.08 C4 C3 95.08
BOT 2 4 90.98 C3 C5 90.98
TOP 4 2 90.98 C5 C3 90.98
BOT 2 5 92.62 C3 C6 92.62
TOP 5 2 92.62 C6 C3 92.62
BOT 2 6 92.62 C3 C7 92.62
TOP 6 2 92.62 C7 C3 92.62
BOT 3 4 88.52 C4 C5 88.52
TOP 4 3 88.52 C5 C4 88.52
BOT 3 5 89.34 C4 C6 89.34
TOP 5 3 89.34 C6 C4 89.34
BOT 3 6 89.34 C4 C7 89.34
TOP 6 3 89.34 C7 C4 89.34
BOT 4 5 90.16 C5 C6 90.16
TOP 5 4 90.16 C6 C5 90.16
BOT 4 6 90.16 C5 C7 90.16
TOP 6 4 90.16 C7 C5 90.16
BOT 5 6 100.00 C6 C7 100.00
TOP 6 5 100.00 C7 C6 100.00
AVG 0 C1 * 92.90
AVG 1 C2 * 93.58
AVG 2 C3 * 93.99
AVG 3 C4 * 91.94
AVG 4 C5 * 89.89
AVG 5 C6 * 92.21
AVG 6 C7 * 92.21
TOT TOT * 92.39
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACAGAGGAAGCTGATTTTAGCGAGCAAATCACCGATGGGAAAAACAA
C2 ATGACAGAGGAAGCTGATTTTAGCGAGCAAATCACCGATGGGAAAAACAA
C3 ATGACCGAGGAAGCTGATTTCAGCGAGCAAATCGTTGATGGAAAAAACAA
C4 ATGACAGAGGAAGCCGATTTTAGCGAGCAAATCACAGATGGAAAAAACAA
C5 ATGACGGAGGTTACTGATTTTAGTGAGCAAATATCCAATGGAAAGAACAT
C6 ATGACAGAAGAGGCTGATTTTAGTGACCAAATAGTTGATGGAAAGAACAA
C7 ATGACAGAAGAGGCTGATTTTAGTGACCAAATAGTTGATGGAAAGAACAA
***** **.*: .* ***** ** ** *****. .****.**.****:
C1 ATCAAATGTGCGCTGCCAGTTTTGCAACTGTTTGATGCTGAAAGCACAAG
C2 ATCAAATGTGCGCTGCCAGTTTTGCAACAGCTTGATGCTGAAAGCCCAAG
C3 ATCAAATGTGCGCTGCCAGTTCTGCAACAGTTTGATGCTGAAAGCCCAAG
C4 ATCAAATGTGCGCTGCCAGTTCTGCAACAGTTTGATGCTGAAAGCCCAGG
C5 ATTAAATGTGCGCTGCCAGTTCTGCAATAGTTTGATGCTCAAGGCCCAAG
C6 ATCAAATGTGCGCTGCCAGTTCTGCAATAGTTTGATGCTCAAGGCTCAGG
C7 ATCAAATGTGCGCTGCCAGTTCTGCAATAGTTTGATGCTCAAGGCTCAGG
** ****************** ***** :* ******** **.** **.*
C1 AGGGCACCTACAACCAGGAGGAGGTGGATGTGCCACTGATGACGCAGAAG
C2 AGGGCACCTACAATCAGGAGGAGGTGGATGTGCCGCTGATGATGCAGAAG
C3 AGGGCACCTACAACCAGGAGGAGGTGGATGTGCCACTGATGATGCAGAAG
C4 AGGGCGCCTACAACCAGGAGAAGGTGGATGTGCCACTGATGATGCAGAAA
C5 AGGGAACCTACAGCCAGGAGGAAGTGGAAGTGCCCCTGATGATGCAAAAA
C6 AGGGCACCTTCAGCGCGGAGGAAGTGGAAGTGCCCCTGATGATGCAAAAA
C7 AGGGCACCTTCAGCGCGGAGGAAGTGGAAGTGCCCCTGATGATGCAAAAA
****..***:**. .****.*.*****:***** ******* ***.**.
C1 CAGGATCGAACGGCGGACAGCCTAAACAGCGAGCCACTGAAAGACTTCTG
C2 CAGGATCGATCGGCGGACAGCCTAAACAGCGAGCCACTGAAGGACTTCTG
C3 CAGGACCGAACAGCGGACAGCCTAAACAGCGAGCCACTGAAGGACTTCTG
C4 CAGGACCAAACGGCGGACAGCCTGAACAGCGAGCCACTGAAGGACTTCTG
C5 CAGGACAGGACGGCGGACAGTCTGAACAGCGAGCCACTGAAGGACTTTTG
C6 CAGGACAGAACGGCGGACAGTCTGAACAGCGAGCCATTGAAGGACTTCTG
C7 CAGGACAGAACGGCGGACAGTCTGAACAGCGAGCCATTGAAGGACTTCTG
***** ...:*.******** **.************ ****.***** **
C1 GCTGGTCAAGGACATGATGACATTCGAGAACATCGGGTTCTCCAACACGG
C2 GCTGGTCAAGGACATGATGACGTTCGAGAACATCGGCTTCTCCAATACGG
C3 GCTGGTTAAGGACATGATGACGTTCGAGAACATCGGCTTCTCCAACACGC
C4 GCTGGTCAAGGACATGATGACGTTCGAGAACATCGGGTTCTCCAACACGG
C5 GCTGGTCAAGGACATGATGATGTTCGAGAATATTGGATTCTCCAACACGG
C6 GCTGGTCAAGGACATGATGACGTTCGAGAATATCGGATTCTCCCACACAG
C7 GCTGGTCAAGGACATGATGACGTTCGAGAATATCGGATTCTCCCACACAG
****** ************* .******** ** ** ******.* **.
C1 TGGACGGCAGAAAGTTTCTGGTTTGCGCGGACTGCGAGCGAGGACCTGTG
C2 TGGACGGCAGAAAGTTCCTGGTTTGCGCGGACTGCGAGCGAGGACCCGTG
C3 TGGACGGCAGGAAGTTCCTGGTTTGTGCGGACTGCGAGCGAGGACCCGTG
C4 TGGACGGCAGAAAGTTCCTGGTTTGTGCAGACTGCGAGCGAGGACCCGTG
C5 TGGATGGCAGGAAGTTCCTGGTTTGTGCGGATTGCGAGCGAGGACCAGTG
C6 TGGACGGCAGGAAGTTCCTGGTTTGTGCGGATTGCGAGCGAGGACCCGTT
C7 TGGACGGCAGGAAGTTCCTGGTTTGTGCGGATTGCGAGCGAGGACCCGTT
**** *****.***** ******** **.** ************** **
C1 GGCTACCATGATCTGAGCACCCGCCACTGCTATCTGGCCCTCAAGAGGGT
C2 GGCTACCATGATCTGAGCACCCGACACTGCTACCTGGCCCTCAAGAGGGT
C3 GGCTACCATGATCTGAGCACCCGCCACTGCTTCCTGGCCCTCAAGAGGGT
C4 GGCTACCATGATCTGAGCACCCGCCACTGCTTCCTGGCCCTCCAAAGGGT
C5 GGCTATCATGATCTGAGCACCCGCCACTGTTTCCTGGCCCTCAAAAGAGT
C6 GGCTATCATGATCTGACCACCCGCCACTGCTTCCTGGCCCTCAAGAGGGT
C7 GGCTATCATGATCTGACCACCCGCCACTGCTTCCTGGCCCTCAAGAGGGT
***** ********** ******.***** *: *********.*.**.**
C1 GGTGCACAAGGACACC
C2 GGTGCACAAGGACACC
C3 GGTCCACAAGGACACC
C4 GGTTCACAAGGACACC
C5 GGTCCACAAGGACTCC
C6 GGTCCACAAGGACTCC
C7 GGTCCACAAGGACTCC
*** *********:**
>C1
ATGACAGAGGAAGCTGATTTTAGCGAGCAAATCACCGATGGGAAAAACAA
ATCAAATGTGCGCTGCCAGTTTTGCAACTGTTTGATGCTGAAAGCACAAG
AGGGCACCTACAACCAGGAGGAGGTGGATGTGCCACTGATGACGCAGAAG
CAGGATCGAACGGCGGACAGCCTAAACAGCGAGCCACTGAAAGACTTCTG
GCTGGTCAAGGACATGATGACATTCGAGAACATCGGGTTCTCCAACACGG
TGGACGGCAGAAAGTTTCTGGTTTGCGCGGACTGCGAGCGAGGACCTGTG
GGCTACCATGATCTGAGCACCCGCCACTGCTATCTGGCCCTCAAGAGGGT
GGTGCACAAGGACACC
>C2
ATGACAGAGGAAGCTGATTTTAGCGAGCAAATCACCGATGGGAAAAACAA
ATCAAATGTGCGCTGCCAGTTTTGCAACAGCTTGATGCTGAAAGCCCAAG
AGGGCACCTACAATCAGGAGGAGGTGGATGTGCCGCTGATGATGCAGAAG
CAGGATCGATCGGCGGACAGCCTAAACAGCGAGCCACTGAAGGACTTCTG
GCTGGTCAAGGACATGATGACGTTCGAGAACATCGGCTTCTCCAATACGG
TGGACGGCAGAAAGTTCCTGGTTTGCGCGGACTGCGAGCGAGGACCCGTG
GGCTACCATGATCTGAGCACCCGACACTGCTACCTGGCCCTCAAGAGGGT
GGTGCACAAGGACACC
>C3
ATGACCGAGGAAGCTGATTTCAGCGAGCAAATCGTTGATGGAAAAAACAA
ATCAAATGTGCGCTGCCAGTTCTGCAACAGTTTGATGCTGAAAGCCCAAG
AGGGCACCTACAACCAGGAGGAGGTGGATGTGCCACTGATGATGCAGAAG
CAGGACCGAACAGCGGACAGCCTAAACAGCGAGCCACTGAAGGACTTCTG
GCTGGTTAAGGACATGATGACGTTCGAGAACATCGGCTTCTCCAACACGC
TGGACGGCAGGAAGTTCCTGGTTTGTGCGGACTGCGAGCGAGGACCCGTG
GGCTACCATGATCTGAGCACCCGCCACTGCTTCCTGGCCCTCAAGAGGGT
GGTCCACAAGGACACC
>C4
ATGACAGAGGAAGCCGATTTTAGCGAGCAAATCACAGATGGAAAAAACAA
ATCAAATGTGCGCTGCCAGTTCTGCAACAGTTTGATGCTGAAAGCCCAGG
AGGGCGCCTACAACCAGGAGAAGGTGGATGTGCCACTGATGATGCAGAAA
CAGGACCAAACGGCGGACAGCCTGAACAGCGAGCCACTGAAGGACTTCTG
GCTGGTCAAGGACATGATGACGTTCGAGAACATCGGGTTCTCCAACACGG
TGGACGGCAGAAAGTTCCTGGTTTGTGCAGACTGCGAGCGAGGACCCGTG
GGCTACCATGATCTGAGCACCCGCCACTGCTTCCTGGCCCTCCAAAGGGT
GGTTCACAAGGACACC
>C5
ATGACGGAGGTTACTGATTTTAGTGAGCAAATATCCAATGGAAAGAACAT
ATTAAATGTGCGCTGCCAGTTCTGCAATAGTTTGATGCTCAAGGCCCAAG
AGGGAACCTACAGCCAGGAGGAAGTGGAAGTGCCCCTGATGATGCAAAAA
CAGGACAGGACGGCGGACAGTCTGAACAGCGAGCCACTGAAGGACTTTTG
GCTGGTCAAGGACATGATGATGTTCGAGAATATTGGATTCTCCAACACGG
TGGATGGCAGGAAGTTCCTGGTTTGTGCGGATTGCGAGCGAGGACCAGTG
GGCTATCATGATCTGAGCACCCGCCACTGTTTCCTGGCCCTCAAAAGAGT
GGTCCACAAGGACTCC
>C6
ATGACAGAAGAGGCTGATTTTAGTGACCAAATAGTTGATGGAAAGAACAA
ATCAAATGTGCGCTGCCAGTTCTGCAATAGTTTGATGCTCAAGGCTCAGG
AGGGCACCTTCAGCGCGGAGGAAGTGGAAGTGCCCCTGATGATGCAAAAA
CAGGACAGAACGGCGGACAGTCTGAACAGCGAGCCATTGAAGGACTTCTG
GCTGGTCAAGGACATGATGACGTTCGAGAATATCGGATTCTCCCACACAG
TGGACGGCAGGAAGTTCCTGGTTTGTGCGGATTGCGAGCGAGGACCCGTT
GGCTATCATGATCTGACCACCCGCCACTGCTTCCTGGCCCTCAAGAGGGT
GGTCCACAAGGACTCC
>C7
ATGACAGAAGAGGCTGATTTTAGTGACCAAATAGTTGATGGAAAGAACAA
ATCAAATGTGCGCTGCCAGTTCTGCAATAGTTTGATGCTCAAGGCTCAGG
AGGGCACCTTCAGCGCGGAGGAAGTGGAAGTGCCCCTGATGATGCAAAAA
CAGGACAGAACGGCGGACAGTCTGAACAGCGAGCCATTGAAGGACTTCTG
GCTGGTCAAGGACATGATGACGTTCGAGAATATCGGATTCTCCCACACAG
TGGACGGCAGGAAGTTCCTGGTTTGTGCGGATTGCGAGCGAGGACCCGTT
GGCTATCATGATCTGACCACCCGCCACTGCTTCCTGGCCCTCAAGAGGGT
GGTCCACAAGGACTCC
>C1
MTEEADFSEQITDGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCYLALKRVVHKDT
>C2
MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK
QDRSADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCYLALKRVVHKDT
>C3
MTEEADFSEQIVDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTLDGRKFLVCADCERGPV
GYHDLSTRHCFLALKRVVHKDT
>C4
MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGAYNQEKVDVPLMMQK
QDQTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCFLALQRVVHKDT
>C5
MTEVTDFSEQISNGKNILNVRCQFCNSLMLKAQEGTYSQEEVEVPLMMQK
QDRTADSLNSEPLKDFWLVKDMMMFENIGFSNTVDGRKFLVCADCERGPV
GYHDLSTRHCFLALKRVVHKDS
>C6
MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV
GYHDLTTRHCFLALKRVVHKDS
>C7
MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK
QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV
GYHDLTTRHCFLALKRVVHKDS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 7 taxa and 366 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478775110
Setting output file names to "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2099514477
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4142185320
Seed = 1559530778
Swapseed = 1478775110
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 17 unique site patterns
Division 2 has 14 unique site patterns
Division 3 has 43 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1316.477238 -- -24.557203
Chain 2 -- -1358.999396 -- -24.557203
Chain 3 -- -1393.932731 -- -24.557203
Chain 4 -- -1350.636919 -- -24.557203
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1341.889675 -- -24.557203
Chain 2 -- -1289.728641 -- -24.557203
Chain 3 -- -1395.006030 -- -24.557203
Chain 4 -- -1400.197194 -- -24.557203
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1316.477] (-1358.999) (-1393.933) (-1350.637) * [-1341.890] (-1289.729) (-1395.006) (-1400.197)
500 -- (-1025.745) [-1026.530] (-1041.995) (-1031.986) * (-1023.180) (-1012.641) [-1030.839] (-1030.749) -- 0:00:00
1000 -- (-1014.265) [-1014.790] (-1020.709) (-1024.957) * (-1019.701) [-1009.815] (-1015.426) (-1016.929) -- 0:00:00
1500 -- [-1006.329] (-1005.621) (-1019.313) (-1019.434) * [-1018.069] (-1010.728) (-1012.621) (-1016.983) -- 0:00:00
2000 -- (-1013.390) (-1006.425) [-1015.741] (-1023.388) * (-1012.331) (-1002.383) (-1004.985) [-1006.445] -- 0:08:19
2500 -- (-1001.348) [-1004.873] (-1012.079) (-1001.750) * (-1006.227) (-1007.042) [-995.519] (-1002.191) -- 0:06:39
3000 -- (-1010.077) (-998.343) (-1010.424) [-998.800] * (-999.550) (-999.395) [-991.015] (-1006.613) -- 0:05:32
3500 -- (-994.891) (-998.322) (-1006.687) [-1007.862] * (-1001.419) (-1000.335) [-990.596] (-1004.093) -- 0:04:44
4000 -- (-1001.014) [-990.912] (-1005.838) (-996.697) * (-1008.175) (-1007.110) [-993.522] (-997.832) -- 0:04:09
4500 -- [-993.889] (-999.579) (-997.312) (-1005.633) * (-999.691) [-997.705] (-998.758) (-994.486) -- 0:03:41
5000 -- [-995.155] (-998.642) (-993.352) (-1006.012) * (-1009.841) (-1000.760) [-989.857] (-993.256) -- 0:03:19
Average standard deviation of split frequencies: 0.000000
5500 -- (-992.315) (-988.963) (-997.214) [-990.695] * (-1000.464) [-999.471] (-992.459) (-990.354) -- 0:03:00
6000 -- [-988.688] (-1002.402) (-999.048) (-995.408) * (-1005.431) (-1000.370) (-999.431) [-993.553] -- 0:02:45
6500 -- (-994.210) (-1000.312) [-999.207] (-993.819) * (-1000.122) (-996.861) [-992.603] (-992.113) -- 0:05:05
7000 -- [-992.889] (-999.065) (-1000.820) (-988.789) * [-1005.744] (-992.890) (-996.916) (-990.536) -- 0:04:43
7500 -- (-998.899) (-996.641) [-998.824] (-997.162) * (-998.819) (-1001.377) [-991.564] (-991.153) -- 0:04:24
8000 -- (-997.707) (-990.107) (-993.437) [-991.694] * (-997.299) (-997.728) [-989.906] (-998.434) -- 0:04:08
8500 -- (-992.207) [-993.769] (-993.243) (-993.614) * (-989.442) (-995.275) [-997.126] (-1003.717) -- 0:03:53
9000 -- (-992.073) (-994.724) [-994.689] (-991.652) * (-992.921) [-995.909] (-992.651) (-996.701) -- 0:03:40
9500 -- [-992.350] (-998.476) (-990.570) (-991.099) * (-996.595) [-997.630] (-994.213) (-997.238) -- 0:03:28
10000 -- [-995.667] (-1001.952) (-994.807) (-994.079) * [-992.784] (-995.513) (-1003.056) (-994.976) -- 0:03:18
Average standard deviation of split frequencies: 0.008839
10500 -- [-991.166] (-993.940) (-994.095) (-992.081) * (-992.788) [-998.443] (-996.987) (-998.321) -- 0:03:08
11000 -- (-990.093) (-994.265) [-997.031] (-995.972) * (-995.133) (-991.701) (-997.331) [-993.380] -- 0:04:29
11500 -- (-995.838) [-986.719] (-995.315) (-992.037) * (-991.219) (-995.566) [-994.505] (-992.580) -- 0:04:17
12000 -- (-998.801) (-990.984) (-992.248) [-996.187] * (-993.229) [-990.979] (-987.018) (-992.086) -- 0:04:07
12500 -- (-999.881) [-993.835] (-1001.058) (-994.250) * (-994.892) (-996.326) [-989.826] (-999.385) -- 0:03:57
13000 -- (-1001.642) (-996.354) [-993.230] (-994.016) * (-994.458) [-995.947] (-992.915) (-995.164) -- 0:03:47
13500 -- (-1001.462) (-993.479) [-994.295] (-994.212) * [-997.247] (-1002.667) (-992.966) (-1001.041) -- 0:03:39
14000 -- [-996.111] (-995.836) (-987.956) (-992.201) * (-992.140) (-994.194) [-992.490] (-999.666) -- 0:03:31
14500 -- (-1001.080) [-987.906] (-989.614) (-1003.104) * (-994.213) [-994.468] (-993.903) (-990.348) -- 0:03:23
15000 -- (-1002.004) (-994.024) [-994.909] (-1000.683) * (-995.908) [-996.913] (-997.004) (-1000.497) -- 0:03:17
Average standard deviation of split frequencies: 0.029463
15500 -- (-996.683) [-992.174] (-1002.494) (-998.666) * (-994.729) (-993.215) [-989.704] (-1001.050) -- 0:04:14
16000 -- (-990.015) (-999.150) [-990.086] (-996.480) * (-990.806) (-994.552) (-996.874) [-994.897] -- 0:04:06
16500 -- [-990.085] (-991.932) (-991.035) (-1005.005) * [-991.263] (-997.127) (-1003.349) (-990.371) -- 0:03:58
17000 -- [-991.240] (-996.564) (-996.262) (-1001.489) * (-990.868) (-997.517) [-995.775] (-993.573) -- 0:03:51
17500 -- (-988.477) [-990.749] (-996.058) (-992.998) * (-1000.016) (-994.754) [-991.358] (-988.349) -- 0:03:44
18000 -- [-992.912] (-989.537) (-990.381) (-1008.015) * [-990.157] (-1001.641) (-991.142) (-1005.389) -- 0:03:38
18500 -- (-992.114) [-990.141] (-990.972) (-1003.520) * [-988.464] (-994.192) (-989.699) (-999.215) -- 0:03:32
19000 -- (-999.820) (-989.167) (-989.929) [-1000.819] * (-992.166) (-999.791) [-1001.512] (-997.165) -- 0:03:26
19500 -- [-992.356] (-995.714) (-998.788) (-998.635) * (-994.605) (-997.074) (-992.685) [-997.319] -- 0:04:11
20000 -- (-989.921) [-993.369] (-999.898) (-997.896) * [-995.221] (-999.714) (-990.999) (-996.117) -- 0:04:05
Average standard deviation of split frequencies: 0.018248
20500 -- (-1006.733) (-991.793) [-992.806] (-1000.329) * (-996.753) [-995.791] (-1000.730) (-995.868) -- 0:03:58
21000 -- [-988.482] (-988.097) (-994.529) (-1001.591) * [-996.637] (-997.030) (-1002.393) (-996.435) -- 0:03:53
21500 -- (-991.308) [-993.356] (-989.919) (-990.045) * (-998.202) [-990.969] (-992.512) (-996.938) -- 0:03:47
22000 -- (-992.454) (-1003.663) [-991.199] (-988.471) * [-992.197] (-997.110) (-994.362) (-997.628) -- 0:03:42
22500 -- (-988.359) (-1000.855) (-992.273) [-995.374] * [-990.249] (-994.340) (-1011.188) (-998.655) -- 0:03:37
23000 -- (-996.987) (-993.766) [-994.329] (-1003.334) * (-1004.094) (-992.063) (-992.112) [-992.203] -- 0:03:32
23500 -- (-994.855) [-994.176] (-994.161) (-992.312) * (-997.638) [-993.563] (-988.895) (-997.273) -- 0:03:27
24000 -- (-996.014) [-991.353] (-994.017) (-993.468) * (-1000.805) [-995.098] (-995.955) (-992.781) -- 0:04:04
24500 -- (-997.339) (-1002.416) [-991.278] (-998.177) * (-996.644) (-987.893) [-991.817] (-996.367) -- 0:03:58
25000 -- (-997.663) (-993.134) [-996.885] (-998.084) * (-991.608) (-992.050) [-990.376] (-991.652) -- 0:03:54
Average standard deviation of split frequencies: 0.007252
25500 -- (-993.949) (-994.783) [-991.474] (-993.487) * [-994.017] (-999.792) (-998.587) (-998.678) -- 0:03:49
26000 -- (-1004.296) (-998.603) [-993.150] (-991.776) * (-992.905) [-992.674] (-1000.359) (-988.006) -- 0:03:44
26500 -- [-1001.136] (-996.158) (-993.013) (-995.374) * (-989.878) (-997.667) (-994.522) [-995.420] -- 0:03:40
27000 -- (-996.765) (-994.782) (-996.369) [-998.857] * (-992.252) [-994.254] (-991.402) (-997.176) -- 0:03:36
27500 -- (-997.875) (-998.030) (-995.632) [-993.822] * [-990.308] (-990.543) (-990.973) (-1000.937) -- 0:03:32
28000 -- (-1003.682) (-995.184) [-1001.384] (-990.995) * (-988.037) (-995.310) [-991.659] (-992.445) -- 0:03:28
28500 -- (-1000.349) (-993.063) (-996.077) [-992.194] * [-991.871] (-998.074) (-990.668) (-996.912) -- 0:03:58
29000 -- (-995.565) (-993.196) [-997.916] (-995.559) * (-991.886) (-993.828) (-993.024) [-994.930] -- 0:03:54
29500 -- (-995.193) [-988.883] (-991.094) (-994.426) * (-992.227) (-999.195) [-995.912] (-996.875) -- 0:03:50
30000 -- (-992.048) [-989.450] (-994.192) (-998.600) * (-996.956) (-1000.490) [-993.976] (-1005.651) -- 0:03:46
Average standard deviation of split frequencies: 0.020496
30500 -- (-991.986) [-991.306] (-1000.591) (-992.068) * (-993.758) (-995.373) (-1001.074) [-994.282] -- 0:03:42
31000 -- [-998.880] (-992.561) (-987.666) (-993.075) * (-1001.983) (-1003.717) [-992.727] (-1003.376) -- 0:03:38
31500 -- (-993.214) [-989.761] (-991.813) (-996.792) * (-996.629) (-990.425) (-995.860) [-995.190] -- 0:03:35
32000 -- (-1004.399) (-989.999) [-990.989] (-996.193) * [-992.578] (-991.695) (-996.382) (-994.580) -- 0:03:31
32500 -- (-991.969) (-995.355) (-997.095) [-996.090] * [-992.501] (-998.116) (-996.425) (-994.130) -- 0:03:28
33000 -- (-993.462) [-995.422] (-989.884) (-996.122) * (-991.384) (-993.240) [-993.712] (-992.692) -- 0:03:54
33500 -- (-994.134) (-1000.662) [-996.215] (-997.375) * [-991.003] (-994.042) (-991.462) (-988.010) -- 0:03:50
34000 -- [-991.008] (-998.481) (-990.793) (-998.310) * (-995.389) (-992.599) (-991.745) [-997.787] -- 0:03:47
34500 -- (-989.526) (-994.174) [-991.000] (-1000.311) * (-992.920) (-1001.177) [-987.236] (-1000.810) -- 0:03:43
35000 -- (-999.069) [-995.505] (-992.673) (-1002.589) * (-995.010) (-993.884) [-987.367] (-999.985) -- 0:03:40
Average standard deviation of split frequencies: 0.013095
35500 -- (-994.361) [-995.417] (-993.583) (-997.987) * (-996.737) (-998.126) [-991.212] (-994.026) -- 0:03:37
36000 -- (-998.929) (-995.586) [-995.181] (-996.699) * (-1002.734) (-991.730) [-988.764] (-998.206) -- 0:03:34
36500 -- (-996.499) [-993.798] (-992.681) (-991.538) * (-989.963) (-995.533) [-992.595] (-997.471) -- 0:03:31
37000 -- (-990.915) [-994.535] (-996.001) (-996.157) * (-989.084) (-994.686) (-994.909) [-994.326] -- 0:03:28
37500 -- (-998.374) [-989.925] (-989.820) (-992.613) * (-990.974) (-995.065) (-994.894) [-994.074] -- 0:03:51
38000 -- [-991.223] (-992.591) (-991.455) (-998.320) * (-994.213) [-997.565] (-997.374) (-1003.259) -- 0:03:47
38500 -- (-992.022) (-996.875) (-1002.317) [-990.407] * [-992.809] (-994.719) (-1008.829) (-1000.910) -- 0:03:44
39000 -- (-993.671) [-989.409] (-1000.540) (-995.802) * (-990.151) [-993.210] (-1011.615) (-997.629) -- 0:03:41
39500 -- (-992.497) [-992.320] (-1004.645) (-999.899) * (-993.746) (-992.210) (-1005.934) [-1001.302] -- 0:03:38
40000 -- [-992.499] (-997.839) (-1002.687) (-994.348) * (-995.698) (-986.560) [-996.383] (-999.447) -- 0:03:36
Average standard deviation of split frequencies: 0.015456
40500 -- (-993.156) [-998.188] (-998.440) (-993.937) * (-999.505) [-993.406] (-1002.411) (-996.163) -- 0:03:33
41000 -- (-989.298) (-999.149) (-984.929) [-990.709] * (-1015.083) [-993.647] (-989.520) (-993.417) -- 0:03:30
41500 -- (-988.171) [-990.415] (-994.850) (-998.119) * (-998.479) (-994.045) (-996.219) [-995.777] -- 0:03:27
42000 -- (-992.456) [-993.646] (-999.141) (-992.833) * (-997.621) (-997.618) (-992.503) [-989.407] -- 0:03:48
42500 -- [-990.281] (-996.948) (-996.482) (-992.980) * (-1003.502) (-995.180) [-992.961] (-1001.369) -- 0:03:45
43000 -- (-992.402) (-1004.894) [-994.855] (-990.587) * (-1008.349) (-996.341) (-1000.073) [-992.989] -- 0:03:42
43500 -- [-987.477] (-990.048) (-992.304) (-996.744) * (-993.633) (-992.666) [-991.130] (-990.010) -- 0:03:39
44000 -- [-986.977] (-999.095) (-990.964) (-990.651) * (-996.594) [-1000.553] (-1003.331) (-996.425) -- 0:03:37
44500 -- (-991.718) [-994.382] (-990.376) (-997.226) * (-993.434) (-995.799) [-993.838] (-993.387) -- 0:03:34
45000 -- [-989.508] (-994.307) (-987.870) (-992.195) * (-998.094) [-993.448] (-994.364) (-997.306) -- 0:03:32
Average standard deviation of split frequencies: 0.023912
45500 -- (-993.431) (-991.022) [-987.962] (-991.789) * (-991.400) [-993.704] (-994.547) (-996.695) -- 0:03:29
46000 -- (-995.803) (-998.039) [-989.242] (-999.438) * (-992.956) (-993.101) (-993.835) [-992.660] -- 0:03:27
46500 -- (-996.971) (-1001.079) [-989.899] (-997.890) * (-1000.214) (-1003.287) (-997.595) [-991.947] -- 0:03:45
47000 -- (-992.310) [-993.475] (-1003.270) (-992.308) * (-995.828) (-992.734) (-993.156) [-992.128] -- 0:03:43
47500 -- (-992.909) [-992.884] (-990.361) (-992.479) * (-995.660) (-989.890) [-988.736] (-990.756) -- 0:03:40
48000 -- (-995.460) (-999.293) (-993.764) [-997.186] * (-994.152) (-1001.235) (-995.444) [-988.730] -- 0:03:38
48500 -- [-989.461] (-1002.384) (-996.154) (-998.959) * (-994.666) (-997.355) (-996.064) [-994.388] -- 0:03:35
49000 -- [-994.384] (-1004.082) (-989.725) (-995.691) * (-994.881) [-993.232] (-998.954) (-993.801) -- 0:03:33
49500 -- (-997.377) (-991.124) [-993.280] (-995.699) * (-993.483) [-995.573] (-990.322) (-1002.053) -- 0:03:31
50000 -- [-989.275] (-993.697) (-995.372) (-990.052) * (-998.292) (-997.837) [-992.218] (-992.522) -- 0:03:29
Average standard deviation of split frequencies: 0.020469
50500 -- (-999.934) (-994.014) (-994.129) [-1002.982] * (-999.092) (-991.408) [-991.098] (-993.750) -- 0:03:26
51000 -- [-996.710] (-996.375) (-992.943) (-993.028) * (-996.079) [-991.029] (-991.588) (-994.801) -- 0:03:43
51500 -- (-987.593) (-999.334) [-1000.950] (-1000.103) * [-994.133] (-989.673) (-993.664) (-995.551) -- 0:03:41
52000 -- (-997.067) [-994.517] (-997.964) (-993.143) * (-996.397) (-989.797) (-993.006) [-1001.718] -- 0:03:38
52500 -- (-994.878) [-988.701] (-995.137) (-997.398) * (-999.538) [-996.103] (-996.323) (-998.294) -- 0:03:36
53000 -- (-994.617) (-991.074) [-989.536] (-995.875) * [-993.053] (-998.294) (-999.878) (-991.537) -- 0:03:34
53500 -- [-995.622] (-988.819) (-987.362) (-997.551) * (-998.056) (-999.551) (-998.891) [-990.407] -- 0:03:32
54000 -- (-993.150) [-987.632] (-993.048) (-997.261) * (-996.783) [-999.946] (-1002.117) (-998.969) -- 0:03:30
54500 -- (-990.054) [-998.642] (-993.295) (-989.117) * (-998.391) [-997.976] (-990.691) (-997.009) -- 0:03:28
55000 -- (-996.612) [-994.647] (-990.095) (-988.263) * (-994.727) [-988.059] (-1000.056) (-994.178) -- 0:03:43
Average standard deviation of split frequencies: 0.011785
55500 -- (-993.977) [-992.250] (-992.572) (-1001.074) * (-994.709) [-992.005] (-992.289) (-991.133) -- 0:03:41
56000 -- [-991.694] (-993.494) (-999.650) (-991.885) * (-995.819) (-996.906) (-990.672) [-989.735] -- 0:03:39
56500 -- (-991.040) [-992.557] (-993.577) (-992.990) * (-1002.033) (-1001.825) [-995.441] (-999.119) -- 0:03:37
57000 -- (-994.887) (-1002.358) (-989.450) [-994.547] * (-990.646) [-992.400] (-994.632) (-995.805) -- 0:03:35
57500 -- (-985.667) (-993.942) (-988.422) [-988.890] * [-989.222] (-994.226) (-998.460) (-997.147) -- 0:03:33
58000 -- (-996.484) (-996.169) [-990.318] (-994.653) * (-996.029) (-993.100) (-991.683) [-994.095] -- 0:03:31
58500 -- [-989.834] (-992.786) (-995.489) (-995.914) * (-995.259) (-995.721) (-991.486) [-990.772] -- 0:03:29
59000 -- [-994.033] (-992.344) (-994.117) (-994.531) * (-992.182) (-993.274) [-992.231] (-994.658) -- 0:03:27
59500 -- (-988.819) (-992.424) [-988.916] (-994.532) * (-993.760) [-993.174] (-1007.604) (-993.279) -- 0:03:41
60000 -- (-995.790) [-992.234] (-998.413) (-998.450) * (-993.520) [-986.003] (-992.573) (-998.532) -- 0:03:39
Average standard deviation of split frequencies: 0.020203
60500 -- (-1002.983) [-993.051] (-992.960) (-993.896) * [-988.841] (-991.088) (-993.754) (-994.047) -- 0:03:37
61000 -- [-986.549] (-989.906) (-994.831) (-996.283) * [-997.828] (-987.228) (-996.234) (-991.754) -- 0:03:35
61500 -- (-989.606) [-988.701] (-996.243) (-999.792) * (-991.596) (-997.692) [-991.595] (-997.916) -- 0:03:33
62000 -- (-997.274) [-991.401] (-990.082) (-990.488) * (-1000.687) (-996.876) (-991.252) [-989.541] -- 0:03:31
62500 -- (-991.421) [-996.271] (-990.840) (-991.893) * (-993.412) (-994.614) [-994.739] (-992.894) -- 0:03:30
63000 -- (-995.612) (-994.564) [-990.954] (-990.229) * (-1000.424) [-994.031] (-993.158) (-995.005) -- 0:03:28
63500 -- [-989.883] (-994.737) (-994.488) (-998.412) * (-997.442) (-997.617) (-990.493) [-993.235] -- 0:03:26
64000 -- (-991.776) (-998.009) (-995.103) [-987.357] * [-994.161] (-995.930) (-998.152) (-992.981) -- 0:03:39
64500 -- [-986.467] (-1002.793) (-995.614) (-995.470) * (-989.413) [-988.460] (-993.571) (-990.211) -- 0:03:37
65000 -- (-995.675) (-993.267) [-992.037] (-994.575) * (-1002.203) (-998.352) [-995.863] (-998.077) -- 0:03:35
Average standard deviation of split frequencies: 0.015713
65500 -- (-991.054) [-986.629] (-999.002) (-987.126) * (-996.006) (-992.473) (-991.450) [-990.016] -- 0:03:34
66000 -- (-992.413) [-991.020] (-992.976) (-991.885) * (-995.764) (-1003.351) [-995.918] (-999.098) -- 0:03:32
66500 -- (-990.490) (-993.684) [-999.619] (-994.247) * (-992.178) (-1000.976) [-992.375] (-993.135) -- 0:03:30
67000 -- [-991.520] (-1003.090) (-1004.950) (-996.841) * (-999.283) (-994.832) (-997.554) [-991.095] -- 0:03:28
67500 -- (-1000.832) (-995.620) [-994.667] (-1003.060) * (-991.472) (-1009.995) (-1004.062) [-991.883] -- 0:03:27
68000 -- (-996.284) [-995.048] (-990.724) (-994.174) * (-989.265) (-1005.128) [-994.279] (-992.345) -- 0:03:25
68500 -- (-989.328) (-995.880) [-994.131] (-993.431) * [-992.311] (-992.835) (-1003.485) (-1006.249) -- 0:03:37
69000 -- (-992.826) (-997.045) (-994.522) [-992.220] * (-1005.058) (-996.661) (-998.263) [-999.427] -- 0:03:35
69500 -- (-993.627) (-999.767) (-992.523) [-990.678] * (-993.876) [-995.977] (-989.921) (-997.179) -- 0:03:34
70000 -- [-991.974] (-996.595) (-991.517) (-1006.874) * (-994.325) [-991.298] (-1004.211) (-992.524) -- 0:03:32
Average standard deviation of split frequencies: 0.014676
70500 -- [-993.219] (-993.520) (-992.936) (-997.172) * (-993.906) [-993.319] (-999.952) (-995.559) -- 0:03:30
71000 -- (-1002.087) (-990.459) [-996.352] (-994.672) * (-996.176) (-987.222) [-989.161] (-1005.120) -- 0:03:29
71500 -- [-992.876] (-988.098) (-999.040) (-1005.504) * (-994.264) (-991.419) [-989.726] (-994.688) -- 0:03:27
72000 -- [-993.081] (-997.259) (-992.471) (-998.687) * (-993.957) [-991.012] (-1001.183) (-991.430) -- 0:03:26
72500 -- (-1002.446) (-991.063) [-995.617] (-998.983) * (-993.533) [-991.744] (-995.250) (-994.472) -- 0:03:24
73000 -- (-999.431) [-994.484] (-1000.691) (-1005.976) * (-993.480) [-999.382] (-999.482) (-996.921) -- 0:03:35
73500 -- (-995.035) (-996.250) (-994.204) [-994.237] * (-995.741) [-993.327] (-991.069) (-1002.026) -- 0:03:34
74000 -- (-1002.052) (-996.473) [-996.415] (-991.993) * (-996.532) (-990.482) [-990.796] (-1002.229) -- 0:03:32
74500 -- (-995.743) [-991.727] (-992.495) (-999.355) * (-992.986) (-995.611) [-990.738] (-993.908) -- 0:03:31
75000 -- (-1002.028) (-995.848) [-988.303] (-1001.956) * (-996.005) [-989.549] (-992.441) (-1001.161) -- 0:03:29
Average standard deviation of split frequencies: 0.019849
75500 -- (-994.841) [-994.747] (-998.102) (-998.644) * [-1000.388] (-994.649) (-991.909) (-999.013) -- 0:03:28
76000 -- (-990.530) (-1001.287) (-990.159) [-995.942] * [-995.635] (-991.841) (-994.990) (-1001.775) -- 0:03:26
76500 -- (-991.278) (-1003.022) [-995.719] (-992.289) * (-993.049) (-994.366) (-997.287) [-993.792] -- 0:03:25
77000 -- (-995.508) (-994.369) [-989.361] (-994.234) * (-994.832) (-991.813) (-995.973) [-994.912] -- 0:03:35
77500 -- (-994.641) (-1003.734) (-994.348) [-992.672] * (-999.876) [-989.762] (-996.936) (-990.027) -- 0:03:34
78000 -- (-990.982) (-988.485) [-994.160] (-995.946) * (-1005.325) (-991.268) (-996.405) [-991.916] -- 0:03:32
78500 -- (-994.018) [-992.057] (-990.189) (-999.616) * (-998.302) (-996.328) [-990.385] (-995.378) -- 0:03:31
79000 -- (-995.051) (-993.934) [-995.673] (-991.838) * (-995.794) (-993.710) (-997.316) [-994.249] -- 0:03:29
79500 -- (-997.908) (-993.194) [-996.639] (-1005.676) * (-995.925) [-990.667] (-994.411) (-993.565) -- 0:03:28
80000 -- (-1002.102) [-993.796] (-995.447) (-1007.538) * (-1000.953) [-992.853] (-996.938) (-993.791) -- 0:03:27
Average standard deviation of split frequencies: 0.008181
80500 -- (-1002.824) [-995.561] (-1003.508) (-988.792) * (-997.579) (-1002.046) [-994.922] (-994.155) -- 0:03:25
81000 -- [-997.038] (-995.336) (-995.203) (-997.958) * (-999.228) (-999.329) (-990.944) [-990.275] -- 0:03:24
81500 -- (-992.089) (-998.333) (-993.288) [-993.496] * [-997.843] (-1004.358) (-993.554) (-988.551) -- 0:03:34
82000 -- (-992.443) (-995.206) (-992.535) [-996.081] * (-1000.654) (-992.767) [-993.079] (-992.708) -- 0:03:32
82500 -- [-997.017] (-992.552) (-997.738) (-998.782) * (-1005.267) (-998.878) [-991.233] (-993.520) -- 0:03:31
83000 -- (-997.319) (-991.303) (-1004.004) [-996.957] * (-1004.873) (-1000.712) [-992.924] (-993.760) -- 0:03:29
83500 -- (-997.270) (-991.965) (-997.308) [-989.957] * (-997.490) (-1001.145) (-997.134) [-998.258] -- 0:03:28
84000 -- (-995.918) (-993.310) (-1001.554) [-991.181] * (-996.152) (-998.493) [-990.808] (-994.584) -- 0:03:27
84500 -- (-996.379) (-996.945) (-992.982) [-990.002] * (-993.436) (-989.777) (-993.478) [-994.149] -- 0:03:25
85000 -- (-988.162) (-997.711) [-991.280] (-1002.518) * (-1003.576) (-995.482) (-991.286) [-991.859] -- 0:03:24
Average standard deviation of split frequencies: 0.008770
85500 -- [-993.334] (-996.448) (-997.214) (-992.752) * (-999.057) [-989.833] (-993.960) (-998.597) -- 0:03:23
86000 -- [-996.022] (-1002.281) (-992.079) (-991.401) * [-1003.146] (-995.233) (-991.580) (-998.204) -- 0:03:32
86500 -- [-990.155] (-995.689) (-994.149) (-991.237) * (-1010.394) (-996.788) [-998.057] (-993.859) -- 0:03:31
87000 -- (-992.142) (-994.473) (-998.552) [-997.203] * (-998.861) (-993.705) [-995.956] (-994.446) -- 0:03:29
87500 -- [-989.712] (-1000.618) (-995.677) (-993.909) * (-1002.813) (-998.345) (-996.947) [-1004.612] -- 0:03:28
88000 -- (-989.987) (-991.748) [-996.898] (-991.526) * (-995.382) [-991.360] (-995.011) (-1001.700) -- 0:03:27
88500 -- [-994.442] (-994.045) (-997.533) (-993.622) * (-1003.578) (-997.612) [-989.573] (-997.295) -- 0:03:25
89000 -- [-989.779] (-992.191) (-999.655) (-991.462) * (-1003.290) (-1000.541) [-993.417] (-989.654) -- 0:03:24
89500 -- (-996.526) (-996.747) (-994.807) [-989.246] * (-996.473) (-991.078) (-994.112) [-989.375] -- 0:03:23
90000 -- [-999.060] (-995.508) (-994.614) (-991.323) * (-996.460) (-999.945) [-988.126] (-987.315) -- 0:03:22
Average standard deviation of split frequencies: 0.009359
90500 -- (-993.622) [-999.001] (-993.497) (-1000.222) * (-999.848) (-1000.689) (-999.225) [-998.138] -- 0:03:20
91000 -- [-998.869] (-996.383) (-994.065) (-996.170) * (-992.902) [-991.838] (-997.490) (-995.993) -- 0:03:29
91500 -- (-997.478) (-988.528) [-988.134] (-992.255) * (-1001.628) (-997.335) [-991.088] (-992.689) -- 0:03:28
92000 -- (-996.157) (-990.932) [-990.495] (-1000.997) * [-994.889] (-996.144) (-992.369) (-994.888) -- 0:03:27
92500 -- (-995.164) (-995.451) (-992.714) [-991.980] * (-994.672) (-1000.364) (-991.382) [-992.552] -- 0:03:26
93000 -- (-993.417) [-986.914] (-1004.980) (-990.546) * (-989.239) [-995.812] (-996.485) (-998.403) -- 0:03:24
93500 -- (-996.093) (-990.647) (-996.355) [-991.371] * (-991.551) (-998.583) (-995.866) [-994.820] -- 0:03:23
94000 -- (-993.746) (-992.715) [-1001.528] (-991.217) * (-993.473) (-996.998) [-995.814] (-995.991) -- 0:03:22
94500 -- (-1002.308) (-990.841) [-1002.233] (-990.483) * [-996.142] (-1001.587) (-993.313) (-993.480) -- 0:03:21
95000 -- (-990.908) (-999.071) (-994.037) [-990.292] * (-994.774) (-995.791) [-991.232] (-994.081) -- 0:03:29
Average standard deviation of split frequencies: 0.009821
95500 -- (-990.424) (-996.248) (-994.798) [-992.147] * [-992.287] (-996.395) (-997.148) (-993.406) -- 0:03:28
96000 -- (-992.206) (-995.191) (-1002.747) [-987.533] * (-993.800) (-990.119) [-993.679] (-999.904) -- 0:03:27
96500 -- [-991.344] (-991.802) (-989.957) (-990.038) * (-995.971) (-996.193) [-990.342] (-1000.895) -- 0:03:25
97000 -- (-991.774) [-993.444] (-995.848) (-988.742) * (-995.616) [-993.900] (-998.532) (-1000.572) -- 0:03:24
97500 -- (-994.707) (-991.345) (-993.165) [-990.695] * (-996.406) (-988.937) [-992.820] (-989.264) -- 0:03:23
98000 -- (-1002.075) (-992.383) [-990.179] (-995.896) * (-998.416) (-1002.127) [-988.789] (-992.433) -- 0:03:22
98500 -- [-992.674] (-991.224) (-1000.126) (-998.027) * (-991.486) (-991.658) [-993.709] (-1001.813) -- 0:03:21
99000 -- [-993.545] (-994.071) (-998.333) (-1000.366) * (-995.387) (-995.490) (-1004.812) [-997.911] -- 0:03:20
99500 -- [-990.316] (-994.947) (-999.874) (-1005.426) * (-993.328) [-996.061] (-991.511) (-996.499) -- 0:03:28
100000 -- [-992.587] (-997.272) (-987.156) (-1005.004) * (-1001.139) (-994.324) [-992.340] (-1003.912) -- 0:03:27
Average standard deviation of split frequencies: 0.014985
100500 -- (-993.488) (-1000.191) [-991.081] (-1000.506) * (-992.791) (-995.306) [-997.784] (-998.482) -- 0:03:25
101000 -- (-992.517) (-989.528) (-999.850) [-990.601] * (-989.820) (-997.332) [-994.563] (-996.001) -- 0:03:24
101500 -- (-997.421) [-994.025] (-990.061) (-991.289) * (-996.979) (-995.096) (-1000.969) [-992.456] -- 0:03:23
102000 -- [-990.443] (-996.154) (-995.224) (-998.884) * (-997.274) (-993.513) [-994.381] (-998.557) -- 0:03:22
102500 -- [-987.875] (-1004.677) (-992.655) (-1003.285) * [-996.844] (-992.717) (-999.443) (-997.770) -- 0:03:21
103000 -- [-996.066] (-992.423) (-999.283) (-998.950) * [-995.946] (-989.810) (-991.502) (-994.039) -- 0:03:20
103500 -- (-996.213) (-992.770) [-996.348] (-992.150) * [-990.472] (-994.101) (-996.412) (-998.099) -- 0:03:19
104000 -- [-988.631] (-991.472) (-995.968) (-998.054) * (-991.345) [-996.330] (-990.059) (-991.508) -- 0:03:26
104500 -- (-992.211) (-994.951) (-996.238) [-991.006] * [-995.275] (-998.603) (-990.015) (-993.282) -- 0:03:25
105000 -- (-999.397) (-996.938) (-997.089) [-987.634] * [-993.155] (-996.320) (-991.054) (-994.288) -- 0:03:24
Average standard deviation of split frequencies: 0.014231
105500 -- (-993.074) (-998.172) (-994.487) [-992.106] * (-994.732) [-995.551] (-996.114) (-996.027) -- 0:03:23
106000 -- (-990.121) (-1000.763) (-998.052) [-986.808] * [-988.698] (-991.547) (-996.165) (-996.583) -- 0:03:22
106500 -- (-991.111) (-998.276) (-992.692) [-990.500] * (-991.276) (-996.842) [-995.051] (-1006.295) -- 0:03:21
107000 -- (-999.943) (-1001.655) (-998.478) [-993.723] * (-992.062) (-996.031) [-1001.721] (-1001.981) -- 0:03:20
107500 -- (-992.486) (-995.594) (-997.432) [-990.000] * (-992.567) (-995.414) (-995.310) [-1002.263] -- 0:03:19
108000 -- [-992.932] (-997.323) (-992.518) (-990.488) * (-997.681) (-991.305) [-996.288] (-990.622) -- 0:03:26
108500 -- (-990.093) [-992.202] (-988.554) (-993.423) * (-995.789) [-993.271] (-992.202) (-995.904) -- 0:03:25
109000 -- (-992.806) [-994.510] (-994.878) (-987.550) * (-992.365) (-995.450) [-989.613] (-992.952) -- 0:03:24
109500 -- [-989.063] (-989.674) (-992.103) (-997.748) * (-989.305) (-1000.969) [-995.825] (-992.064) -- 0:03:23
110000 -- (-990.977) (-993.427) [-995.315] (-992.676) * (-998.634) [-991.385] (-989.990) (-993.644) -- 0:03:22
Average standard deviation of split frequencies: 0.014483
110500 -- [-992.803] (-1002.439) (-991.106) (-995.270) * (-990.999) [-988.922] (-992.351) (-994.540) -- 0:03:21
111000 -- (-988.668) (-994.540) (-996.073) [-992.829] * [-993.444] (-992.235) (-996.048) (-993.772) -- 0:03:20
111500 -- (-994.877) (-997.787) [-995.216] (-997.460) * (-990.235) [-998.620] (-989.091) (-992.963) -- 0:03:19
112000 -- (-992.394) (-990.512) (-1000.022) [-994.126] * [-988.887] (-991.169) (-989.842) (-999.561) -- 0:03:18
112500 -- (-994.344) (-997.252) [-998.042] (-989.815) * (-992.036) [-993.471] (-993.052) (-997.022) -- 0:03:25
113000 -- (-994.651) [-993.768] (-995.919) (-998.146) * [-988.152] (-991.488) (-991.976) (-996.791) -- 0:03:24
113500 -- (-995.722) (-996.828) (-992.854) [-999.310] * (-991.278) (-991.741) (-1000.406) [-992.546] -- 0:03:23
114000 -- (-993.010) (-995.397) [-997.159] (-996.172) * [-989.619] (-996.292) (-996.471) (-990.532) -- 0:03:22
114500 -- (-998.181) (-997.412) (-995.238) [-995.028] * [-988.402] (-996.248) (-996.033) (-998.830) -- 0:03:21
115000 -- (-996.080) (-998.639) [-991.298] (-995.414) * [-997.099] (-993.148) (-997.532) (-997.625) -- 0:03:20
Average standard deviation of split frequencies: 0.021132
115500 -- (-993.995) (-995.561) [-990.470] (-993.875) * (-995.679) [-994.068] (-995.109) (-993.135) -- 0:03:19
116000 -- (-995.215) [-992.645] (-994.318) (-996.342) * (-994.148) (-991.128) (-993.851) [-1000.239] -- 0:03:18
116500 -- (-995.701) (-992.839) [-989.879] (-994.073) * (-1000.855) (-997.307) (-990.403) [-1000.725] -- 0:03:17
117000 -- (-994.065) [-993.861] (-994.347) (-995.251) * [-990.291] (-994.003) (-992.338) (-991.129) -- 0:03:23
117500 -- (-993.044) (-992.352) [-992.900] (-996.203) * (-996.215) (-997.612) [-987.368] (-991.365) -- 0:03:22
118000 -- (-1002.946) (-998.556) (-993.486) [-994.093] * [-995.826] (-1001.562) (-996.422) (-992.654) -- 0:03:21
118500 -- (-1000.047) (-998.605) (-993.828) [-1001.545] * (-996.799) [-992.462] (-988.038) (-995.289) -- 0:03:20
119000 -- [-993.242] (-994.386) (-990.405) (-998.724) * (-997.320) [-998.182] (-994.708) (-988.757) -- 0:03:19
119500 -- (-990.958) (-989.669) (-1001.314) [-993.448] * (-987.847) (-997.758) [-991.027] (-999.425) -- 0:03:18
120000 -- (-997.461) (-998.340) (-998.580) [-992.423] * (-989.910) (-997.099) (-992.071) [-990.320] -- 0:03:18
Average standard deviation of split frequencies: 0.017971
120500 -- (-997.493) (-994.995) [-990.023] (-995.575) * (-992.717) (-998.158) (-986.718) [-991.860] -- 0:03:17
121000 -- (-995.179) [-989.694] (-994.889) (-996.160) * (-999.762) (-996.369) [-994.320] (-995.453) -- 0:03:16
121500 -- (-995.427) (-992.722) [-990.574] (-992.515) * (-1000.754) [-996.656] (-990.581) (-991.957) -- 0:03:22
122000 -- [-991.473] (-998.781) (-1001.091) (-993.699) * (-992.530) (-998.068) [-988.684] (-994.624) -- 0:03:21
122500 -- [-986.553] (-992.378) (-989.727) (-994.322) * (-1001.953) (-992.798) (-988.442) [-990.260] -- 0:03:20
123000 -- (-988.293) (-991.898) (-1001.233) [-994.033] * (-1002.112) [-988.070] (-996.054) (-994.237) -- 0:03:19
123500 -- (-991.045) (-991.404) (-993.924) [-992.091] * (-993.002) (-993.475) (-990.590) [-986.815] -- 0:03:18
124000 -- (-988.104) (-998.158) (-1000.515) [-991.338] * (-1001.813) (-992.839) [-987.235] (-990.514) -- 0:03:17
124500 -- (-990.378) (-994.226) (-1007.950) [-993.192] * (-996.001) [-994.902] (-998.319) (-993.106) -- 0:03:16
125000 -- [-992.584] (-993.719) (-999.869) (-997.999) * [-994.845] (-991.548) (-993.216) (-998.033) -- 0:03:16
Average standard deviation of split frequencies: 0.014965
125500 -- (-996.930) (-997.643) (-996.882) [-995.070] * (-996.532) [-990.377] (-991.454) (-997.333) -- 0:03:15
126000 -- (-995.419) (-997.610) (-999.642) [-989.360] * (-1003.115) (-996.716) [-992.884] (-994.557) -- 0:03:21
126500 -- (-994.799) [-993.278] (-997.276) (-994.419) * (-992.884) (-999.483) (-998.254) [-991.032] -- 0:03:20
127000 -- (-992.741) [-992.929] (-997.886) (-999.209) * (-997.063) (-992.648) [-992.874] (-997.617) -- 0:03:19
127500 -- (-993.475) (-999.981) [-993.635] (-991.720) * (-998.656) [-995.465] (-994.956) (-999.644) -- 0:03:18
128000 -- (-999.293) [-990.342] (-994.587) (-993.617) * [-1001.393] (-991.299) (-988.518) (-996.762) -- 0:03:17
128500 -- (-995.153) (-994.528) [-995.347] (-990.322) * [-991.733] (-992.667) (-992.378) (-989.849) -- 0:03:16
129000 -- [-992.120] (-998.837) (-993.803) (-992.995) * [-987.219] (-1005.923) (-988.634) (-1000.461) -- 0:03:15
129500 -- (-989.172) (-1000.066) (-1007.263) [-996.650] * (-992.261) (-993.364) [-991.877] (-996.191) -- 0:03:14
130000 -- (-994.088) (-996.878) [-993.488] (-991.068) * (-990.733) (-997.178) (-999.812) [-994.243] -- 0:03:20
Average standard deviation of split frequencies: 0.013709
130500 -- [-1001.534] (-997.545) (-996.033) (-993.579) * (-990.596) (-992.862) [-988.371] (-994.215) -- 0:03:19
131000 -- (-998.802) (-995.344) [-992.159] (-993.103) * (-991.313) [-996.033] (-998.896) (-996.324) -- 0:03:19
131500 -- (-1001.832) (-995.618) (-996.112) [-990.033] * (-993.474) (-1000.922) [-992.175] (-998.705) -- 0:03:18
132000 -- (-997.931) [-989.127] (-1002.625) (-991.869) * (-1000.514) [-998.589] (-990.181) (-998.921) -- 0:03:17
132500 -- [-997.863] (-992.131) (-998.037) (-995.255) * (-997.122) (-992.509) [-989.321] (-997.251) -- 0:03:16
133000 -- [-993.844] (-996.389) (-994.632) (-997.120) * [-1000.287] (-996.611) (-992.400) (-986.680) -- 0:03:15
133500 -- (-993.500) (-996.875) (-993.383) [-990.264] * (-1000.805) [-990.465] (-1000.138) (-991.489) -- 0:03:14
134000 -- [-994.512] (-993.321) (-997.572) (-994.483) * (-990.610) [-986.391] (-986.174) (-989.906) -- 0:03:13
134500 -- [-993.102] (-996.809) (-996.082) (-993.251) * (-995.236) [-994.471] (-989.754) (-991.678) -- 0:03:19
135000 -- (-998.987) [-993.426] (-993.396) (-992.370) * (-996.084) (-1007.285) [-990.204] (-996.272) -- 0:03:18
Average standard deviation of split frequencies: 0.012478
135500 -- (-991.451) (-996.593) (-993.482) [-992.307] * (-993.645) (-995.933) (-999.635) [-990.270] -- 0:03:17
136000 -- (-1003.566) [-990.124] (-998.208) (-995.691) * (-992.562) (-992.101) (-998.738) [-993.009] -- 0:03:16
136500 -- (-993.272) [-992.132] (-1001.236) (-990.502) * [-994.231] (-994.790) (-996.032) (-988.684) -- 0:03:16
137000 -- (-1000.103) (-996.553) (-997.972) [-994.991] * (-991.348) (-995.596) (-996.088) [-989.515] -- 0:03:15
137500 -- (-990.735) (-1002.388) [-995.856] (-993.798) * [-995.094] (-993.358) (-998.304) (-992.734) -- 0:03:14
138000 -- [-990.129] (-1003.165) (-995.560) (-996.541) * (-994.122) [-991.098] (-1001.937) (-994.994) -- 0:03:13
138500 -- (-994.659) (-999.328) (-991.343) [-995.512] * (-995.645) (-989.048) (-996.903) [-991.390] -- 0:03:12
139000 -- [-1002.233] (-1000.490) (-994.650) (-990.774) * (-992.562) [-991.603] (-991.202) (-993.396) -- 0:03:18
139500 -- (-990.497) [-995.472] (-998.826) (-989.710) * [-995.289] (-991.746) (-994.777) (-997.986) -- 0:03:17
140000 -- [-991.732] (-989.074) (-994.466) (-1004.631) * (-999.729) [-989.412] (-989.024) (-993.640) -- 0:03:16
Average standard deviation of split frequencies: 0.012064
140500 -- (-996.367) [-992.783] (-994.563) (-990.906) * (-993.287) [-991.399] (-992.203) (-988.832) -- 0:03:15
141000 -- (-993.755) [-996.373] (-1001.436) (-993.937) * (-994.134) (-992.222) [-993.233] (-991.978) -- 0:03:14
141500 -- (-991.129) (-994.503) [-990.682] (-1004.554) * [-994.600] (-999.786) (-1003.878) (-993.798) -- 0:03:14
142000 -- (-996.991) [-989.301] (-992.196) (-992.917) * [-993.624] (-995.259) (-1005.883) (-1007.972) -- 0:03:13
142500 -- (-991.365) (-1002.611) [-989.105] (-994.473) * (-988.191) [-988.471] (-991.767) (-1002.695) -- 0:03:12
143000 -- [-992.958] (-995.737) (-991.008) (-996.237) * (-1005.797) (-1005.697) (-997.199) [-995.475] -- 0:03:11
143500 -- [-994.756] (-994.880) (-989.426) (-989.926) * (-993.319) (-1000.506) [-990.431] (-998.530) -- 0:03:16
144000 -- (-999.071) (-998.685) (-993.025) [-994.066] * (-988.782) (-996.822) (-995.041) [-990.600] -- 0:03:16
144500 -- (-993.638) [-988.194] (-995.805) (-994.234) * (-993.004) (-994.555) [-988.353] (-989.855) -- 0:03:15
145000 -- (-991.735) (-993.781) [-992.178] (-989.772) * (-999.225) (-997.758) (-990.684) [-995.231] -- 0:03:14
Average standard deviation of split frequencies: 0.013561
145500 -- (-994.240) (-987.579) (-999.584) [-989.914] * (-995.529) (-1002.774) [-990.127] (-992.218) -- 0:03:13
146000 -- [-992.993] (-995.445) (-990.673) (-990.950) * (-1006.091) (-1002.537) (-994.026) [-988.923] -- 0:03:13
146500 -- (-992.147) (-1002.639) (-1000.417) [-987.556] * [-1003.417] (-1000.436) (-1001.296) (-1000.593) -- 0:03:12
147000 -- (-997.012) (-991.010) (-996.566) [-989.097] * (-996.748) (-1001.433) [-992.755] (-998.512) -- 0:03:11
147500 -- (-996.745) (-990.310) [-996.970] (-993.509) * (-997.702) [-997.439] (-995.743) (-999.017) -- 0:03:16
148000 -- [-993.757] (-988.001) (-997.164) (-990.780) * (-1000.951) [-996.053] (-997.157) (-998.543) -- 0:03:15
148500 -- (-992.445) (-993.708) (-989.638) [-997.193] * (-999.196) [-993.025] (-993.545) (-995.304) -- 0:03:14
149000 -- (-994.093) [-990.134] (-992.079) (-997.445) * [-995.732] (-995.664) (-994.469) (-993.006) -- 0:03:14
149500 -- (-990.573) (-988.651) [-990.986] (-1001.307) * (-994.655) (-995.155) [-990.816] (-1001.166) -- 0:03:13
150000 -- [-991.033] (-991.847) (-996.563) (-998.772) * (-990.779) (-990.683) (-996.648) [-991.678] -- 0:03:12
Average standard deviation of split frequencies: 0.014392
150500 -- (-996.053) [-991.236] (-993.622) (-989.944) * (-993.396) (-996.256) [-993.166] (-996.620) -- 0:03:11
151000 -- (-999.767) (-990.775) [-992.797] (-993.715) * (-989.802) [-994.077] (-990.369) (-999.184) -- 0:03:11
151500 -- (-992.692) (-991.764) (-995.466) [-996.519] * [-992.618] (-993.511) (-995.480) (-997.933) -- 0:03:10
152000 -- [-993.249] (-995.800) (-999.313) (-990.397) * (-993.926) [-999.357] (-992.971) (-997.100) -- 0:03:15
152500 -- (-994.927) [-990.412] (-993.171) (-991.554) * (-989.569) (-989.829) [-992.466] (-997.355) -- 0:03:14
153000 -- (-990.129) [-989.048] (-993.292) (-999.053) * (-997.114) [-988.875] (-997.565) (-1009.838) -- 0:03:13
153500 -- (-994.330) [-998.133] (-991.483) (-995.819) * (-994.881) (-986.159) [-992.920] (-995.090) -- 0:03:13
154000 -- (-990.081) [-991.518] (-1000.437) (-998.047) * (-991.678) (-997.068) (-992.031) [-988.972] -- 0:03:12
154500 -- (-995.174) (-992.839) [-994.701] (-995.850) * (-991.376) [-986.100] (-999.927) (-1000.855) -- 0:03:11
155000 -- (-996.726) (-995.799) [-991.033] (-998.557) * (-993.551) [-991.962] (-989.240) (-997.736) -- 0:03:10
Average standard deviation of split frequencies: 0.012087
155500 -- (-996.571) (-993.007) [-994.562] (-994.936) * (-993.650) [-990.224] (-990.958) (-992.710) -- 0:03:10
156000 -- (-999.257) [-997.972] (-993.905) (-1005.237) * (-997.258) (-999.584) [-990.505] (-991.319) -- 0:03:09
156500 -- [-1001.231] (-991.968) (-998.495) (-993.825) * (-994.717) (-996.770) [-990.391] (-988.799) -- 0:03:14
157000 -- (-988.023) [-993.150] (-991.908) (-996.147) * (-991.814) (-992.301) [-993.085] (-997.001) -- 0:03:13
157500 -- (-992.341) (-1001.397) (-1002.731) [-993.558] * (-997.891) (-997.474) (-991.672) [-998.736] -- 0:03:12
158000 -- (-998.654) (-991.713) (-997.050) [-1000.341] * [-990.802] (-998.792) (-993.704) (-989.030) -- 0:03:11
158500 -- (-992.460) (-993.445) [-993.726] (-990.780) * (-998.638) (-999.299) [-992.235] (-993.286) -- 0:03:11
159000 -- (-995.941) (-1001.696) [-995.198] (-992.281) * [-996.719] (-994.384) (-990.012) (-997.720) -- 0:03:10
159500 -- [-996.177] (-1001.515) (-998.520) (-998.140) * (-999.180) (-992.519) (-991.471) [-994.377] -- 0:03:09
160000 -- [-994.570] (-1000.070) (-997.727) (-995.824) * (-1001.443) [-988.548] (-1004.472) (-989.842) -- 0:03:09
Average standard deviation of split frequencies: 0.011149
160500 -- (-996.472) [-994.602] (-988.451) (-995.673) * (-992.980) (-997.049) [-987.611] (-1002.131) -- 0:03:08
161000 -- [-993.295] (-998.151) (-994.640) (-988.358) * (-1000.016) [-1000.819] (-994.007) (-992.189) -- 0:03:12
161500 -- [-991.712] (-997.493) (-994.424) (-992.379) * [-994.792] (-993.078) (-991.992) (-991.868) -- 0:03:12
162000 -- [-991.392] (-995.180) (-996.220) (-990.191) * (-992.514) (-1004.342) (-996.453) [-1001.817] -- 0:03:11
162500 -- (-994.995) [-997.324] (-992.741) (-991.534) * [-993.803] (-993.220) (-989.538) (-996.704) -- 0:03:10
163000 -- (-991.752) (-993.046) (-990.992) [-994.566] * (-997.616) [-994.814] (-989.922) (-992.121) -- 0:03:09
163500 -- (-1004.466) (-995.016) (-999.404) [-990.064] * [-994.350] (-996.761) (-995.974) (-990.755) -- 0:03:09
164000 -- (-994.238) [-995.341] (-988.811) (-990.851) * (-992.516) [-987.450] (-996.654) (-1011.131) -- 0:03:08
164500 -- (-1005.244) (-1000.294) [-994.406] (-1001.653) * (-1001.349) [-992.209] (-998.439) (-1000.229) -- 0:03:07
165000 -- (-996.585) [-995.306] (-987.532) (-991.068) * (-992.581) [-995.712] (-999.534) (-1003.505) -- 0:03:07
Average standard deviation of split frequencies: 0.011927
165500 -- (-998.788) (-1003.123) (-992.309) [-994.794] * (-1003.226) (-993.959) (-994.740) [-999.301] -- 0:03:11
166000 -- (-999.222) [-989.883] (-988.031) (-995.187) * (-1002.930) [-996.680] (-992.878) (-998.957) -- 0:03:10
166500 -- (-1004.991) [-987.357] (-995.632) (-991.245) * (-1000.713) (-994.567) [-992.422] (-1000.377) -- 0:03:10
167000 -- (-1004.104) (-994.101) (-1003.147) [-998.462] * (-991.682) (-992.338) (-989.238) [-990.847] -- 0:03:09
167500 -- (-1004.974) [-987.731] (-990.131) (-996.122) * (-992.932) (-1008.354) [-991.406] (-990.078) -- 0:03:08
168000 -- [-1003.865] (-994.698) (-988.440) (-999.239) * (-1002.129) (-995.777) (-994.823) [-995.210] -- 0:03:08
168500 -- (-997.108) (-1003.591) [-992.216] (-998.202) * (-995.979) [-994.544] (-993.406) (-998.839) -- 0:03:07
169000 -- (-996.776) (-998.935) [-992.238] (-1002.097) * (-996.930) (-995.339) [-991.190] (-999.053) -- 0:03:06
169500 -- (-992.423) (-997.799) [-1000.162] (-992.587) * (-993.577) [-992.689] (-1003.065) (-988.718) -- 0:03:06
170000 -- (-993.260) (-1000.238) [-997.096] (-993.934) * (-998.590) [-989.976] (-996.138) (-999.260) -- 0:03:10
Average standard deviation of split frequencies: 0.010496
170500 -- [-991.068] (-997.410) (-998.347) (-995.685) * (-998.826) [-990.348] (-986.673) (-996.843) -- 0:03:09
171000 -- [-997.948] (-997.002) (-993.661) (-991.358) * (-997.593) [-990.666] (-994.178) (-990.529) -- 0:03:09
171500 -- [-988.673] (-996.244) (-992.558) (-995.854) * (-994.822) [-996.112] (-991.697) (-993.679) -- 0:03:08
172000 -- [-993.620] (-991.687) (-997.669) (-1002.564) * (-999.318) (-987.518) [-996.161] (-994.841) -- 0:03:07
172500 -- [-993.272] (-990.820) (-998.558) (-996.566) * (-985.595) (-995.472) [-991.773] (-993.276) -- 0:03:07
173000 -- (-1002.671) (-991.980) [-991.665] (-996.303) * (-992.279) (-997.638) (-991.069) [-998.931] -- 0:03:06
173500 -- (-990.209) [-991.942] (-998.596) (-1002.553) * (-996.377) (-996.754) (-989.424) [-987.754] -- 0:03:05
174000 -- (-990.976) [-991.053] (-991.693) (-999.542) * [-998.455] (-993.737) (-999.587) (-996.264) -- 0:03:05
174500 -- (-999.541) [-986.974] (-990.239) (-992.073) * (-1002.527) (-990.649) (-1002.890) [-998.421] -- 0:03:09
175000 -- (-994.499) (-989.326) [-993.584] (-994.378) * (-1006.460) [-995.830] (-997.799) (-994.986) -- 0:03:08
Average standard deviation of split frequencies: 0.010178
175500 -- (-996.921) (-988.506) (-986.832) [-996.383] * (-999.893) (-990.872) [-999.435] (-992.916) -- 0:03:07
176000 -- (-996.510) (-991.508) (-998.320) [-989.491] * (-1003.874) (-987.894) [-994.797] (-1005.943) -- 0:03:07
176500 -- (-992.179) (-997.893) [-997.264] (-993.414) * (-1000.464) (-991.599) (-993.450) [-999.542] -- 0:03:06
177000 -- (-996.775) [-992.170] (-1002.331) (-995.758) * [-1000.942] (-991.389) (-996.979) (-997.766) -- 0:03:05
177500 -- (-1004.300) (-999.399) (-993.306) [-992.978] * (-989.260) [-1002.706] (-1001.887) (-1002.391) -- 0:03:05
178000 -- (-1002.621) (-993.213) [-991.929] (-987.616) * (-997.708) (-999.802) [-994.698] (-998.632) -- 0:03:04
178500 -- (-1001.158) (-996.863) (-995.574) [-999.394] * (-993.932) [-990.102] (-998.655) (-995.902) -- 0:03:08
179000 -- (-997.015) (-999.826) [-992.939] (-997.252) * [-990.177] (-996.494) (-992.510) (-994.584) -- 0:03:08
179500 -- [-997.861] (-996.033) (-1001.854) (-1000.648) * (-998.927) [-993.171] (-990.913) (-1005.770) -- 0:03:07
180000 -- (-993.898) (-1002.016) (-996.771) [-990.765] * (-999.016) (-998.507) [-1001.821] (-1002.315) -- 0:03:06
Average standard deviation of split frequencies: 0.010437
180500 -- [-999.060] (-998.214) (-999.075) (-991.885) * (-999.785) (-996.448) (-995.567) [-987.574] -- 0:03:06
181000 -- [-996.960] (-1006.211) (-1002.321) (-992.889) * (-997.655) (-994.107) [-990.847] (-996.846) -- 0:03:05
181500 -- (-994.272) (-992.471) (-994.868) [-990.930] * (-992.276) [-993.930] (-998.138) (-996.889) -- 0:03:04
182000 -- (-990.544) (-993.410) (-1004.883) [-992.115] * (-994.218) [-992.502] (-996.229) (-992.355) -- 0:03:04
182500 -- (-991.729) (-996.611) (-1008.736) [-996.941] * (-991.810) (-993.906) (-993.720) [-993.314] -- 0:03:03
183000 -- [-989.503] (-1006.115) (-1001.418) (-988.242) * (-995.812) (-994.667) [-998.042] (-996.332) -- 0:03:07
183500 -- (-993.133) (-991.309) [-990.437] (-987.944) * (-997.495) [-993.823] (-996.007) (-994.207) -- 0:03:06
184000 -- [-990.898] (-1000.123) (-992.911) (-1000.329) * (-997.197) [-992.294] (-999.744) (-992.063) -- 0:03:06
184500 -- (-992.143) [-990.850] (-993.963) (-991.985) * [-992.317] (-992.642) (-997.700) (-989.731) -- 0:03:05
185000 -- [-991.766] (-996.712) (-995.966) (-999.837) * (-1000.404) [-999.432] (-993.488) (-992.374) -- 0:03:05
Average standard deviation of split frequencies: 0.013179
185500 -- (-999.247) [-993.281] (-998.350) (-998.016) * (-994.612) (-1002.140) [-994.861] (-994.883) -- 0:03:04
186000 -- [-993.341] (-994.739) (-992.609) (-998.803) * (-992.029) [-995.937] (-991.878) (-991.625) -- 0:03:03
186500 -- (-1001.565) (-994.656) [-994.779] (-988.887) * (-995.697) [-992.627] (-990.997) (-1000.465) -- 0:03:03
187000 -- [-987.317] (-992.007) (-992.113) (-1000.584) * (-1002.390) (-989.036) (-995.800) [-991.799] -- 0:03:02
187500 -- (-996.540) (-988.563) [-994.211] (-1005.310) * (-996.635) [-990.404] (-993.446) (-994.768) -- 0:03:06
188000 -- (-989.895) (-991.605) [-997.063] (-996.349) * (-994.280) (-1000.555) (-1000.057) [-988.459] -- 0:03:05
188500 -- (-992.723) (-991.639) (-996.046) [-995.825] * (-999.249) [-992.468] (-998.362) (-995.354) -- 0:03:05
189000 -- (-1005.435) [-998.608] (-992.267) (-1003.516) * [-995.996] (-993.784) (-994.096) (-994.407) -- 0:03:04
189500 -- (-995.864) (-994.595) [-988.923] (-995.997) * (-995.089) (-1004.118) [-1001.555] (-998.797) -- 0:03:03
190000 -- [-998.473] (-997.495) (-994.300) (-1009.084) * (-992.010) [-991.238] (-990.880) (-993.035) -- 0:03:03
Average standard deviation of split frequencies: 0.012856
190500 -- (-999.810) (-994.663) [-998.933] (-1006.720) * [-992.770] (-986.255) (-992.928) (-995.081) -- 0:03:02
191000 -- (-989.872) (-992.130) [-990.714] (-1004.917) * (-998.395) (-998.674) [-990.164] (-996.130) -- 0:03:02
191500 -- (-995.087) (-1001.317) (-999.617) [-1000.981] * (-1007.882) (-994.983) [-995.398] (-989.147) -- 0:03:01
192000 -- (-996.734) (-994.340) [-1005.793] (-1004.375) * (-996.556) (-991.557) [-996.886] (-993.690) -- 0:03:05
192500 -- (-1002.898) [-998.165] (-996.843) (-998.613) * [-994.216] (-996.162) (-991.245) (-995.383) -- 0:03:04
193000 -- (-1002.171) [-996.880] (-999.022) (-994.450) * (-992.642) (-991.027) [-994.210] (-996.439) -- 0:03:03
193500 -- (-1004.780) (-989.450) (-993.534) [-1006.213] * [-993.153] (-997.204) (-990.369) (-995.204) -- 0:03:03
194000 -- (-995.250) (-995.715) [-993.826] (-990.411) * [-997.259] (-991.398) (-992.066) (-989.518) -- 0:03:02
194500 -- (-1000.133) (-992.301) (-994.429) [-990.758] * (-1006.371) [-989.242] (-992.763) (-999.611) -- 0:03:02
195000 -- (-999.978) [-989.175] (-993.421) (-992.019) * (-996.106) (-994.339) (-988.875) [-990.608] -- 0:03:01
Average standard deviation of split frequencies: 0.013469
195500 -- (-999.321) [-988.093] (-994.206) (-992.324) * (-1003.095) (-991.897) [-993.225] (-999.877) -- 0:03:01
196000 -- (-1005.319) (-993.289) [-995.840] (-995.746) * (-1003.875) (-992.822) [-988.926] (-1001.131) -- 0:03:00
196500 -- (-1006.760) [-1001.956] (-993.393) (-990.752) * (-998.265) [-995.885] (-996.964) (-992.334) -- 0:03:04
197000 -- (-1005.739) [-995.511] (-997.192) (-994.343) * (-1001.910) [-995.320] (-997.249) (-996.473) -- 0:03:03
197500 -- (-992.213) (-1006.858) (-992.059) [-994.757] * (-1001.991) [-994.184] (-988.906) (-1004.197) -- 0:03:02
198000 -- (-991.284) (-1003.058) (-992.518) [-988.071] * (-993.888) [-988.684] (-1007.382) (-1000.793) -- 0:03:02
198500 -- (-999.285) (-1003.986) [-994.571] (-996.371) * (-994.160) (-991.326) [-994.924] (-1008.584) -- 0:03:01
199000 -- (-994.650) (-996.456) [-995.070] (-994.894) * [-989.186] (-998.222) (-995.437) (-1001.850) -- 0:03:01
199500 -- [-998.693] (-993.655) (-994.708) (-997.089) * [-995.143] (-991.953) (-992.005) (-996.598) -- 0:03:00
200000 -- (-991.884) [-1000.692] (-997.257) (-1000.109) * [-994.155] (-1001.222) (-992.689) (-1000.851) -- 0:03:00
Average standard deviation of split frequencies: 0.013625
200500 -- (-993.958) (-993.777) [-993.637] (-1003.299) * (-993.540) [-992.990] (-988.811) (-1002.038) -- 0:03:03
201000 -- [-990.478] (-995.454) (-995.579) (-1010.260) * (-992.042) [-997.788] (-988.573) (-998.374) -- 0:03:02
201500 -- [-993.920] (-999.884) (-999.634) (-997.391) * (-989.960) [-992.888] (-992.711) (-997.943) -- 0:03:02
202000 -- (-992.835) (-1002.076) [-1002.593] (-991.983) * [-992.694] (-1001.034) (-990.419) (-1005.517) -- 0:03:01
202500 -- [-995.377] (-997.708) (-992.746) (-995.642) * (-995.537) (-999.419) (-992.314) [-998.221] -- 0:03:01
203000 -- (-994.253) (-1000.159) (-997.903) [-994.052] * [-992.049] (-996.592) (-991.640) (-1001.796) -- 0:03:00
203500 -- [-992.543] (-1000.227) (-994.394) (-994.569) * (-992.051) (-998.918) (-999.475) [-994.227] -- 0:03:00
204000 -- (-997.109) (-1002.281) [-1000.469] (-1000.690) * (-997.142) (-1001.687) (-991.452) [-999.346] -- 0:02:59
204500 -- (-1000.238) (-996.316) [-987.429] (-997.417) * (-995.854) (-996.754) [-995.679] (-998.049) -- 0:02:58
205000 -- (-1001.352) (-997.630) [-992.550] (-994.123) * (-997.392) (-988.021) (-1000.839) [-992.791] -- 0:03:02
Average standard deviation of split frequencies: 0.010984
205500 -- (-999.230) (-1001.366) [-994.909] (-999.225) * (-993.790) [-991.386] (-1010.045) (-992.627) -- 0:03:01
206000 -- [-999.343] (-996.367) (-994.109) (-996.182) * (-1010.682) (-1000.396) [-996.513] (-994.970) -- 0:03:01
206500 -- (-995.414) [-1001.048] (-1004.023) (-992.856) * (-999.836) [-994.677] (-993.642) (-996.996) -- 0:03:00
207000 -- (-994.405) (-1004.802) (-998.968) [-997.215] * (-990.093) (-988.965) [-997.211] (-988.797) -- 0:03:00
207500 -- (-1002.582) (-1000.378) [-996.329] (-993.042) * [-991.329] (-993.275) (-1002.175) (-998.204) -- 0:02:59
208000 -- [-991.831] (-999.035) (-985.465) (-990.521) * (-1006.601) (-991.450) [-996.699] (-998.259) -- 0:02:58
208500 -- (-992.204) (-1001.835) [-990.122] (-991.519) * (-993.130) (-998.040) [-997.265] (-1001.416) -- 0:02:58
209000 -- (-995.232) [-1001.667] (-990.444) (-1000.573) * (-1008.668) [-998.341] (-1005.001) (-994.902) -- 0:02:57
209500 -- (-993.591) (-997.856) [-991.072] (-994.227) * (-1001.077) (-992.073) (-1000.851) [-990.781] -- 0:03:01
210000 -- (-998.550) (-997.952) [-988.604] (-1000.696) * (-996.659) [-993.267] (-1001.488) (-1001.641) -- 0:03:00
Average standard deviation of split frequencies: 0.011188
210500 -- (-988.412) [-997.311] (-993.603) (-993.746) * (-1001.038) [-992.172] (-996.690) (-989.845) -- 0:03:00
211000 -- (-995.181) (-995.032) (-990.871) [-989.967] * (-995.337) (-996.013) [-994.628] (-997.317) -- 0:02:59
211500 -- (-1003.389) (-997.903) (-1002.690) [-990.604] * (-990.761) [-998.074] (-997.444) (-992.344) -- 0:02:58
212000 -- (-997.934) (-995.685) [-992.188] (-1000.169) * (-993.211) (-992.396) [-988.144] (-996.512) -- 0:02:58
212500 -- [-1003.174] (-1000.237) (-993.134) (-998.296) * (-986.765) [-990.230] (-998.834) (-993.070) -- 0:02:57
213000 -- (-990.935) [-994.702] (-1001.374) (-1002.476) * (-995.175) [-989.679] (-1006.047) (-992.337) -- 0:02:57
213500 -- (-991.337) (-1002.470) [-998.213] (-993.503) * [-993.190] (-1000.018) (-1000.540) (-993.185) -- 0:02:56
214000 -- (-992.819) (-997.785) (-994.350) [-993.635] * (-994.849) (-995.103) (-994.966) [-998.181] -- 0:02:59
214500 -- [-989.636] (-997.278) (-995.159) (-995.006) * (-998.695) (-993.292) [-994.355] (-991.808) -- 0:02:59
215000 -- (-994.351) (-999.338) [-1000.174] (-989.964) * (-997.881) (-994.192) (-993.643) [-997.776] -- 0:02:58
Average standard deviation of split frequencies: 0.014841
215500 -- (-991.808) (-998.204) (-997.264) [-996.052] * (-996.301) [-997.415] (-991.700) (-992.253) -- 0:02:58
216000 -- (-989.526) (-1001.147) (-1005.842) [-989.130] * (-993.431) (-994.913) (-992.927) [-996.854] -- 0:02:57
216500 -- [-996.708] (-993.873) (-998.861) (-994.335) * (-1001.310) [-988.054] (-993.273) (-992.565) -- 0:02:57
217000 -- (-990.451) (-991.010) [-999.134] (-995.589) * (-997.450) (-1003.297) (-996.937) [-990.029] -- 0:02:56
217500 -- (-998.745) (-992.640) [-1003.818] (-994.304) * [-989.264] (-995.496) (-989.856) (-988.259) -- 0:02:56
218000 -- (-995.722) (-997.738) (-997.396) [-994.377] * [-999.592] (-999.515) (-993.814) (-988.553) -- 0:02:55
218500 -- (-1000.498) [-990.942] (-995.213) (-992.180) * [-991.555] (-996.446) (-994.995) (-997.164) -- 0:02:58
219000 -- (-997.713) (-999.881) (-1006.270) [-997.174] * (-992.076) [-994.755] (-996.457) (-990.299) -- 0:02:58
219500 -- (-990.737) [-1001.569] (-992.955) (-993.551) * (-994.767) (-992.075) [-997.560] (-992.740) -- 0:02:57
220000 -- (-994.843) (-994.946) [-989.842] (-999.446) * (-989.997) [-998.698] (-992.923) (-993.863) -- 0:02:57
Average standard deviation of split frequencies: 0.016236
220500 -- (-999.255) (-996.214) (-990.936) [-997.039] * (-998.162) (-996.899) (-1001.021) [-990.418] -- 0:02:56
221000 -- [-992.326] (-996.811) (-999.918) (-991.812) * (-992.541) (-1002.480) [-994.491] (-999.322) -- 0:02:56
221500 -- (-1002.034) [-993.457] (-990.919) (-995.686) * (-994.841) (-1006.376) [-995.138] (-988.095) -- 0:02:55
222000 -- (-998.441) [-988.808] (-996.323) (-994.775) * (-1001.879) [-993.503] (-1001.785) (-992.389) -- 0:02:55
222500 -- (-996.233) (-995.832) [-992.595] (-991.889) * [-995.713] (-993.726) (-990.483) (-992.414) -- 0:02:54
223000 -- (-992.686) (-992.485) (-1002.876) [-995.698] * (-993.364) (-1000.588) [-991.930] (-988.639) -- 0:02:57
223500 -- (-992.127) (-997.818) [-990.489] (-988.555) * (-999.545) [-988.547] (-994.175) (-992.371) -- 0:02:57
224000 -- (-994.791) [-991.492] (-991.907) (-992.754) * (-1003.538) (-994.172) (-994.877) [-989.734] -- 0:02:56
224500 -- (-994.204) (-990.356) (-993.296) [-988.165] * (-998.324) (-989.548) (-1002.082) [-993.356] -- 0:02:56
225000 -- [-990.509] (-993.528) (-1003.983) (-991.792) * (-1003.493) [-993.285] (-995.779) (-993.679) -- 0:02:55
Average standard deviation of split frequencies: 0.016270
225500 -- (-991.231) (-995.624) [-991.483] (-996.200) * (-995.829) [-992.577] (-995.247) (-1002.290) -- 0:02:55
226000 -- (-994.158) (-997.626) (-995.309) [-993.134] * (-996.403) (-1000.385) (-993.266) [-993.260] -- 0:02:54
226500 -- (-998.221) [-994.527] (-989.713) (-996.036) * (-993.970) [-989.894] (-990.338) (-992.975) -- 0:02:54
227000 -- (-997.982) [-994.223] (-990.227) (-994.317) * (-1001.480) (-993.388) [-990.227] (-992.931) -- 0:02:53
227500 -- [-992.456] (-995.151) (-994.628) (-994.310) * (-990.314) (-991.279) [-991.198] (-994.341) -- 0:02:56
228000 -- (-992.005) (-998.454) (-991.140) [-991.441] * (-999.057) (-993.907) (-995.069) [-990.109] -- 0:02:56
228500 -- (-993.661) (-999.476) [-999.767] (-994.284) * (-995.750) (-990.050) [-993.747] (-993.722) -- 0:02:55
229000 -- (-995.963) (-1002.198) [-993.145] (-989.663) * (-993.808) (-990.945) [-993.145] (-992.274) -- 0:02:55
229500 -- [-992.597] (-995.268) (-998.218) (-992.136) * (-1007.119) [-990.187] (-993.056) (-1004.736) -- 0:02:54
230000 -- (-997.978) (-998.642) [-992.044] (-997.550) * (-1002.915) (-991.991) [-990.347] (-993.164) -- 0:02:54
Average standard deviation of split frequencies: 0.017167
230500 -- (-990.122) [-994.562] (-995.336) (-998.904) * (-990.270) (-990.701) [-991.662] (-1002.535) -- 0:02:53
231000 -- (-1008.578) (-993.794) (-996.395) [-992.025] * [-993.557] (-995.658) (-995.379) (-998.955) -- 0:02:53
231500 -- [-991.556] (-994.543) (-995.258) (-996.402) * (-990.724) (-991.997) (-995.030) [-994.210] -- 0:02:55
232000 -- (-996.705) (-991.590) (-997.282) [-995.140] * (-993.905) [-992.923] (-993.741) (-1000.496) -- 0:02:55
232500 -- (-993.212) (-996.569) (-997.093) [-997.341] * (-986.854) [-995.253] (-989.685) (-999.698) -- 0:02:54
233000 -- (-990.849) (-997.754) [-991.694] (-989.607) * [-989.434] (-1001.367) (-999.850) (-1004.012) -- 0:02:54
233500 -- (-989.139) (-995.035) (-995.231) [-992.845] * (-990.966) (-989.703) [-992.783] (-997.918) -- 0:02:53
234000 -- (-992.593) (-997.489) (-990.224) [-991.506] * (-1002.056) (-997.346) [-989.710] (-995.867) -- 0:02:53
234500 -- [-990.983] (-994.203) (-993.957) (-997.033) * (-997.660) (-998.970) [-992.276] (-991.632) -- 0:02:53
235000 -- (-991.898) [-995.856] (-993.805) (-1002.111) * (-1003.893) (-993.526) (-991.984) [-995.502] -- 0:02:52
Average standard deviation of split frequencies: 0.016379
235500 -- (-994.589) (-993.169) [-991.015] (-991.610) * (-994.539) (-988.704) [-993.667] (-1001.606) -- 0:02:52
236000 -- (-1002.984) (-1002.413) [-991.484] (-994.524) * [-1000.052] (-1000.609) (-999.335) (-1000.046) -- 0:02:54
236500 -- (-994.210) [-998.168] (-994.226) (-999.823) * (-994.589) [-996.616] (-1000.612) (-997.006) -- 0:02:54
237000 -- [-993.428] (-996.128) (-989.604) (-994.828) * [-989.748] (-998.837) (-994.726) (-997.549) -- 0:02:53
237500 -- (-999.015) (-1007.187) (-996.210) [-998.451] * (-990.230) (-996.017) (-990.489) [-991.188] -- 0:02:53
238000 -- (-993.235) (-1004.683) (-993.311) [-994.476] * (-994.974) (-992.325) [-991.780] (-994.209) -- 0:02:52
238500 -- (-991.633) (-1000.391) [-991.575] (-999.192) * (-992.766) (-994.638) (-999.251) [-993.583] -- 0:02:52
239000 -- [-992.770] (-999.366) (-997.838) (-993.888) * (-992.216) [-1002.020] (-994.446) (-995.369) -- 0:02:51
239500 -- (-992.609) (-1000.537) [-995.289] (-995.020) * (-992.725) [-995.472] (-995.288) (-995.902) -- 0:02:51
240000 -- (-994.080) (-994.771) [-989.675] (-994.061) * (-993.198) (-992.105) (-995.448) [-988.769] -- 0:02:51
Average standard deviation of split frequencies: 0.015278
240500 -- (-995.357) (-998.925) [-990.701] (-991.589) * (-996.308) (-994.481) [-992.051] (-990.921) -- 0:02:53
241000 -- (-999.417) (-991.905) [-991.990] (-993.958) * (-993.530) (-998.254) (-990.200) [-993.295] -- 0:02:53
241500 -- (-999.371) (-1006.850) (-987.626) [-991.678] * [-997.998] (-1004.916) (-997.828) (-999.265) -- 0:02:52
242000 -- (-989.048) (-995.570) [-991.686] (-995.737) * [-988.558] (-1000.575) (-994.652) (-988.511) -- 0:02:52
242500 -- (-996.622) [-997.243] (-989.232) (-997.960) * (-1002.551) (-1002.917) [-991.666] (-993.049) -- 0:02:51
243000 -- (-995.570) (-999.243) (-993.053) [-996.472] * (-994.723) (-995.441) [-994.540] (-994.386) -- 0:02:51
243500 -- (-989.393) [-998.221] (-992.538) (-991.540) * (-995.679) (-991.612) [-990.072] (-997.317) -- 0:02:50
244000 -- (-993.783) (-993.456) [-1004.085] (-991.899) * (-999.032) (-996.743) [-995.201] (-993.687) -- 0:02:50
244500 -- (-988.726) [-994.671] (-993.858) (-998.017) * (-1001.591) (-992.658) [-993.808] (-998.105) -- 0:02:49
245000 -- (-988.128) [-988.798] (-998.296) (-994.542) * (-997.458) [-993.457] (-995.359) (-993.380) -- 0:02:52
Average standard deviation of split frequencies: 0.014564
245500 -- (-989.495) [-993.446] (-991.118) (-994.045) * (-998.638) (-992.916) (-991.974) [-988.907] -- 0:02:52
246000 -- (-990.708) [-992.075] (-996.962) (-990.051) * [-996.385] (-998.538) (-997.888) (-1007.372) -- 0:02:51
246500 -- (-996.354) (-996.297) [-996.675] (-996.862) * (-1000.978) (-993.955) [-994.290] (-997.893) -- 0:02:51
247000 -- (-992.442) [-992.676] (-992.259) (-997.750) * (-998.857) [-989.421] (-995.836) (-1000.973) -- 0:02:50
247500 -- (-999.131) (-993.077) (-996.681) [-990.065] * (-997.806) (-987.876) (-1001.363) [-999.047] -- 0:02:50
248000 -- (-998.440) (-987.627) (-999.707) [-993.207] * (-1006.612) (-987.493) (-994.439) [-993.427] -- 0:02:49
248500 -- (-999.684) [-990.625] (-992.442) (-1004.589) * (-995.682) (-995.673) [-989.914] (-1006.643) -- 0:02:49
249000 -- [-991.346] (-990.974) (-1001.147) (-990.698) * (-991.176) (-990.516) (-1001.959) [-995.985] -- 0:02:48
249500 -- (-994.376) (-1000.830) (-1002.132) [-995.675] * (-998.223) [-994.217] (-999.796) (-995.194) -- 0:02:51
250000 -- (-993.798) (-997.070) (-997.054) [-991.835] * (-994.974) [-989.288] (-1000.336) (-1000.822) -- 0:02:51
Average standard deviation of split frequencies: 0.014293
250500 -- (-992.510) [-999.309] (-992.496) (-991.930) * [-993.420] (-991.892) (-999.167) (-992.490) -- 0:02:50
251000 -- (-998.711) [-995.306] (-1002.141) (-996.533) * (-993.721) [-993.043] (-996.385) (-990.319) -- 0:02:50
251500 -- (-999.982) (-992.447) (-994.065) [-994.934] * (-993.185) (-1000.221) [-996.695] (-991.898) -- 0:02:49
252000 -- (-991.734) [-990.736] (-992.425) (-998.597) * [-1006.177] (-996.102) (-993.768) (-989.223) -- 0:02:49
252500 -- (-997.161) (-992.002) [-990.918] (-994.653) * (-993.178) (-996.921) (-995.062) [-992.251] -- 0:02:48
253000 -- (-990.956) (-994.153) [-1000.543] (-995.032) * (-991.044) (-1000.509) (-1001.873) [-1000.391] -- 0:02:48
253500 -- (-993.720) (-990.822) (-997.343) [-998.245] * (-1001.582) [-991.040] (-1000.304) (-997.588) -- 0:02:47
254000 -- [-990.286] (-994.497) (-996.271) (-995.791) * [-1000.360] (-994.368) (-997.299) (-1005.392) -- 0:02:50
254500 -- (-997.286) (-999.732) (-991.940) [-994.782] * [-994.754] (-997.416) (-992.826) (-1004.400) -- 0:02:49
255000 -- [-990.498] (-994.373) (-994.343) (-1003.992) * [-987.966] (-993.470) (-1000.700) (-990.609) -- 0:02:49
Average standard deviation of split frequencies: 0.012890
255500 -- [-994.849] (-993.901) (-998.553) (-997.037) * (-996.879) (-990.616) (-997.957) [-996.969] -- 0:02:49
256000 -- (-994.293) [-1000.510] (-998.687) (-1002.891) * (-998.080) [-990.369] (-992.906) (-991.927) -- 0:02:48
256500 -- (-994.040) [-994.988] (-998.288) (-997.522) * [-989.249] (-991.617) (-995.384) (-993.234) -- 0:02:48
257000 -- [-989.806] (-993.377) (-993.733) (-995.981) * (-998.020) (-997.638) [-989.704] (-1004.153) -- 0:02:47
257500 -- (-990.590) (-997.511) [-992.630] (-999.169) * (-999.774) [-991.465] (-988.864) (-991.368) -- 0:02:47
258000 -- (-999.430) [-991.316] (-999.393) (-998.713) * [-996.321] (-990.914) (-992.617) (-992.324) -- 0:02:46
258500 -- (-996.554) [-991.665] (-996.221) (-994.498) * [-991.986] (-993.100) (-995.602) (-990.195) -- 0:02:49
259000 -- (-993.659) [-996.078] (-990.044) (-992.265) * (-991.064) (-989.500) (-994.835) [-992.027] -- 0:02:48
259500 -- (-994.773) [-992.440] (-988.145) (-1005.888) * (-994.401) [-991.065] (-991.744) (-995.954) -- 0:02:48
260000 -- (-996.111) (-996.499) [-997.812] (-999.187) * [-991.440] (-998.763) (-990.206) (-1000.002) -- 0:02:47
Average standard deviation of split frequencies: 0.013021
260500 -- [-987.486] (-1000.093) (-1000.813) (-988.579) * (-992.491) [-990.322] (-994.456) (-988.720) -- 0:02:47
261000 -- (-993.529) [-1006.807] (-993.900) (-990.570) * [-992.529] (-990.015) (-993.535) (-993.986) -- 0:02:47
261500 -- (-991.625) [-993.764] (-994.034) (-997.968) * (-994.579) (-995.841) (-996.314) [-993.387] -- 0:02:46
262000 -- (-999.217) (-991.609) [-988.921] (-993.034) * [-987.926] (-993.827) (-993.256) (-987.582) -- 0:02:46
262500 -- [-1000.294] (-995.909) (-995.408) (-997.164) * (-993.689) (-994.312) (-989.541) [-997.935] -- 0:02:48
263000 -- [-999.123] (-994.771) (-996.882) (-997.186) * (-999.138) (-1000.214) (-996.672) [-990.408] -- 0:02:48
263500 -- (-1001.890) (-997.722) (-999.261) [-989.965] * (-993.073) (-994.795) (-997.563) [-992.078] -- 0:02:47
264000 -- (-994.164) [-995.161] (-997.832) (-999.787) * (-995.176) [-989.588] (-990.253) (-996.131) -- 0:02:47
264500 -- [-992.765] (-993.245) (-998.013) (-1001.490) * (-994.607) [-991.646] (-1004.302) (-991.101) -- 0:02:46
265000 -- [-992.009] (-992.573) (-995.573) (-999.340) * (-1002.111) [-995.360] (-1000.759) (-990.494) -- 0:02:46
Average standard deviation of split frequencies: 0.012760
265500 -- (-993.511) (-993.540) (-995.433) [-997.501] * (-995.146) [-1002.408] (-991.305) (-996.819) -- 0:02:45
266000 -- (-992.262) (-1002.151) [-1004.571] (-1007.428) * (-998.296) (-990.416) (-996.679) [-989.585] -- 0:02:45
266500 -- [-995.211] (-991.742) (-993.692) (-1002.158) * (-986.916) (-992.854) (-1000.172) [-988.365] -- 0:02:45
267000 -- (-991.315) (-994.718) [-993.817] (-992.975) * (-992.163) (-990.537) (-997.709) [-990.460] -- 0:02:47
267500 -- [-987.410] (-987.762) (-992.604) (-999.909) * (-993.226) [-997.012] (-993.171) (-993.697) -- 0:02:47
268000 -- (-990.092) [-992.140] (-1001.196) (-994.051) * [-989.282] (-1004.098) (-997.601) (-995.679) -- 0:02:46
268500 -- [-997.159] (-991.594) (-993.687) (-989.420) * (-995.825) (-1001.137) (-998.553) [-991.226] -- 0:02:46
269000 -- [-994.210] (-987.029) (-1003.916) (-994.962) * (-993.172) (-988.728) (-991.526) [-989.872] -- 0:02:45
269500 -- (-989.125) [-989.272] (-998.268) (-992.601) * (-994.249) (-991.166) [-995.138] (-989.177) -- 0:02:45
270000 -- [-991.834] (-988.807) (-1003.788) (-994.643) * [-990.548] (-990.952) (-988.839) (-1002.253) -- 0:02:44
Average standard deviation of split frequencies: 0.010102
270500 -- (-994.480) (-986.833) [-995.285] (-990.654) * (-993.045) (-996.803) (-990.015) [-998.031] -- 0:02:44
271000 -- (-997.044) (-999.064) (-998.654) [-991.039] * [-1001.007] (-994.659) (-994.656) (-995.886) -- 0:02:44
271500 -- (-994.370) [-999.114] (-997.880) (-988.511) * [-997.635] (-1001.751) (-998.821) (-994.785) -- 0:02:46
272000 -- (-995.361) (-997.447) [-993.306] (-992.662) * (-995.345) (-996.804) (-994.758) [-994.238] -- 0:02:45
272500 -- (-989.550) (-998.809) [-1000.683] (-990.230) * (-996.051) [-992.910] (-996.523) (-996.940) -- 0:02:45
273000 -- [-989.972] (-993.290) (-1002.179) (-991.889) * (-991.693) (-996.133) [-989.019] (-1000.960) -- 0:02:45
273500 -- (-997.230) [-993.184] (-997.961) (-999.338) * (-993.574) (-995.590) (-996.655) [-993.906] -- 0:02:44
274000 -- [-992.143] (-997.116) (-998.234) (-993.919) * (-994.292) (-993.333) [-995.099] (-996.144) -- 0:02:44
274500 -- [-987.976] (-998.736) (-999.985) (-990.886) * (-997.596) (-995.178) [-995.325] (-988.284) -- 0:02:43
275000 -- [-997.855] (-1001.929) (-995.536) (-993.126) * (-996.603) (-1002.077) (-997.171) [-995.784] -- 0:02:43
Average standard deviation of split frequencies: 0.010931
275500 -- (-989.713) [-990.153] (-1002.054) (-988.227) * (-996.305) (-991.596) (-994.279) [-990.991] -- 0:02:43
276000 -- [-988.971] (-994.774) (-996.730) (-990.398) * (-988.347) (-996.488) (-1001.916) [-994.770] -- 0:02:45
276500 -- (-1005.008) (-1007.738) (-996.485) [-994.785] * (-990.874) (-989.265) [-993.061] (-999.032) -- 0:02:44
277000 -- (-996.284) [-998.046] (-996.783) (-1003.871) * [-993.442] (-989.144) (-995.454) (-991.474) -- 0:02:44
277500 -- (-997.493) (-994.502) [-1002.836] (-998.558) * (-996.933) [-992.996] (-992.411) (-994.249) -- 0:02:44
278000 -- (-1000.610) (-999.005) (-1005.316) [-990.748] * (-998.126) (-1001.769) [-997.559] (-989.310) -- 0:02:43
278500 -- (-991.809) (-997.349) (-994.306) [-996.432] * (-1008.646) (-989.516) [-996.397] (-992.115) -- 0:02:43
279000 -- [-991.173] (-998.514) (-1001.772) (-989.590) * (-999.706) (-989.758) (-1006.209) [-994.911] -- 0:02:42
279500 -- (-1003.499) (-995.437) (-996.115) [-998.042] * (-991.598) [-995.590] (-998.732) (-991.862) -- 0:02:42
280000 -- (-999.508) (-1005.047) (-992.655) [-986.572] * (-998.125) (-1001.092) (-997.996) [-994.315] -- 0:02:44
Average standard deviation of split frequencies: 0.011085
280500 -- (-999.284) [-998.427] (-993.342) (-997.755) * [-993.733] (-1002.583) (-1002.125) (-993.924) -- 0:02:44
281000 -- (-996.192) (-997.564) [-992.673] (-992.159) * [-988.893] (-995.917) (-999.289) (-1000.591) -- 0:02:43
281500 -- (-994.852) [-990.123] (-994.450) (-987.844) * (-1002.841) (-992.893) [-991.614] (-992.227) -- 0:02:43
282000 -- (-1001.997) [-995.002] (-998.374) (-992.011) * (-1001.300) (-995.176) (-998.689) [-990.757] -- 0:02:42
282500 -- (-995.738) [-991.870] (-997.296) (-998.835) * (-995.271) (-1005.233) (-992.484) [-991.348] -- 0:02:42
283000 -- (-993.621) (-995.341) [-996.763] (-994.481) * [-991.835] (-993.344) (-996.640) (-1004.074) -- 0:02:42
283500 -- (-992.005) [-992.350] (-997.934) (-998.855) * (-993.908) [-994.947] (-991.848) (-993.913) -- 0:02:41
284000 -- [-990.941] (-991.663) (-999.215) (-995.995) * [-993.490] (-996.224) (-989.090) (-991.937) -- 0:02:41
284500 -- [-989.245] (-996.559) (-997.971) (-1002.723) * (-999.173) [-994.428] (-995.207) (-994.270) -- 0:02:43
285000 -- [-989.704] (-990.463) (-992.555) (-997.300) * (-993.855) [-997.729] (-1000.346) (-994.034) -- 0:02:43
Average standard deviation of split frequencies: 0.007582
285500 -- (-991.827) (-993.580) (-1006.124) [-993.309] * [-992.425] (-994.204) (-1004.287) (-994.957) -- 0:02:42
286000 -- (-991.995) (-987.869) (-995.595) [-992.341] * (-992.170) (-999.965) (-995.249) [-994.610] -- 0:02:42
286500 -- (-989.870) (-1002.472) [-994.540] (-996.161) * (-997.122) (-998.859) [-993.289] (-990.069) -- 0:02:41
287000 -- (-990.456) [-994.415] (-995.783) (-996.125) * (-991.486) (-998.251) (-992.871) [-997.167] -- 0:02:41
287500 -- (-994.272) (-1000.293) [-989.829] (-997.207) * [-986.344] (-998.532) (-995.932) (-989.381) -- 0:02:41
288000 -- [-992.276] (-993.521) (-1002.632) (-997.276) * (-997.133) [-993.303] (-996.795) (-991.013) -- 0:02:40
288500 -- [-997.351] (-993.862) (-999.748) (-993.215) * (-989.079) [-990.612] (-991.703) (-996.543) -- 0:02:40
289000 -- (-989.718) [-986.680] (-994.111) (-989.289) * (-989.751) (-994.337) [-994.828] (-999.053) -- 0:02:42
289500 -- [-987.392] (-996.755) (-998.162) (-989.841) * [-994.201] (-988.593) (-1004.335) (-998.950) -- 0:02:41
290000 -- (-995.444) (-995.489) (-1000.455) [-988.115] * (-1002.783) [-989.392] (-995.965) (-993.403) -- 0:02:41
Average standard deviation of split frequencies: 0.008758
290500 -- (-997.397) (-997.913) [-994.992] (-990.558) * [-995.119] (-993.753) (-993.549) (-995.380) -- 0:02:41
291000 -- [-990.378] (-1013.888) (-994.203) (-997.956) * [-998.280] (-992.193) (-994.697) (-1000.066) -- 0:02:40
291500 -- (-996.368) (-993.380) [-993.506] (-996.504) * (-1000.364) (-1004.295) (-996.831) [-994.341] -- 0:02:40
292000 -- (-996.799) (-992.101) [-990.803] (-990.918) * (-1000.588) [-991.796] (-989.814) (-998.476) -- 0:02:40
292500 -- (-999.032) [-994.719] (-995.640) (-992.107) * (-995.193) (-993.027) [-991.073] (-990.683) -- 0:02:39
293000 -- (-989.947) (-998.263) (-993.956) [-990.512] * [-999.368] (-992.220) (-994.175) (-992.574) -- 0:02:39
293500 -- (-991.554) (-997.079) [-990.621] (-1010.920) * [-994.652] (-989.596) (-991.455) (-993.098) -- 0:02:41
294000 -- (-994.217) (-998.111) [-999.318] (-993.618) * (-998.821) (-991.757) (-990.864) [-1003.299] -- 0:02:40
294500 -- [-993.308] (-1003.930) (-1001.229) (-990.800) * (-993.739) [-989.671] (-991.953) (-1001.742) -- 0:02:40
295000 -- (-998.528) (-996.603) [-991.755] (-995.099) * (-997.830) [-989.730] (-990.087) (-994.842) -- 0:02:40
Average standard deviation of split frequencies: 0.006689
295500 -- (-1000.205) (-994.203) [-993.071] (-995.216) * (-987.513) [-988.194] (-999.477) (-996.894) -- 0:02:39
296000 -- (-990.840) (-993.588) [-993.199] (-1001.800) * (-995.696) [-994.361] (-995.722) (-998.552) -- 0:02:39
296500 -- [-990.976] (-992.327) (-995.438) (-1000.211) * (-989.608) (-1003.606) [-994.386] (-998.362) -- 0:02:38
297000 -- [-993.718] (-995.961) (-991.760) (-997.609) * [-991.483] (-995.572) (-1000.108) (-990.182) -- 0:02:38
297500 -- (-995.362) (-996.268) (-992.272) [-989.201] * (-993.713) (-997.956) (-1000.166) [-996.335] -- 0:02:38
298000 -- [-992.891] (-994.626) (-999.040) (-1002.648) * [-992.638] (-998.302) (-997.380) (-993.352) -- 0:02:40
298500 -- (-996.708) (-991.960) [-992.688] (-998.428) * (-995.011) (-994.943) (-999.655) [-991.246] -- 0:02:39
299000 -- (-993.946) (-995.706) [-994.931] (-994.262) * (-996.430) (-996.153) [-988.937] (-1000.970) -- 0:02:39
299500 -- (-993.457) (-996.816) (-991.015) [-998.655] * (-998.769) [-991.296] (-990.313) (-994.467) -- 0:02:39
300000 -- (-996.976) (-999.762) [-988.837] (-992.353) * (-992.919) (-991.188) (-997.381) [-997.503] -- 0:02:38
Average standard deviation of split frequencies: 0.006899
300500 -- (-994.154) (-1005.774) [-989.553] (-996.707) * [-995.565] (-994.967) (-997.567) (-1001.945) -- 0:02:38
301000 -- [-998.446] (-1010.370) (-999.683) (-994.683) * (-999.290) (-1004.695) [-993.048] (-992.139) -- 0:02:37
301500 -- (-990.602) (-999.814) (-990.748) [-991.421] * (-996.380) (-993.857) (-995.964) [-990.861] -- 0:02:37
302000 -- (-988.864) [-998.012] (-992.304) (-995.605) * [-999.385] (-997.841) (-990.614) (-995.197) -- 0:02:37
302500 -- [-996.169] (-1012.453) (-996.810) (-997.537) * (-998.034) [-994.462] (-991.674) (-994.371) -- 0:02:39
303000 -- (-995.112) (-1000.074) [-995.020] (-1002.666) * (-998.408) (-997.534) (-997.830) [-988.683] -- 0:02:38
303500 -- (-1004.004) [-990.710] (-992.369) (-995.669) * (-994.052) (-991.991) (-993.760) [-991.097] -- 0:02:38
304000 -- (-1000.972) (-1000.036) (-994.090) [-994.374] * (-999.974) (-992.551) (-995.791) [-990.319] -- 0:02:37
304500 -- [-995.081] (-998.539) (-991.573) (-996.429) * (-996.922) [-998.277] (-1001.556) (-990.781) -- 0:02:37
305000 -- [-996.262] (-998.818) (-989.373) (-999.898) * (-995.074) (-990.132) (-991.146) [-995.191] -- 0:02:37
Average standard deviation of split frequencies: 0.006778
305500 -- (-994.439) (-1002.950) [-990.734] (-995.580) * [-1003.670] (-990.608) (-989.936) (-989.644) -- 0:02:36
306000 -- [-996.146] (-1009.805) (-1000.145) (-989.961) * (-995.945) (-995.091) (-989.735) [-987.770] -- 0:02:36
306500 -- (-999.088) (-1007.333) (-996.622) [-984.728] * (-995.437) (-995.362) (-989.929) [-994.055] -- 0:02:36
307000 -- [-994.157] (-997.121) (-997.670) (-997.477) * (-1000.763) (-991.031) (-990.912) [-991.627] -- 0:02:38
307500 -- (-992.313) [-998.427] (-1002.410) (-996.759) * (-993.535) [-987.753] (-989.153) (-1002.937) -- 0:02:37
308000 -- (-991.845) [-992.278] (-1004.303) (-990.246) * (-989.063) (-995.869) (-995.942) [-997.948] -- 0:02:37
308500 -- [-991.255] (-989.261) (-1000.934) (-989.440) * [-988.071] (-995.470) (-991.507) (-986.649) -- 0:02:36
309000 -- (-990.129) [-988.274] (-990.666) (-1000.917) * (-994.715) (-999.392) (-991.501) [-990.420] -- 0:02:36
309500 -- (-996.485) [-990.124] (-997.099) (-995.885) * [-990.334] (-999.366) (-991.454) (-1001.103) -- 0:02:36
310000 -- [-991.589] (-989.273) (-994.363) (-1004.354) * (-991.209) (-994.822) [-989.352] (-994.245) -- 0:02:35
Average standard deviation of split frequencies: 0.007587
310500 -- (-995.173) (-1000.941) [-991.039] (-1000.594) * (-992.561) (-990.763) [-995.297] (-993.578) -- 0:02:35
311000 -- (-993.327) [-995.696] (-989.060) (-997.806) * (-997.759) [-1000.133] (-992.612) (-992.163) -- 0:02:37
311500 -- (-994.905) [-996.582] (-997.273) (-997.722) * (-1002.147) [-993.250] (-991.940) (-990.695) -- 0:02:36
312000 -- (-987.802) (-992.711) [-994.209] (-997.729) * (-999.886) [-990.604] (-990.038) (-997.137) -- 0:02:36
312500 -- (-995.970) (-1003.918) [-990.653] (-997.622) * (-993.602) [-993.041] (-992.663) (-997.917) -- 0:02:36
313000 -- (-993.594) [-995.268] (-1002.273) (-997.679) * (-997.860) [-987.954] (-989.653) (-999.752) -- 0:02:35
313500 -- [-995.645] (-993.668) (-1004.573) (-995.178) * [-993.086] (-990.360) (-993.005) (-993.292) -- 0:02:35
314000 -- [-995.270] (-992.369) (-1002.501) (-996.881) * (-996.333) (-998.449) (-989.464) [-989.584] -- 0:02:35
314500 -- [-991.175] (-990.869) (-996.439) (-993.662) * (-991.655) [-990.740] (-995.815) (-1000.918) -- 0:02:34
315000 -- [-997.762] (-993.517) (-997.308) (-995.439) * (-995.702) (-992.813) [-991.007] (-1014.566) -- 0:02:34
Average standard deviation of split frequencies: 0.009249
315500 -- (-995.880) (-993.736) [-992.049] (-997.645) * (-998.045) (-998.796) (-998.789) [-996.364] -- 0:02:36
316000 -- [-994.917] (-996.833) (-995.888) (-998.335) * (-995.123) [-994.464] (-996.936) (-1003.946) -- 0:02:35
316500 -- (-996.889) [-991.536] (-990.951) (-995.680) * (-992.211) [-990.910] (-996.141) (-995.473) -- 0:02:35
317000 -- (-1000.120) [-994.726] (-992.179) (-997.937) * (-998.347) (-995.992) [-987.624] (-1005.774) -- 0:02:35
317500 -- (-1002.145) (-990.873) (-991.094) [-995.877] * (-994.646) (-992.165) [-988.332] (-994.189) -- 0:02:34
318000 -- (-994.119) [-993.599] (-993.219) (-1007.835) * (-994.580) (-996.793) [-992.942] (-996.656) -- 0:02:34
318500 -- (-997.129) [-990.619] (-995.489) (-1000.812) * (-1002.853) (-991.434) [-993.893] (-993.869) -- 0:02:34
319000 -- (-988.984) (-996.123) [-992.465] (-999.760) * (-994.982) (-992.361) [-995.322] (-993.841) -- 0:02:33
319500 -- (-993.056) [-994.543] (-1005.151) (-993.043) * (-995.201) (-993.634) [-995.835] (-985.943) -- 0:02:33
320000 -- (-996.141) (-1001.178) (-996.703) [-991.453] * (-999.490) (-995.882) (-999.501) [-990.781] -- 0:02:35
Average standard deviation of split frequencies: 0.008526
320500 -- (-996.527) (-993.008) (-989.775) [-993.280] * (-997.263) (-994.213) (-993.093) [-994.383] -- 0:02:34
321000 -- (-997.244) (-995.244) [-991.734] (-991.739) * (-992.485) (-989.041) [-989.838] (-992.019) -- 0:02:34
321500 -- (-997.321) [-989.700] (-995.355) (-994.086) * [-991.990] (-1001.046) (-996.659) (-993.174) -- 0:02:34
322000 -- (-994.850) [-991.097] (-991.110) (-994.289) * (-995.709) (-1000.106) (-991.783) [-996.219] -- 0:02:33
322500 -- (-997.772) (-1003.895) [-988.668] (-993.468) * [-996.532] (-997.714) (-997.566) (-1000.320) -- 0:02:33
323000 -- [-990.678] (-995.747) (-990.265) (-997.786) * (-994.385) (-994.635) [-992.826] (-996.689) -- 0:02:33
323500 -- (-998.554) (-990.875) (-994.416) [-988.550] * (-996.721) [-994.085] (-996.102) (-995.351) -- 0:02:32
324000 -- (-994.269) (-988.947) (-989.190) [-992.754] * (-1003.244) (-997.552) [-995.146] (-990.618) -- 0:02:32
324500 -- (-994.358) (-999.573) [-1000.209] (-988.865) * (-991.563) [-996.999] (-991.498) (-996.622) -- 0:02:34
325000 -- (-994.950) (-993.671) (-992.625) [-992.205] * (-997.924) (-998.923) [-990.929] (-997.963) -- 0:02:33
Average standard deviation of split frequencies: 0.011568
325500 -- (-998.577) (-1004.144) (-988.430) [-991.307] * [-991.365] (-994.455) (-995.988) (-994.303) -- 0:02:33
326000 -- (-1004.082) (-999.168) [-987.145] (-998.544) * (-993.963) (-992.082) (-996.817) [-996.108] -- 0:02:32
326500 -- (-995.904) [-995.082] (-998.314) (-994.741) * (-995.414) (-1011.049) [-990.693] (-991.517) -- 0:02:32
327000 -- [-989.644] (-991.477) (-994.163) (-994.620) * [-991.145] (-1000.463) (-993.904) (-992.891) -- 0:02:32
327500 -- [-989.880] (-995.030) (-996.630) (-997.482) * [-990.208] (-993.336) (-994.616) (-990.039) -- 0:02:31
328000 -- (-1003.859) (-992.362) [-993.433] (-993.833) * (-988.744) (-992.758) [-997.551] (-998.880) -- 0:02:31
328500 -- (-1006.710) (-995.881) (-1000.018) [-996.324] * [-990.709] (-993.071) (-988.346) (-995.998) -- 0:02:33
329000 -- [-994.066] (-994.417) (-999.679) (-995.021) * [-991.571] (-994.600) (-988.556) (-1002.786) -- 0:02:32
329500 -- (-999.287) (-995.101) [-991.217] (-997.058) * (-987.539) (-997.946) (-997.810) [-1002.812] -- 0:02:32
330000 -- [-1000.558] (-993.630) (-996.112) (-996.947) * (-1000.280) (-994.228) (-1002.569) [-995.667] -- 0:02:32
Average standard deviation of split frequencies: 0.011975
330500 -- (-990.147) (-1001.916) [-987.108] (-989.827) * (-1001.497) (-996.619) (-999.671) [-1000.682] -- 0:02:31
331000 -- (-995.463) (-1003.931) (-990.867) [-989.950] * [-991.946] (-993.958) (-992.306) (-1000.702) -- 0:02:31
331500 -- (-1002.934) (-1000.133) [-995.968] (-994.033) * (-993.124) (-997.644) [-994.146] (-997.988) -- 0:02:31
332000 -- (-998.087) (-996.818) [-997.967] (-992.744) * (-997.963) [-993.175] (-994.022) (-1002.512) -- 0:02:30
332500 -- (-992.620) [-992.347] (-995.283) (-998.978) * (-1000.924) [-991.673] (-1003.822) (-999.274) -- 0:02:30
333000 -- (-1000.454) (-998.401) (-993.737) [-994.586] * (-994.927) [-990.993] (-993.362) (-1003.349) -- 0:02:32
333500 -- (-995.874) (-992.956) [-991.917] (-995.532) * (-999.326) (-997.472) (-994.614) [-995.169] -- 0:02:31
334000 -- [-994.908] (-999.841) (-992.098) (-991.414) * [-991.082] (-992.718) (-995.209) (-996.942) -- 0:02:31
334500 -- (-990.541) (-998.154) (-992.308) [-993.536] * [-990.003] (-993.259) (-991.265) (-995.387) -- 0:02:31
335000 -- (-1003.115) (-993.601) (-995.994) [-991.926] * (-998.170) (-994.799) (-994.711) [-995.548] -- 0:02:30
Average standard deviation of split frequencies: 0.011505
335500 -- (-993.456) (-999.403) [-998.012] (-987.894) * (-997.526) (-995.257) (-1003.019) [-991.808] -- 0:02:30
336000 -- (-990.018) (-998.987) (-998.626) [-987.838] * (-1003.465) (-1002.812) [-992.982] (-994.373) -- 0:02:30
336500 -- (-994.936) (-998.222) (-1003.406) [-989.759] * (-996.258) (-993.604) [-1001.201] (-994.932) -- 0:02:29
337000 -- (-995.616) (-1009.077) (-996.045) [-992.284] * [-991.536] (-992.518) (-997.508) (-995.090) -- 0:02:29
337500 -- (-998.721) [-991.347] (-993.020) (-995.575) * [-990.075] (-990.907) (-999.105) (-994.927) -- 0:02:31
338000 -- (-995.585) [-994.669] (-992.474) (-992.011) * [-991.047] (-997.054) (-1005.660) (-995.497) -- 0:02:30
338500 -- (-1000.246) (-1000.069) (-996.368) [-995.745] * (-1009.415) (-992.530) (-998.281) [-988.396] -- 0:02:30
339000 -- (-999.656) [-992.831] (-1002.420) (-994.530) * (-998.220) [-991.061] (-998.391) (-991.259) -- 0:02:30
339500 -- (-998.809) [-992.182] (-994.552) (-992.045) * (-992.328) [-996.037] (-998.442) (-994.505) -- 0:02:29
340000 -- (-997.695) (-997.653) (-991.429) [-997.301] * (-999.161) (-998.840) (-986.906) [-996.416] -- 0:02:29
Average standard deviation of split frequencies: 0.006919
340500 -- (-995.427) (-995.625) [-989.552] (-1004.703) * [-1000.997] (-990.226) (-992.813) (-996.147) -- 0:02:29
341000 -- (-994.715) (-1004.227) (-1001.205) [-989.915] * [-992.255] (-995.162) (-989.474) (-994.818) -- 0:02:28
341500 -- (-998.593) (-998.611) (-992.871) [-989.216] * [-992.344] (-990.317) (-991.755) (-1001.986) -- 0:02:28
342000 -- (-992.685) (-996.775) [-990.412] (-997.466) * (-994.427) (-998.708) [-993.878] (-995.394) -- 0:02:30
342500 -- [-990.686] (-992.004) (-995.825) (-999.634) * (-1001.402) (-995.107) (-992.130) [-993.086] -- 0:02:29
343000 -- (-994.600) [-997.177] (-1000.821) (-1001.515) * (-993.211) (-989.830) [-994.322] (-997.911) -- 0:02:29
343500 -- (-991.407) (-997.637) [-993.784] (-991.855) * (-997.325) (-997.448) [-995.125] (-991.913) -- 0:02:29
344000 -- (-1003.443) (-998.206) (-992.396) [-990.384] * (-996.541) (-994.729) [-999.035] (-992.218) -- 0:02:28
344500 -- (-993.295) (-1010.497) (-992.150) [-992.890] * (-989.310) (-992.260) (-1010.177) [-996.415] -- 0:02:28
345000 -- (-996.938) [-993.645] (-988.963) (-995.670) * [-989.199] (-994.771) (-998.867) (-993.473) -- 0:02:28
Average standard deviation of split frequencies: 0.005450
345500 -- [-995.561] (-995.315) (-988.187) (-994.441) * [-990.339] (-995.666) (-1001.864) (-991.558) -- 0:02:27
346000 -- [-990.966] (-1002.823) (-992.246) (-991.095) * (-993.695) [-995.638] (-1001.231) (-995.616) -- 0:02:27
346500 -- [-990.260] (-1004.987) (-991.840) (-992.564) * [-991.519] (-996.325) (-1000.891) (-993.741) -- 0:02:28
347000 -- (-995.392) (-992.111) [-989.941] (-1002.030) * [-992.719] (-1000.534) (-1002.764) (-993.467) -- 0:02:28
347500 -- (-993.170) (-1000.805) [-991.464] (-995.936) * (-999.090) (-994.200) [-1000.351] (-990.697) -- 0:02:28
348000 -- (-988.772) (-1004.619) (-995.597) [-987.552] * [-990.965] (-999.840) (-994.540) (-998.307) -- 0:02:28
348500 -- [-996.234] (-996.629) (-998.167) (-990.334) * (-1004.727) (-992.261) [-998.689] (-989.566) -- 0:02:27
349000 -- (-990.710) (-1000.633) (-996.112) [-992.556] * (-998.358) (-997.454) [-997.709] (-992.713) -- 0:02:27
349500 -- (-996.962) (-991.433) [-989.762] (-994.409) * [-990.460] (-993.353) (-991.133) (-996.088) -- 0:02:27
350000 -- (-1001.125) (-989.259) (-992.962) [-986.017] * [-994.198] (-991.014) (-992.575) (-1000.710) -- 0:02:26
Average standard deviation of split frequencies: 0.004840
350500 -- (-991.996) [-988.166] (-992.045) (-987.164) * (-995.740) (-990.817) [-994.349] (-1003.665) -- 0:02:28
351000 -- (-999.372) (-988.727) [-994.086] (-992.644) * (-1001.580) [-994.605] (-1000.761) (-1004.451) -- 0:02:27
351500 -- (-995.671) [-990.423] (-988.928) (-998.565) * (-989.874) [-997.593] (-998.937) (-997.615) -- 0:02:27
352000 -- (-995.523) (-1002.844) (-997.293) [-989.400] * [-998.348] (-995.940) (-992.620) (-994.869) -- 0:02:27
352500 -- [-993.482] (-991.319) (-1001.877) (-996.393) * (-993.606) (-994.975) (-998.796) [-992.020] -- 0:02:26
353000 -- [-990.883] (-1003.638) (-989.947) (-991.457) * (-997.554) (-992.102) (-995.845) [-987.914] -- 0:02:26
353500 -- (-999.265) (-996.839) (-996.219) [-987.101] * (-996.091) (-992.428) (-999.492) [-994.136] -- 0:02:26
354000 -- (-1001.447) (-1001.555) [-997.635] (-994.454) * (-995.769) [-990.652] (-995.397) (-989.577) -- 0:02:25
354500 -- (-989.660) [-999.128] (-995.660) (-991.440) * [-993.102] (-996.495) (-993.120) (-992.809) -- 0:02:25
355000 -- (-990.396) (-998.158) (-994.121) [-990.389] * [-994.060] (-1000.536) (-991.254) (-991.363) -- 0:02:27
Average standard deviation of split frequencies: 0.005297
355500 -- (-990.559) (-998.819) (-997.094) [-990.742] * [-986.935] (-995.869) (-990.346) (-991.925) -- 0:02:26
356000 -- (-986.662) (-992.801) [-991.092] (-992.216) * (-993.370) (-995.682) [-993.132] (-990.438) -- 0:02:26
356500 -- (-998.347) [-993.514] (-995.668) (-991.205) * [-993.363] (-998.470) (-993.318) (-993.124) -- 0:02:26
357000 -- (-993.652) (-990.636) (-994.548) [-988.221] * (-992.715) (-993.979) (-990.592) [-994.695] -- 0:02:25
357500 -- (-996.572) (-988.095) (-990.206) [-994.160] * (-991.409) (-991.994) [-991.587] (-1002.273) -- 0:02:25
358000 -- (-1001.961) [-996.938] (-990.278) (-993.401) * (-992.964) [-991.745] (-998.121) (-999.897) -- 0:02:25
358500 -- (-997.328) (-994.385) (-995.920) [-999.079] * [-997.131] (-990.581) (-991.671) (-1000.154) -- 0:02:24
359000 -- (-994.226) (-993.622) [-990.184] (-995.180) * [-992.803] (-992.350) (-998.106) (-991.341) -- 0:02:24
359500 -- (-996.493) (-995.457) [-990.368] (-1001.627) * (-995.555) (-997.498) (-1003.474) [-992.423] -- 0:02:26
360000 -- (-995.389) (-1003.723) (-989.049) [-991.024] * (-993.357) [-992.070] (-990.713) (-996.610) -- 0:02:25
Average standard deviation of split frequencies: 0.007058
360500 -- [-987.952] (-1003.577) (-994.857) (-999.112) * (-988.945) [-996.802] (-1003.495) (-987.544) -- 0:02:25
361000 -- (-999.593) (-994.257) (-993.744) [-993.353] * (-993.229) [-1001.309] (-1002.136) (-996.442) -- 0:02:25
361500 -- (-995.455) [-997.662] (-995.833) (-991.932) * [-992.897] (-1002.622) (-991.134) (-997.451) -- 0:02:24
362000 -- (-998.971) (-993.440) [-991.380] (-995.245) * (-995.477) (-992.628) [-994.667] (-993.785) -- 0:02:24
362500 -- (-991.169) [-990.719] (-994.410) (-989.613) * [-993.394] (-995.879) (-1003.556) (-989.776) -- 0:02:24
363000 -- (-991.117) (-993.396) (-989.244) [-993.709] * (-996.504) [-995.269] (-993.076) (-990.587) -- 0:02:23
363500 -- [-992.090] (-992.207) (-994.241) (-995.282) * (-994.737) (-997.497) (-989.644) [-990.082] -- 0:02:23
364000 -- [-992.858] (-994.285) (-995.616) (-990.129) * (-1000.931) [-995.065] (-999.011) (-993.596) -- 0:02:25
364500 -- (-998.307) (-990.676) (-995.809) [-992.809] * (-990.902) (-991.651) (-996.318) [-997.407] -- 0:02:24
365000 -- (-999.301) (-998.237) [-990.683] (-993.359) * (-987.477) (-996.361) [-999.992] (-993.963) -- 0:02:24
Average standard deviation of split frequencies: 0.007986
365500 -- (-997.335) [-992.134] (-992.331) (-992.135) * (-997.497) (-997.370) [-988.135] (-998.357) -- 0:02:24
366000 -- (-991.455) [-994.105] (-993.793) (-992.316) * (-996.224) [-997.467] (-992.958) (-999.782) -- 0:02:23
366500 -- (-995.165) [-990.749] (-1000.733) (-994.712) * (-993.229) (-996.147) [-996.561] (-995.923) -- 0:02:23
367000 -- (-998.007) (-994.095) [-994.871] (-993.469) * (-994.032) [-994.584] (-993.200) (-997.799) -- 0:02:23
367500 -- (-997.276) (-1004.264) [-993.320] (-991.550) * (-993.661) (-1005.069) [-1008.116] (-992.893) -- 0:02:22
368000 -- [-995.371] (-1015.819) (-997.811) (-994.686) * (-993.410) (-994.662) (-994.344) [-994.980] -- 0:02:24
368500 -- (-995.400) (-1001.953) [-992.125] (-997.894) * (-997.157) (-989.269) [-998.076] (-990.341) -- 0:02:23
369000 -- (-995.429) (-1006.732) [-992.882] (-994.827) * [-991.263] (-993.567) (-990.199) (-1005.092) -- 0:02:23
369500 -- [-992.851] (-995.846) (-991.118) (-997.344) * [-990.928] (-995.629) (-1001.352) (-996.147) -- 0:02:23
370000 -- (-1003.801) (-997.926) [-991.779] (-994.091) * (-993.660) (-998.798) [-991.559] (-997.242) -- 0:02:23
Average standard deviation of split frequencies: 0.009411
370500 -- [-998.154] (-993.357) (-1001.073) (-999.361) * [-991.417] (-996.721) (-996.093) (-996.620) -- 0:02:22
371000 -- (-995.787) [-1000.628] (-997.032) (-996.692) * [-993.651] (-995.143) (-1001.452) (-995.321) -- 0:02:22
371500 -- (-992.013) (-998.068) [-989.493] (-1006.824) * [-990.570] (-994.759) (-993.121) (-995.607) -- 0:02:22
372000 -- [-992.350] (-992.273) (-1003.140) (-999.380) * [-992.276] (-992.605) (-989.967) (-999.809) -- 0:02:21
372500 -- (-998.582) (-993.288) [-987.794] (-988.774) * (-992.847) (-990.287) [-991.323] (-997.123) -- 0:02:23
373000 -- (-995.238) (-996.275) (-989.773) [-992.831] * [-998.233] (-1002.340) (-998.339) (-994.705) -- 0:02:22
373500 -- (-998.686) [-992.602] (-995.585) (-991.258) * [-990.967] (-999.210) (-994.179) (-990.786) -- 0:02:22
374000 -- (-995.042) (-1001.418) [-993.738] (-994.323) * (-992.436) (-993.394) (-998.795) [-993.390] -- 0:02:22
374500 -- (-998.784) (-991.858) [-992.463] (-994.826) * (-1003.535) (-990.076) [-997.303] (-991.285) -- 0:02:21
375000 -- (-993.250) [-991.212] (-995.877) (-988.568) * [-999.432] (-988.180) (-997.209) (-997.973) -- 0:02:21
Average standard deviation of split frequencies: 0.009779
375500 -- (-997.707) (-992.221) [-996.544] (-992.308) * [-994.485] (-992.072) (-1006.479) (-997.304) -- 0:02:21
376000 -- (-999.287) (-991.710) (-996.733) [-994.221] * (-1001.409) [-1000.093] (-1006.348) (-996.590) -- 0:02:21
376500 -- [-996.088] (-997.886) (-991.271) (-995.076) * (-1001.143) (-993.148) [-990.860] (-993.191) -- 0:02:20
377000 -- (-999.028) (-1001.146) [-990.653] (-995.851) * (-1001.399) [-992.782] (-997.838) (-991.431) -- 0:02:22
377500 -- (-991.152) [-998.080] (-992.134) (-991.000) * (-998.027) (-991.770) [-1000.005] (-994.311) -- 0:02:21
378000 -- (-992.626) (-999.613) (-993.847) [-991.639] * (-994.293) [-995.434] (-996.490) (-990.366) -- 0:02:21
378500 -- (-994.893) (-997.811) [-993.319] (-991.753) * (-993.339) (-993.388) (-991.735) [-989.742] -- 0:02:21
379000 -- [-994.391] (-1004.020) (-990.125) (-997.422) * (-992.300) [-990.701] (-992.943) (-1003.344) -- 0:02:20
379500 -- (-995.381) (-997.463) [-993.865] (-1000.253) * (-991.720) [-994.457] (-996.935) (-992.136) -- 0:02:20
380000 -- (-990.003) (-996.916) (-997.473) [-989.938] * (-996.174) (-990.620) [-994.613] (-994.638) -- 0:02:20
Average standard deviation of split frequencies: 0.008916
380500 -- (-992.140) (-993.305) [-997.635] (-994.821) * (-997.501) (-989.429) (-992.165) [-993.670] -- 0:02:20
381000 -- (-989.816) [-994.439] (-999.216) (-992.554) * (-995.072) (-991.926) (-997.675) [-1005.499] -- 0:02:19
381500 -- (-998.336) [-997.699] (-996.489) (-993.413) * [-996.661] (-994.709) (-1002.499) (-990.822) -- 0:02:21
382000 -- (-997.178) [-993.030] (-1003.972) (-1003.377) * (-991.249) [-989.182] (-996.598) (-993.791) -- 0:02:20
382500 -- (-992.711) (-1013.906) [-991.392] (-992.918) * (-991.269) [-996.958] (-994.257) (-1003.954) -- 0:02:20
383000 -- (-1004.144) (-997.424) (-996.031) [-989.780] * [-995.315] (-996.157) (-995.017) (-1001.354) -- 0:02:20
383500 -- (-996.858) [-994.374] (-995.011) (-993.368) * (-997.933) (-995.224) (-990.197) [-994.015] -- 0:02:19
384000 -- (-996.570) (-990.792) (-998.963) [-998.014] * (-1004.658) [-989.589] (-993.555) (-993.590) -- 0:02:19
384500 -- [-994.976] (-995.912) (-991.982) (-995.168) * (-994.998) (-997.269) [-1001.598] (-995.592) -- 0:02:19
385000 -- (-994.283) (-1009.388) (-990.329) [-997.274] * (-991.605) (-996.985) [-992.575] (-999.791) -- 0:02:18
Average standard deviation of split frequencies: 0.008793
385500 -- [-996.122] (-989.747) (-991.583) (-995.130) * [-997.460] (-993.345) (-992.058) (-1002.020) -- 0:02:20
386000 -- (-995.435) (-989.861) (-1003.876) [-994.862] * (-994.815) [-1003.579] (-995.121) (-1007.969) -- 0:02:19
386500 -- [-988.851] (-996.053) (-1000.019) (-994.407) * (-999.336) (-994.846) [-991.667] (-1009.828) -- 0:02:19
387000 -- (-988.500) [-991.550] (-1004.254) (-989.919) * (-998.742) (-1000.554) (-991.395) [-1001.611] -- 0:02:19
387500 -- (-993.948) [-991.522] (-997.887) (-994.764) * (-995.042) (-1005.945) [-990.670] (-992.532) -- 0:02:19
388000 -- [-988.054] (-991.332) (-994.480) (-992.658) * (-1000.918) (-995.325) (-994.366) [-997.530] -- 0:02:18
388500 -- (-990.273) (-992.297) (-993.454) [-991.588] * (-991.661) (-995.208) (-992.659) [-997.549] -- 0:02:18
389000 -- [-989.717] (-995.609) (-999.392) (-987.104) * [-991.589] (-997.452) (-992.000) (-1003.166) -- 0:02:18
389500 -- (-992.659) [-992.589] (-992.196) (-997.797) * (-999.011) (-995.399) [-987.696] (-984.885) -- 0:02:17
390000 -- [-996.675] (-995.648) (-995.861) (-1001.344) * (-996.417) [-990.400] (-996.780) (-993.562) -- 0:02:19
Average standard deviation of split frequencies: 0.010136
390500 -- (-994.345) (-993.025) [-987.741] (-998.818) * [-993.436] (-997.363) (-990.940) (-990.594) -- 0:02:18
391000 -- (-994.855) [-994.227] (-998.751) (-997.200) * (-994.725) (-989.617) (-995.808) [-997.680] -- 0:02:18
391500 -- [-1000.116] (-998.079) (-996.403) (-996.993) * [-999.231] (-999.086) (-987.561) (-991.873) -- 0:02:18
392000 -- (-993.018) [-990.270] (-996.469) (-998.921) * [-1000.588] (-999.937) (-995.851) (-1002.031) -- 0:02:18
392500 -- (-999.802) (-993.188) [-991.953] (-998.347) * (-996.090) (-997.889) [-996.862] (-999.891) -- 0:02:17
393000 -- (-1001.103) (-997.013) [-992.786] (-1001.193) * (-993.982) [-993.033] (-996.725) (-994.903) -- 0:02:17
393500 -- [-1005.661] (-994.462) (-998.495) (-997.129) * [-992.536] (-994.470) (-993.271) (-1001.128) -- 0:02:17
394000 -- (-1007.673) [-991.485] (-1001.391) (-993.726) * (-988.085) [-995.388] (-995.341) (-999.336) -- 0:02:16
394500 -- (-994.401) (-995.851) (-998.557) [-999.310] * [-996.628] (-994.138) (-997.994) (-992.031) -- 0:02:18
395000 -- (-995.247) (-995.294) (-996.924) [-995.229] * (-995.317) (-999.783) (-992.521) [-1000.524] -- 0:02:17
Average standard deviation of split frequencies: 0.009285
395500 -- (-998.490) (-998.771) [-992.688] (-997.801) * (-996.521) (-998.806) [-992.385] (-991.570) -- 0:02:17
396000 -- (-993.118) (-998.988) (-988.964) [-996.104] * [-988.084] (-997.196) (-996.004) (-997.570) -- 0:02:17
396500 -- (-994.201) (-993.099) (-991.481) [-998.599] * [-995.434] (-994.656) (-992.411) (-993.236) -- 0:02:16
397000 -- (-997.943) [-998.262] (-992.555) (-995.335) * (-992.838) [-992.707] (-991.603) (-993.858) -- 0:02:16
397500 -- [-995.498] (-996.315) (-994.649) (-998.829) * (-989.022) [-999.903] (-996.693) (-996.873) -- 0:02:16
398000 -- [-990.671] (-998.149) (-999.199) (-1000.792) * (-1003.875) [-997.754] (-997.342) (-992.906) -- 0:02:16
398500 -- (-990.101) [-991.400] (-993.532) (-1006.740) * (-991.077) (-994.498) [-994.917] (-990.914) -- 0:02:17
399000 -- (-996.462) [-990.948] (-993.399) (-998.788) * (-993.539) [-996.086] (-993.535) (-998.029) -- 0:02:17
399500 -- (-996.630) (-988.569) (-1003.812) [-995.677] * [-998.371] (-992.749) (-992.576) (-1001.145) -- 0:02:16
400000 -- (-999.051) [-995.646] (-994.794) (-999.876) * [-998.326] (-999.799) (-991.447) (-995.370) -- 0:02:16
Average standard deviation of split frequencies: 0.008942
400500 -- (-997.345) (-994.417) (-998.172) [-993.029] * (-991.515) [-987.475] (-993.383) (-994.667) -- 0:02:16
401000 -- [-992.015] (-998.024) (-996.109) (-994.724) * (-1003.001) (-993.805) [-992.497] (-1001.030) -- 0:02:15
401500 -- (-991.962) [-989.848] (-1001.516) (-994.571) * (-998.756) (-990.639) (-1003.535) [-996.615] -- 0:02:15
402000 -- [-993.830] (-992.123) (-994.114) (-993.660) * [-994.602] (-1005.662) (-997.048) (-996.535) -- 0:02:15
402500 -- [-993.164] (-995.978) (-998.708) (-1009.885) * [-993.875] (-996.740) (-1005.049) (-994.512) -- 0:02:15
403000 -- (-1005.017) (-994.517) [-991.031] (-986.331) * (-991.049) [-987.478] (-999.191) (-1004.290) -- 0:02:16
403500 -- (-999.052) (-997.553) [-991.107] (-1001.216) * (-987.431) (-991.277) (-999.824) [-998.957] -- 0:02:16
404000 -- (-996.416) (-994.423) (-1002.260) [-996.763] * (-988.523) (-993.611) [-998.883] (-998.974) -- 0:02:15
404500 -- [-989.285] (-992.995) (-990.884) (-995.299) * (-995.040) [-997.492] (-1002.159) (-997.748) -- 0:02:15
405000 -- (-991.446) (-999.937) [-995.980] (-1000.660) * (-999.889) (-1003.013) [-992.998] (-993.323) -- 0:02:15
Average standard deviation of split frequencies: 0.009289
405500 -- [-999.006] (-1000.583) (-998.361) (-1002.995) * (-998.997) [-997.170] (-992.693) (-993.667) -- 0:02:14
406000 -- [-992.500] (-988.632) (-993.937) (-1001.978) * (-996.981) [-992.196] (-990.480) (-989.975) -- 0:02:14
406500 -- [-990.927] (-1001.737) (-997.291) (-997.538) * (-1004.469) (-988.822) [-994.320] (-1007.616) -- 0:02:14
407000 -- (-1001.356) (-1001.389) (-995.278) [-993.698] * (-1003.031) [-989.981] (-990.145) (-1001.657) -- 0:02:14
407500 -- (-993.117) [-994.195] (-1002.751) (-993.676) * (-993.110) (-992.322) (-994.816) [-989.181] -- 0:02:15
408000 -- (-1001.704) (-994.018) (-994.831) [-992.467] * (-993.349) (-998.659) [-987.357] (-995.265) -- 0:02:14
408500 -- (-1000.662) (-996.583) [-987.171] (-988.355) * (-991.070) [-996.869] (-994.481) (-1001.411) -- 0:02:14
409000 -- (-994.590) (-989.147) [-991.374] (-994.409) * [-992.290] (-994.433) (-991.400) (-991.776) -- 0:02:14
409500 -- (-992.771) [-996.114] (-1002.636) (-1002.876) * (-992.280) (-995.758) (-991.130) [-993.627] -- 0:02:14
410000 -- (-987.471) [-996.239] (-992.824) (-995.184) * [-988.575] (-998.137) (-1000.554) (-999.919) -- 0:02:13
Average standard deviation of split frequencies: 0.010561
410500 -- (-988.030) [-996.558] (-994.235) (-995.072) * (-997.327) [-989.290] (-995.522) (-1000.301) -- 0:02:13
411000 -- (-994.057) (-996.418) (-994.169) [-995.024] * [-995.832] (-992.880) (-990.703) (-990.584) -- 0:02:13
411500 -- (-997.604) [-996.310] (-1002.678) (-990.710) * (-993.109) [-989.009] (-992.456) (-994.673) -- 0:02:14
412000 -- (-999.611) [-997.406] (-992.372) (-995.850) * (-997.370) [-998.381] (-993.491) (-994.688) -- 0:02:14
412500 -- (-991.947) [-992.499] (-995.794) (-993.422) * [-990.891] (-996.712) (-996.887) (-991.981) -- 0:02:13
413000 -- (-991.729) (-1003.712) (-996.577) [-995.541] * (-986.479) [-988.938] (-996.524) (-992.531) -- 0:02:13
413500 -- (-993.426) (-999.061) [-990.941] (-992.901) * [-1008.999] (-995.062) (-989.647) (-995.413) -- 0:02:13
414000 -- [-994.166] (-993.715) (-995.011) (-1000.740) * (-995.356) (-992.139) (-993.935) [-989.641] -- 0:02:13
414500 -- (-988.151) (-990.206) (-1000.833) [-993.788] * (-998.289) (-994.238) [-997.892] (-993.356) -- 0:02:12
415000 -- (-988.350) (-996.082) (-994.187) [-999.150] * (-999.660) [-995.047] (-989.330) (-994.079) -- 0:02:12
Average standard deviation of split frequencies: 0.010652
415500 -- [-989.975] (-996.812) (-991.803) (-995.623) * (-992.586) (-989.440) [-991.443] (-997.186) -- 0:02:12
416000 -- (-995.300) [-999.662] (-997.270) (-994.891) * (-997.904) [-992.542] (-998.222) (-994.897) -- 0:02:13
416500 -- (-994.514) (-1001.735) (-1000.846) [-994.905] * (-990.416) [-994.959] (-1000.183) (-996.855) -- 0:02:13
417000 -- (-991.579) (-995.996) [-994.679] (-998.167) * (-991.076) [-990.141] (-995.999) (-995.082) -- 0:02:12
417500 -- (-997.883) [-992.862] (-996.539) (-995.549) * (-992.536) [-995.057] (-991.679) (-993.287) -- 0:02:12
418000 -- [-991.565] (-991.281) (-996.856) (-994.650) * (-1000.655) [-992.663] (-989.546) (-995.294) -- 0:02:12
418500 -- (-996.637) (-992.434) [-990.262] (-994.872) * (-997.870) [-995.667] (-1000.297) (-996.256) -- 0:02:12
419000 -- (-998.537) [-990.953] (-997.319) (-993.412) * (-1007.634) (-989.015) (-994.223) [-988.426] -- 0:02:11
419500 -- (-1001.675) [-998.132] (-990.832) (-993.019) * (-996.390) [-992.615] (-991.774) (-995.430) -- 0:02:11
420000 -- (-996.558) (-996.536) [-995.191] (-993.659) * [-996.021] (-994.078) (-1001.493) (-997.614) -- 0:02:11
Average standard deviation of split frequencies: 0.009637
420500 -- (-991.475) [-993.769] (-994.578) (-995.745) * (-996.613) (-996.850) [-993.242] (-994.558) -- 0:02:12
421000 -- (-1001.396) (-992.706) [-995.492] (-997.022) * (-989.769) [-994.957] (-996.020) (-1006.044) -- 0:02:12
421500 -- (-996.651) [-1001.017] (-996.058) (-996.628) * (-991.460) (-997.789) (-989.545) [-1001.746] -- 0:02:11
422000 -- (-998.292) (-993.807) (-988.812) [-1000.632] * (-993.798) [-990.502] (-999.298) (-1005.281) -- 0:02:11
422500 -- [-994.868] (-1004.205) (-989.491) (-997.054) * (-992.294) [-993.251] (-992.144) (-994.594) -- 0:02:11
423000 -- [-996.237] (-999.535) (-1004.364) (-1000.256) * (-990.592) (-996.469) [-989.477] (-995.827) -- 0:02:10
423500 -- [-991.626] (-1000.339) (-1002.220) (-1005.413) * (-991.516) (-994.006) (-999.349) [-994.742] -- 0:02:10
424000 -- [-987.292] (-996.758) (-997.864) (-1003.726) * [-995.875] (-994.718) (-993.444) (-999.658) -- 0:02:10
424500 -- (-999.486) (-995.603) (-991.575) [-997.845] * [-989.914] (-992.952) (-996.113) (-991.789) -- 0:02:10
425000 -- [-993.336] (-1002.573) (-988.260) (-995.631) * (-995.593) (-1001.014) (-989.082) [-993.824] -- 0:02:11
Average standard deviation of split frequencies: 0.008853
425500 -- (-993.338) (-1000.401) (-988.209) [-993.098] * (-996.782) (-1006.037) (-989.289) [-995.348] -- 0:02:10
426000 -- (-998.690) (-999.698) (-999.279) [-994.036] * (-995.040) (-994.660) [-990.485] (-996.319) -- 0:02:10
426500 -- (-995.765) (-999.094) (-997.891) [-993.801] * [-994.558] (-1000.749) (-990.507) (-996.906) -- 0:02:10
427000 -- (-994.731) (-999.204) [-999.619] (-996.536) * [-991.272] (-999.837) (-993.359) (-1002.246) -- 0:02:10
427500 -- (-991.978) (-993.780) [-997.092] (-999.539) * [-992.143] (-991.377) (-997.757) (-1007.253) -- 0:02:09
428000 -- (-992.993) (-986.775) (-995.448) [-994.525] * [-988.889] (-992.512) (-992.561) (-1002.848) -- 0:02:09
428500 -- (-990.654) (-991.660) [-989.896] (-991.010) * (-996.168) [-990.489] (-1003.425) (-997.563) -- 0:02:09
429000 -- (-1009.628) (-993.983) (-990.044) [-995.883] * (-992.957) [-996.317] (-1001.769) (-998.654) -- 0:02:10
429500 -- (-997.969) (-998.845) [-997.809] (-998.013) * (-995.875) [-993.214] (-996.307) (-990.425) -- 0:02:10
430000 -- (-994.023) (-995.180) (-1000.657) [-999.425] * (-988.896) [-986.787] (-993.494) (-1003.024) -- 0:02:09
Average standard deviation of split frequencies: 0.009632
430500 -- (-998.701) [-993.890] (-1001.435) (-997.651) * (-998.483) (-988.693) (-999.653) [-996.034] -- 0:02:09
431000 -- [-999.063] (-992.856) (-993.226) (-996.221) * (-996.181) (-992.233) (-997.890) [-997.048] -- 0:02:09
431500 -- [-997.819] (-994.736) (-993.432) (-1007.383) * [-991.279] (-1001.475) (-994.730) (-999.178) -- 0:02:09
432000 -- [-993.412] (-993.949) (-990.505) (-997.987) * (-998.477) (-999.322) (-993.928) [-996.034] -- 0:02:08
432500 -- (-992.413) (-991.500) [-998.675] (-1003.128) * (-997.527) [-992.508] (-992.428) (-996.072) -- 0:02:08
433000 -- (-995.881) (-991.892) [-995.315] (-1006.797) * (-997.737) [-992.448] (-998.214) (-994.479) -- 0:02:08
433500 -- (-991.082) (-994.192) [-994.668] (-999.454) * (-1001.549) (-999.191) [-992.666] (-1003.124) -- 0:02:09
434000 -- [-994.318] (-995.385) (-995.206) (-1000.103) * (-1004.779) (-994.074) (-996.202) [-993.230] -- 0:02:09
434500 -- (-993.198) (-998.094) (-999.213) [-1001.926] * (-998.407) (-992.953) (-994.095) [-994.306] -- 0:02:08
435000 -- (-994.350) [-992.090] (-1008.987) (-993.964) * (-1001.348) [-993.162] (-993.638) (-998.808) -- 0:02:08
Average standard deviation of split frequencies: 0.008866
435500 -- (-989.782) [-992.756] (-998.094) (-992.563) * (-995.623) [-989.066] (-996.470) (-991.616) -- 0:02:08
436000 -- (-991.930) [-988.726] (-989.554) (-998.038) * (-990.858) [-986.797] (-998.324) (-993.318) -- 0:02:08
436500 -- (-987.046) (-997.555) [-991.518] (-995.455) * (-1004.897) (-996.517) [-987.125] (-996.301) -- 0:02:07
437000 -- (-998.186) (-993.742) [-991.810] (-998.499) * (-991.075) (-996.550) (-995.272) [-998.027] -- 0:02:07
437500 -- [-993.788] (-1010.010) (-989.292) (-991.931) * (-998.848) (-996.760) (-994.487) [-988.697] -- 0:02:07
438000 -- (-996.817) (-1001.467) (-991.312) [-992.245] * (-994.606) (-1000.321) (-997.670) [-989.059] -- 0:02:08
438500 -- [-991.658] (-997.339) (-992.394) (-992.713) * [-989.904] (-994.638) (-997.988) (-1000.316) -- 0:02:08
439000 -- (-994.010) [-995.862] (-992.443) (-993.739) * (-998.502) (-995.332) (-995.962) [-994.519] -- 0:02:07
439500 -- (-994.473) (-999.517) (-994.507) [-992.247] * (-996.244) [-989.654] (-993.087) (-994.434) -- 0:02:07
440000 -- (-997.788) [-994.763] (-990.940) (-997.170) * (-994.244) (-993.357) (-996.656) [-995.282] -- 0:02:07
Average standard deviation of split frequencies: 0.009628
440500 -- (-994.325) (-992.449) [-990.419] (-994.602) * (-998.481) (-985.995) [-995.479] (-997.035) -- 0:02:07
441000 -- (-997.934) (-995.624) (-1001.448) [-993.159] * (-994.525) (-990.815) (-997.332) [-995.237] -- 0:02:06
441500 -- (-1000.798) (-997.618) (-994.872) [-990.594] * (-996.219) (-994.088) [-992.392] (-1000.572) -- 0:02:06
442000 -- (-991.739) (-995.532) [-1001.839] (-991.269) * [-999.038] (-995.095) (-998.826) (-1002.012) -- 0:02:06
442500 -- [-994.301] (-994.510) (-997.416) (-996.296) * (-1000.550) (-993.272) [-993.934] (-1006.169) -- 0:02:07
443000 -- (-1000.774) (-1007.824) [-990.413] (-998.615) * (-991.587) [-993.934] (-990.505) (-992.086) -- 0:02:06
443500 -- (-993.796) (-999.706) (-991.519) [-992.036] * (-1002.719) [-990.603] (-989.343) (-998.985) -- 0:02:06
444000 -- (-993.613) (-997.499) (-993.394) [-993.817] * (-992.629) (-997.227) (-996.491) [-989.142] -- 0:02:06
444500 -- [-995.152] (-1009.427) (-993.225) (-995.886) * (-998.748) (-994.405) (-994.614) [-989.892] -- 0:02:06
445000 -- (-996.599) (-1001.782) [-990.264] (-995.102) * (-993.835) (-994.920) [-990.876] (-998.592) -- 0:02:05
Average standard deviation of split frequencies: 0.009301
445500 -- [-989.529] (-998.050) (-991.862) (-1003.458) * (-995.625) (-996.663) (-991.905) [-995.943] -- 0:02:05
446000 -- [-991.781] (-993.063) (-991.256) (-997.982) * (-998.975) (-993.210) (-999.063) [-990.358] -- 0:02:05
446500 -- [-997.266] (-1000.353) (-989.959) (-994.273) * (-994.218) (-996.527) [-989.217] (-998.735) -- 0:02:06
447000 -- [-992.734] (-991.700) (-992.076) (-999.513) * (-995.900) (-998.808) (-993.155) [-991.188] -- 0:02:06
447500 -- (-992.959) (-999.352) (-993.129) [-999.087] * (-999.084) (-1001.726) (-1000.882) [-995.491] -- 0:02:05
448000 -- (-997.484) (-999.528) [-992.263] (-1006.595) * [-990.638] (-991.423) (-994.329) (-996.524) -- 0:02:05
448500 -- (-997.088) (-995.213) [-991.177] (-994.897) * (-995.385) (-999.019) [-995.898] (-991.730) -- 0:02:05
449000 -- (-996.953) (-991.592) [-991.795] (-1000.569) * (-999.556) (-999.014) [-991.760] (-1000.771) -- 0:02:05
449500 -- (-993.417) [-993.088] (-995.256) (-992.870) * [-987.344] (-1003.143) (-997.219) (-998.595) -- 0:02:04
450000 -- (-992.380) (-996.777) (-990.981) [-996.491] * [-993.397] (-996.615) (-985.992) (-990.994) -- 0:02:04
Average standard deviation of split frequencies: 0.010460
450500 -- (-998.444) (-994.080) [-995.590] (-990.476) * [-989.288] (-991.878) (-991.189) (-999.919) -- 0:02:04
451000 -- (-995.811) (-992.792) (-991.626) [-990.444] * (-995.480) (-1005.544) [-988.344] (-996.489) -- 0:02:05
451500 -- (-998.240) [-997.584] (-999.410) (-994.825) * (-990.453) (-998.138) [-995.389] (-990.587) -- 0:02:05
452000 -- (-1001.701) (-996.854) (-994.332) [-987.644] * (-991.812) (-999.871) [-994.266] (-997.387) -- 0:02:04
452500 -- (-1005.830) [-989.484] (-987.923) (-991.392) * [-996.954] (-1002.411) (-990.317) (-995.896) -- 0:02:04
453000 -- (-996.554) (-995.881) (-991.387) [-990.298] * (-992.614) [-998.671] (-999.359) (-993.864) -- 0:02:04
453500 -- (-994.822) (-995.771) (-1003.407) [-993.257] * (-996.715) (-994.668) (-994.429) [-990.068] -- 0:02:04
454000 -- (-997.334) (-997.146) (-995.482) [-992.798] * (-994.742) (-993.593) (-994.034) [-993.147] -- 0:02:03
454500 -- (-994.183) (-997.193) (-995.889) [-999.727] * (-992.417) [-992.814] (-998.470) (-997.193) -- 0:02:03
455000 -- (-994.801) (-997.049) [-987.302] (-1003.810) * (-996.940) (-991.264) [-997.483] (-991.922) -- 0:02:03
Average standard deviation of split frequencies: 0.009511
455500 -- [-987.995] (-992.536) (-994.672) (-993.079) * [-997.762] (-1003.628) (-994.472) (-991.117) -- 0:02:04
456000 -- (-997.337) [-991.924] (-997.839) (-996.287) * (-998.554) (-1004.680) (-1000.248) [-995.258] -- 0:02:04
456500 -- (-994.777) [-992.249] (-997.306) (-997.355) * (-996.246) (-998.500) (-992.624) [-995.060] -- 0:02:03
457000 -- (-992.852) (-994.231) (-996.465) [-1000.588] * [-994.522] (-1006.097) (-997.558) (-992.796) -- 0:02:03
457500 -- [-990.252] (-990.231) (-993.805) (-999.998) * (-988.268) (-995.466) (-986.856) [-997.672] -- 0:02:03
458000 -- (-999.726) (-1000.594) (-991.422) [-996.120] * (-989.570) [-998.138] (-998.549) (-1002.891) -- 0:02:03
458500 -- (-994.426) (-996.480) [-994.620] (-997.748) * (-986.898) (-1001.890) (-997.682) [-994.887] -- 0:02:02
459000 -- (-998.805) [-993.957] (-994.289) (-1003.371) * (-991.078) (-993.751) (-996.185) [-991.228] -- 0:02:02
459500 -- (-996.106) [-991.068] (-988.386) (-990.216) * (-993.610) (-992.780) [-990.248] (-1005.659) -- 0:02:02
460000 -- (-993.873) (-997.582) [-993.711] (-993.541) * (-992.724) (-999.591) [-997.833] (-996.777) -- 0:02:03
Average standard deviation of split frequencies: 0.007163
460500 -- (-996.808) [-990.033] (-1001.383) (-1005.195) * (-1009.881) (-987.287) [-991.225] (-998.231) -- 0:02:03
461000 -- (-996.827) [-1001.048] (-993.104) (-994.149) * (-1000.416) (-993.697) [-993.386] (-997.234) -- 0:02:02
461500 -- (-997.914) (-1002.482) [-993.842] (-995.078) * (-1002.394) [-989.557] (-994.678) (-994.998) -- 0:02:02
462000 -- (-996.527) [-991.865] (-986.600) (-993.055) * (-994.764) (-1001.290) [-996.662] (-987.165) -- 0:02:02
462500 -- (-991.440) (-995.748) (-989.607) [-996.860] * (-1002.262) (-1004.098) (-993.476) [-989.388] -- 0:02:02
463000 -- (-993.921) (-996.344) [-991.518] (-998.872) * (-1003.708) (-1003.429) [-993.191] (-1001.728) -- 0:02:01
463500 -- [-993.995] (-998.232) (-992.392) (-997.885) * (-1004.362) (-1002.708) (-992.814) [-997.745] -- 0:02:01
464000 -- (-997.493) [-990.006] (-1000.101) (-1001.902) * (-1002.419) (-995.421) (-1001.025) [-995.559] -- 0:02:02
464500 -- [-997.361] (-991.423) (-993.545) (-1001.824) * (-1008.839) (-999.251) [-993.672] (-995.292) -- 0:02:02
465000 -- (-995.761) (-999.224) [-994.126] (-999.597) * (-1006.583) (-998.774) (-997.102) [-994.754] -- 0:02:01
Average standard deviation of split frequencies: 0.007688
465500 -- (-996.687) (-998.957) [-989.186] (-993.312) * (-995.341) (-997.571) [-996.235] (-996.663) -- 0:02:01
466000 -- (-990.498) [-990.615] (-992.311) (-1000.427) * (-996.523) (-991.671) [-993.213] (-991.286) -- 0:02:01
466500 -- [-991.008] (-995.922) (-994.898) (-994.647) * (-994.552) [-996.082] (-991.034) (-990.040) -- 0:02:01
467000 -- (-992.940) (-993.746) [-992.559] (-999.241) * (-988.997) [-992.470] (-994.935) (-991.980) -- 0:02:00
467500 -- (-1001.648) (-991.429) (-996.636) [-995.813] * (-994.167) [-994.206] (-998.701) (-993.492) -- 0:02:00
468000 -- [-995.071] (-994.090) (-994.648) (-994.500) * (-991.078) [-999.252] (-991.130) (-996.653) -- 0:02:00
468500 -- (-997.151) [-993.201] (-991.136) (-995.088) * (-990.729) (-991.537) [-993.615] (-997.880) -- 0:02:01
469000 -- [-993.078] (-994.992) (-996.903) (-993.382) * (-992.594) [-991.931] (-995.376) (-986.653) -- 0:02:01
469500 -- (-997.363) (-993.442) (-996.049) [-996.379] * [-993.239] (-992.188) (-990.223) (-994.455) -- 0:02:00
470000 -- [-989.602] (-999.157) (-990.573) (-990.134) * (-991.630) (-1009.563) [-992.015] (-992.458) -- 0:02:00
Average standard deviation of split frequencies: 0.007412
470500 -- (-985.657) (-1000.337) (-997.757) [-995.431] * (-996.763) (-997.997) [-988.756] (-992.018) -- 0:02:00
471000 -- (-992.604) (-995.296) [-993.526] (-997.340) * (-994.232) (-995.815) [-991.296] (-990.066) -- 0:02:00
471500 -- (-992.401) [-998.433] (-993.113) (-995.075) * (-997.526) [-995.323] (-988.645) (-991.927) -- 0:01:59
472000 -- [-992.490] (-993.567) (-993.017) (-998.407) * (-995.611) (-993.478) (-990.262) [-990.907] -- 0:01:59
472500 -- (-998.850) (-997.738) (-996.311) [-1004.441] * (-999.440) (-995.089) [-995.342] (-988.162) -- 0:01:59
473000 -- (-997.056) (-999.317) (-992.062) [-993.928] * (-1005.746) (-995.040) [-996.830] (-995.019) -- 0:02:00
473500 -- (-993.759) (-1000.042) [-990.754] (-998.940) * (-999.756) [-990.535] (-991.991) (-995.063) -- 0:02:00
474000 -- (-991.238) (-994.342) (-996.926) [-994.382] * (-993.348) (-999.365) [-994.465] (-987.729) -- 0:01:59
474500 -- [-994.568] (-996.486) (-996.572) (-1006.357) * [-992.042] (-1002.173) (-998.744) (-990.823) -- 0:01:59
475000 -- (-988.700) (-994.016) [-990.839] (-997.185) * (-999.276) [-991.873] (-994.718) (-990.996) -- 0:01:59
Average standard deviation of split frequencies: 0.006932
475500 -- (-993.869) (-991.077) [-997.117] (-996.900) * (-1012.229) [-994.774] (-989.166) (-1001.760) -- 0:01:59
476000 -- (-989.602) (-1000.973) [-992.348] (-997.453) * (-1004.587) (-998.990) (-990.334) [-991.641] -- 0:01:58
476500 -- (-993.017) (-997.818) [-992.540] (-996.253) * [-996.485] (-995.762) (-992.486) (-994.376) -- 0:01:58
477000 -- [-995.466] (-994.597) (-998.073) (-995.984) * [-997.565] (-1000.738) (-991.500) (-993.239) -- 0:01:58
477500 -- (-993.581) (-993.233) (-1003.399) [-994.890] * (-997.794) [-996.076] (-993.625) (-994.061) -- 0:01:59
478000 -- (-998.507) [-994.279] (-996.935) (-997.673) * [-987.638] (-996.548) (-997.054) (-996.631) -- 0:01:59
478500 -- (-1010.623) (-997.054) [-992.240] (-994.533) * [-986.870] (-997.525) (-997.415) (-996.763) -- 0:01:58
479000 -- [-994.979] (-988.380) (-994.956) (-991.957) * [-994.279] (-996.658) (-991.936) (-1001.079) -- 0:01:58
479500 -- (-992.989) (-991.021) [-1001.031] (-999.148) * (-1003.071) [-993.931] (-999.098) (-997.610) -- 0:01:58
480000 -- (-996.593) (-987.403) (-993.402) [-991.117] * [-996.931] (-995.825) (-998.605) (-993.839) -- 0:01:58
Average standard deviation of split frequencies: 0.005884
480500 -- (-1001.550) (-992.013) (-995.150) [-987.415] * (-988.530) [-988.834] (-1007.722) (-994.553) -- 0:01:57
481000 -- (-1001.404) (-991.952) [-1003.388] (-991.725) * (-995.283) (-995.931) [-996.246] (-993.149) -- 0:01:57
481500 -- (-1000.501) (-993.326) [-995.160] (-991.760) * [-991.162] (-989.533) (-999.925) (-989.428) -- 0:01:57
482000 -- (-996.466) (-1000.364) (-1005.327) [-996.784] * (-996.292) (-993.268) (-1005.894) [-992.076] -- 0:01:58
482500 -- [-992.302] (-996.996) (-1001.589) (-1000.909) * (-992.132) (-995.470) [-996.894] (-998.724) -- 0:01:57
483000 -- [-991.250] (-989.980) (-995.042) (-1000.431) * (-988.731) (-1004.994) [-990.475] (-1003.897) -- 0:01:57
483500 -- (-994.057) (-989.579) [-994.571] (-995.574) * (-989.485) [-996.243] (-998.048) (-999.193) -- 0:01:57
484000 -- [-991.072] (-999.008) (-998.740) (-992.768) * (-995.336) [-993.236] (-995.611) (-999.487) -- 0:01:57
484500 -- [-988.795] (-993.546) (-997.519) (-1000.054) * (-993.428) (-994.926) [-996.360] (-997.936) -- 0:01:57
485000 -- [-995.534] (-1002.531) (-995.385) (-991.647) * [-991.579] (-993.312) (-990.921) (-995.392) -- 0:01:56
Average standard deviation of split frequencies: 0.005432
485500 -- (-994.917) (-997.741) [-999.703] (-994.889) * [-989.912] (-998.435) (-991.696) (-993.157) -- 0:01:56
486000 -- (-1002.228) [-991.607] (-988.963) (-997.412) * [-993.174] (-993.708) (-992.920) (-1001.283) -- 0:01:57
486500 -- (-991.520) [-996.830] (-995.299) (-998.604) * [-991.105] (-994.431) (-996.971) (-992.963) -- 0:01:57
487000 -- (-993.742) (-997.508) (-998.060) [-988.617] * (-995.143) (-996.581) (-991.148) [-987.742] -- 0:01:56
487500 -- (-992.159) [-988.421] (-997.634) (-996.509) * (-990.226) (-994.527) (-1001.977) [-990.463] -- 0:01:56
488000 -- [-994.505] (-988.689) (-995.318) (-990.224) * (-996.982) [-990.725] (-1001.577) (-992.377) -- 0:01:56
488500 -- [-988.415] (-992.274) (-1000.738) (-988.977) * (-1004.496) [-1003.439] (-993.017) (-997.420) -- 0:01:56
489000 -- [-994.711] (-992.639) (-992.234) (-994.028) * [-995.871] (-996.354) (-993.091) (-989.274) -- 0:01:55
489500 -- (-999.650) (-998.347) [-992.984] (-998.383) * (-990.654) (-987.994) (-998.614) [-992.851] -- 0:01:55
490000 -- (-1003.025) (-995.023) [-988.562] (-989.881) * (-1002.492) (-987.834) [-999.733] (-1003.173) -- 0:01:55
Average standard deviation of split frequencies: 0.004996
490500 -- (-997.071) (-994.391) [-995.001] (-991.445) * (-990.830) (-1005.008) (-994.455) [-990.635] -- 0:01:56
491000 -- (-994.714) [-996.012] (-997.586) (-995.977) * (-993.568) [-987.921] (-993.621) (-996.143) -- 0:01:56
491500 -- (-1005.695) (-1000.765) [-996.971] (-993.421) * [-990.000] (-991.634) (-996.981) (-995.490) -- 0:01:55
492000 -- (-1003.870) (-991.155) [-994.007] (-1003.009) * [-993.463] (-987.914) (-993.468) (-998.099) -- 0:01:55
492500 -- (-988.993) (-998.848) (-993.950) [-991.860] * (-996.908) [-991.022] (-997.060) (-996.650) -- 0:01:55
493000 -- [-991.421] (-1000.499) (-991.145) (-1003.367) * (-1000.606) (-993.869) [-995.542] (-994.226) -- 0:01:55
493500 -- (-992.386) (-999.611) [-991.572] (-987.536) * [-997.065] (-1000.985) (-993.401) (-990.851) -- 0:01:54
494000 -- (-990.943) (-1000.354) (-987.784) [-1001.303] * (-997.303) (-990.926) (-984.693) [-998.009] -- 0:01:54
494500 -- [-990.920] (-992.793) (-989.636) (-994.753) * (-992.678) (-997.716) (-995.743) [-996.408] -- 0:01:54
495000 -- (-995.721) (-989.833) [-1003.081] (-988.882) * (-990.225) (-1002.899) (-999.256) [-994.880] -- 0:01:55
Average standard deviation of split frequencies: 0.005512
495500 -- (-991.145) (-992.501) (-1008.071) [-988.270] * [-993.051] (-990.114) (-995.577) (-994.430) -- 0:01:55
496000 -- (-999.362) (-988.626) (-996.044) [-989.476] * [-996.372] (-1000.901) (-992.898) (-999.578) -- 0:01:54
496500 -- (-994.357) (-998.307) [-993.625] (-993.481) * (-998.477) (-993.513) [-1001.727] (-999.172) -- 0:01:54
497000 -- (-987.757) (-1002.940) (-1000.537) [-992.939] * (-990.884) (-998.839) (-993.796) [-991.736] -- 0:01:54
497500 -- (-990.350) (-994.754) (-989.298) [-993.897] * (-993.457) (-996.366) [-996.748] (-1004.860) -- 0:01:54
498000 -- [-992.860] (-996.299) (-993.512) (-993.889) * [-988.204] (-996.784) (-1009.046) (-994.927) -- 0:01:53
498500 -- [-991.526] (-993.229) (-991.556) (-995.665) * (-991.880) (-998.589) [-992.101] (-994.035) -- 0:01:53
499000 -- (-995.835) [-990.162] (-999.774) (-994.449) * (-994.053) (-1000.158) [-995.172] (-996.143) -- 0:01:53
499500 -- (-1001.865) [-989.281] (-998.138) (-997.454) * [-992.485] (-993.229) (-990.058) (-995.391) -- 0:01:54
500000 -- (-1004.467) [-987.688] (-991.134) (-995.145) * [-990.705] (-995.196) (-996.615) (-988.379) -- 0:01:54
Average standard deviation of split frequencies: 0.004331
500500 -- (-993.994) (-997.863) (-998.404) [-990.487] * (-994.901) (-990.241) [-996.448] (-991.919) -- 0:01:53
501000 -- (-1002.661) (-993.490) [-995.758] (-988.058) * (-990.659) (-994.641) [-1001.118] (-992.007) -- 0:01:53
501500 -- (-996.666) [-992.376] (-999.157) (-990.137) * [-992.025] (-995.742) (-988.760) (-991.680) -- 0:01:53
502000 -- [-998.478] (-994.364) (-1003.594) (-993.518) * (-995.376) (-1000.542) [-992.446] (-997.583) -- 0:01:53
502500 -- [-995.339] (-991.686) (-1004.327) (-993.568) * (-992.522) [-993.817] (-995.679) (-995.889) -- 0:01:52
503000 -- (-993.688) [-985.832] (-996.200) (-992.513) * (-989.348) (-1004.045) (-994.445) [-988.748] -- 0:01:52
503500 -- (-997.261) [-991.465] (-1006.973) (-992.309) * [-993.108] (-995.353) (-998.341) (-990.975) -- 0:01:53
504000 -- (-994.972) [-994.697] (-1001.017) (-992.726) * (-999.466) (-993.676) [-992.304] (-996.034) -- 0:01:53
504500 -- (-1000.034) [-992.539] (-993.405) (-1003.147) * (-990.603) (-991.082) [-990.287] (-995.067) -- 0:01:52
505000 -- (-991.830) (-997.083) (-998.459) [-994.678] * [-991.057] (-993.546) (-994.821) (-988.104) -- 0:01:52
Average standard deviation of split frequencies: 0.005031
505500 -- (-991.696) [-990.633] (-993.390) (-993.691) * (-995.887) (-992.244) (-992.903) [-992.951] -- 0:01:52
506000 -- [-996.321] (-992.587) (-997.571) (-995.098) * (-995.154) [-989.535] (-991.958) (-991.510) -- 0:01:52
506500 -- [-991.374] (-994.058) (-991.412) (-997.521) * (-990.236) (-997.460) (-995.201) [-993.604] -- 0:01:52
507000 -- [-994.790] (-993.652) (-990.714) (-993.542) * [-990.644] (-992.127) (-998.308) (-998.868) -- 0:01:51
507500 -- (-993.998) (-994.292) (-1000.091) [-997.702] * (-991.379) [-992.055] (-997.197) (-1000.594) -- 0:01:51
508000 -- (-992.020) [-997.118] (-1000.907) (-1000.106) * [-987.472] (-991.763) (-995.180) (-994.398) -- 0:01:52
508500 -- [-989.808] (-988.942) (-991.046) (-997.924) * (-1000.550) (-991.726) (-987.487) [-998.213] -- 0:01:52
509000 -- (-998.491) (-996.528) (-991.964) [-997.221] * (-992.686) (-1000.854) [-991.866] (-997.537) -- 0:01:51
509500 -- (-995.856) (-991.192) (-990.585) [-991.409] * (-1000.616) (-996.610) (-993.943) [-993.102] -- 0:01:51
510000 -- (-992.236) (-994.517) [-992.600] (-1001.422) * [-991.074] (-993.375) (-992.226) (-992.639) -- 0:01:51
Average standard deviation of split frequencies: 0.004062
510500 -- [-994.718] (-995.026) (-997.254) (-990.170) * (-1000.025) (-1003.691) (-996.205) [-988.449] -- 0:01:51
511000 -- (-998.609) (-996.307) (-993.969) [-990.647] * (-990.790) (-1001.797) [-993.005] (-995.588) -- 0:01:51
511500 -- (-991.707) [-991.421] (-990.529) (-993.867) * (-999.055) (-1002.331) (-993.744) [-990.188] -- 0:01:50
512000 -- [-989.776] (-988.548) (-1001.125) (-992.143) * (-997.702) [-996.504] (-1007.690) (-999.554) -- 0:01:50
512500 -- [-993.498] (-996.976) (-997.281) (-996.280) * (-993.874) (-996.444) (-999.565) [-998.517] -- 0:01:51
513000 -- (-987.525) [-992.304] (-1002.394) (-1000.615) * (-991.733) (-998.287) (-1005.067) [-996.056] -- 0:01:51
513500 -- (-999.454) (-990.663) [-996.348] (-988.212) * (-994.476) (-1004.715) [-997.913] (-993.740) -- 0:01:50
514000 -- (-993.906) (-995.373) [-993.565] (-992.404) * [-994.337] (-995.771) (-992.910) (-993.194) -- 0:01:50
514500 -- (-998.436) (-994.436) (-996.615) [-989.764] * (-998.026) (-1000.395) (-992.096) [-993.766] -- 0:01:50
515000 -- (-996.636) (-995.741) [-995.604] (-995.637) * (-990.744) [-992.229] (-999.036) (-993.474) -- 0:01:50
Average standard deviation of split frequencies: 0.004568
515500 -- [-992.549] (-1003.380) (-995.697) (-993.765) * [-994.320] (-990.335) (-1000.206) (-993.463) -- 0:01:49
516000 -- (-992.020) [-992.736] (-993.187) (-994.300) * [-995.421] (-1004.378) (-994.958) (-992.433) -- 0:01:49
516500 -- (-999.911) [-992.750] (-994.743) (-999.702) * (-991.823) (-995.001) [-1000.652] (-993.467) -- 0:01:50
517000 -- (-991.405) [-990.789] (-997.399) (-987.809) * (-999.272) [-991.476] (-994.067) (-994.935) -- 0:01:50
517500 -- (-992.334) (-995.809) (-997.863) [-991.071] * (-1000.612) [-987.890] (-1009.692) (-998.149) -- 0:01:50
518000 -- (-996.062) (-987.427) (-999.065) [-991.861] * (-995.917) (-994.779) [-997.526] (-991.245) -- 0:01:49
518500 -- (-997.496) [-992.702] (-1013.043) (-993.173) * (-1003.024) (-997.232) (-996.888) [-991.553] -- 0:01:49
519000 -- (-996.306) (-995.775) (-1004.189) [-989.412] * (-1008.021) [-994.105] (-1000.002) (-997.806) -- 0:01:49
519500 -- (-993.449) (-991.247) (-998.345) [-991.778] * (-1000.590) (-996.636) (-992.358) [-990.894] -- 0:01:49
520000 -- [-991.757] (-994.161) (-995.029) (-1001.642) * (-1003.048) (-994.493) (-988.975) [-994.944] -- 0:01:48
Average standard deviation of split frequencies: 0.005794
520500 -- (-993.520) [-999.897] (-999.961) (-994.240) * [-995.288] (-990.035) (-992.544) (-996.149) -- 0:01:48
521000 -- (-996.947) [-991.756] (-995.640) (-992.994) * (-993.551) (-991.763) (-994.807) [-999.300] -- 0:01:49
521500 -- (-990.522) [-996.631] (-992.509) (-998.231) * (-994.448) (-993.888) [-995.647] (-998.925) -- 0:01:49
522000 -- (-995.137) [-992.478] (-995.604) (-992.634) * (-996.358) (-991.197) (-993.322) [-995.521] -- 0:01:48
522500 -- (-991.429) (-990.807) (-996.856) [-989.750] * (-997.022) (-997.505) (-999.775) [-992.740] -- 0:01:48
523000 -- [-995.261] (-999.056) (-997.795) (-986.231) * (-1007.134) [-1000.491] (-992.145) (-1000.349) -- 0:01:48
523500 -- (-996.970) [-991.061] (-999.057) (-992.282) * (-993.824) (-997.920) (-992.899) [-991.113] -- 0:01:48
524000 -- [-996.898] (-991.528) (-998.277) (-996.304) * [-994.552] (-996.289) (-989.832) (-994.416) -- 0:01:48
524500 -- (-991.890) (-1002.401) [-993.207] (-996.759) * (-1003.013) (-995.363) [-989.998] (-993.738) -- 0:01:47
525000 -- [-993.576] (-994.581) (-993.650) (-996.816) * [-994.439] (-997.983) (-990.979) (-991.069) -- 0:01:47
Average standard deviation of split frequencies: 0.005377
525500 -- [-991.897] (-993.113) (-996.738) (-996.907) * (-991.086) (-998.770) [-989.965] (-997.062) -- 0:01:48
526000 -- [-994.126] (-996.250) (-991.932) (-994.260) * [-988.910] (-990.463) (-989.666) (-1007.853) -- 0:01:48
526500 -- (-991.744) (-1001.738) [-993.312] (-991.894) * [-992.952] (-1004.107) (-1004.951) (-993.240) -- 0:01:47
527000 -- (-995.731) (-991.650) (-993.795) [-995.623] * (-990.860) [-996.254] (-1000.903) (-1002.898) -- 0:01:47
527500 -- (-990.699) [-988.768] (-995.730) (-991.295) * [-991.045] (-1002.721) (-996.017) (-1006.474) -- 0:01:47
528000 -- (-991.618) (-994.660) (-994.231) [-991.494] * [-994.635] (-1013.644) (-988.470) (-990.642) -- 0:01:47
528500 -- (-992.078) (-993.449) (-990.515) [-997.189] * (-990.195) (-1001.706) [-988.917] (-989.926) -- 0:01:47
529000 -- (-997.962) (-994.477) (-999.214) [-990.557] * (-992.975) (-1002.400) (-1001.410) [-990.878] -- 0:01:46
529500 -- (-994.365) (-997.168) [-989.117] (-991.710) * (-999.089) (-998.052) (-1008.254) [-993.982] -- 0:01:47
530000 -- (-995.247) (-992.069) [-990.086] (-994.939) * (-991.310) [-1001.376] (-997.745) (-995.522) -- 0:01:47
Average standard deviation of split frequencies: 0.004975
530500 -- (-992.515) (-990.742) (-990.691) [-993.249] * [-991.917] (-995.321) (-991.210) (-998.509) -- 0:01:47
531000 -- (-993.396) (-991.166) (-990.994) [-991.433] * (-996.611) (-995.109) (-997.159) [-989.411] -- 0:01:46
531500 -- (-997.871) [-994.956] (-995.473) (-991.780) * (-1003.471) [-993.302] (-992.033) (-997.720) -- 0:01:46
532000 -- (-994.718) (-992.383) [-989.458] (-994.578) * (-991.455) (-1000.217) [-991.823] (-993.162) -- 0:01:46
532500 -- [-997.763] (-990.820) (-1002.179) (-994.714) * [-987.605] (-997.236) (-991.830) (-996.407) -- 0:01:46
533000 -- (-999.030) [-990.249] (-1005.321) (-1001.159) * (-994.768) (-996.151) [-995.375] (-995.397) -- 0:01:46
533500 -- (-988.769) [-996.939] (-997.591) (-995.829) * (-990.033) (-994.919) [-993.482] (-997.378) -- 0:01:45
534000 -- (-996.380) (-1001.383) (-996.909) [-1002.098] * (-993.312) (-994.965) (-995.721) [-993.832] -- 0:01:46
534500 -- (-998.677) [-1002.550] (-1001.619) (-992.738) * (-992.852) (-992.237) [-994.471] (-1006.042) -- 0:01:46
535000 -- (-993.645) (-994.102) [-997.160] (-992.949) * (-993.168) [-991.565] (-996.109) (-997.430) -- 0:01:46
Average standard deviation of split frequencies: 0.003166
535500 -- (-1001.768) [-993.591] (-992.916) (-994.612) * (-1000.927) (-992.546) (-993.745) [-992.272] -- 0:01:45
536000 -- [-994.966] (-991.867) (-996.218) (-999.511) * (-999.996) [-994.448] (-988.499) (-990.773) -- 0:01:45
536500 -- (-1004.033) (-992.035) (-995.683) [-996.126] * (-993.888) (-992.127) [-993.134] (-1000.686) -- 0:01:45
537000 -- (-1005.347) (-1000.371) [-994.427] (-994.672) * (-996.214) (-995.180) [-993.359] (-1001.228) -- 0:01:45
537500 -- (-992.974) [-992.227] (-995.117) (-997.131) * (-986.990) [-991.539] (-996.395) (-995.119) -- 0:01:44
538000 -- [-990.975] (-994.441) (-994.745) (-1001.769) * (-993.571) (-998.448) [-994.612] (-996.285) -- 0:01:44
538500 -- (-994.533) (-999.705) [-997.926] (-1001.364) * (-993.611) (-1000.666) (-992.042) [-991.323] -- 0:01:45
539000 -- (-998.778) (-994.582) (-988.670) [-989.494] * (-1003.375) (-995.285) [-993.427] (-993.709) -- 0:01:45
539500 -- (-994.158) (-995.489) [-995.902] (-1005.778) * (-993.368) (-995.062) [-994.826] (-999.263) -- 0:01:44
540000 -- (-996.540) (-996.005) [-992.166] (-997.552) * (-992.240) [-990.331] (-992.987) (-998.011) -- 0:01:44
Average standard deviation of split frequencies: 0.004011
540500 -- [-991.152] (-995.526) (-998.915) (-991.230) * (-991.472) (-994.546) [-997.229] (-993.022) -- 0:01:44
541000 -- [-994.136] (-992.600) (-1000.583) (-992.121) * (-995.497) (-993.567) [-992.003] (-995.118) -- 0:01:44
541500 -- (-990.290) (-993.107) [-991.640] (-992.711) * [-995.648] (-990.528) (-993.170) (-994.236) -- 0:01:44
542000 -- (-995.295) (-995.104) [-998.585] (-1004.988) * (-996.181) (-991.791) (-1001.987) [-989.784] -- 0:01:43
542500 -- (-999.637) [-992.114] (-992.095) (-998.244) * [-994.932] (-1000.637) (-994.225) (-1000.488) -- 0:01:43
543000 -- (-990.392) (-1003.938) [-997.344] (-994.255) * (-1002.530) [-994.664] (-994.622) (-992.634) -- 0:01:44
543500 -- (-991.057) (-998.634) [-990.561] (-994.939) * (-997.353) (-989.181) (-991.410) [-990.820] -- 0:01:44
544000 -- [-999.853] (-992.121) (-999.447) (-989.528) * (-989.596) (-1002.656) (-994.246) [-991.886] -- 0:01:43
544500 -- (-992.396) (-993.639) (-994.506) [-991.687] * [-997.856] (-1002.562) (-997.392) (-998.867) -- 0:01:43
545000 -- (-993.327) (-994.315) [-1002.563] (-998.212) * [-995.315] (-993.769) (-994.375) (-992.070) -- 0:01:43
Average standard deviation of split frequencies: 0.003972
545500 -- (-995.887) (-998.117) (-993.507) [-991.019] * (-991.896) (-1006.173) (-990.093) [-995.079] -- 0:01:43
546000 -- (-994.007) (-1000.250) [-999.543] (-999.059) * (-1000.063) (-997.409) (-990.605) [-995.611] -- 0:01:43
546500 -- (-999.932) [-996.831] (-997.949) (-990.653) * (-991.682) (-993.279) (-994.467) [-993.711] -- 0:01:42
547000 -- (-993.676) (-997.144) (-996.761) [-995.236] * (-995.983) [-987.761] (-989.401) (-991.351) -- 0:01:43
547500 -- (-998.478) [-995.071] (-991.282) (-995.591) * (-991.635) [-989.350] (-991.248) (-995.055) -- 0:01:43
548000 -- (-994.461) (-1001.304) (-992.025) [-990.280] * (-990.448) (-993.034) (-993.273) [-991.621] -- 0:01:43
548500 -- [-990.561] (-1001.720) (-995.725) (-998.418) * (-994.124) [-994.301] (-1007.392) (-995.619) -- 0:01:42
549000 -- [-988.809] (-994.796) (-991.999) (-991.760) * [-991.387] (-991.549) (-1012.897) (-995.346) -- 0:01:42
549500 -- (-995.032) (-994.709) (-992.643) [-991.559] * (-994.984) (-999.238) (-993.232) [-995.368] -- 0:01:42
550000 -- [-999.804] (-992.913) (-992.994) (-994.549) * (-996.829) (-991.756) [-992.610] (-989.994) -- 0:01:42
Average standard deviation of split frequencies: 0.005136
550500 -- (-997.871) (-1003.279) [-993.223] (-1006.792) * (-994.903) (-994.056) (-994.303) [-987.938] -- 0:01:42
551000 -- (-997.206) (-992.216) [-996.185] (-1001.005) * (-992.545) (-991.119) [-990.615] (-997.161) -- 0:01:41
551500 -- [-996.824] (-998.653) (-995.852) (-998.076) * (-996.792) [-991.445] (-990.668) (-995.631) -- 0:01:42
552000 -- (-999.801) [-996.753] (-990.879) (-998.774) * (-1002.236) (-994.280) (-987.777) [-994.981] -- 0:01:42
552500 -- (-1002.011) [-998.023] (-993.216) (-998.996) * [-993.747] (-996.097) (-992.060) (-1006.319) -- 0:01:42
553000 -- (-991.242) [-1001.509] (-999.784) (-998.387) * [-990.889] (-993.835) (-996.380) (-1001.151) -- 0:01:41
553500 -- (-989.929) (-999.424) [-993.999] (-1010.922) * (-1000.182) [-992.312] (-997.452) (-1000.358) -- 0:01:41
554000 -- (-992.659) [-994.982] (-1000.927) (-1003.585) * (-989.472) (-996.969) (-996.916) [-990.793] -- 0:01:41
554500 -- (-994.315) (-994.771) (-999.635) [-997.500] * [-986.393] (-997.523) (-994.209) (-1005.607) -- 0:01:41
555000 -- (-1002.516) [-1002.392] (-998.604) (-993.217) * [-1000.077] (-996.120) (-996.654) (-1001.824) -- 0:01:41
Average standard deviation of split frequencies: 0.004918
555500 -- (-1014.331) [-994.904] (-1000.160) (-992.084) * (-1004.032) [-990.680] (-998.926) (-1000.996) -- 0:01:40
556000 -- (-996.096) [-997.012] (-998.884) (-991.787) * [-992.753] (-1001.036) (-993.494) (-997.161) -- 0:01:41
556500 -- (-996.693) (-996.257) (-995.502) [-992.504] * (-997.721) [-992.973] (-996.506) (-992.882) -- 0:01:41
557000 -- (-1001.901) (-994.194) [-992.343] (-995.441) * (-1001.213) (-996.204) (-998.636) [-992.593] -- 0:01:41
557500 -- (-994.369) (-999.560) (-996.761) [-990.876] * (-993.591) (-995.240) [-995.685] (-994.707) -- 0:01:40
558000 -- (-995.097) (-996.633) [-991.167] (-995.803) * (-997.687) [-997.470] (-997.680) (-997.895) -- 0:01:40
558500 -- [-993.289] (-991.553) (-989.801) (-999.453) * [-997.094] (-997.828) (-996.864) (-992.898) -- 0:01:40
559000 -- (-995.456) (-997.172) (-990.182) [-994.476] * (-1004.439) (-994.920) [-996.406] (-996.286) -- 0:01:40
559500 -- (-993.451) (-1000.953) [-994.533] (-992.864) * (-994.972) [-999.453] (-990.998) (-1001.080) -- 0:01:39
560000 -- (-994.617) (-1004.902) [-988.857] (-994.728) * (-993.609) [-991.185] (-1005.280) (-995.511) -- 0:01:39
Average standard deviation of split frequencies: 0.005045
560500 -- [-994.256] (-995.366) (-990.737) (-996.032) * (-991.739) (-985.885) (-995.740) [-995.313] -- 0:01:40
561000 -- (-992.920) (-992.384) (-987.119) [-995.589] * (-988.544) [-991.596] (-1003.454) (-994.551) -- 0:01:40
561500 -- (-996.690) (-995.340) (-993.338) [-991.503] * [-993.236] (-994.778) (-996.840) (-998.311) -- 0:01:39
562000 -- (-991.862) [-991.215] (-999.445) (-992.282) * (-989.790) [-987.816] (-990.816) (-993.349) -- 0:01:39
562500 -- [-991.590] (-989.038) (-995.324) (-989.278) * (-995.676) (-992.840) [-990.845] (-1005.166) -- 0:01:39
563000 -- [-993.880] (-991.445) (-991.323) (-998.438) * (-1003.815) (-996.820) (-997.562) [-993.274] -- 0:01:39
563500 -- (-999.773) [-988.479] (-994.296) (-991.169) * (-993.047) (-1000.778) (-993.941) [-993.239] -- 0:01:39
564000 -- (-991.738) (-988.833) [-998.181] (-993.196) * [-992.870] (-1001.637) (-993.063) (-997.345) -- 0:01:38
564500 -- (-1004.181) [-995.194] (-989.520) (-995.790) * [-993.254] (-995.315) (-994.711) (-994.780) -- 0:01:39
565000 -- (-995.461) (-997.773) (-1001.178) [-993.433] * [-999.014] (-999.719) (-995.430) (-994.333) -- 0:01:39
Average standard deviation of split frequencies: 0.004164
565500 -- (-994.682) (-999.652) (-989.971) [-996.258] * (-997.475) (-990.907) (-995.106) [-993.786] -- 0:01:39
566000 -- (-992.855) [-1001.628] (-998.664) (-992.675) * (-991.236) (-991.623) [-1003.379] (-987.281) -- 0:01:38
566500 -- (-994.748) [-992.404] (-993.772) (-1003.208) * (-991.830) (-997.239) (-996.616) [-987.245] -- 0:01:38
567000 -- [-990.957] (-992.703) (-1005.748) (-1000.920) * [-998.102] (-994.389) (-993.272) (-996.324) -- 0:01:38
567500 -- (-991.021) (-993.343) [-995.190] (-994.205) * (-1005.097) (-1000.382) [-996.457] (-989.654) -- 0:01:38
568000 -- (-992.612) (-997.422) [-996.455] (-998.950) * (-996.933) [-1002.489] (-994.761) (-994.630) -- 0:01:38
568500 -- (-995.058) (-995.100) [-992.837] (-998.753) * (-1000.656) (-1000.420) (-1000.215) [-991.121] -- 0:01:37
569000 -- (-995.993) [-995.213] (-996.186) (-992.974) * (-998.596) (-1002.222) (-1001.287) [-995.276] -- 0:01:38
569500 -- (-1007.755) [-988.069] (-996.321) (-994.152) * (-993.434) (-988.722) (-997.475) [-992.036] -- 0:01:38
570000 -- (-996.358) [-991.765] (-1003.862) (-1005.496) * (-999.350) (-988.283) (-1001.693) [-997.146] -- 0:01:38
Average standard deviation of split frequencies: 0.002974
570500 -- (-1004.986) (-997.024) [-998.624] (-1002.716) * (-997.280) [-992.437] (-1008.700) (-994.108) -- 0:01:37
571000 -- (-993.114) [-1001.157] (-1002.062) (-995.408) * (-997.644) (-996.743) [-991.308] (-998.800) -- 0:01:37
571500 -- (-998.146) [-987.925] (-1009.463) (-995.276) * [-989.399] (-994.254) (-993.817) (-998.973) -- 0:01:37
572000 -- (-996.191) (-995.885) (-989.645) [-990.784] * [-988.975] (-1004.217) (-993.680) (-1003.631) -- 0:01:37
572500 -- (-994.085) [-990.618] (-995.165) (-992.645) * (-989.892) (-1005.153) [-993.880] (-992.955) -- 0:01:37
573000 -- (-1005.418) (-998.175) [-993.942] (-993.177) * (-993.334) (-992.475) [-998.322] (-991.070) -- 0:01:36
573500 -- (-994.004) (-998.083) [-995.776] (-997.743) * (-997.263) (-992.861) [-1002.797] (-996.764) -- 0:01:37
574000 -- (-1001.972) [-990.512] (-998.175) (-997.829) * (-996.932) (-1001.396) [-999.785] (-994.291) -- 0:01:37
574500 -- [-992.800] (-991.370) (-992.257) (-991.344) * (-995.892) [-994.837] (-998.525) (-992.076) -- 0:01:37
575000 -- (-1003.136) (-995.510) [-994.441] (-1001.408) * [-991.377] (-992.591) (-999.543) (-991.079) -- 0:01:36
Average standard deviation of split frequencies: 0.004583
575500 -- [-991.601] (-989.795) (-988.157) (-999.187) * [-991.364] (-991.871) (-993.759) (-990.975) -- 0:01:36
576000 -- (-995.418) (-987.649) [-990.989] (-992.313) * (-995.089) [-996.288] (-994.477) (-990.987) -- 0:01:36
576500 -- [-994.806] (-996.643) (-993.033) (-987.649) * (-997.984) [-992.402] (-992.734) (-989.225) -- 0:01:36
577000 -- (-1007.240) (-996.155) (-1005.104) [-988.277] * (-997.431) (-987.138) [-992.323] (-999.273) -- 0:01:36
577500 -- (-999.266) (-996.730) (-994.813) [-995.635] * (-998.929) [-997.500] (-995.461) (-994.170) -- 0:01:35
578000 -- (-1004.645) [-991.978] (-998.486) (-996.615) * [-996.930] (-990.625) (-992.313) (-993.512) -- 0:01:36
578500 -- (-994.853) [-992.862] (-995.781) (-992.134) * (-996.565) [-990.941] (-994.447) (-996.110) -- 0:01:36
579000 -- (-997.144) [-998.388] (-996.247) (-992.652) * [-992.840] (-996.033) (-992.398) (-997.971) -- 0:01:35
579500 -- (-993.260) [-994.293] (-999.492) (-994.805) * [-998.493] (-994.152) (-992.920) (-991.248) -- 0:01:35
580000 -- [-991.393] (-991.600) (-995.944) (-998.803) * [-992.558] (-1000.528) (-995.964) (-997.070) -- 0:01:35
Average standard deviation of split frequencies: 0.003897
580500 -- (-990.368) (-991.637) (-996.569) [-1000.414] * (-997.545) (-993.421) [-993.483] (-995.624) -- 0:01:35
581000 -- [-989.481] (-999.351) (-994.801) (-990.800) * (-993.010) (-994.760) [-988.511] (-996.427) -- 0:01:35
581500 -- [-988.840] (-993.692) (-995.023) (-991.656) * [-994.017] (-994.642) (-991.815) (-996.293) -- 0:01:34
582000 -- (-994.166) (-995.351) (-993.830) [-994.790] * [-1000.386] (-1002.007) (-996.708) (-992.680) -- 0:01:34
582500 -- [-991.616] (-995.175) (-1003.033) (-992.600) * (-991.367) [-991.902] (-997.685) (-990.200) -- 0:01:35
583000 -- [-989.891] (-988.313) (-993.986) (-989.188) * [-990.881] (-991.078) (-998.231) (-1002.469) -- 0:01:35
583500 -- [-989.428] (-999.479) (-997.576) (-993.747) * [-999.279] (-997.923) (-996.670) (-992.795) -- 0:01:34
584000 -- [-992.212] (-994.996) (-995.176) (-993.485) * (-1001.220) (-1004.159) (-1004.920) [-993.372] -- 0:01:34
584500 -- [-995.782] (-993.624) (-1001.487) (-994.396) * (-996.294) (-992.110) [-996.345] (-1000.494) -- 0:01:34
585000 -- (-997.521) (-995.696) (-987.522) [-989.749] * (-996.905) (-1002.185) (-998.726) [-990.986] -- 0:01:34
Average standard deviation of split frequencies: 0.003379
585500 -- (-997.419) (-994.091) (-994.430) [-992.823] * (-1009.392) (-1003.536) [-996.659] (-996.663) -- 0:01:34
586000 -- (-1000.390) (-998.317) (-995.821) [-993.293] * (-1002.726) (-994.538) [-990.418] (-1002.878) -- 0:01:33
586500 -- (-994.714) (-990.964) (-994.064) [-989.967] * [-997.996] (-1002.947) (-996.865) (-997.689) -- 0:01:34
587000 -- (-994.309) (-1001.246) (-997.788) [-992.201] * (-993.590) (-1003.148) (-993.821) [-990.548] -- 0:01:34
587500 -- (-988.757) (-1000.846) (-999.512) [-988.796] * [-993.901] (-993.870) (-992.287) (-998.955) -- 0:01:34
588000 -- (-997.617) (-998.723) [-994.879] (-991.810) * (-992.045) (-997.618) [-986.060] (-992.336) -- 0:01:33
588500 -- (-1004.003) (-1003.404) (-999.657) [-990.167] * (-987.368) (-999.545) (-991.869) [-991.982] -- 0:01:33
589000 -- (-995.033) (-1000.134) (-993.519) [-986.987] * (-993.751) (-1003.895) (-989.502) [-1000.840] -- 0:01:33
589500 -- (-997.101) (-998.756) (-1002.660) [-994.236] * (-988.962) (-993.006) (-1002.992) [-988.768] -- 0:01:33
590000 -- (-995.495) (-996.883) [-995.925] (-997.850) * (-995.845) (-994.764) (-1001.837) [-995.645] -- 0:01:33
Average standard deviation of split frequencies: 0.003831
590500 -- (-996.520) [-993.337] (-1007.414) (-998.115) * (-1006.065) (-993.374) (-1004.065) [-992.524] -- 0:01:32
591000 -- (-1009.954) (-996.261) [-995.313] (-996.413) * (-997.674) [-992.067] (-989.123) (-994.475) -- 0:01:33
591500 -- [-990.529] (-996.185) (-991.725) (-995.763) * (-996.873) (-992.568) [-988.146] (-993.243) -- 0:01:33
592000 -- (-993.445) (-997.749) [-994.382] (-995.809) * (-1000.737) [-995.798] (-991.905) (-990.403) -- 0:01:33
592500 -- (-988.063) (-998.249) (-996.147) [-991.297] * (-997.155) (-995.883) [-989.333] (-996.554) -- 0:01:32
593000 -- (-998.405) [-997.289] (-995.011) (-995.933) * (-995.322) (-998.525) (-993.051) [-993.271] -- 0:01:32
593500 -- [-990.428] (-998.464) (-992.084) (-1003.080) * (-998.359) (-1004.753) [-993.290] (-996.029) -- 0:01:32
594000 -- (-997.604) [-996.845] (-996.434) (-996.921) * (-991.280) [-988.061] (-1000.614) (-1000.702) -- 0:01:32
594500 -- (-998.804) [-996.626] (-995.142) (-997.553) * (-996.005) [-991.156] (-993.932) (-1004.338) -- 0:01:32
595000 -- (-997.001) [-993.851] (-994.185) (-997.133) * (-996.005) (-997.639) [-991.430] (-998.587) -- 0:01:31
Average standard deviation of split frequencies: 0.003638
595500 -- (-994.442) (-990.564) [-994.286] (-998.398) * (-989.105) [-992.249] (-994.764) (-1005.174) -- 0:01:32
596000 -- (-993.882) [-997.760] (-1007.065) (-993.276) * (-996.912) (-994.183) (-997.112) [-992.807] -- 0:01:32
596500 -- [-993.859] (-994.063) (-993.859) (-996.812) * [-996.469] (-993.439) (-1000.838) (-991.595) -- 0:01:31
597000 -- (-996.270) [-993.638] (-1003.811) (-997.095) * (-993.349) (-987.229) [-1007.506] (-997.273) -- 0:01:31
597500 -- [-994.826] (-994.616) (-997.020) (-996.946) * (-990.893) [-994.920] (-990.523) (-991.023) -- 0:01:31
598000 -- [-987.595] (-996.380) (-1002.195) (-1001.234) * (-990.576) (-993.850) (-991.154) [-995.411] -- 0:01:31
598500 -- (-993.074) [-993.484] (-995.562) (-992.804) * (-994.716) [-996.247] (-991.916) (-998.524) -- 0:01:31
599000 -- (-996.095) (-994.271) (-1005.575) [-988.208] * (-1001.781) (-990.495) (-991.804) [-991.121] -- 0:01:31
599500 -- (-1004.189) (-996.297) (-993.633) [-987.172] * (-988.598) [-991.777] (-995.048) (-997.997) -- 0:01:30
600000 -- (-990.022) [-992.286] (-993.015) (-988.803) * (-997.900) [-991.416] (-993.728) (-990.022) -- 0:01:31
Average standard deviation of split frequencies: 0.003767
600500 -- (-995.683) (-987.103) (-994.430) [-992.815] * (-996.952) (-996.807) (-995.700) [-996.335] -- 0:01:31
601000 -- [-990.959] (-992.728) (-991.681) (-992.687) * (-997.275) (-996.627) (-992.837) [-998.954] -- 0:01:30
601500 -- [-995.338] (-992.413) (-991.786) (-997.701) * (-989.132) (-998.849) [-992.935] (-999.009) -- 0:01:30
602000 -- [-992.421] (-999.985) (-1006.966) (-1001.342) * (-990.520) [-994.221] (-995.193) (-997.434) -- 0:01:30
602500 -- (-997.838) [-1000.217] (-996.226) (-993.591) * (-990.512) (-991.166) (-991.544) [-996.791] -- 0:01:30
603000 -- [-995.986] (-1003.501) (-992.085) (-996.799) * (-994.508) (-994.957) (-998.992) [-991.747] -- 0:01:30
603500 -- [-991.299] (-991.128) (-991.788) (-993.680) * [-1000.219] (-994.527) (-999.596) (-991.061) -- 0:01:30
604000 -- [-993.685] (-987.097) (-990.514) (-993.837) * (-995.355) (-994.369) (-993.548) [-994.713] -- 0:01:29
604500 -- (-999.068) (-1000.712) (-989.879) [-1001.967] * (-990.869) (-999.682) (-993.014) [-994.391] -- 0:01:30
605000 -- (-993.407) [-992.945] (-990.951) (-994.010) * (-999.045) (-991.992) (-994.665) [-990.020] -- 0:01:30
Average standard deviation of split frequencies: 0.003734
605500 -- [-988.952] (-1003.343) (-989.928) (-995.844) * (-989.854) (-996.056) [-996.659] (-990.772) -- 0:01:29
606000 -- (-995.688) [-993.113] (-992.609) (-1002.166) * (-989.455) (-1000.434) [-990.577] (-1003.383) -- 0:01:29
606500 -- (-994.065) (-992.347) [-986.985] (-996.226) * (-1001.454) (-1002.799) (-992.278) [-990.275] -- 0:01:29
607000 -- (-1002.368) [-992.419] (-991.737) (-991.198) * (-993.592) (-1005.361) (-1000.686) [-989.936] -- 0:01:29
607500 -- [-1000.993] (-996.905) (-991.921) (-990.429) * (-995.797) (-998.689) [-987.742] (-992.770) -- 0:01:29
608000 -- (-1003.023) (-994.418) [-995.532] (-1002.824) * [-987.362] (-1000.859) (-990.620) (-997.052) -- 0:01:28
608500 -- [-995.258] (-996.590) (-994.115) (-993.299) * [-990.572] (-992.469) (-1005.447) (-988.664) -- 0:01:29
609000 -- (-1002.945) [-995.588] (-991.531) (-993.065) * (-987.892) (-1002.535) (-997.862) [-995.391] -- 0:01:29
609500 -- (-999.728) (-989.011) (-997.439) [-989.723] * [-992.028] (-997.596) (-987.800) (-991.450) -- 0:01:29
610000 -- (-996.837) (-992.127) (-995.490) [-991.617] * (-995.377) [-999.296] (-992.949) (-989.234) -- 0:01:28
Average standard deviation of split frequencies: 0.004169
610500 -- (-998.882) (-1003.633) (-994.917) [-991.380] * (-996.294) [-992.056] (-999.433) (-998.145) -- 0:01:28
611000 -- (-996.654) (-994.619) [-991.196] (-989.817) * (-1008.344) (-1002.262) [-992.728] (-991.942) -- 0:01:28
611500 -- [-989.164] (-997.484) (-997.230) (-990.010) * [-991.763] (-992.551) (-991.650) (-999.334) -- 0:01:28
612000 -- (-998.341) [-991.316] (-994.326) (-997.420) * (-988.632) (-994.434) [-992.895] (-999.822) -- 0:01:28
612500 -- (-1001.309) (-998.916) [-992.804] (-999.603) * (-998.739) [-996.257] (-991.626) (-994.197) -- 0:01:27
613000 -- [-998.104] (-997.487) (-990.508) (-1004.001) * (-992.451) (-994.528) (-989.557) [-994.007] -- 0:01:28
613500 -- [-993.043] (-995.885) (-1000.076) (-992.686) * (-989.820) (-1001.031) [-992.312] (-1001.170) -- 0:01:28
614000 -- (-992.285) [-992.227] (-989.538) (-995.520) * [-996.167] (-994.710) (-994.133) (-996.093) -- 0:01:28
614500 -- (-999.425) (-998.997) [-988.591] (-992.714) * (-991.798) (-993.125) [-1000.018] (-993.039) -- 0:01:27
615000 -- [-992.464] (-995.967) (-996.187) (-991.344) * [-990.766] (-994.322) (-993.732) (-992.117) -- 0:01:27
Average standard deviation of split frequencies: 0.004898
615500 -- [-991.954] (-1004.187) (-998.246) (-994.177) * (-993.309) [-994.088] (-998.290) (-995.326) -- 0:01:27
616000 -- (-1000.039) [-993.419] (-989.603) (-990.124) * (-1002.552) (-994.178) (-992.799) [-993.329] -- 0:01:27
616500 -- (-996.088) [-996.424] (-995.778) (-996.533) * (-995.970) (-996.764) (-991.836) [-989.888] -- 0:01:27
617000 -- (-1003.345) (-991.637) [-991.766] (-999.342) * (-992.192) (-998.696) [-995.903] (-995.483) -- 0:01:26
617500 -- (-995.551) (-991.539) [-997.052] (-993.063) * (-994.847) [-1001.365] (-990.156) (-1004.796) -- 0:01:27
618000 -- (-995.803) (-990.184) (-998.021) [-990.732] * (-996.849) (-996.809) [-991.670] (-995.310) -- 0:01:27
618500 -- (-993.502) (-990.674) [-993.279] (-1000.751) * [-985.587] (-995.679) (-991.476) (-998.609) -- 0:01:26
619000 -- (-997.800) [-995.264] (-988.964) (-991.647) * (-994.265) (-994.393) [-997.150] (-998.477) -- 0:01:26
619500 -- [-993.053] (-994.582) (-990.118) (-996.013) * (-992.886) (-1003.474) (-995.163) [-996.443] -- 0:01:26
620000 -- [-993.360] (-992.456) (-995.766) (-991.213) * (-991.547) (-995.403) (-1000.350) [-990.541] -- 0:01:26
Average standard deviation of split frequencies: 0.005013
620500 -- [-994.099] (-993.189) (-989.366) (-996.079) * (-991.500) (-993.565) (-999.409) [-990.474] -- 0:01:26
621000 -- (-993.677) (-993.669) (-996.121) [-990.719] * [-991.651] (-996.949) (-988.121) (-997.259) -- 0:01:26
621500 -- (-991.073) (-993.951) [-990.754] (-995.358) * (-996.347) (-1002.976) [-990.496] (-995.132) -- 0:01:25
622000 -- (-998.316) (-995.175) (-997.066) [-988.486] * (-996.819) (-997.400) [-998.242] (-997.711) -- 0:01:26
622500 -- (-991.542) [-992.601] (-995.464) (-996.751) * (-1002.747) (-1001.076) [-994.704] (-1001.755) -- 0:01:26
623000 -- [-995.526] (-1001.687) (-991.486) (-993.579) * (-1001.346) [-993.794] (-992.098) (-997.607) -- 0:01:25
623500 -- (-998.825) (-999.480) [-994.783] (-994.244) * [-990.982] (-996.373) (-989.817) (-1005.530) -- 0:01:25
624000 -- (-994.348) (-992.252) [-990.455] (-1005.941) * [-995.699] (-995.128) (-990.143) (-992.559) -- 0:01:25
624500 -- (-994.643) (-992.492) (-991.781) [-997.452] * [-993.748] (-1000.932) (-992.909) (-989.617) -- 0:01:25
625000 -- [-995.199] (-1003.053) (-997.274) (-994.889) * (-994.164) (-992.447) (-998.733) [-990.076] -- 0:01:25
Average standard deviation of split frequencies: 0.003615
625500 -- [-992.469] (-996.471) (-995.948) (-1004.528) * (-1005.889) (-996.601) [-992.872] (-993.026) -- 0:01:25
626000 -- [-994.105] (-995.933) (-1003.114) (-997.434) * (-998.157) [-989.068] (-992.651) (-997.288) -- 0:01:25
626500 -- (-1001.220) (-992.206) [-996.151] (-994.439) * (-998.040) (-998.349) (-994.338) [-994.538] -- 0:01:25
627000 -- (-1007.467) [-995.327] (-997.687) (-989.500) * (-999.229) (-992.659) [-991.543] (-995.872) -- 0:01:25
627500 -- [-996.722] (-991.924) (-996.037) (-994.985) * (-1009.796) (-997.258) [-1000.594] (-997.969) -- 0:01:24
628000 -- [-993.643] (-992.932) (-998.197) (-997.609) * [-993.357] (-994.439) (-996.151) (-993.825) -- 0:01:24
628500 -- (-990.152) (-995.290) [-999.128] (-990.092) * (-991.106) (-994.561) [-993.744] (-1008.141) -- 0:01:24
629000 -- (-989.773) (-994.875) (-1005.543) [-991.101] * (-995.629) [-990.139] (-992.856) (-1003.130) -- 0:01:24
629500 -- (-988.375) (-1004.813) (-998.503) [-995.743] * (-994.256) (-991.519) (-992.596) [-994.836] -- 0:01:24
630000 -- (-993.275) (-996.055) (-993.296) [-997.918] * (-1002.119) (-994.629) [-989.924] (-997.652) -- 0:01:23
Average standard deviation of split frequencies: 0.003289
630500 -- (-999.487) (-995.216) [-997.953] (-992.677) * [-991.722] (-990.182) (-992.949) (-991.236) -- 0:01:24
631000 -- (-999.031) (-993.226) [-989.275] (-989.952) * (-994.651) (-993.069) [-991.649] (-998.069) -- 0:01:24
631500 -- (-992.742) (-996.259) (-996.580) [-993.260] * (-1001.044) (-1001.995) (-998.478) [-996.145] -- 0:01:24
632000 -- (-993.269) [-993.317] (-992.092) (-995.101) * (-991.970) (-993.388) (-989.318) [-990.761] -- 0:01:23
632500 -- (-997.106) (-997.058) [-992.188] (-993.281) * [-991.546] (-993.315) (-992.339) (-1002.387) -- 0:01:23
633000 -- (-991.551) (-997.494) [-996.273] (-995.853) * (-998.608) [-992.591] (-989.846) (-997.063) -- 0:01:23
633500 -- (-1004.360) (-996.880) [-986.522] (-991.817) * (-993.996) (-989.977) [-991.134] (-1005.454) -- 0:01:23
634000 -- (-992.226) (-994.893) [-994.720] (-997.356) * (-995.315) (-1002.147) [-990.108] (-987.953) -- 0:01:23
634500 -- [-992.185] (-991.607) (-994.378) (-1000.636) * (-1008.389) (-994.772) (-996.746) [-991.967] -- 0:01:23
635000 -- (-989.540) (-995.262) [-995.843] (-994.785) * (-999.838) (-996.194) (-997.688) [-997.127] -- 0:01:23
Average standard deviation of split frequencies: 0.002372
635500 -- (-1003.302) (-1002.610) (-993.039) [-992.874] * (-998.808) (-994.738) [-1002.282] (-994.899) -- 0:01:23
636000 -- (-989.073) (-1004.472) (-997.480) [-989.058] * (-991.474) (-998.644) [-991.699] (-995.933) -- 0:01:22
636500 -- (-993.181) (-1004.743) [-997.105] (-991.774) * (-998.002) (-991.330) (-1001.304) [-990.656] -- 0:01:22
637000 -- (-989.981) (-997.429) (-991.892) [-989.544] * [-992.420] (-991.791) (-996.558) (-994.193) -- 0:01:22
637500 -- (-998.455) [-993.308] (-1002.801) (-994.775) * [-996.088] (-997.712) (-992.285) (-997.374) -- 0:01:22
638000 -- [-995.221] (-988.736) (-992.148) (-986.678) * (-994.043) [-996.015] (-993.825) (-995.833) -- 0:01:22
638500 -- (-1003.615) (-992.502) [-993.427] (-990.413) * (-996.993) [-992.936] (-997.282) (-992.377) -- 0:01:22
639000 -- (-1000.793) (-993.905) [-998.919] (-989.458) * (-997.845) [-994.536] (-994.243) (-990.272) -- 0:01:22
639500 -- [-996.317] (-992.305) (-992.837) (-991.463) * (-1000.766) [-996.851] (-1001.692) (-990.117) -- 0:01:22
640000 -- (-1000.513) [-994.988] (-993.579) (-995.147) * (-990.813) (-994.248) (-1005.414) [-985.986] -- 0:01:22
Average standard deviation of split frequencies: 0.001913
640500 -- [-996.993] (-993.239) (-993.321) (-987.821) * (-992.665) (-990.973) [-995.272] (-996.553) -- 0:01:21
641000 -- [-996.591] (-986.948) (-994.487) (-995.524) * [-992.262] (-996.704) (-992.887) (-991.060) -- 0:01:21
641500 -- [-994.726] (-998.757) (-1000.475) (-990.274) * [-990.290] (-997.389) (-998.067) (-1001.306) -- 0:01:21
642000 -- (-992.186) [-996.709] (-991.267) (-995.513) * (-997.887) [-993.069] (-1007.528) (-993.514) -- 0:01:21
642500 -- [-989.290] (-993.621) (-990.044) (-997.871) * [-992.396] (-1006.579) (-997.942) (-997.683) -- 0:01:21
643000 -- (-995.772) (-998.671) (-999.279) [-991.238] * (-1006.718) (-1003.631) [-993.121] (-1001.052) -- 0:01:21
643500 -- (-993.419) (-998.178) (-994.383) [-986.207] * [-995.002] (-1004.627) (-994.889) (-993.854) -- 0:01:21
644000 -- (-998.440) (-994.515) [-987.614] (-995.055) * (-997.972) [-992.095] (-999.048) (-998.698) -- 0:01:21
644500 -- [-996.091] (-994.559) (-989.587) (-988.293) * [-991.136] (-991.028) (-1001.586) (-994.999) -- 0:01:21
645000 -- (-996.890) (-990.438) (-989.149) [-990.263] * [-991.713] (-1000.755) (-997.645) (-994.609) -- 0:01:20
Average standard deviation of split frequencies: 0.001605
645500 -- (-997.644) [-995.308] (-1000.562) (-1003.037) * [-989.571] (-997.022) (-996.605) (-993.593) -- 0:01:20
646000 -- (-995.697) (-993.297) (-988.411) [-991.643] * (-998.272) (-993.443) (-990.819) [-986.623] -- 0:01:20
646500 -- (-997.795) (-994.466) (-992.186) [-990.224] * (-987.684) (-994.794) [-998.828] (-992.826) -- 0:01:20
647000 -- (-993.891) (-999.820) [-994.625] (-999.035) * (-993.224) (-1001.647) (-993.985) [-991.277] -- 0:01:20
647500 -- (-991.800) (-1000.564) (-994.968) [-991.818] * (-997.426) (-998.319) (-1000.618) [-998.292] -- 0:01:20
648000 -- [-997.714] (-1001.186) (-993.305) (-987.811) * (-1001.581) [-991.431] (-994.523) (-996.072) -- 0:01:20
648500 -- [-997.224] (-1001.794) (-1001.363) (-997.001) * (-993.260) (-995.411) [-993.432] (-995.321) -- 0:01:20
649000 -- [-993.571] (-999.376) (-997.334) (-993.601) * (-998.058) (-994.278) (-997.944) [-995.598] -- 0:01:20
649500 -- (-989.025) (-990.392) (-993.260) [-990.935] * (-989.143) (-990.462) (-1001.885) [-998.854] -- 0:01:19
650000 -- (-989.398) (-992.957) (-995.978) [-994.750] * (-996.221) (-995.619) [-993.793] (-997.358) -- 0:01:19
Average standard deviation of split frequencies: 0.001739
650500 -- (-992.253) [-993.779] (-994.279) (-997.646) * (-990.776) (-997.135) (-991.795) [-996.321] -- 0:01:19
651000 -- (-997.466) (-992.521) (-995.379) [-992.800] * (-996.485) [-995.361] (-994.045) (-1001.519) -- 0:01:19
651500 -- (-992.529) (-999.802) [-996.125] (-1001.204) * (-991.457) (-990.363) (-998.924) [-995.075] -- 0:01:19
652000 -- (-993.274) [-999.492] (-996.492) (-999.190) * (-993.177) (-999.569) (-994.872) [-997.200] -- 0:01:19
652500 -- (-991.615) (-1004.732) (-995.414) [-992.626] * (-998.830) (-999.134) [-996.247] (-993.862) -- 0:01:19
653000 -- (-1000.765) (-993.067) (-996.764) [-992.574] * (-992.499) [-993.880] (-991.953) (-996.911) -- 0:01:19
653500 -- [-994.772] (-993.258) (-989.176) (-999.401) * [-997.167] (-993.388) (-996.752) (-994.661) -- 0:01:19
654000 -- [-991.125] (-992.524) (-989.973) (-1001.808) * [-995.439] (-989.989) (-990.917) (-998.793) -- 0:01:18
654500 -- (-992.145) (-997.652) [-997.552] (-995.521) * (-990.608) (-993.693) (-1000.612) [-991.089] -- 0:01:18
655000 -- [-991.739] (-1006.080) (-993.102) (-993.225) * (-992.942) (-997.197) (-987.603) [-989.775] -- 0:01:18
Average standard deviation of split frequencies: 0.001581
655500 -- (-1000.872) [-998.618] (-996.465) (-991.978) * (-990.082) [-997.617] (-998.319) (-1006.992) -- 0:01:18
656000 -- (-998.152) (-996.340) (-997.284) [-990.893] * (-997.670) (-992.746) (-995.867) [-991.446] -- 0:01:18
656500 -- (-999.349) (-993.028) [-989.054] (-998.637) * (-992.409) (-993.738) [-997.292] (-990.324) -- 0:01:18
657000 -- (-1011.692) (-997.368) [-986.686] (-996.587) * (-997.378) (-991.254) [-989.201] (-998.956) -- 0:01:18
657500 -- (-1000.890) (-1010.000) [-994.136] (-995.918) * (-994.894) (-991.650) (-994.667) [-990.391] -- 0:01:18
658000 -- (-993.941) (-994.127) [-991.970] (-995.433) * [-994.045] (-999.789) (-998.360) (-993.205) -- 0:01:17
658500 -- [-998.746] (-1001.353) (-994.278) (-989.756) * (-992.441) (-994.047) (-989.927) [-990.941] -- 0:01:17
659000 -- (-995.140) (-999.581) (-995.883) [-989.202] * (-998.281) (-1003.488) (-992.387) [-996.033] -- 0:01:17
659500 -- (-996.998) (-994.553) (-1004.644) [-989.045] * (-997.320) (-994.125) [-993.420] (-994.472) -- 0:01:17
660000 -- [-988.552] (-989.913) (-992.229) (-994.184) * (-1002.973) [-993.617] (-1007.291) (-990.036) -- 0:01:17
Average standard deviation of split frequencies: 0.001284
660500 -- [-989.478] (-1000.238) (-992.950) (-994.944) * (-998.716) (-992.092) [-1000.628] (-991.092) -- 0:01:17
661000 -- (-998.473) (-1007.466) (-997.990) [-992.399] * (-990.795) (-993.481) (-992.965) [-993.636] -- 0:01:17
661500 -- (-997.322) [-992.168] (-988.454) (-1002.176) * (-1006.251) (-993.753) [-995.301] (-988.993) -- 0:01:17
662000 -- (-993.094) (-994.811) [-990.523] (-993.112) * (-997.933) (-998.037) [-995.798] (-993.712) -- 0:01:17
662500 -- (-991.406) (-996.208) (-989.588) [-990.233] * (-993.941) [-989.533] (-1000.178) (-1003.319) -- 0:01:16
663000 -- [-992.256] (-996.112) (-993.049) (-997.533) * [-989.554] (-993.078) (-993.517) (-995.841) -- 0:01:16
663500 -- [-991.527] (-998.477) (-992.211) (-993.378) * [-988.413] (-996.727) (-996.052) (-992.666) -- 0:01:16
664000 -- [-994.157] (-995.462) (-991.447) (-1004.233) * (-989.064) [-997.053] (-1003.942) (-990.835) -- 0:01:16
664500 -- [-991.209] (-991.252) (-992.192) (-990.427) * (-994.204) (-994.865) [-989.145] (-990.642) -- 0:01:16
665000 -- (-988.310) [-992.257] (-992.870) (-993.703) * (-995.176) (-997.068) [-991.701] (-990.245) -- 0:01:16
Average standard deviation of split frequencies: 0.001133
665500 -- (-996.477) (-993.001) [-985.930] (-1004.101) * (-988.698) [-993.530] (-996.004) (-988.812) -- 0:01:16
666000 -- (-998.337) [-989.728] (-994.033) (-997.595) * (-988.177) (-996.853) [-991.699] (-993.595) -- 0:01:16
666500 -- (-993.104) (-996.228) (-993.126) [-1001.877] * [-991.444] (-997.511) (-1000.626) (-998.371) -- 0:01:16
667000 -- (-999.217) (-996.820) (-1002.430) [-990.376] * [-992.028] (-997.238) (-992.911) (-989.784) -- 0:01:15
667500 -- [-996.967] (-999.642) (-1001.112) (-996.305) * (-995.993) (-993.245) (-993.041) [-990.563] -- 0:01:15
668000 -- [-990.224] (-996.625) (-994.061) (-995.034) * (-998.255) (-994.218) [-1001.429] (-1000.117) -- 0:01:15
668500 -- [-990.407] (-995.401) (-1002.738) (-989.808) * (-993.401) (-998.434) (-998.561) [-994.767] -- 0:01:15
669000 -- (-1006.303) [-995.257] (-1001.222) (-993.641) * (-997.358) (-995.004) [-994.434] (-990.752) -- 0:01:15
669500 -- [-989.850] (-991.753) (-1002.028) (-992.117) * (-994.448) (-991.456) [-990.424] (-991.326) -- 0:01:15
670000 -- (-992.383) [-995.558] (-1001.465) (-991.576) * (-993.705) (-996.622) [-986.901] (-988.059) -- 0:01:15
Average standard deviation of split frequencies: 0.001968
670500 -- [-997.623] (-989.005) (-999.835) (-996.839) * (-988.971) [-991.555] (-998.068) (-1005.360) -- 0:01:15
671000 -- (-991.881) (-995.606) [-993.497] (-990.265) * [-993.514] (-993.847) (-1001.681) (-988.209) -- 0:01:15
671500 -- [-995.625] (-997.363) (-999.243) (-1003.625) * (-1000.236) (-996.921) [-991.720] (-1006.254) -- 0:01:14
672000 -- [-995.140] (-1007.326) (-993.137) (-1003.213) * (-990.412) [-992.517] (-992.669) (-997.208) -- 0:01:14
672500 -- (-1005.739) (-1003.695) [-992.551] (-994.400) * (-995.575) (-986.995) [-994.246] (-991.960) -- 0:01:14
673000 -- (-1007.427) (-994.010) (-998.931) [-992.406] * (-995.862) (-992.356) (-995.798) [-998.363] -- 0:01:14
673500 -- [-992.868] (-997.242) (-997.104) (-1003.252) * (-997.369) [-989.675] (-993.173) (-995.475) -- 0:01:14
674000 -- (-1001.002) (-994.569) [-990.475] (-996.498) * (-995.363) (-1000.665) [-991.150] (-995.249) -- 0:01:14
674500 -- [-995.902] (-998.036) (-1000.528) (-990.742) * (-1000.352) (-994.615) (-990.545) [-988.292] -- 0:01:14
675000 -- (-997.144) (-998.991) [-994.660] (-1001.166) * (-1005.196) [-996.180] (-990.488) (-989.901) -- 0:01:14
Average standard deviation of split frequencies: 0.002232
675500 -- (-992.133) [-997.535] (-996.621) (-988.397) * (-990.151) (-990.286) (-997.286) [-994.572] -- 0:01:13
676000 -- (-993.592) (-995.802) (-993.098) [-993.196] * (-994.343) (-995.435) [-993.260] (-990.541) -- 0:01:13
676500 -- (-991.170) [-993.387] (-1000.630) (-995.765) * [-995.334] (-993.394) (-990.599) (-992.652) -- 0:01:13
677000 -- (-992.262) (-1001.874) (-991.281) [-997.714] * (-989.814) (-994.484) [-991.598] (-992.823) -- 0:01:13
677500 -- (-991.617) [-993.690] (-989.431) (-989.976) * [-999.247] (-993.175) (-991.193) (-990.095) -- 0:01:13
678000 -- (-1000.650) [-997.216] (-989.962) (-1004.855) * (-999.923) (-991.804) [-992.573] (-1000.661) -- 0:01:13
678500 -- (-993.316) [-989.165] (-991.064) (-998.581) * [-990.272] (-1004.646) (-990.336) (-994.980) -- 0:01:13
679000 -- (-990.914) (-992.071) (-991.580) [-994.530] * (-992.274) (-997.410) (-997.444) [-991.425] -- 0:01:13
679500 -- (-996.380) [-993.043] (-992.815) (-996.073) * (-992.664) (-993.842) (-991.506) [-998.570] -- 0:01:13
680000 -- (-992.584) (-1001.409) (-997.108) [-996.140] * (-991.603) [-995.877] (-996.932) (-998.452) -- 0:01:12
Average standard deviation of split frequencies: 0.001939
680500 -- (-994.949) (-993.869) (-991.098) [-999.175] * (-994.829) (-999.722) [-994.564] (-993.205) -- 0:01:12
681000 -- (-993.055) (-999.603) (-995.143) [-995.135] * (-997.548) [-994.896] (-999.818) (-997.098) -- 0:01:12
681500 -- [-990.341] (-998.441) (-993.214) (-994.329) * (-999.008) (-989.796) [-997.185] (-990.540) -- 0:01:12
682000 -- (-991.213) (-1002.262) [-990.914] (-990.573) * (-1006.775) [-990.746] (-995.175) (-998.073) -- 0:01:12
682500 -- (-996.067) [-992.907] (-991.523) (-995.321) * (-996.447) [-993.043] (-988.029) (-1002.668) -- 0:01:12
683000 -- [-999.733] (-992.314) (-992.003) (-993.623) * (-1008.592) [-992.160] (-994.976) (-992.746) -- 0:01:12
683500 -- (-993.015) (-996.196) [-987.866] (-995.897) * (-992.526) (-995.943) (-995.584) [-995.774] -- 0:01:12
684000 -- [-988.854] (-998.437) (-994.610) (-997.461) * (-999.986) (-994.138) [-994.922] (-992.392) -- 0:01:12
684500 -- (-995.943) (-995.583) [-989.072] (-993.197) * (-998.965) (-998.682) [-992.813] (-1001.413) -- 0:01:11
685000 -- [-988.039] (-991.112) (-996.147) (-997.558) * (-997.160) [-992.789] (-992.922) (-993.164) -- 0:01:11
Average standard deviation of split frequencies: 0.001649
685500 -- [-989.250] (-997.092) (-997.535) (-996.827) * (-992.816) (-991.480) [-995.820] (-994.445) -- 0:01:11
686000 -- (-991.741) [-998.114] (-996.661) (-998.952) * (-994.762) (-992.283) [-994.641] (-1000.241) -- 0:01:11
686500 -- [-997.631] (-1003.140) (-993.701) (-994.030) * (-990.296) (-992.685) [-989.533] (-995.726) -- 0:01:11
687000 -- (-996.174) (-991.106) [-993.632] (-1005.472) * [-990.384] (-993.694) (-991.698) (-995.453) -- 0:01:11
687500 -- (-991.873) (-994.896) [-990.830] (-993.954) * (-993.525) [-992.301] (-998.946) (-995.382) -- 0:01:11
688000 -- [-990.943] (-999.676) (-989.256) (-993.397) * (-993.864) (-1000.945) [-998.558] (-992.748) -- 0:01:11
688500 -- [-992.587] (-996.587) (-993.552) (-992.047) * (-991.559) (-999.362) (-993.473) [-994.316] -- 0:01:11
689000 -- (-994.343) (-995.311) [-989.673] (-993.257) * (-996.572) [-1001.771] (-996.226) (-993.895) -- 0:01:10
689500 -- (-994.448) (-998.625) [-993.661] (-992.629) * [-995.181] (-1003.790) (-991.405) (-991.452) -- 0:01:10
690000 -- (-1006.058) (-996.945) [-993.708] (-990.778) * (-1000.501) (-1002.429) (-997.188) [-990.257] -- 0:01:10
Average standard deviation of split frequencies: 0.001365
690500 -- (-997.432) (-997.300) [-993.916] (-1000.556) * (-994.119) (-1004.538) (-998.857) [-988.224] -- 0:01:10
691000 -- [-992.631] (-999.773) (-995.220) (-999.271) * (-1003.704) (-993.319) [-998.069] (-1000.446) -- 0:01:10
691500 -- [-1000.970] (-999.463) (-990.892) (-996.769) * (-994.898) [-992.238] (-991.862) (-999.351) -- 0:01:10
692000 -- [-989.121] (-995.701) (-993.821) (-993.237) * (-1003.343) [-994.904] (-997.584) (-1001.818) -- 0:01:10
692500 -- (-995.273) (-993.606) [-989.752] (-995.484) * (-993.368) [-992.454] (-994.028) (-994.799) -- 0:01:10
693000 -- (-996.941) (-997.002) [-996.645] (-1008.149) * (-992.865) (-991.583) (-998.448) [-993.403] -- 0:01:09
693500 -- [-991.551] (-1000.514) (-987.973) (-1002.318) * [-996.138] (-1006.143) (-994.513) (-988.881) -- 0:01:09
694000 -- (-995.330) [-996.832] (-992.082) (-995.560) * (-999.852) (-993.010) (-992.211) [-998.511] -- 0:01:09
694500 -- [-992.911] (-987.458) (-992.805) (-999.875) * (-1000.574) (-1000.921) (-995.991) [-993.599] -- 0:01:09
695000 -- (-993.216) [-991.399] (-996.231) (-987.997) * (-996.349) [-993.155] (-1000.921) (-993.695) -- 0:01:09
Average standard deviation of split frequencies: 0.000677
695500 -- (-995.304) (-996.983) (-990.281) [-990.328] * (-997.320) (-992.310) (-993.002) [-1003.026] -- 0:01:09
696000 -- (-994.683) (-1001.418) (-988.554) [-993.378] * (-996.870) (-998.638) [-993.376] (-994.794) -- 0:01:09
696500 -- [-995.311] (-1001.120) (-993.430) (-990.610) * (-1000.381) (-1001.219) (-996.475) [-990.916] -- 0:01:09
697000 -- (-992.724) [-992.634] (-989.838) (-1004.151) * (-998.349) (-1003.041) (-998.901) [-990.790] -- 0:01:09
697500 -- (-997.464) (-995.010) [-997.803] (-994.547) * [-989.866] (-997.440) (-992.516) (-997.402) -- 0:01:08
698000 -- (-991.551) (-993.232) [-989.100] (-996.349) * [-991.352] (-995.880) (-995.668) (-1002.219) -- 0:01:08
698500 -- (-992.122) [-990.333] (-992.012) (-1002.959) * (-992.037) [-990.427] (-991.226) (-1002.673) -- 0:01:08
699000 -- (-994.613) (-1004.348) [-990.406] (-989.447) * (-994.807) [-996.601] (-997.197) (-1005.432) -- 0:01:08
699500 -- [-996.808] (-992.575) (-994.984) (-992.709) * (-996.692) [-996.768] (-993.611) (-992.284) -- 0:01:08
700000 -- [-998.470] (-1000.337) (-999.542) (-1003.731) * (-994.862) (-1000.010) (-990.755) [-990.643] -- 0:01:08
Average standard deviation of split frequencies: 0.001076
700500 -- (-996.969) (-995.613) (-996.931) [-990.620] * (-990.640) (-1003.173) (-994.896) [-994.252] -- 0:01:08
701000 -- (-991.478) (-1001.358) (-997.349) [-994.218] * (-997.031) (-1002.923) (-997.175) [-990.867] -- 0:01:08
701500 -- [-994.413] (-1001.244) (-1004.611) (-991.093) * [-992.256] (-997.179) (-990.407) (-995.269) -- 0:01:08
702000 -- (-996.329) (-998.202) (-992.029) [-991.790] * (-992.905) (-1000.745) (-994.189) [-987.585] -- 0:01:07
702500 -- [-991.263] (-989.773) (-992.326) (-996.429) * (-996.008) (-997.375) (-991.453) [-988.758] -- 0:01:07
703000 -- (-997.099) (-986.971) [-989.360] (-991.547) * (-995.795) (-998.328) [-994.081] (-996.255) -- 0:01:07
703500 -- (-993.545) [-993.350] (-994.896) (-997.644) * (-993.218) (-1003.873) (-998.519) [-987.091] -- 0:01:07
704000 -- (-1003.782) (-996.060) (-992.155) [-991.275] * (-988.673) [-1000.463] (-994.411) (-1000.500) -- 0:01:07
704500 -- (-997.862) [-992.995] (-992.471) (-992.891) * [-991.173] (-996.471) (-1003.951) (-992.861) -- 0:01:07
705000 -- [-999.630] (-991.278) (-999.573) (-1000.121) * (-994.028) (-996.112) [-995.584] (-995.095) -- 0:01:07
Average standard deviation of split frequencies: 0.000267
705500 -- [-995.865] (-1003.403) (-992.585) (-1003.509) * [-989.362] (-987.881) (-994.186) (-993.755) -- 0:01:07
706000 -- [-994.351] (-990.270) (-995.856) (-995.512) * (-990.947) [-989.840] (-1002.605) (-1002.261) -- 0:01:07
706500 -- (-1006.977) [-990.414] (-993.003) (-1002.291) * [-990.387] (-992.448) (-1001.158) (-993.248) -- 0:01:06
707000 -- (-993.081) [-990.897] (-990.946) (-997.157) * (-998.563) (-1004.615) (-992.214) [-991.431] -- 0:01:06
707500 -- (-996.699) (-994.629) (-1002.640) [-993.170] * (-1001.732) (-994.517) (-994.753) [-997.862] -- 0:01:06
708000 -- (-992.518) [-1000.538] (-988.766) (-994.324) * (-992.214) (-998.945) [-987.756] (-1000.000) -- 0:01:06
708500 -- (-998.094) [-1001.920] (-998.949) (-1002.747) * (-992.886) (-990.170) (-997.014) [-990.884] -- 0:01:06
709000 -- (-995.726) (-996.313) (-997.925) [-991.793] * [-990.846] (-992.561) (-997.557) (-987.190) -- 0:01:06
709500 -- (-1008.330) [-999.013] (-1004.394) (-990.563) * (-996.177) (-991.168) [-997.762] (-997.004) -- 0:01:06
710000 -- (-995.506) [-989.966] (-1001.917) (-996.187) * (-995.480) [-990.941] (-1003.942) (-991.414) -- 0:01:06
Average standard deviation of split frequencies: 0.000796
710500 -- [-994.528] (-994.206) (-1001.230) (-994.314) * (-997.881) (-996.386) (-996.871) [-991.797] -- 0:01:06
711000 -- (-997.922) (-993.745) [-990.239] (-999.601) * (-995.065) (-998.896) [-1004.120] (-996.888) -- 0:01:05
711500 -- [-988.874] (-990.663) (-996.305) (-998.154) * (-996.700) (-994.427) [-993.577] (-992.019) -- 0:01:05
712000 -- (-1000.624) (-995.731) (-992.104) [-991.463] * (-995.652) (-994.309) [-991.996] (-989.079) -- 0:01:05
712500 -- (-989.934) (-997.068) (-994.119) [-992.247] * [-989.979] (-1001.370) (-994.820) (-990.834) -- 0:01:05
713000 -- (-991.266) [-1004.207] (-996.987) (-1004.109) * (-998.360) (-1000.153) (-989.791) [-991.404] -- 0:01:05
713500 -- (-995.684) (-1001.892) (-995.972) [-991.045] * (-996.858) (-997.820) [-993.310] (-991.513) -- 0:01:05
714000 -- (-992.844) [-993.730] (-995.330) (-996.752) * (-996.397) [-993.512] (-991.836) (-1000.998) -- 0:01:05
714500 -- (-994.716) (-998.464) (-993.773) [-999.974] * (-993.608) (-989.017) (-993.532) [-996.097] -- 0:01:05
715000 -- (-994.535) [-995.417] (-1001.330) (-999.532) * [-990.527] (-991.826) (-998.631) (-988.163) -- 0:01:04
Average standard deviation of split frequencies: 0.001580
715500 -- (-992.115) (-993.691) [-992.129] (-998.225) * [-994.070] (-994.595) (-992.138) (-997.187) -- 0:01:04
716000 -- (-997.860) (-994.800) (-987.851) [-993.198] * (-1002.799) (-991.165) (-993.127) [-996.419] -- 0:01:04
716500 -- (-995.906) (-996.352) (-988.834) [-992.213] * [-991.550] (-1002.531) (-1001.668) (-995.795) -- 0:01:04
717000 -- (-988.617) (-992.619) [-988.227] (-996.450) * (-988.485) (-997.723) (-990.700) [-995.083] -- 0:01:04
717500 -- (-990.224) (-998.325) [-992.092] (-993.185) * (-990.159) (-993.513) [-995.215] (-993.518) -- 0:01:04
718000 -- (-1003.133) [-997.481] (-991.256) (-991.128) * (-994.286) (-994.396) [-994.509] (-993.571) -- 0:01:04
718500 -- [-993.544] (-993.233) (-997.294) (-986.428) * [-994.651] (-995.381) (-989.975) (-994.062) -- 0:01:04
719000 -- (-1002.467) [-990.186] (-995.608) (-997.927) * (-996.184) (-992.256) (-998.312) [-995.047] -- 0:01:04
719500 -- [-990.368] (-992.266) (-995.181) (-994.899) * (-997.291) (-994.446) [-993.190] (-992.769) -- 0:01:03
720000 -- (-992.990) [-992.946] (-990.958) (-994.824) * (-989.580) (-991.350) (-993.943) [-988.579] -- 0:01:03
Average standard deviation of split frequencies: 0.002093
720500 -- [-991.087] (-991.255) (-993.984) (-1002.233) * (-993.763) (-1000.139) (-996.153) [-990.249] -- 0:01:03
721000 -- (-989.372) [-996.295] (-994.289) (-998.708) * (-995.922) [-987.790] (-998.767) (-997.979) -- 0:01:03
721500 -- (-996.052) [-994.953] (-990.811) (-990.652) * (-990.749) (-991.727) [-994.626] (-990.175) -- 0:01:03
722000 -- [-992.256] (-998.529) (-996.794) (-998.482) * [-989.747] (-990.802) (-994.214) (-996.504) -- 0:01:03
722500 -- (-994.904) (-994.929) (-994.723) [-993.586] * [-990.641] (-995.825) (-990.823) (-997.306) -- 0:01:03
723000 -- [-995.060] (-990.608) (-1002.225) (-993.875) * [-992.236] (-990.647) (-997.879) (-994.892) -- 0:01:03
723500 -- [-990.477] (-990.996) (-1003.337) (-996.731) * [-986.927] (-995.265) (-1003.610) (-995.766) -- 0:01:03
724000 -- (-1002.189) (-993.271) (-1002.882) [-990.660] * (-988.051) [-993.913] (-997.106) (-991.479) -- 0:01:02
724500 -- (-994.505) (-993.286) [-997.409] (-987.821) * (-997.291) (-993.473) [-1007.340] (-995.047) -- 0:01:02
725000 -- (-988.400) (-994.332) [-995.964] (-1001.460) * (-995.194) (-993.877) (-998.744) [-1000.244] -- 0:01:02
Average standard deviation of split frequencies: 0.002987
725500 -- (-993.683) (-997.526) [-991.070] (-1003.842) * (-993.627) (-989.008) (-991.819) [-992.012] -- 0:01:02
726000 -- (-998.535) [-989.341] (-993.073) (-993.849) * (-993.161) [-994.109] (-992.369) (-1000.290) -- 0:01:02
726500 -- (-993.910) [-992.375] (-998.708) (-992.529) * [-993.188] (-998.965) (-996.802) (-988.765) -- 0:01:02
727000 -- (-992.625) (-999.127) [-989.388] (-998.224) * (-995.724) (-999.611) [-992.280] (-996.039) -- 0:01:02
727500 -- [-996.907] (-1002.938) (-996.866) (-993.465) * (-997.419) (-990.719) (-996.929) [-989.258] -- 0:01:02
728000 -- (-989.925) (-992.744) (-993.855) [-993.766] * (-1000.590) (-995.013) [-995.718] (-995.810) -- 0:01:02
728500 -- (-993.283) [-996.969] (-992.681) (-997.411) * [-996.580] (-992.902) (-990.357) (-994.236) -- 0:01:01
729000 -- (-993.470) (-995.435) [-989.674] (-991.164) * (-992.544) (-1002.739) [-990.525] (-998.594) -- 0:01:01
729500 -- (-1008.744) (-999.104) [-988.230] (-990.615) * (-1000.261) (-998.802) (-991.243) [-991.682] -- 0:01:01
730000 -- [-988.211] (-1003.632) (-995.024) (-996.897) * (-1005.717) (-992.927) (-997.134) [-994.125] -- 0:01:01
Average standard deviation of split frequencies: 0.002323
730500 -- (-997.640) (-992.487) [-993.048] (-1002.437) * (-999.725) (-1001.113) [-990.994] (-997.113) -- 0:01:01
731000 -- (-993.095) (-996.338) (-993.328) [-995.400] * (-989.785) [-992.102] (-995.685) (-998.215) -- 0:01:01
731500 -- (-1002.349) [-996.185] (-992.676) (-997.311) * (-990.498) (-988.348) [-994.312] (-995.927) -- 0:01:01
732000 -- [-989.258] (-1001.831) (-999.113) (-998.086) * (-1000.348) (-991.518) [-991.751] (-997.627) -- 0:01:01
732500 -- (-1002.172) (-991.721) [-991.079] (-993.476) * (-994.309) (-987.993) (-1000.677) [-991.767] -- 0:01:00
733000 -- (-996.386) [-993.023] (-991.346) (-998.547) * (-995.890) (-994.198) (-993.936) [-989.818] -- 0:01:00
733500 -- [-996.901] (-993.360) (-991.699) (-996.220) * [-998.573] (-995.776) (-997.040) (-990.455) -- 0:01:00
734000 -- (-994.327) (-1001.778) (-993.054) [-1000.860] * (-994.861) (-992.065) [-992.750] (-996.633) -- 0:01:00
734500 -- [-990.830] (-996.943) (-997.382) (-993.823) * (-991.943) [-989.591] (-992.946) (-992.181) -- 0:01:00
735000 -- (-993.240) (-995.689) (-1001.222) [-992.756] * (-995.848) (-994.192) [-997.226] (-991.125) -- 0:01:00
Average standard deviation of split frequencies: 0.002562
735500 -- (-1005.466) [-988.875] (-995.937) (-1001.723) * (-1000.579) (-998.399) (-994.895) [-989.418] -- 0:01:00
736000 -- (-998.267) (-1002.219) (-990.853) [-993.173] * (-997.824) (-997.296) [-996.760] (-992.659) -- 0:01:00
736500 -- (-995.271) (-994.902) (-993.123) [-999.153] * (-997.514) (-995.482) (-998.987) [-1000.461] -- 0:01:00
737000 -- (-993.729) (-1004.927) [-991.998] (-991.723) * (-998.531) [-994.084] (-993.125) (-994.434) -- 0:00:59
737500 -- (-993.806) (-1003.659) [-995.277] (-998.637) * (-1000.002) (-995.997) (-995.113) [-993.978] -- 0:00:59
738000 -- [-997.653] (-996.552) (-998.188) (-996.583) * (-998.167) (-994.362) [-987.351] (-994.391) -- 0:00:59
738500 -- (-988.192) (-996.959) (-1007.901) [-993.803] * (-995.426) (-999.210) [-993.331] (-993.770) -- 0:00:59
739000 -- [-991.088] (-993.572) (-990.684) (-991.886) * (-997.730) (-997.816) (-991.332) [-987.385] -- 0:00:59
739500 -- [-999.384] (-999.480) (-993.637) (-993.634) * (-998.230) (-991.728) (-993.256) [-992.741] -- 0:00:59
740000 -- (-987.350) [-994.250] (-1000.464) (-993.041) * (-989.422) (-997.983) [-997.268] (-1004.297) -- 0:00:59
Average standard deviation of split frequencies: 0.002419
740500 -- (-992.500) (-994.121) [-989.153] (-997.784) * (-993.097) (-1001.872) (-1001.811) [-995.595] -- 0:00:59
741000 -- (-988.631) (-998.015) (-993.112) [-992.164] * (-994.864) (-995.704) (-998.261) [-1001.241] -- 0:00:59
741500 -- [-993.852] (-989.458) (-996.285) (-991.792) * (-996.696) (-995.376) (-1000.934) [-991.821] -- 0:00:58
742000 -- (-996.078) (-989.710) [-991.293] (-996.628) * (-995.430) (-996.728) (-1002.654) [-1000.117] -- 0:00:58
742500 -- (-994.972) (-998.908) [-988.231] (-990.431) * (-999.072) (-990.965) (-994.763) [-994.577] -- 0:00:58
743000 -- (-991.493) (-995.188) (-992.163) [-996.937] * [-999.003] (-991.838) (-993.757) (-996.739) -- 0:00:58
743500 -- [-1000.015] (-995.070) (-991.934) (-988.441) * (-991.843) [-995.601] (-993.654) (-995.045) -- 0:00:58
744000 -- (-995.027) [-989.130] (-996.049) (-994.583) * (-992.284) (-998.964) [-997.788] (-992.341) -- 0:00:58
744500 -- (-993.165) [-986.556] (-993.472) (-992.548) * (-1001.966) (-989.962) (-996.564) [-996.791] -- 0:00:58
745000 -- (-999.946) (-992.185) (-996.279) [-988.283] * (-996.292) (-988.699) [-989.212] (-997.124) -- 0:00:58
Average standard deviation of split frequencies: 0.002401
745500 -- (-993.699) (-997.176) (-994.322) [-997.211] * (-998.059) (-995.167) (-992.171) [-993.806] -- 0:00:58
746000 -- (-994.977) (-998.210) [-996.068] (-995.212) * (-1001.290) [-994.731] (-995.478) (-997.490) -- 0:00:57
746500 -- (-989.751) (-992.475) (-1001.369) [-1000.459] * (-996.032) [-989.317] (-995.969) (-996.814) -- 0:00:57
747000 -- (-990.343) (-992.043) (-995.724) [-994.717] * [-994.696] (-998.353) (-993.865) (-996.906) -- 0:00:57
747500 -- (-992.877) (-1002.645) (-995.412) [-993.178] * (-990.387) (-987.959) (-1001.771) [-999.008] -- 0:00:57
748000 -- (-995.016) [-992.664] (-998.747) (-1004.136) * [-991.593] (-987.716) (-990.947) (-1000.290) -- 0:00:57
748500 -- (-997.638) [-990.091] (-991.455) (-992.821) * (-995.689) (-995.596) (-994.995) [-993.615] -- 0:00:57
749000 -- (-1002.726) [-991.440] (-994.304) (-995.381) * (-993.644) (-994.093) (-993.328) [-995.963] -- 0:00:57
749500 -- [-993.138] (-993.279) (-997.831) (-991.012) * (-991.950) (-994.900) (-996.413) [-993.806] -- 0:00:57
750000 -- (-995.746) (-992.541) (-995.701) [-993.990] * [-997.790] (-995.338) (-995.486) (-1001.443) -- 0:00:57
Average standard deviation of split frequencies: 0.001884
750500 -- (-993.624) [-993.936] (-995.279) (-1002.510) * (-1000.165) [-990.699] (-989.053) (-993.983) -- 0:00:56
751000 -- (-1003.288) (-992.999) [-992.355] (-1004.155) * [-989.456] (-994.686) (-992.035) (-1001.729) -- 0:00:56
751500 -- (-992.146) (-996.867) (-998.273) [-992.671] * (-990.225) [-989.051] (-996.192) (-995.811) -- 0:00:56
752000 -- (-1002.584) (-989.497) [-991.413] (-993.993) * (-1001.469) [-988.860] (-993.788) (-998.630) -- 0:00:56
752500 -- (-993.012) (-990.033) [-1000.561] (-993.286) * (-994.203) (-988.523) (-996.624) [-993.489] -- 0:00:56
753000 -- (-996.384) [-987.967] (-1006.577) (-996.500) * (-994.865) (-1000.547) (-1003.664) [-987.606] -- 0:00:56
753500 -- (-989.061) (-993.740) (-1004.466) [-997.013] * [-995.423] (-994.624) (-994.985) (-994.345) -- 0:00:56
754000 -- [-991.238] (-991.965) (-999.812) (-995.172) * (-993.943) (-995.208) (-996.791) [-992.358] -- 0:00:56
754500 -- (-990.102) [-991.742] (-999.940) (-994.474) * (-995.297) [-993.457] (-993.664) (-993.868) -- 0:00:55
755000 -- [-990.585] (-992.818) (-1003.341) (-997.770) * (-993.978) (-996.108) (-995.658) [-994.943] -- 0:00:55
Average standard deviation of split frequencies: 0.001497
755500 -- (-994.405) (-992.124) (-990.010) [-994.690] * (-992.747) [-993.924] (-994.331) (-998.068) -- 0:00:55
756000 -- (-995.035) (-997.093) (-987.375) [-995.946] * (-991.856) [-990.364] (-993.223) (-1001.461) -- 0:00:55
756500 -- [-996.264] (-992.776) (-990.891) (-996.064) * (-992.050) (-993.698) [-988.682] (-995.504) -- 0:00:55
757000 -- [-997.327] (-991.146) (-993.149) (-995.491) * (-987.701) (-992.105) [-992.979] (-993.185) -- 0:00:55
757500 -- (-1008.645) [-997.873] (-1007.551) (-996.329) * [-990.556] (-998.726) (-993.244) (-1001.511) -- 0:00:55
758000 -- (-1003.931) [-994.286] (-995.826) (-988.268) * [-989.894] (-998.162) (-998.040) (-995.240) -- 0:00:55
758500 -- [-1003.223] (-996.466) (-993.496) (-1000.610) * (-994.398) (-995.847) (-1003.804) [-994.594] -- 0:00:55
759000 -- (-993.483) [-988.611] (-1000.925) (-991.505) * (-999.114) (-998.577) (-1010.703) [-995.198] -- 0:00:54
759500 -- (-997.503) [-996.496] (-996.452) (-994.191) * (-996.901) (-999.864) (-1002.801) [-992.023] -- 0:00:54
760000 -- (-995.023) [-991.230] (-997.890) (-995.762) * (-993.297) (-998.861) (-1004.697) [-998.230] -- 0:00:54
Average standard deviation of split frequencies: 0.001363
760500 -- (-999.451) (-989.554) (-993.831) [-992.103] * [-990.013] (-997.347) (-1002.011) (-992.614) -- 0:00:54
761000 -- (-994.305) [-989.671] (-991.104) (-995.247) * [-993.849] (-996.787) (-1001.343) (-992.273) -- 0:00:54
761500 -- (-998.333) (-997.567) (-995.679) [-994.966] * [-994.608] (-1004.102) (-997.610) (-995.262) -- 0:00:54
762000 -- (-997.345) [-993.909] (-995.056) (-991.503) * (-994.823) (-993.982) (-1003.343) [-989.788] -- 0:00:54
762500 -- (-997.314) (-994.611) [-990.652] (-1001.413) * (-994.841) (-995.833) (-994.901) [-991.780] -- 0:00:54
763000 -- (-1003.461) (-996.496) [-988.557] (-997.640) * [-995.591] (-989.475) (-994.249) (-996.192) -- 0:00:54
763500 -- (-991.436) (-990.124) [-991.678] (-994.471) * [-987.465] (-993.849) (-996.448) (-989.668) -- 0:00:53
764000 -- (-998.740) [-990.237] (-994.252) (-992.048) * (-992.884) (-997.467) [-989.987] (-992.685) -- 0:00:53
764500 -- (-998.506) (-992.261) (-1000.127) [-993.887] * (-995.662) (-991.741) (-995.589) [-994.616] -- 0:00:53
765000 -- [-991.916] (-997.974) (-1008.348) (-997.654) * [-998.899] (-992.121) (-992.344) (-995.722) -- 0:00:53
Average standard deviation of split frequencies: 0.001600
765500 -- (-1001.566) (-996.033) (-995.345) [-989.693] * [-988.553] (-1001.579) (-992.135) (-995.389) -- 0:00:53
766000 -- (-996.051) (-999.817) [-992.518] (-994.734) * [-994.529] (-1001.475) (-992.094) (-996.027) -- 0:00:53
766500 -- [-989.903] (-997.640) (-997.553) (-999.605) * (-1003.464) (-993.587) [-989.266] (-997.608) -- 0:00:53
767000 -- (-994.212) [-988.530] (-994.897) (-1004.108) * (-993.102) [-992.736] (-991.129) (-1000.774) -- 0:00:53
767500 -- [-993.114] (-991.588) (-986.026) (-995.213) * (-994.953) (-998.391) (-991.596) [-993.388] -- 0:00:53
768000 -- (-989.439) [-995.466] (-998.602) (-995.296) * (-994.842) [-993.845] (-995.265) (-992.377) -- 0:00:52
768500 -- (-996.139) (-990.105) (-990.316) [-992.492] * (-992.239) (-994.219) [-993.609] (-996.837) -- 0:00:52
769000 -- (-995.296) (-999.711) [-989.066] (-994.558) * (-992.064) [-994.207] (-1004.121) (-999.910) -- 0:00:52
769500 -- [-995.044] (-995.446) (-1006.683) (-993.696) * (-992.797) (-998.126) [-995.002] (-992.641) -- 0:00:52
770000 -- (-993.494) (-997.638) [-997.245] (-991.829) * (-993.233) (-992.677) [-992.293] (-993.813) -- 0:00:52
Average standard deviation of split frequencies: 0.001346
770500 -- (-991.757) (-1001.201) [-991.361] (-1002.396) * (-1000.661) (-990.972) [-989.969] (-993.124) -- 0:00:52
771000 -- [-992.057] (-993.085) (-992.052) (-999.005) * (-997.316) (-995.821) [-987.900] (-1001.787) -- 0:00:52
771500 -- (-1000.671) [-996.594] (-992.893) (-995.231) * (-1001.367) (-987.515) (-991.806) [-988.360] -- 0:00:52
772000 -- (-999.761) (-996.876) (-1006.134) [-992.183] * [-996.583] (-1000.957) (-989.020) (-996.061) -- 0:00:51
772500 -- (-996.818) (-997.737) [-994.416] (-1000.115) * (-991.248) [-1002.408] (-990.105) (-993.719) -- 0:00:51
773000 -- (-996.097) [-990.558] (-991.107) (-990.134) * [-987.643] (-1003.148) (-993.719) (-990.285) -- 0:00:51
773500 -- (-1002.861) (-994.962) (-991.436) [-997.127] * (-990.056) [-996.363] (-1001.279) (-993.413) -- 0:00:51
774000 -- (-1007.073) (-1000.225) (-992.520) [-997.614] * [-990.221] (-993.301) (-997.775) (-1002.114) -- 0:00:51
774500 -- (-997.550) (-995.219) [-993.962] (-998.731) * [-992.452] (-992.640) (-1000.180) (-1000.870) -- 0:00:51
775000 -- [-992.663] (-995.993) (-992.343) (-995.977) * (-992.777) [-995.620] (-995.471) (-989.857) -- 0:00:51
Average standard deviation of split frequencies: 0.001336
775500 -- (-997.713) (-998.301) [-994.068] (-996.823) * (-988.464) (-989.870) [-994.684] (-994.854) -- 0:00:51
776000 -- (-998.884) (-995.138) (-994.845) [-991.564] * [-993.800] (-993.155) (-991.393) (-997.669) -- 0:00:51
776500 -- (-994.980) (-1000.175) [-988.012] (-996.585) * (-993.946) (-993.457) [-996.621] (-997.387) -- 0:00:50
777000 -- (-994.257) (-1006.912) (-993.933) [-996.492] * (-993.126) [-991.080] (-1003.938) (-997.406) -- 0:00:50
777500 -- (-992.818) [-998.493] (-998.407) (-995.572) * (-1000.656) [-990.644] (-1000.469) (-994.674) -- 0:00:50
778000 -- (-993.710) (-996.456) (-997.813) [-1001.901] * (-999.709) (-994.983) [-999.972] (-992.680) -- 0:00:50
778500 -- (-989.804) (-1001.887) (-990.894) [-993.129] * (-995.616) [-995.936] (-1007.384) (-992.107) -- 0:00:50
779000 -- (-991.977) (-999.219) (-988.707) [-993.701] * (-999.374) (-990.451) (-1003.109) [-1003.014] -- 0:00:50
779500 -- (-994.892) (-995.268) [-995.843] (-990.284) * (-993.429) (-989.187) [-996.456] (-1001.192) -- 0:00:50
780000 -- (-994.373) (-996.253) [-993.412] (-993.968) * (-993.823) [-989.716] (-998.889) (-997.738) -- 0:00:50
Average standard deviation of split frequencies: 0.001932
780500 -- (-994.069) [-996.420] (-990.846) (-995.144) * (-1006.292) [-991.376] (-990.681) (-999.352) -- 0:00:50
781000 -- (-999.045) [-996.099] (-991.488) (-995.438) * (-1002.167) (-1003.007) (-999.664) [-986.199] -- 0:00:49
781500 -- (-988.992) (-990.537) (-991.105) [-1000.070] * (-994.745) [-996.351] (-999.605) (-990.967) -- 0:00:49
782000 -- [-996.299] (-991.721) (-993.273) (-1001.648) * (-995.212) (-995.311) (-989.870) [-995.088] -- 0:00:49
782500 -- [-995.679] (-1004.345) (-992.835) (-1000.113) * [-1004.606] (-1001.886) (-991.712) (-990.216) -- 0:00:49
783000 -- [-988.295] (-999.625) (-990.381) (-994.891) * (-1001.715) [-990.827] (-997.015) (-995.129) -- 0:00:49
783500 -- (-990.529) (-994.442) (-1003.353) [-993.788] * [-992.482] (-991.462) (-993.922) (-995.374) -- 0:00:49
784000 -- (-999.980) [-990.771] (-994.803) (-991.847) * (-991.392) (-991.913) [-994.077] (-994.860) -- 0:00:49
784500 -- (-998.123) (-991.196) [-989.674] (-991.636) * (-996.156) (-993.452) (-989.298) [-999.091] -- 0:00:49
785000 -- (-999.077) (-1001.747) [-990.158] (-992.375) * (-995.260) [-991.115] (-997.456) (-986.366) -- 0:00:49
Average standard deviation of split frequencies: 0.002159
785500 -- (-1000.628) (-991.115) (-995.930) [-992.557] * (-993.008) [-997.905] (-993.030) (-998.173) -- 0:00:48
786000 -- (-1001.165) (-995.979) [-990.421] (-988.967) * (-992.069) [-996.105] (-993.777) (-991.090) -- 0:00:48
786500 -- (-988.717) (-997.168) (-992.916) [-990.781] * (-996.901) (-994.808) (-998.233) [-990.442] -- 0:00:48
787000 -- [-999.820] (-993.940) (-989.318) (-993.425) * (-992.159) (-995.680) [-992.831] (-994.923) -- 0:00:48
787500 -- [-991.767] (-997.687) (-993.023) (-998.360) * (-990.829) [-989.194] (-996.196) (-990.222) -- 0:00:48
788000 -- [-991.083] (-996.987) (-991.278) (-996.027) * (-994.177) [-992.782] (-994.521) (-992.700) -- 0:00:48
788500 -- (-995.047) (-996.718) [-993.157] (-997.392) * (-992.265) (-1000.230) (-992.052) [-987.626] -- 0:00:48
789000 -- (-1002.610) [-991.765] (-992.637) (-996.079) * (-994.698) (-992.510) [-997.111] (-993.565) -- 0:00:48
789500 -- (-996.953) [-996.221] (-993.332) (-993.228) * (-989.715) (-996.036) (-996.535) [-991.642] -- 0:00:47
790000 -- [-996.309] (-993.771) (-993.657) (-990.940) * (-995.232) (-991.740) [-999.919] (-994.989) -- 0:00:47
Average standard deviation of split frequencies: 0.002743
790500 -- (-992.531) (-992.387) [-997.650] (-994.019) * (-993.027) (-1000.085) (-997.349) [-991.245] -- 0:00:47
791000 -- (-1001.138) (-994.055) [-991.712] (-995.356) * (-999.583) (-995.106) [-994.486] (-991.775) -- 0:00:47
791500 -- (-989.777) (-995.307) (-992.666) [-989.798] * (-992.363) [-998.684] (-992.698) (-987.481) -- 0:00:47
792000 -- (-1000.363) (-991.804) [-993.984] (-989.268) * (-991.687) (-996.743) [-987.660] (-992.404) -- 0:00:47
792500 -- [-989.342] (-990.261) (-990.250) (-992.386) * (-999.517) (-996.080) [-993.636] (-990.329) -- 0:00:47
793000 -- (-994.542) (-996.472) (-998.990) [-987.321] * [-996.385] (-991.800) (-992.230) (-988.122) -- 0:00:47
793500 -- [-992.515] (-992.421) (-994.597) (-996.596) * (-996.071) (-990.645) [-995.236] (-1000.115) -- 0:00:47
794000 -- (-988.079) [-994.575] (-999.723) (-996.642) * [-987.083] (-989.219) (-993.220) (-992.592) -- 0:00:46
794500 -- (-995.600) (-987.643) [-996.845] (-1000.921) * [-995.151] (-991.184) (-1002.818) (-991.461) -- 0:00:46
795000 -- (-995.607) (-995.182) (-1000.186) [-996.730] * (-996.068) (-991.535) (-997.312) [-997.162] -- 0:00:46
Average standard deviation of split frequencies: 0.003790
795500 -- (-995.610) [-990.716] (-993.029) (-997.060) * [-992.597] (-989.260) (-993.448) (-988.708) -- 0:00:46
796000 -- (-999.311) [-1002.233] (-996.127) (-998.559) * (-990.715) [-991.770] (-998.790) (-989.888) -- 0:00:46
796500 -- (-1005.621) (-992.450) [-992.680] (-1001.674) * [-998.980] (-1000.981) (-995.037) (-993.653) -- 0:00:46
797000 -- (-995.893) [-999.758] (-998.093) (-990.240) * (-993.141) (-995.478) [-993.286] (-1008.506) -- 0:00:46
797500 -- (-991.504) (-999.235) (-999.752) [-996.007] * (-994.785) [-999.180] (-992.481) (-996.202) -- 0:00:46
798000 -- (-993.245) (-994.053) (-993.738) [-993.379] * (-994.440) (-999.932) [-991.570] (-990.918) -- 0:00:46
798500 -- [-990.596] (-990.942) (-993.260) (-994.130) * (-998.145) (-995.959) [-992.993] (-1000.604) -- 0:00:45
799000 -- (-992.845) [-985.075] (-995.745) (-990.758) * [-992.218] (-1000.863) (-996.358) (-994.898) -- 0:00:45
799500 -- (-994.593) (-1006.065) [-995.534] (-990.862) * (-988.690) (-996.693) [-990.637] (-994.678) -- 0:00:45
800000 -- (-994.209) (-996.211) [-991.291] (-996.994) * (-995.300) (-999.851) (-988.911) [-993.943] -- 0:00:45
Average standard deviation of split frequencies: 0.003062
800500 -- (-992.471) (-990.575) (-995.268) [-989.298] * (-989.284) (-1004.777) [-990.521] (-994.890) -- 0:00:45
801000 -- (-991.268) (-997.963) (-993.309) [-994.187] * (-992.519) (-994.976) [-995.511] (-997.201) -- 0:00:45
801500 -- [-991.149] (-992.026) (-995.383) (-990.477) * (-992.503) (-997.869) (-995.611) [-995.066] -- 0:00:45
802000 -- [-991.353] (-991.113) (-998.259) (-991.159) * (-991.943) (-1002.215) [-989.277] (-994.222) -- 0:00:45
802500 -- (-996.634) [-994.270] (-997.183) (-996.097) * (-994.026) (-996.332) [-995.378] (-994.581) -- 0:00:45
803000 -- (-1006.254) (-998.945) [-990.449] (-999.511) * (-994.868) (-996.556) [-993.924] (-1003.780) -- 0:00:44
803500 -- (-991.674) (-991.893) [-993.501] (-990.064) * (-992.600) (-1001.770) [-987.384] (-992.310) -- 0:00:44
804000 -- [-992.175] (-998.332) (-997.412) (-994.579) * (-996.887) (-991.123) (-995.746) [-991.656] -- 0:00:44
804500 -- (-997.696) [-993.731] (-997.058) (-995.616) * (-994.467) (-996.927) [-990.056] (-993.403) -- 0:00:44
805000 -- (-990.118) [-991.942] (-996.126) (-992.358) * (-998.336) [-996.937] (-996.658) (-993.444) -- 0:00:44
Average standard deviation of split frequencies: 0.003626
805500 -- (-997.914) [-989.330] (-993.726) (-993.278) * (-994.194) (-994.369) (-988.073) [-989.992] -- 0:00:44
806000 -- (-995.802) [-990.742] (-993.966) (-991.968) * (-994.152) (-1002.859) (-994.571) [-988.745] -- 0:00:44
806500 -- [-991.729] (-992.185) (-1000.568) (-995.719) * (-993.403) (-996.796) [-993.989] (-994.022) -- 0:00:44
807000 -- (-1002.477) (-997.196) (-989.097) [-996.229] * (-991.437) [-990.501] (-989.877) (-1000.386) -- 0:00:44
807500 -- (-996.508) (-993.791) (-985.413) [-989.459] * [-989.338] (-995.058) (-1000.125) (-996.202) -- 0:00:43
808000 -- (-993.317) (-994.047) (-997.465) [-999.387] * (-995.530) (-992.951) [-991.551] (-997.473) -- 0:00:43
808500 -- [-994.725] (-1002.906) (-993.176) (-994.800) * (-991.018) (-990.703) [-999.354] (-992.950) -- 0:00:43
809000 -- (-992.519) (-994.381) [-989.818] (-989.289) * (-996.087) (-995.925) (-997.649) [-991.921] -- 0:00:43
809500 -- (-992.347) (-994.207) [-992.731] (-991.339) * (-994.837) (-1000.453) [-994.155] (-995.266) -- 0:00:43
810000 -- [-994.354] (-999.016) (-989.944) (-994.213) * [-991.297] (-992.007) (-995.608) (-998.170) -- 0:00:43
Average standard deviation of split frequencies: 0.003489
810500 -- (-995.644) (-990.792) [-988.276] (-990.603) * (-989.179) [-996.081] (-996.304) (-995.089) -- 0:00:43
811000 -- (-997.919) (-990.624) (-993.937) [-996.610] * (-994.687) (-993.008) (-998.461) [-994.282] -- 0:00:43
811500 -- (-1001.672) [-991.776] (-994.096) (-997.954) * (-996.335) (-999.234) (-1001.461) [-993.129] -- 0:00:42
812000 -- [-994.224] (-990.470) (-998.166) (-991.445) * (-995.938) (-995.890) (-994.336) [-999.647] -- 0:00:42
812500 -- (-991.904) (-991.247) (-997.125) [-993.513] * (-993.060) [-995.747] (-993.363) (-992.840) -- 0:00:42
813000 -- [-988.262] (-1007.309) (-1006.100) (-993.603) * (-988.511) [-989.534] (-996.014) (-996.823) -- 0:00:42
813500 -- (-1006.367) (-999.110) (-1003.095) [-995.483] * (-989.938) (-994.373) (-997.064) [-994.608] -- 0:00:42
814000 -- (-994.565) (-996.023) [-989.130] (-994.699) * (-994.339) [-989.788] (-997.005) (-990.293) -- 0:00:42
814500 -- (-994.583) [-989.265] (-992.837) (-992.369) * (-992.550) (-991.093) [-988.123] (-997.452) -- 0:00:42
815000 -- (-996.516) (-988.406) (-996.203) [-993.930] * (-999.230) (-993.999) [-994.267] (-990.816) -- 0:00:42
Average standard deviation of split frequencies: 0.003582
815500 -- [-998.733] (-992.806) (-993.025) (-993.800) * (-990.249) (-999.043) [-996.668] (-994.464) -- 0:00:42
816000 -- [-990.238] (-993.485) (-989.493) (-993.080) * [-990.956] (-991.093) (-1000.530) (-999.190) -- 0:00:41
816500 -- [-994.966] (-991.615) (-987.687) (-995.198) * [-988.771] (-999.444) (-996.309) (-1003.856) -- 0:00:41
817000 -- [-994.361] (-992.453) (-990.038) (-987.233) * [-994.721] (-996.268) (-993.055) (-990.053) -- 0:00:41
817500 -- (-995.065) (-997.772) (-989.376) [-993.259] * [-999.056] (-992.857) (-997.201) (-992.526) -- 0:00:41
818000 -- [-992.864] (-997.417) (-995.096) (-993.121) * [-995.187] (-993.046) (-999.805) (-996.363) -- 0:00:41
818500 -- (-991.680) [-991.238] (-998.984) (-998.048) * [-991.861] (-991.792) (-1004.229) (-996.360) -- 0:00:41
819000 -- (-986.578) (-994.804) [-994.450] (-996.262) * [-993.299] (-996.257) (-1003.460) (-1003.950) -- 0:00:41
819500 -- [-997.482] (-1003.944) (-995.613) (-993.311) * (-996.498) [-995.884] (-994.438) (-1000.378) -- 0:00:41
820000 -- (-996.895) (-993.762) (-989.155) [-988.184] * (-989.272) (-996.827) [-990.659] (-1001.572) -- 0:00:41
Average standard deviation of split frequencies: 0.003906
820500 -- (-993.411) (-993.610) [-995.242] (-994.318) * (-996.596) [-993.359] (-990.889) (-993.635) -- 0:00:40
821000 -- (-997.224) [-991.388] (-991.648) (-990.324) * (-989.558) (-989.502) (-1003.469) [-997.108] -- 0:00:40
821500 -- (-997.322) [-992.544] (-992.400) (-1002.952) * (-991.674) (-991.173) (-987.326) [-992.454] -- 0:00:40
822000 -- (-994.051) (-999.500) (-1012.313) [-996.717] * (-992.012) [-991.396] (-988.454) (-1001.367) -- 0:00:40
822500 -- (-992.309) (-992.366) [-988.720] (-999.962) * (-998.021) [-991.048] (-999.243) (-999.934) -- 0:00:40
823000 -- (-997.362) [-994.523] (-990.122) (-1001.222) * [-992.794] (-995.663) (-992.261) (-1001.853) -- 0:00:40
823500 -- (-996.790) [-992.154] (-995.595) (-996.372) * (-1002.982) (-992.209) [-989.377] (-994.094) -- 0:00:40
824000 -- (-1004.403) (-998.196) [-993.898] (-997.555) * [-997.790] (-992.341) (-998.341) (-993.066) -- 0:00:40
824500 -- (-990.191) (-1000.843) (-991.958) [-988.206] * [-998.887] (-996.676) (-992.174) (-999.924) -- 0:00:40
825000 -- [-987.795] (-995.199) (-1000.465) (-996.190) * (-998.152) (-996.310) (-994.786) [-996.799] -- 0:00:39
Average standard deviation of split frequencies: 0.004223
825500 -- (-996.014) [-992.281] (-993.135) (-1001.024) * (-989.533) (-991.459) [-990.459] (-1001.426) -- 0:00:39
826000 -- (-995.627) [-995.214] (-996.588) (-992.315) * (-993.896) [-991.674] (-991.455) (-1004.434) -- 0:00:39
826500 -- (-993.976) (-999.764) (-1000.567) [-995.672] * (-1001.091) [-997.789] (-996.416) (-997.876) -- 0:00:39
827000 -- (-996.475) (-997.241) [-993.332] (-997.484) * (-992.342) (-1004.756) (-996.413) [-997.063] -- 0:00:39
827500 -- (-995.251) [-989.855] (-995.759) (-992.099) * [-995.495] (-989.863) (-989.793) (-987.404) -- 0:00:39
828000 -- (-994.925) [-994.781] (-998.753) (-995.200) * (-995.976) (-998.751) (-997.361) [-988.647] -- 0:00:39
828500 -- (-997.009) (-996.211) (-992.206) [-997.580] * (-996.247) (-994.820) [-994.237] (-993.420) -- 0:00:39
829000 -- (-994.018) [-996.738] (-993.302) (-990.446) * (-993.692) (-992.180) [-993.907] (-998.996) -- 0:00:38
829500 -- (-991.670) (-989.247) (-995.548) [-988.132] * (-990.558) (-999.301) (-989.260) [-998.148] -- 0:00:38
830000 -- (-988.667) [-991.328] (-997.924) (-991.025) * (-988.723) [-990.531] (-993.715) (-996.485) -- 0:00:38
Average standard deviation of split frequencies: 0.004540
830500 -- (-1013.468) [-997.558] (-990.235) (-994.582) * (-993.233) (-993.615) (-998.526) [-988.874] -- 0:00:38
831000 -- (-999.492) (-1001.750) [-993.456] (-1003.242) * (-997.813) [-988.474] (-990.840) (-1001.313) -- 0:00:38
831500 -- (-1000.035) [-995.588] (-993.764) (-996.309) * [-991.244] (-988.304) (-991.268) (-992.751) -- 0:00:38
832000 -- (-994.921) (-990.416) (-992.695) [-995.556] * (-1001.515) (-994.673) (-990.023) [-995.831] -- 0:00:38
832500 -- (-992.479) [-990.750] (-992.726) (-1002.800) * (-999.189) (-988.272) [-993.053] (-1000.386) -- 0:00:38
833000 -- (-996.116) [-994.165] (-995.373) (-1001.187) * (-1000.789) [-988.260] (-992.750) (-992.060) -- 0:00:38
833500 -- (-998.660) [-997.845] (-994.825) (-995.757) * (-993.484) (-991.778) (-993.251) [-988.814] -- 0:00:37
834000 -- (-1002.925) (-997.465) [-996.514] (-1000.003) * [-990.351] (-992.223) (-1003.756) (-989.051) -- 0:00:37
834500 -- [-999.286] (-996.246) (-994.623) (-1008.946) * [-986.034] (-991.863) (-994.553) (-996.512) -- 0:00:37
835000 -- (-1002.160) (-994.186) [-996.747] (-1002.031) * [-986.574] (-1001.655) (-993.926) (-990.516) -- 0:00:37
Average standard deviation of split frequencies: 0.003947
835500 -- (-997.223) (-989.872) [-991.037] (-998.262) * (-997.976) (-989.362) (-996.478) [-992.269] -- 0:00:37
836000 -- [-992.412] (-988.622) (-996.800) (-998.962) * [-995.063] (-1000.064) (-999.526) (-999.556) -- 0:00:37
836500 -- (-990.896) (-995.856) [-995.067] (-998.282) * (-989.304) (-1001.328) (-1000.918) [-988.590] -- 0:00:37
837000 -- (-999.195) [-991.914] (-997.691) (-1001.484) * [-990.263] (-993.722) (-999.042) (-995.011) -- 0:00:37
837500 -- [-991.666] (-1001.247) (-1003.545) (-997.840) * (-1001.891) (-998.876) (-1010.158) [-993.512] -- 0:00:37
838000 -- [-992.946] (-993.493) (-1001.406) (-1001.627) * (-1002.332) (-995.158) [-1003.150] (-992.461) -- 0:00:36
838500 -- (-990.554) (-994.294) [-989.434] (-1001.368) * [-990.525] (-990.992) (-1000.055) (-992.573) -- 0:00:36
839000 -- (-992.006) (-993.348) (-996.111) [-996.903] * (-996.269) [-993.398] (-1001.456) (-998.097) -- 0:00:36
839500 -- (-988.779) (-994.122) (-999.118) [-990.706] * (-992.973) [-992.920] (-999.584) (-988.843) -- 0:00:36
840000 -- [-993.244] (-997.193) (-998.984) (-996.448) * [-992.602] (-994.404) (-995.784) (-988.200) -- 0:00:36
Average standard deviation of split frequencies: 0.004262
840500 -- (-994.623) [-1000.413] (-995.571) (-992.438) * [-989.191] (-991.236) (-995.908) (-998.934) -- 0:00:36
841000 -- [-992.670] (-988.094) (-995.363) (-998.791) * (-996.281) (-995.793) (-995.480) [-998.420] -- 0:00:36
841500 -- [-992.298] (-1000.055) (-993.130) (-991.819) * (-999.673) (-992.694) (-992.817) [-1000.434] -- 0:00:36
842000 -- (-990.785) [-994.233] (-993.544) (-996.611) * (-994.639) (-996.082) [-995.409] (-999.420) -- 0:00:36
842500 -- [-992.324] (-992.653) (-996.584) (-998.059) * (-991.776) [-996.381] (-1000.480) (-1003.893) -- 0:00:35
843000 -- (-991.480) (-995.213) (-989.573) [-992.107] * [-990.337] (-991.787) (-992.548) (-996.956) -- 0:00:35
843500 -- (-987.352) (-995.832) (-991.985) [-992.077] * (-1002.285) (-994.570) [-994.102] (-998.268) -- 0:00:35
844000 -- (-996.106) (-996.527) [-990.939] (-998.005) * (-991.713) [-988.466] (-990.112) (-992.898) -- 0:00:35
844500 -- (-993.049) [-995.330] (-989.506) (-993.884) * [-993.307] (-993.336) (-994.140) (-992.042) -- 0:00:35
845000 -- [-995.298] (-999.401) (-993.841) (-992.005) * [-993.852] (-997.826) (-1000.930) (-991.182) -- 0:00:35
Average standard deviation of split frequencies: 0.004012
845500 -- [-995.637] (-993.054) (-999.241) (-994.714) * [-989.736] (-1002.346) (-990.828) (-990.224) -- 0:00:35
846000 -- [-996.834] (-993.919) (-993.258) (-998.776) * (-996.844) (-1003.539) [-1000.329] (-991.461) -- 0:00:35
846500 -- (-1001.904) (-999.062) [-994.279] (-1005.686) * (-999.440) (-1001.026) [-992.816] (-993.218) -- 0:00:34
847000 -- (-990.932) (-992.067) [-991.882] (-994.753) * [-996.767] (-998.144) (-1000.739) (-996.419) -- 0:00:34
847500 -- (-994.103) (-993.679) (-1004.087) [-989.396] * (-1001.422) [-995.267] (-997.634) (-1004.742) -- 0:00:34
848000 -- (-990.965) (-996.100) [-994.834] (-993.959) * (-990.841) (-993.233) [-996.397] (-993.447) -- 0:00:34
848500 -- [-988.117] (-992.883) (-995.063) (-991.286) * [-994.659] (-998.837) (-992.090) (-993.499) -- 0:00:34
849000 -- (-988.874) (-995.845) (-991.204) [-988.817] * (-1001.489) [-996.131] (-991.066) (-994.571) -- 0:00:34
849500 -- [-994.706] (-996.201) (-995.172) (-990.126) * (-993.346) (-989.662) (-1000.491) [-991.845] -- 0:00:34
850000 -- [-993.476] (-996.151) (-997.369) (-996.454) * (-992.614) [-988.371] (-1001.116) (-1000.351) -- 0:00:34
Average standard deviation of split frequencies: 0.003436
850500 -- (-992.212) (-996.257) [-990.497] (-993.045) * [-995.516] (-993.952) (-999.353) (-998.294) -- 0:00:34
851000 -- (-994.775) [-991.666] (-999.986) (-1001.149) * (-998.882) (-996.572) [-995.500] (-997.596) -- 0:00:33
851500 -- (-993.326) [-990.143] (-995.226) (-995.507) * [-989.957] (-999.113) (-994.906) (-1002.603) -- 0:00:33
852000 -- (-998.100) (-997.753) [-992.983] (-997.601) * (-995.426) (-994.914) (-988.345) [-989.865] -- 0:00:33
852500 -- [-992.678] (-989.618) (-991.430) (-1006.788) * (-996.867) (-1002.387) (-1000.625) [-993.538] -- 0:00:33
853000 -- [-995.930] (-990.427) (-992.166) (-991.314) * (-991.669) [-988.260] (-991.141) (-995.805) -- 0:00:33
853500 -- (-995.788) [-994.441] (-988.333) (-990.594) * (-998.058) [-990.684] (-999.178) (-995.774) -- 0:00:33
854000 -- (-998.450) [-992.528] (-991.497) (-991.236) * (-996.954) (-989.716) (-998.972) [-988.617] -- 0:00:33
854500 -- (-998.051) (-1000.202) [-997.580] (-992.437) * [-995.923] (-989.337) (-990.042) (-1003.263) -- 0:00:33
855000 -- (-996.839) (-996.148) (-1001.068) [-991.681] * [-994.939] (-993.327) (-992.741) (-1002.326) -- 0:00:33
Average standard deviation of split frequencies: 0.002533
855500 -- (-993.119) (-991.878) (-992.561) [-990.234] * (-992.215) [-989.937] (-992.187) (-996.761) -- 0:00:32
856000 -- (-994.759) (-994.250) (-996.723) [-994.984] * (-995.656) [-991.879] (-995.113) (-1004.068) -- 0:00:32
856500 -- (-993.628) (-993.381) (-994.972) [-998.406] * (-1000.033) [-989.402] (-992.607) (-1001.708) -- 0:00:32
857000 -- [-989.698] (-1000.170) (-996.910) (-1000.158) * [-989.789] (-997.111) (-996.366) (-998.678) -- 0:00:32
857500 -- (-988.006) [-994.523] (-993.444) (-994.200) * (-993.655) (-996.886) [-992.483] (-1001.706) -- 0:00:32
858000 -- (-991.275) (-987.660) (-991.683) [-992.848] * [-992.014] (-993.069) (-994.450) (-996.231) -- 0:00:32
858500 -- (-989.600) [-993.034] (-994.104) (-997.774) * [-986.093] (-1000.317) (-999.781) (-999.365) -- 0:00:32
859000 -- (-991.803) (-997.077) [-991.590] (-999.578) * [-990.289] (-1002.281) (-992.392) (-1001.904) -- 0:00:32
859500 -- (-992.865) (-993.578) [-993.977] (-1000.629) * (-992.103) [-995.978] (-992.796) (-994.827) -- 0:00:32
860000 -- [-997.224] (-997.324) (-998.661) (-988.845) * (-990.678) (-1000.084) (-995.780) [-996.307] -- 0:00:31
Average standard deviation of split frequencies: 0.002739
860500 -- [-991.596] (-993.642) (-988.878) (-993.103) * [-991.096] (-991.398) (-997.355) (-994.947) -- 0:00:31
861000 -- (-989.010) [-995.734] (-990.022) (-991.451) * (-993.961) (-1000.786) (-997.063) [-989.077] -- 0:00:31
861500 -- (-995.002) (-993.170) [-993.919] (-996.098) * (-997.750) [-996.182] (-991.033) (-995.309) -- 0:00:31
862000 -- [-991.936] (-990.951) (-994.523) (-994.562) * (-998.813) (-997.371) (-998.725) [-999.448] -- 0:00:31
862500 -- [-990.001] (-993.217) (-996.884) (-998.847) * [-997.615] (-999.078) (-994.054) (-992.909) -- 0:00:31
863000 -- [-990.344] (-998.105) (-998.636) (-992.543) * (-996.567) (-997.471) (-996.478) [-988.555] -- 0:00:31
863500 -- [-995.062] (-992.069) (-992.399) (-996.592) * (-994.755) (-999.072) (-992.012) [-994.934] -- 0:00:31
864000 -- [-994.228] (-999.348) (-1000.062) (-1003.584) * (-1012.688) (-987.004) (-992.854) [-995.836] -- 0:00:31
864500 -- (-992.007) [-988.570] (-1005.522) (-991.015) * [-992.532] (-991.412) (-997.548) (-994.193) -- 0:00:30
865000 -- (-992.908) [-989.460] (-996.763) (-991.702) * (-997.070) (-1003.152) (-989.535) [-994.712] -- 0:00:30
Average standard deviation of split frequencies: 0.002831
865500 -- (-992.163) (-993.414) (-1002.359) [-994.460] * (-997.755) [-993.246] (-987.560) (-993.951) -- 0:00:30
866000 -- (-997.967) [-993.510] (-1000.511) (-996.535) * (-993.213) [-991.120] (-989.066) (-990.784) -- 0:00:30
866500 -- (-997.292) (-994.519) (-990.098) [-994.226] * [-994.366] (-996.394) (-998.473) (-994.560) -- 0:00:30
867000 -- (-994.910) (-994.323) (-994.117) [-992.035] * (-996.360) (-991.335) (-995.832) [-989.500] -- 0:00:30
867500 -- (-993.052) (-992.963) [-997.223] (-995.760) * (-992.373) [-988.349] (-990.870) (-990.481) -- 0:00:30
868000 -- (-998.178) (-990.440) [-991.793] (-998.420) * [-993.319] (-1000.803) (-1005.073) (-994.252) -- 0:00:30
868500 -- (-999.945) (-993.374) (-996.466) [-995.830] * (-988.481) (-1001.077) [-990.200] (-998.865) -- 0:00:29
869000 -- (-1009.051) (-990.989) (-991.484) [-990.286] * (-995.059) (-996.637) (-996.040) [-994.855] -- 0:00:29
869500 -- (-997.716) (-992.451) [-988.023] (-995.218) * [-994.390] (-995.032) (-995.414) (-993.120) -- 0:00:29
870000 -- (-1001.332) [-989.639] (-995.142) (-991.749) * (-991.858) (-994.239) (-1001.302) [-990.827] -- 0:00:29
Average standard deviation of split frequencies: 0.002274
870500 -- (-995.588) [-994.455] (-996.502) (-993.414) * (-996.151) [-999.066] (-997.729) (-996.334) -- 0:00:29
871000 -- (-994.176) [-990.737] (-989.999) (-1003.171) * (-1000.469) (-995.767) (-1002.647) [-991.237] -- 0:00:29
871500 -- (-997.290) (-1003.456) [-996.189] (-991.311) * [-995.629] (-992.870) (-994.817) (-1004.630) -- 0:00:29
872000 -- (-996.574) [-988.948] (-987.890) (-999.203) * [-989.672] (-996.381) (-998.267) (-994.630) -- 0:00:29
872500 -- (-993.966) [-994.129] (-993.190) (-994.891) * (-995.742) [-992.592] (-997.941) (-999.584) -- 0:00:29
873000 -- (-988.969) [-992.508] (-996.623) (-988.960) * (-988.002) [-993.958] (-991.751) (-991.804) -- 0:00:28
873500 -- (-998.313) [-993.119] (-998.321) (-994.547) * (-991.009) (-1007.506) (-995.159) [-995.063] -- 0:00:28
874000 -- [-989.849] (-994.861) (-998.878) (-1000.217) * (-1003.628) (-995.943) (-990.313) [-990.707] -- 0:00:28
874500 -- [-989.504] (-995.054) (-991.981) (-989.072) * [-996.162] (-997.252) (-1001.360) (-989.320) -- 0:00:28
875000 -- (-997.824) (-997.897) (-988.148) [-992.020] * (-992.435) [-994.178] (-1005.712) (-992.386) -- 0:00:28
Average standard deviation of split frequencies: 0.002045
875500 -- [-997.787] (-991.336) (-988.021) (-996.247) * (-1004.643) (-992.252) [-999.084] (-994.394) -- 0:00:28
876000 -- [-993.948] (-995.764) (-990.856) (-999.719) * (-1005.908) (-995.643) (-990.327) [-987.974] -- 0:00:28
876500 -- (-1001.895) (-989.647) [-995.941] (-991.267) * (-1000.238) (-993.536) (-988.775) [-993.491] -- 0:00:28
877000 -- (-989.147) (-1002.148) [-991.477] (-999.882) * [-990.611] (-997.644) (-992.592) (-990.998) -- 0:00:28
877500 -- (-1002.337) (-993.805) [-991.334] (-996.004) * [-992.601] (-992.114) (-993.111) (-1003.177) -- 0:00:27
878000 -- (-1009.039) (-993.981) [-988.833] (-996.235) * [-995.370] (-994.876) (-994.167) (-1002.451) -- 0:00:27
878500 -- (-1000.723) (-992.338) [-1002.892] (-994.078) * [-990.514] (-994.960) (-993.190) (-999.921) -- 0:00:27
879000 -- [-996.534] (-992.525) (-998.102) (-993.734) * (-994.136) (-989.619) [-996.878] (-992.474) -- 0:00:27
879500 -- (-994.943) [-992.303] (-995.830) (-999.710) * (-999.096) (-993.371) [-994.763] (-993.278) -- 0:00:27
880000 -- (-996.080) (-992.438) [-993.438] (-997.380) * (-995.950) (-994.380) (-999.349) [-993.451] -- 0:00:27
Average standard deviation of split frequencies: 0.002569
880500 -- (-995.082) (-995.116) [-993.330] (-991.776) * (-994.554) (-994.563) [-992.564] (-990.967) -- 0:00:27
881000 -- (-991.924) (-988.791) (-998.820) [-988.168] * (-998.345) [-987.335] (-993.383) (-995.637) -- 0:00:27
881500 -- (-997.792) (-991.258) [-990.960] (-997.795) * (-994.951) [-993.478] (-993.145) (-998.764) -- 0:00:27
882000 -- (-999.354) (-998.411) (-991.197) [-987.709] * [-988.781] (-999.887) (-995.751) (-994.512) -- 0:00:26
882500 -- [-992.776] (-992.858) (-992.114) (-995.782) * (-992.949) (-996.846) [-991.764] (-1004.382) -- 0:00:26
883000 -- (-995.654) (-992.067) (-986.933) [-1001.721] * (-993.916) [-992.075] (-996.684) (-1001.518) -- 0:00:26
883500 -- (-1000.505) (-993.695) [-995.576] (-994.178) * (-990.745) (-992.776) (-990.579) [-998.387] -- 0:00:26
884000 -- (-995.540) (-998.092) (-992.163) [-992.479] * (-996.826) [-993.890] (-992.220) (-997.982) -- 0:00:26
884500 -- (-989.200) [-992.370] (-995.746) (-991.477) * (-994.035) [-996.167] (-996.701) (-999.818) -- 0:00:26
885000 -- (-992.228) [-994.830] (-996.124) (-996.465) * [-993.276] (-998.716) (-997.749) (-993.623) -- 0:00:26
Average standard deviation of split frequencies: 0.002447
885500 -- (-992.818) [-992.083] (-1000.458) (-991.124) * (-997.196) [-989.317] (-991.721) (-993.846) -- 0:00:26
886000 -- (-993.812) [-992.031] (-1000.737) (-990.291) * (-995.709) [-995.246] (-997.604) (-998.243) -- 0:00:25
886500 -- [-997.954] (-993.802) (-1001.868) (-997.466) * (-1001.217) (-993.155) (-1000.017) [-995.539] -- 0:00:25
887000 -- [-996.723] (-995.508) (-992.860) (-989.519) * (-993.736) (-989.201) [-991.538] (-998.782) -- 0:00:25
887500 -- (-996.006) (-990.015) (-996.675) [-991.937] * (-1000.084) [-989.868] (-993.241) (-1010.264) -- 0:00:25
888000 -- [-996.272] (-994.787) (-989.800) (-992.482) * (-996.470) (-992.685) [-988.970] (-997.644) -- 0:00:25
888500 -- (-987.824) [-993.939] (-993.678) (-998.616) * (-992.496) [-985.820] (-997.328) (-999.622) -- 0:00:25
889000 -- (-993.310) (-995.761) [-990.721] (-997.644) * (-997.047) (-996.025) [-998.102] (-992.735) -- 0:00:25
889500 -- (-989.813) (-990.900) (-1000.200) [-988.684] * [-991.813] (-1003.167) (-1003.053) (-1003.745) -- 0:00:25
890000 -- (-991.872) [-995.611] (-999.766) (-994.734) * [-993.926] (-990.960) (-996.220) (-994.857) -- 0:00:25
Average standard deviation of split frequencies: 0.002117
890500 -- (-1000.408) (-989.648) (-992.708) [-992.692] * [-989.283] (-990.461) (-992.751) (-992.288) -- 0:00:24
891000 -- [-991.763] (-998.401) (-995.064) (-993.874) * (-989.938) [-993.058] (-990.098) (-1005.724) -- 0:00:24
891500 -- (-996.136) (-1001.657) (-995.024) [-994.309] * (-987.863) (-995.560) [-991.400] (-1000.835) -- 0:00:24
892000 -- (-1000.995) [-1000.504] (-993.197) (-995.915) * [-992.812] (-995.123) (-991.975) (-1000.790) -- 0:00:24
892500 -- [-992.367] (-993.763) (-995.367) (-997.348) * (-991.043) (-999.225) [-989.786] (-990.001) -- 0:00:24
893000 -- [-990.346] (-1003.264) (-994.359) (-1000.894) * [-991.679] (-991.222) (-996.844) (-992.184) -- 0:00:24
893500 -- [-991.802] (-1000.586) (-997.098) (-1001.676) * (-993.661) (-993.908) (-993.746) [-991.674] -- 0:00:24
894000 -- (-998.472) (-994.198) (-994.949) [-995.535] * (-990.863) (-991.238) [-987.904] (-991.295) -- 0:00:24
894500 -- (-993.605) (-998.220) [-992.843] (-992.602) * (-1000.626) (-995.993) [-990.576] (-990.909) -- 0:00:24
895000 -- (-992.794) (-991.648) (-995.696) [-988.253] * (-991.685) (-995.185) (-993.903) [-994.554] -- 0:00:23
Average standard deviation of split frequencies: 0.001473
895500 -- (-990.332) (-999.398) [-992.923] (-992.519) * [-985.096] (-999.403) (-991.991) (-992.350) -- 0:00:23
896000 -- (-999.193) (-996.233) [-996.316] (-994.085) * (-988.617) [-995.657] (-988.766) (-994.668) -- 0:00:23
896500 -- [-992.851] (-1004.118) (-991.485) (-991.867) * (-1001.089) (-1009.633) (-998.321) [-1001.381] -- 0:00:23
897000 -- (-993.199) (-995.593) [-995.794] (-993.803) * (-993.423) (-1000.129) (-993.183) [-991.823] -- 0:00:23
897500 -- (-991.652) (-1004.090) (-1001.392) [-992.226] * (-999.413) (-990.298) [-994.489] (-988.074) -- 0:00:23
898000 -- [-994.849] (-997.714) (-995.827) (-990.415) * [-993.876] (-999.461) (-999.230) (-995.325) -- 0:00:23
898500 -- (-995.265) (-988.191) (-998.993) [-988.941] * (-1007.396) [-1001.774] (-991.864) (-996.626) -- 0:00:23
899000 -- [-995.128] (-991.199) (-994.964) (-991.631) * (-999.086) (-992.763) [-991.730] (-994.985) -- 0:00:23
899500 -- (-991.926) (-993.728) (-998.503) [-991.541] * (-1008.990) (-989.303) (-993.925) [-992.362] -- 0:00:22
900000 -- (-1000.232) (-994.406) (-993.152) [-990.590] * (-1004.347) (-997.587) [-996.315] (-994.341) -- 0:00:22
Average standard deviation of split frequencies: 0.002198
900500 -- (-998.863) (-994.226) [-994.994] (-997.794) * [-997.474] (-999.869) (-995.016) (-996.254) -- 0:00:22
901000 -- (-997.108) (-990.559) (-998.900) [-993.803] * [-989.218] (-997.514) (-996.130) (-993.380) -- 0:00:22
901500 -- (-1010.632) (-995.888) (-997.496) [-986.773] * (-1003.813) (-994.399) (-995.770) [-989.448] -- 0:00:22
902000 -- (-1000.114) (-991.938) (-991.869) [-990.165] * (-1000.022) (-997.969) (-994.628) [-990.040] -- 0:00:22
902500 -- (-996.313) (-992.960) (-1003.960) [-991.063] * (-1000.546) [-995.147] (-993.185) (-992.252) -- 0:00:22
903000 -- (-993.049) [-993.862] (-995.684) (-996.348) * (-998.698) (-992.897) [-994.355] (-993.222) -- 0:00:22
903500 -- (-996.454) [-998.975] (-995.421) (-1000.773) * [-994.871] (-1004.837) (-996.767) (-999.042) -- 0:00:22
904000 -- (-1003.229) (-995.474) [-989.757] (-992.733) * (-994.618) (-990.919) [-996.744] (-991.702) -- 0:00:21
904500 -- (-996.371) (-991.788) [-994.988] (-1003.044) * [-993.663] (-995.939) (-999.947) (-997.204) -- 0:00:21
905000 -- (-992.718) (-999.289) [-990.771] (-1003.722) * (-992.677) [-995.317] (-994.117) (-1001.377) -- 0:00:21
Average standard deviation of split frequencies: 0.002810
905500 -- (-999.623) (-995.135) [-994.351] (-998.613) * [-995.182] (-996.987) (-993.384) (-993.083) -- 0:00:21
906000 -- (-1001.357) [-994.432] (-1000.774) (-996.365) * [-992.297] (-995.955) (-995.943) (-999.384) -- 0:00:21
906500 -- (-999.646) (-993.074) [-991.262] (-999.670) * (-990.752) (-1002.018) (-987.890) [-995.805] -- 0:00:21
907000 -- [-990.467] (-996.762) (-996.303) (-997.985) * (-990.659) (-993.988) [-988.178] (-990.962) -- 0:00:21
907500 -- (-990.558) (-997.085) (-1001.158) [-993.234] * [-990.055] (-1006.400) (-991.501) (-994.010) -- 0:00:21
908000 -- (-993.240) [-996.026] (-997.402) (-994.262) * (-991.199) [-997.145] (-993.699) (-996.855) -- 0:00:20
908500 -- (-997.725) (-996.597) [-996.066] (-999.792) * [-991.582] (-996.034) (-993.942) (-1002.598) -- 0:00:20
909000 -- [-990.369] (-999.559) (-991.075) (-992.819) * (-992.397) [-998.589] (-1002.026) (-996.852) -- 0:00:20
909500 -- [-993.468] (-994.292) (-994.267) (-993.159) * [-990.470] (-1002.064) (-1000.387) (-994.724) -- 0:00:20
910000 -- (-1001.694) (-996.725) [-994.454] (-995.090) * (-998.382) [-994.798] (-1000.889) (-998.236) -- 0:00:20
Average standard deviation of split frequencies: 0.003313
910500 -- (-993.972) [-992.370] (-998.583) (-996.842) * [-992.344] (-989.356) (-1003.023) (-987.505) -- 0:00:20
911000 -- (-993.636) (-995.181) (-996.196) [-992.828] * (-992.635) (-992.478) [-998.024] (-993.570) -- 0:00:20
911500 -- (-999.156) (-997.672) (-994.176) [-990.788] * (-990.731) [-987.051] (-995.776) (-994.663) -- 0:00:20
912000 -- (-994.945) (-989.892) (-997.774) [-988.179] * (-999.275) [-993.983] (-999.119) (-991.555) -- 0:00:20
912500 -- [-994.608] (-990.643) (-992.386) (-987.818) * [-988.172] (-996.947) (-993.892) (-997.229) -- 0:00:19
913000 -- [-999.444] (-994.312) (-993.424) (-990.970) * (-998.690) (-993.995) [-991.820] (-987.939) -- 0:00:19
913500 -- (-997.319) (-998.098) (-992.006) [-994.337] * (-999.574) (-994.135) [-989.823] (-987.377) -- 0:00:19
914000 -- (-1007.301) [-992.888] (-999.447) (-992.506) * (-995.205) (-1002.582) [-996.362] (-996.164) -- 0:00:19
914500 -- [-995.672] (-996.209) (-990.833) (-1000.931) * (-996.016) [-997.651] (-991.009) (-999.150) -- 0:00:19
915000 -- (-999.088) (-988.863) (-1000.924) [-989.611] * (-1000.274) (-990.627) [-993.655] (-993.069) -- 0:00:19
Average standard deviation of split frequencies: 0.003294
915500 -- (-995.343) (-991.383) [-992.024] (-989.268) * (-996.057) (-992.459) [-990.776] (-996.069) -- 0:00:19
916000 -- (-994.955) (-998.354) [-993.895] (-1001.446) * (-992.745) (-994.903) [-992.205] (-998.175) -- 0:00:19
916500 -- (-995.084) (-989.027) [-989.877] (-1005.919) * (-993.480) [-987.588] (-995.262) (-995.636) -- 0:00:19
917000 -- (-999.783) (-1007.246) (-991.292) [-994.648] * (-996.725) (-994.244) [-986.917] (-998.341) -- 0:00:18
917500 -- (-990.431) (-996.867) (-990.542) [-992.991] * (-998.342) [-992.659] (-1000.565) (-989.441) -- 0:00:18
918000 -- [-992.069] (-996.341) (-990.755) (-998.166) * [-998.084] (-993.731) (-994.965) (-1001.977) -- 0:00:18
918500 -- (-996.904) (-996.777) [-991.999] (-992.253) * (-993.900) (-990.009) [-989.639] (-995.976) -- 0:00:18
919000 -- [-988.094] (-990.323) (-989.974) (-991.206) * (-998.513) (-995.950) (-1001.347) [-998.162] -- 0:00:18
919500 -- [-992.890] (-1000.889) (-993.825) (-993.164) * (-990.025) [-988.748] (-995.716) (-999.223) -- 0:00:18
920000 -- (-993.613) (-1002.032) (-992.542) [-994.566] * (-1000.836) [-988.722] (-989.652) (-998.039) -- 0:00:18
Average standard deviation of split frequencies: 0.003482
920500 -- [-993.346] (-992.778) (-1001.616) (-990.133) * (-990.645) (-993.796) (-1007.336) [-992.866] -- 0:00:18
921000 -- (-992.905) (-991.513) (-992.930) [-991.816] * [-993.789] (-992.347) (-996.304) (-1008.402) -- 0:00:18
921500 -- [-992.105] (-995.276) (-991.140) (-994.739) * (-997.160) (-1002.307) [-999.780] (-994.222) -- 0:00:17
922000 -- (-993.444) (-995.817) [-997.684] (-992.005) * (-992.815) [-995.692] (-998.965) (-990.790) -- 0:00:17
922500 -- (-996.062) [-991.754] (-994.368) (-994.781) * (-1001.400) (-998.289) [-992.474] (-994.037) -- 0:00:17
923000 -- (-1000.106) (-998.826) (-1007.854) [-988.220] * (-994.546) [-989.429] (-996.698) (-993.980) -- 0:00:17
923500 -- (-999.051) (-995.032) (-1003.015) [-997.076] * (-995.930) (-993.098) (-1002.691) [-988.483] -- 0:00:17
924000 -- (-993.497) (-1001.591) [-993.915] (-1007.327) * (-995.218) (-994.141) [-993.431] (-992.724) -- 0:00:17
924500 -- (-992.782) (-995.355) (-992.932) [-994.141] * (-1015.273) (-990.216) (-1000.048) [-988.873] -- 0:00:17
925000 -- (-998.896) (-1002.191) [-993.215] (-1001.278) * (-997.397) (-995.242) [-992.420] (-990.621) -- 0:00:17
Average standard deviation of split frequencies: 0.003564
925500 -- (-995.718) [-992.630] (-994.074) (-991.089) * (-996.719) (-997.061) (-1003.051) [-996.062] -- 0:00:16
926000 -- (-989.342) [-986.601] (-1000.352) (-999.781) * (-998.903) [-998.824] (-988.955) (-994.443) -- 0:00:16
926500 -- (-997.643) [-989.507] (-988.030) (-1001.065) * (-996.656) [-1000.634] (-992.452) (-996.889) -- 0:00:16
927000 -- (-997.106) (-991.150) (-991.996) [-994.893] * (-996.810) (-997.192) [-996.107] (-1000.677) -- 0:00:16
927500 -- [-994.002] (-996.701) (-996.249) (-998.072) * [-989.609] (-998.667) (-988.673) (-998.673) -- 0:00:16
928000 -- [-989.089] (-995.145) (-992.501) (-989.157) * (-1001.448) [-987.970] (-995.863) (-994.196) -- 0:00:16
928500 -- [-988.805] (-1002.936) (-993.905) (-996.590) * (-996.792) [-989.376] (-999.434) (-995.180) -- 0:00:16
929000 -- (-992.116) (-994.907) (-993.928) [-996.567] * (-995.877) [-995.599] (-998.273) (-992.716) -- 0:00:16
929500 -- (-994.330) [-986.348] (-999.512) (-1005.588) * (-995.692) [-992.673] (-998.867) (-991.103) -- 0:00:16
930000 -- [-994.359] (-991.621) (-998.151) (-992.133) * [-1001.263] (-994.176) (-1003.898) (-995.207) -- 0:00:15
Average standard deviation of split frequencies: 0.004153
930500 -- (-995.487) [-990.286] (-995.484) (-994.140) * [-996.130] (-999.297) (-997.779) (-992.816) -- 0:00:15
931000 -- (-1003.767) (-995.615) [-996.547] (-998.837) * (-995.518) [-999.329] (-995.730) (-994.486) -- 0:00:15
931500 -- (-992.014) [-997.241] (-996.733) (-1003.268) * (-991.279) [-992.293] (-999.103) (-993.883) -- 0:00:15
932000 -- (-1002.073) [-992.377] (-995.103) (-993.172) * [-990.469] (-991.009) (-992.824) (-994.776) -- 0:00:15
932500 -- (-1005.140) (-996.928) (-993.181) [-999.356] * (-994.871) [-990.116] (-994.386) (-996.075) -- 0:00:15
933000 -- (-992.603) [-993.307] (-998.555) (-991.073) * (-995.004) (-993.040) (-995.501) [-987.808] -- 0:00:15
933500 -- (-994.851) (-998.491) (-994.403) [-991.022] * (-996.294) [-990.654] (-990.620) (-998.308) -- 0:00:15
934000 -- [-996.277] (-991.041) (-991.503) (-999.000) * (-992.846) (-992.191) [-991.880] (-995.184) -- 0:00:15
934500 -- (-992.782) (-1000.169) (-995.217) [-990.926] * (-1002.648) [-991.496] (-996.576) (-994.232) -- 0:00:14
935000 -- (-995.891) (-997.409) (-996.455) [-992.728] * (-994.991) (-995.085) [-992.103] (-996.362) -- 0:00:14
Average standard deviation of split frequencies: 0.004432
935500 -- (-999.014) [-992.932] (-992.775) (-997.212) * (-993.344) (-994.583) [-995.980] (-1003.328) -- 0:00:14
936000 -- (-994.299) (-991.341) (-995.924) [-991.183] * [-992.493] (-992.575) (-1000.602) (-996.070) -- 0:00:14
936500 -- [-993.795] (-993.471) (-999.159) (-998.840) * (-994.519) (-991.531) (-993.604) [-993.494] -- 0:00:14
937000 -- (-993.146) (-997.396) [-996.263] (-994.433) * (-992.129) (-999.785) [-996.081] (-997.258) -- 0:00:14
937500 -- [-991.473] (-992.799) (-989.034) (-998.120) * (-992.347) (-997.163) [-997.432] (-995.799) -- 0:00:14
938000 -- [-997.832] (-995.788) (-990.294) (-995.167) * (-989.270) (-995.605) [-997.648] (-1000.282) -- 0:00:14
938500 -- (-992.212) (-996.170) [-991.775] (-993.503) * (-997.057) (-987.853) [-993.141] (-1003.677) -- 0:00:14
939000 -- (-991.586) (-1000.023) (-995.557) [-990.514] * (-995.067) (-992.942) (-1005.762) [-991.800] -- 0:00:13
939500 -- (-999.613) [-988.223] (-993.797) (-998.652) * (-1003.933) [-987.773] (-995.333) (-996.815) -- 0:00:13
940000 -- (-997.095) [-995.269] (-997.559) (-992.657) * [-996.660] (-1002.316) (-991.954) (-1000.380) -- 0:00:13
Average standard deviation of split frequencies: 0.004210
940500 -- (-993.720) (-993.626) [-986.404] (-1003.009) * (-992.702) (-994.610) [-993.494] (-998.816) -- 0:00:13
941000 -- [-993.268] (-993.918) (-996.506) (-995.459) * (-992.889) (-1002.346) (-999.612) [-995.726] -- 0:00:13
941500 -- (-994.563) (-990.283) [-992.994] (-994.664) * (-995.039) [-997.430] (-998.273) (-997.741) -- 0:00:13
942000 -- (-997.964) (-1001.395) (-998.977) [-998.902] * (-999.066) (-997.882) (-994.450) [-989.235] -- 0:00:13
942500 -- (-999.046) (-999.189) (-993.215) [-992.505] * (-998.482) (-996.317) (-994.304) [-993.101] -- 0:00:13
943000 -- [-994.955] (-992.733) (-998.657) (-997.462) * (-996.719) (-991.557) (-990.667) [-991.117] -- 0:00:12
943500 -- (-1005.308) (-996.935) (-993.540) [-988.800] * (-995.279) [-993.407] (-993.621) (-1000.345) -- 0:00:12
944000 -- (-1000.614) (-996.188) [-994.242] (-998.283) * (-994.945) [-993.423] (-995.245) (-998.244) -- 0:00:12
944500 -- (-1000.881) (-990.973) [-990.318] (-991.385) * (-995.421) (-989.638) (-999.058) [-997.194] -- 0:00:12
945000 -- (-1007.578) (-994.765) (-993.195) [-992.534] * [-992.943] (-999.134) (-989.777) (-997.789) -- 0:00:12
Average standard deviation of split frequencies: 0.004086
945500 -- (-992.759) (-1000.491) (-991.777) [-985.279] * (-995.206) [-1004.021] (-1003.220) (-992.352) -- 0:00:12
946000 -- (-1001.531) (-1000.860) (-995.639) [-992.009] * (-999.218) [-992.211] (-999.110) (-994.983) -- 0:00:12
946500 -- (-1004.879) [-990.034] (-999.289) (-998.354) * (-990.967) (-989.299) [-989.322] (-1005.587) -- 0:00:12
947000 -- [-990.098] (-997.708) (-1000.626) (-991.250) * [-989.805] (-992.300) (-998.281) (-993.122) -- 0:00:12
947500 -- (-995.278) (-991.345) (-998.683) [-990.171] * (-993.650) [-987.496] (-1005.712) (-997.835) -- 0:00:11
948000 -- [-995.277] (-993.426) (-1002.144) (-1003.226) * (-1001.799) (-987.507) [-990.180] (-993.692) -- 0:00:11
948500 -- (-1000.811) [-991.166] (-994.048) (-1001.009) * [-998.189] (-990.428) (-995.432) (-998.591) -- 0:00:11
949000 -- (-992.779) (-996.332) [-996.226] (-999.357) * (-994.715) (-996.923) (-999.353) [-988.932] -- 0:00:11
949500 -- [-994.037] (-1001.410) (-997.360) (-991.913) * [-998.193] (-1000.499) (-1000.015) (-994.151) -- 0:00:11
950000 -- (-1003.592) [-1000.026] (-1000.075) (-993.244) * (-995.265) (-995.275) (-991.309) [-994.787] -- 0:00:11
Average standard deviation of split frequencies: 0.003669
950500 -- (-997.355) (-997.889) (-996.119) [-987.844] * [-990.860] (-988.288) (-995.936) (-1001.388) -- 0:00:11
951000 -- [-987.972] (-994.695) (-991.358) (-992.370) * (-992.452) [-998.135] (-989.653) (-989.857) -- 0:00:11
951500 -- (-1002.422) (-994.421) (-989.497) [-992.613] * (-992.639) [-994.348] (-993.222) (-998.225) -- 0:00:11
952000 -- (-991.865) (-995.370) [-994.744] (-996.081) * [-992.372] (-997.421) (-997.385) (-990.423) -- 0:00:10
952500 -- (-995.284) (-998.696) (-1000.009) [-994.401] * (-992.251) (-993.915) [-993.261] (-993.963) -- 0:00:10
953000 -- [-992.167] (-997.099) (-997.720) (-1007.920) * [-997.347] (-994.069) (-993.061) (-989.678) -- 0:00:10
953500 -- (-992.667) [-994.031] (-1002.686) (-993.242) * (-991.628) (-995.751) (-994.191) [-995.298] -- 0:00:10
954000 -- (-997.489) [-995.249] (-995.442) (-994.006) * (-991.110) [-989.844] (-1000.553) (-996.216) -- 0:00:10
954500 -- (-990.857) [-994.117] (-991.233) (-991.924) * (-1005.159) (-1000.437) (-992.729) [-993.231] -- 0:00:10
955000 -- [-992.153] (-994.692) (-995.131) (-996.830) * (-1003.361) (-996.697) (-988.402) [-994.953] -- 0:00:10
Average standard deviation of split frequencies: 0.004438
955500 -- (-993.355) (-992.210) [-991.195] (-990.571) * (-999.117) (-994.696) (-993.845) [-988.283] -- 0:00:10
956000 -- [-1001.585] (-997.520) (-998.877) (-996.931) * (-997.634) (-999.982) (-1003.277) [-995.473] -- 0:00:10
956500 -- (-999.276) [-998.294] (-996.392) (-1005.342) * (-996.159) (-990.394) (-1006.166) [-988.021] -- 0:00:09
957000 -- (-990.802) [-995.356] (-997.889) (-997.102) * (-995.236) (-994.460) [-997.028] (-994.282) -- 0:00:09
957500 -- [-999.788] (-991.085) (-991.722) (-1001.589) * (-992.279) (-993.364) (-1001.425) [-995.495] -- 0:00:09
958000 -- [-993.792] (-993.593) (-989.501) (-997.263) * (-993.002) (-997.634) [-993.788] (-998.549) -- 0:00:09
958500 -- [-996.416] (-995.418) (-997.721) (-1000.559) * [-993.989] (-989.483) (-994.652) (-993.765) -- 0:00:09
959000 -- [-994.336] (-994.637) (-993.707) (-996.285) * (-1000.121) (-1003.647) (-991.514) [-989.803] -- 0:00:09
959500 -- (-997.042) (-995.226) [-991.393] (-988.172) * (-1000.100) [-992.905] (-997.385) (-1002.349) -- 0:00:09
960000 -- (-999.843) [-992.594] (-994.379) (-996.450) * [-988.330] (-1000.095) (-992.926) (-997.646) -- 0:00:09
Average standard deviation of split frequencies: 0.004416
960500 -- (-999.178) [-990.296] (-997.203) (-986.668) * (-996.007) [-988.919] (-1002.852) (-993.173) -- 0:00:09
961000 -- [-990.575] (-992.007) (-994.214) (-992.505) * [-999.397] (-988.101) (-1000.091) (-998.519) -- 0:00:08
961500 -- (-991.327) [-992.758] (-994.996) (-998.101) * (-994.460) (-998.810) (-999.316) [-987.587] -- 0:00:08
962000 -- [-992.899] (-991.835) (-998.285) (-1001.126) * (-1002.472) (-995.068) [-995.607] (-1000.127) -- 0:00:08
962500 -- (-992.263) (-993.298) (-997.253) [-995.230] * [-995.373] (-991.909) (-989.602) (-992.978) -- 0:00:08
963000 -- (-991.838) (-993.732) [-990.555] (-995.634) * [-990.120] (-1000.176) (-996.156) (-991.841) -- 0:00:08
963500 -- (-994.494) [-992.020] (-994.528) (-995.152) * [-994.248] (-997.280) (-1002.424) (-996.509) -- 0:00:08
964000 -- (-997.438) [-992.642] (-993.683) (-995.195) * (-994.985) (-992.601) (-1006.063) [-994.925] -- 0:00:08
964500 -- (-998.158) (-996.985) [-989.199] (-994.241) * (-996.599) (-992.667) [-995.651] (-989.821) -- 0:00:08
965000 -- [-994.586] (-1002.286) (-994.604) (-996.746) * [-989.579] (-1001.255) (-999.702) (-1007.129) -- 0:00:07
Average standard deviation of split frequencies: 0.004685
965500 -- (-991.682) (-997.449) [-992.037] (-1002.539) * (-992.283) [-991.772] (-1000.265) (-995.434) -- 0:00:07
966000 -- (-993.717) [-993.163] (-1001.553) (-996.034) * [-987.747] (-999.098) (-993.563) (-1002.082) -- 0:00:07
966500 -- (-999.981) (-993.906) [-990.336] (-989.694) * (-990.905) [-992.151] (-1001.599) (-997.001) -- 0:00:07
967000 -- [-994.647] (-994.554) (-998.326) (-999.135) * (-996.261) [-992.237] (-994.228) (-996.163) -- 0:00:07
967500 -- (-992.884) (-998.558) (-999.409) [-991.484] * (-996.553) (-996.236) [-990.089] (-1001.182) -- 0:00:07
968000 -- (-999.819) (-1002.317) (-992.482) [-987.784] * [-996.400] (-996.471) (-1012.235) (-995.745) -- 0:00:07
968500 -- (-996.539) [-994.832] (-997.145) (-988.845) * (-1002.692) [-992.557] (-1000.572) (-995.866) -- 0:00:07
969000 -- [-993.783] (-997.571) (-999.924) (-994.884) * (-998.218) [-995.305] (-990.252) (-992.573) -- 0:00:07
969500 -- (-991.948) (-993.262) (-992.639) [-992.381] * [-998.027] (-989.679) (-1003.271) (-992.039) -- 0:00:06
970000 -- (-992.899) [-1001.533] (-997.579) (-991.686) * (-997.916) (-991.257) (-989.445) [-989.232] -- 0:00:06
Average standard deviation of split frequencies: 0.004759
970500 -- (-997.249) (-994.874) [-998.055] (-990.043) * (-994.242) [-991.621] (-996.425) (-994.599) -- 0:00:06
971000 -- (-1002.528) (-998.879) (-995.229) [-995.366] * (-993.444) [-991.360] (-990.483) (-1010.769) -- 0:00:06
971500 -- [-991.569] (-992.655) (-994.629) (-999.036) * (-997.880) [-995.027] (-995.484) (-992.872) -- 0:00:06
972000 -- (-992.819) [-988.416] (-990.714) (-994.572) * (-991.222) (-999.250) (-991.577) [-989.819] -- 0:00:06
972500 -- [-987.756] (-990.635) (-999.052) (-991.582) * (-994.741) [-989.731] (-1002.949) (-994.894) -- 0:00:06
973000 -- (-996.607) (-997.502) (-1000.696) [-989.303] * (-997.470) [-989.307] (-996.713) (-998.978) -- 0:00:06
973500 -- (-1001.033) (-1000.544) (-991.174) [-989.587] * (-993.725) [-993.153] (-992.658) (-1000.412) -- 0:00:06
974000 -- [-991.774] (-1008.585) (-989.726) (-992.816) * (-997.846) (-992.788) [-993.638] (-999.776) -- 0:00:05
974500 -- (-1001.540) [-995.079] (-995.230) (-995.285) * [-998.240] (-994.367) (-991.837) (-998.142) -- 0:00:05
975000 -- (-1004.563) (-994.875) [-992.316] (-991.291) * (-993.467) (-992.740) [-993.607] (-1000.750) -- 0:00:05
Average standard deviation of split frequencies: 0.004540
975500 -- (-994.813) (-997.551) (-995.667) [-990.138] * (-1000.700) [-992.858] (-999.986) (-1003.176) -- 0:00:05
976000 -- (-996.168) (-996.668) (-989.947) [-995.039] * (-1000.044) (-990.933) [-993.847] (-989.731) -- 0:00:05
976500 -- (-1000.417) [-996.056] (-998.668) (-999.990) * (-997.833) (-992.047) [-992.544] (-992.939) -- 0:00:05
977000 -- (-1000.212) (-996.723) [-1003.100] (-1002.811) * (-999.098) (-1006.860) [-990.698] (-995.761) -- 0:00:05
977500 -- (-992.261) [-994.951] (-996.745) (-1000.054) * (-1001.915) (-994.133) [-991.778] (-995.188) -- 0:00:05
978000 -- [-992.280] (-989.492) (-988.571) (-1009.227) * [-1013.234] (-990.443) (-995.666) (-992.345) -- 0:00:05
978500 -- (-995.565) [-1000.802] (-998.603) (-991.809) * (-990.008) [-998.766] (-996.180) (-998.103) -- 0:00:04
979000 -- (-996.460) (-989.143) [-993.455] (-996.561) * (-989.766) (-1001.475) [-993.856] (-992.453) -- 0:00:04
979500 -- (-992.038) (-996.670) (-990.394) [-990.715] * (-993.618) [-994.266] (-996.992) (-996.000) -- 0:00:04
980000 -- (-995.109) (-996.574) (-994.918) [-994.684] * (-989.647) (-993.244) (-996.443) [-991.374] -- 0:00:04
Average standard deviation of split frequencies: 0.004903
980500 -- (-999.656) [-994.687] (-997.516) (-992.613) * [-989.329] (-995.143) (-992.158) (-996.648) -- 0:00:04
981000 -- (-999.159) (-994.843) [-988.683] (-994.986) * (-991.529) (-994.718) [-1003.510] (-991.597) -- 0:00:04
981500 -- (-1002.308) (-994.427) [-989.815] (-1000.811) * [-989.608] (-992.798) (-994.519) (-991.675) -- 0:00:04
982000 -- (-1004.246) (-992.405) (-1002.089) [-994.879] * (-991.663) (-995.850) [-989.823] (-992.752) -- 0:00:04
982500 -- (-1001.398) (-988.278) (-996.218) [-996.080] * (-995.897) (-997.529) (-992.102) [-989.888] -- 0:00:03
983000 -- (-996.866) (-996.002) [-994.922] (-1000.213) * (-994.960) (-1002.583) (-989.826) [-995.722] -- 0:00:03
983500 -- [-994.630] (-996.266) (-992.773) (-994.520) * (-996.577) (-1007.628) [-990.725] (-992.692) -- 0:00:03
984000 -- (-994.715) [-994.346] (-1001.779) (-993.195) * (-996.534) (-1000.933) (-990.190) [-994.641] -- 0:00:03
984500 -- [-994.909] (-996.909) (-1002.033) (-997.203) * (-994.957) (-998.519) [-992.428] (-989.552) -- 0:00:03
985000 -- (-1004.394) [-989.429] (-989.428) (-1002.747) * (-991.031) (-992.562) [-993.146] (-996.577) -- 0:00:03
Average standard deviation of split frequencies: 0.005163
985500 -- (-1003.843) (-996.061) [-988.927] (-992.960) * (-997.077) (-991.905) [-996.217] (-994.458) -- 0:00:03
986000 -- (-1011.054) [-996.365] (-995.387) (-998.556) * (-988.734) [-995.752] (-993.861) (-1000.072) -- 0:00:03
986500 -- (-992.113) [-988.639] (-994.330) (-993.488) * (-993.936) (-999.680) [-998.181] (-997.391) -- 0:00:03
987000 -- (-995.834) [-990.518] (-997.542) (-1001.525) * (-988.546) (-992.317) (-997.916) [-999.835] -- 0:00:02
987500 -- (-996.148) [-993.990] (-1002.799) (-987.389) * [-989.611] (-996.534) (-1003.786) (-999.484) -- 0:00:02
988000 -- (-1003.861) [-989.859] (-996.419) (-1002.511) * (-990.890) [-994.866] (-994.323) (-994.689) -- 0:00:02
988500 -- (-993.676) [-990.201] (-1000.811) (-996.128) * (-1004.140) (-992.262) (-994.776) [-991.010] -- 0:00:02
989000 -- (-996.261) (-996.515) [-993.880] (-999.132) * (-993.250) [-994.808] (-1000.082) (-993.687) -- 0:00:02
989500 -- [-988.177] (-1005.289) (-992.104) (-999.101) * (-999.321) (-998.453) [-997.456] (-997.322) -- 0:00:02
990000 -- (-1001.810) [-992.395] (-989.904) (-993.329) * (-996.280) (-994.516) (-998.256) [-1001.648] -- 0:00:02
Average standard deviation of split frequencies: 0.005329
990500 -- [-991.109] (-990.898) (-997.967) (-998.375) * (-994.435) [-1002.453] (-1004.687) (-992.878) -- 0:00:02
991000 -- (-996.081) [-987.056] (-992.588) (-999.662) * [-989.507] (-997.471) (-995.994) (-991.199) -- 0:00:02
991500 -- (-1003.306) [-993.529] (-995.207) (-989.964) * [-994.232] (-1000.371) (-994.284) (-990.543) -- 0:00:01
992000 -- [-991.139] (-995.651) (-997.859) (-994.290) * [-991.154] (-992.940) (-993.985) (-999.754) -- 0:00:01
992500 -- (-992.170) [-992.629] (-994.803) (-988.840) * (-992.136) (-996.517) [-994.173] (-994.361) -- 0:00:01
993000 -- (-993.704) (-991.443) (-992.680) [-995.922] * [-991.043] (-995.181) (-997.425) (-987.955) -- 0:00:01
993500 -- (-994.322) (-991.508) [-992.980] (-991.872) * (-992.657) (-994.447) [-993.425] (-990.565) -- 0:00:01
994000 -- (-992.636) [-994.897] (-996.579) (-999.265) * (-990.489) (-990.446) (-995.772) [-990.842] -- 0:00:01
994500 -- [-997.498] (-998.012) (-991.285) (-990.042) * (-994.713) (-998.329) (-1002.077) [-992.226] -- 0:00:01
995000 -- (-993.359) (-993.506) [-990.134] (-997.574) * (-993.629) (-997.281) [-990.523] (-994.491) -- 0:00:01
Average standard deviation of split frequencies: 0.004733
995500 -- (-1001.652) [-994.582] (-992.192) (-989.267) * (-996.116) (-999.978) (-1000.605) [-995.079] -- 0:00:01
996000 -- (-1001.005) (-996.659) [-989.951] (-989.151) * [-990.477] (-1003.266) (-994.335) (-1002.274) -- 0:00:00
996500 -- (-993.352) (-997.725) (-997.663) [-990.700] * (-997.074) [-988.962] (-993.702) (-995.593) -- 0:00:00
997000 -- (-998.631) (-1008.091) [-996.414] (-991.834) * (-993.800) [-988.159] (-991.902) (-991.647) -- 0:00:00
997500 -- (-999.094) [-994.364] (-993.062) (-991.927) * (-993.633) (-992.507) [-988.023] (-1004.506) -- 0:00:00
998000 -- (-992.343) (-993.684) [-992.153] (-1003.993) * (-997.663) (-991.328) [-996.293] (-995.956) -- 0:00:00
998500 -- (-995.200) (-988.355) (-999.335) [-990.473] * (-997.649) [-1000.354] (-997.396) (-999.380) -- 0:00:00
999000 -- [-996.136] (-990.695) (-994.226) (-997.174) * (-995.311) (-997.317) (-995.979) [-992.940] -- 0:00:00
999500 -- (-997.716) (-1002.080) (-996.354) [-992.025] * (-1003.023) [-991.033] (-991.108) (-998.062) -- 0:00:00
1000000 -- [-988.372] (-989.891) (-1000.002) (-991.658) * (-995.394) (-995.832) [-992.686] (-1002.764) -- 0:00:00
Average standard deviation of split frequencies: 0.005276
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -988.372274 -- 17.514917
Chain 1 -- -988.372270 -- 17.514917
Chain 2 -- -989.891002 -- 17.749440
Chain 2 -- -989.890996 -- 17.749440
Chain 3 -- -1000.001539 -- 16.794527
Chain 3 -- -1000.001539 -- 16.794527
Chain 4 -- -991.657875 -- 18.866421
Chain 4 -- -991.657872 -- 18.866421
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -995.394492 -- 17.916102
Chain 1 -- -995.394492 -- 17.916102
Chain 2 -- -995.831762 -- 20.237530
Chain 2 -- -995.831760 -- 20.237530
Chain 3 -- -992.685900 -- 20.506721
Chain 3 -- -992.685898 -- 20.506721
Chain 4 -- -1002.763780 -- 18.339547
Chain 4 -- -1002.763782 -- 18.339547
Analysis completed in 3 mins 48 seconds
Analysis used 228.09 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -983.98
Likelihood of best state for "cold" chain of run 2 was -984.05
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
55.2 % ( 50 %) Dirichlet(Revmat{all})
71.9 % ( 53 %) Slider(Revmat{all})
32.7 % ( 27 %) Dirichlet(Pi{all})
33.7 % ( 30 %) Slider(Pi{all})
59.2 % ( 28 %) Multiplier(Alpha{1,2})
50.9 % ( 31 %) Multiplier(Alpha{3})
76.2 % ( 56 %) Slider(Pinvar{all})
12.5 % ( 7 %) ExtSPR(Tau{all},V{all})
8.0 % ( 4 %) ExtTBR(Tau{all},V{all})
10.1 % ( 9 %) NNI(Tau{all},V{all})
12.9 % ( 10 %) ParsSPR(Tau{all},V{all})
26.7 % ( 29 %) Multiplier(V{all})
32.2 % ( 26 %) Nodeslider(V{all})
26.0 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
56.4 % ( 57 %) Dirichlet(Revmat{all})
71.1 % ( 64 %) Slider(Revmat{all})
32.0 % ( 30 %) Dirichlet(Pi{all})
33.1 % ( 23 %) Slider(Pi{all})
59.8 % ( 28 %) Multiplier(Alpha{1,2})
50.5 % ( 27 %) Multiplier(Alpha{3})
75.7 % ( 50 %) Slider(Pinvar{all})
12.2 % ( 12 %) ExtSPR(Tau{all},V{all})
8.2 % ( 7 %) ExtTBR(Tau{all},V{all})
10.1 % ( 9 %) NNI(Tau{all},V{all})
13.0 % ( 19 %) ParsSPR(Tau{all},V{all})
26.6 % ( 27 %) Multiplier(V{all})
32.2 % ( 38 %) Nodeslider(V{all})
25.6 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.48
2 | 166480 0.82 0.65
3 | 166860 166688 0.83
4 | 166288 166815 166869
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.48
2 | 166406 0.81 0.65
3 | 166718 166824 0.83
4 | 166491 167065 166496
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -991.94
| 1 2 2 21 1 |
| 1 1 2 2 2 2 2 1|
| 2 1 2 1 1 1 1 |
| 21 1 21 2 1 2 1 1 2 1 1 2 |
| 211 11 2 1 1 21 2 1 221 2 |
|2 2 2 11 2 2* 2 2 1 1 2|
| 21 2 1 2 1 1 1121 * 2 22 1 |
| 2 22 2 1 1 12 21 2 1 1 |
| 11 2 1 1 1 1 1 |
|11 2 2 2 2 2 |
| 2 1 2 2 2 |
| 2 |
| 2 1 1 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -995.68
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -989.69 -1000.18
2 -989.69 -1005.95
--------------------------------------
TOTAL -989.69 -1005.26
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.502640 0.006819 0.350610 0.662763 0.495768 973.99 1177.79 1.000
r(A<->C){all} 0.085149 0.001040 0.025399 0.144695 0.082751 689.28 725.95 1.000
r(A<->G){all} 0.213591 0.002693 0.118886 0.317510 0.209635 513.55 567.93 1.000
r(A<->T){all} 0.124657 0.002129 0.046321 0.221326 0.120679 583.33 631.22 1.001
r(C<->G){all} 0.047780 0.000457 0.012457 0.092048 0.044890 720.65 803.32 1.000
r(C<->T){all} 0.504052 0.005507 0.356224 0.640697 0.504914 505.67 507.53 1.000
r(G<->T){all} 0.024770 0.000375 0.000013 0.063040 0.020486 639.27 740.12 1.001
pi(A){all} 0.276425 0.000482 0.237161 0.322955 0.275207 1202.09 1208.53 1.000
pi(C){all} 0.245294 0.000436 0.203830 0.284975 0.245152 1068.52 1113.89 1.000
pi(G){all} 0.290386 0.000478 0.248135 0.333666 0.290106 1070.03 1198.75 1.000
pi(T){all} 0.187895 0.000373 0.152645 0.227427 0.187187 956.08 1032.48 1.000
alpha{1,2} 0.111209 0.005437 0.000352 0.238301 0.103786 912.97 1000.81 1.003
alpha{3} 1.632596 0.477607 0.627431 3.068261 1.490353 1181.74 1341.37 1.000
pinvar{all} 0.157514 0.011390 0.000023 0.355689 0.142369 1025.40 1028.99 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
Key to taxon bipartitions (saved to file "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-------------
1 -- .******
2 -- .*.....
3 -- ..*....
4 -- ...*...
5 -- ....*..
6 -- .....*.
7 -- ......*
8 -- ..*****
9 -- .....**
10 -- ....***
11 -- ...****
12 -- ..*.***
-------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
8 3002 1.000000 0.000000 1.000000 1.000000 2
9 3002 1.000000 0.000000 1.000000 1.000000 2
10 3002 1.000000 0.000000 1.000000 1.000000 2
11 1976 0.658228 0.015075 0.647568 0.668887 2
12 810 0.269820 0.011306 0.261825 0.277815 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.039677 0.000220 0.014452 0.070068 0.037664 1.000 2
length{all}[2] 0.030317 0.000162 0.008835 0.055500 0.028300 1.001 2
length{all}[3] 0.037330 0.000234 0.011893 0.067566 0.034832 1.000 2
length{all}[4] 0.050045 0.000347 0.017448 0.087341 0.047832 1.003 2
length{all}[5] 0.094647 0.000943 0.039813 0.155790 0.090918 1.000 2
length{all}[6] 0.003337 0.000011 0.000002 0.009982 0.002334 1.000 2
length{all}[7] 0.003489 0.000013 0.000000 0.010321 0.002366 1.000 2
length{all}[8] 0.035649 0.000240 0.010920 0.067616 0.033256 1.000 2
length{all}[9] 0.075329 0.000784 0.025404 0.129130 0.071865 1.000 2
length{all}[10] 0.118330 0.001436 0.055905 0.196496 0.113459 1.000 2
length{all}[11] 0.016596 0.000149 0.000064 0.040872 0.013669 1.000 2
length{all}[12] 0.011777 0.000087 0.000029 0.030386 0.009356 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005276
Maximum standard deviation of split frequencies = 0.015075
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
| /---------------------------------------------------------- C3 (3)
| |
\-----100-----+ /------------------------------------------- C4 (4)
| |
\------66------+ /----------------------------- C5 (5)
| |
\-----100-----+ /-------------- C6 (6)
\------100-----+
\-------------- C7 (7)
Phylogram (based on average branch lengths):
/----------- C1 (1)
|
|-------- C2 (2)
+
| /---------- C3 (3)
| |
\---------+ /-------------- C4 (4)
| |
\--+ /-------------------------- C5 (5)
| |
\--------------------------------+ / C6 (6)
\--------------------+
\ C7 (7)
|-------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
90 % credible set contains 2 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 7 ls = 366
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Sequences read..
Counting site patterns.. 0:00
91 patterns at 122 / 122 sites (100.0%), 0:00
Counting codons..
168 bytes for distance
88816 bytes for conP
12376 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, (3, (4, (5, (6, 7))))); MP score: 88
222040 bytes for conP, adjusted
0.079489 0.055373 0.101637 0.041531 0.026199 0.064485 0.239566 0.176649 0.117664 0.000000 0.000001 0.300000 1.300000
ntime & nrate & np: 11 2 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 13
lnL0 = -1090.024844
Iterating by ming2
Initial: fx= 1090.024844
x= 0.07949 0.05537 0.10164 0.04153 0.02620 0.06448 0.23957 0.17665 0.11766 0.00000 0.00000 0.30000 1.30000
1 h-m-p 0.0000 0.0000 262.4963 ++ 1090.024385 m 0.0000 18 | 2/13
2 h-m-p 0.0000 0.0005 453.8836 +++ 1080.766293 m 0.0005 35 | 2/13
3 h-m-p 0.0000 0.0000 2060.4007 CCCC 1079.496368 3 0.0000 57 | 2/13
4 h-m-p 0.0001 0.0063 240.4969 +++YYYYYYYCYC 1040.069674 10 0.0061 87 | 2/13
5 h-m-p 0.0000 0.0000 3529.7385 CCCCC 1039.109405 4 0.0000 111 | 2/13
6 h-m-p 0.0002 0.0219 75.3603 +YYCCC 1037.005503 4 0.0012 134 | 2/13
7 h-m-p 0.0004 0.0020 56.3932 C 1036.601109 0 0.0004 150 | 2/13
8 h-m-p 0.0010 0.0084 23.8693 +YYYC 1035.650566 3 0.0036 170 | 2/13
9 h-m-p 0.0065 0.0326 12.1888 CCCCC 1035.059286 4 0.0069 194 | 2/13
10 h-m-p 0.0042 0.0208 9.1292 YYC 1034.835182 2 0.0037 212 | 2/13
11 h-m-p 0.0016 0.0157 20.5164 CYC 1034.569335 2 0.0018 231 | 2/13
12 h-m-p 0.0122 0.3388 3.0521 ++CYYYYYYYYY 975.482416 9 0.3050 260 | 2/13
13 h-m-p 0.1780 0.8900 0.1838 YCYCCC 970.170209 5 0.4762 284 | 2/13
14 h-m-p 0.0178 0.0891 1.5352 +YCYCCC 965.471096 5 0.0497 320 | 2/13
15 h-m-p 0.2077 1.0387 0.2673 YCYC 960.424987 3 0.3441 340 | 2/13
16 h-m-p 0.4709 2.3544 0.1372 YCCC 956.029374 3 0.8000 372 | 2/13
17 h-m-p 0.7255 3.6276 0.0844 CYCC 954.228018 3 0.8984 404 | 2/13
18 h-m-p 0.3316 1.6582 0.0921 YCCCCC 952.115307 5 0.7554 440 | 2/13
19 h-m-p 1.3927 6.9633 0.0413 CCCC 951.056781 3 1.1624 473 | 2/13
20 h-m-p 1.6000 8.0000 0.0171 CYCC 950.707072 3 2.1308 505 | 2/13
21 h-m-p 1.6000 8.0000 0.0111 CCC 950.580537 2 1.9533 536 | 2/13
22 h-m-p 1.6000 8.0000 0.0082 CCC 950.514035 2 1.8368 567 | 2/13
23 h-m-p 1.6000 8.0000 0.0045 CC 950.499537 1 1.5348 596 | 2/13
24 h-m-p 1.6000 8.0000 0.0015 C 950.499344 0 0.4055 623 | 2/13
25 h-m-p 1.6000 8.0000 0.0001 -----------Y 950.499344 0 0.0000 661
Out..
lnL = -950.499344
662 lfun, 662 eigenQcodon, 7282 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, 2, (3, (4, (5, (6, 7))))); MP score: 88
0.079490 0.055373 0.101637 0.041531 0.026198 0.064484 0.239567 0.176650 0.117664 0.000001 0.000000 0.821927 0.534390 0.193110
ntime & nrate & np: 11 2 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.405194
np = 14
lnL0 = -996.950039
Iterating by ming2
Initial: fx= 996.950039
x= 0.07949 0.05537 0.10164 0.04153 0.02620 0.06448 0.23957 0.17665 0.11766 0.00000 0.00000 0.82193 0.53439 0.19311
1 h-m-p 0.0000 0.0000 222.5336 ++ 996.949644 m 0.0000 19 | 2/14
2 h-m-p 0.0000 0.0014 243.9244 ++++ 974.041467 m 0.0014 38 | 2/14
3 h-m-p 0.0005 0.0024 132.5056 +YYYCCC 955.810857 5 0.0019 63 | 2/14
4 h-m-p 0.0001 0.0005 135.3363 YCCCC 954.700842 4 0.0003 87 | 2/14
5 h-m-p 0.0001 0.0005 28.3788 ++ 954.466576 m 0.0005 104 | 3/14
6 h-m-p 0.0011 0.0125 10.6217 YCCC 954.248341 3 0.0022 126 | 3/14
7 h-m-p 0.0041 0.0276 5.6768 YCCCC 953.549989 4 0.0077 150 | 3/14
8 h-m-p 0.0020 0.0100 15.6052 CYCC 953.141801 3 0.0019 172 | 3/14
9 h-m-p 0.0055 0.0616 5.4865 +YYCCC 951.321691 4 0.0193 196 | 2/14
10 h-m-p 0.0007 0.0037 77.6791 YCCCC 950.819992 4 0.0004 220 | 2/14
11 h-m-p 0.0017 0.0092 17.7729 +YYYYC 946.910078 4 0.0067 242 | 2/14
12 h-m-p 0.0027 0.0135 17.3028 YCC 946.643612 2 0.0018 262 | 2/14
13 h-m-p 0.0053 0.0354 5.9167 YCC 946.586100 2 0.0030 282 | 2/14
14 h-m-p 0.0083 0.1061 2.1476 CCC 946.571791 2 0.0027 303 | 2/14
15 h-m-p 0.0175 0.9125 0.3344 ++YYC 945.062677 2 0.2119 324 | 2/14
16 h-m-p 1.2988 8.0000 0.0546 CCCC 943.826641 3 1.2364 359 | 2/14
17 h-m-p 1.1727 8.0000 0.0575 CCCC 942.660122 3 1.8936 394 | 2/14
18 h-m-p 1.6000 8.0000 0.0552 CCCC 941.245780 3 2.1554 429 | 2/14
19 h-m-p 0.8989 4.4945 0.0898 +YCCC 939.128291 3 2.8943 464 | 2/14
20 h-m-p 0.2916 1.4580 0.1673 ++ 936.231844 m 1.4580 493 | 2/14
21 h-m-p -0.0000 -0.0000 0.2676
h-m-p: -4.79805469e-17 -2.39902735e-16 2.67578166e-01 936.231844
.. | 2/14
22 h-m-p 0.0000 0.0015 64.7004 ++YCCCC 935.429124 4 0.0004 557 | 2/14
23 h-m-p 0.0004 0.0020 57.9440 CYCCC 934.600420 4 0.0007 581 | 2/14
24 h-m-p 0.0003 0.0015 25.3965 CYCCC 934.468488 4 0.0005 605 | 2/14
25 h-m-p 0.0005 0.0025 12.7892 +YC 934.381851 1 0.0014 624 | 2/14
26 h-m-p 0.0006 0.0132 28.4325 CCC 934.284661 2 0.0009 645 | 2/14
27 h-m-p 0.0011 0.0053 19.0338 YCC 934.182713 2 0.0017 665 | 2/14
28 h-m-p 0.0010 0.0571 31.3828 +YCCC 933.478570 3 0.0078 688 | 2/14
29 h-m-p 0.0038 0.0221 65.0280 CCCC 932.732194 3 0.0041 711 | 2/14
30 h-m-p 0.0012 0.0061 93.0887 CCCC 932.333939 3 0.0016 734 | 2/14
31 h-m-p 0.0005 0.0026 16.8740 +YC 932.268899 1 0.0017 753 | 2/14
32 h-m-p 0.0035 0.0176 4.8978 YC 932.256487 1 0.0017 771 | 2/14
33 h-m-p 0.0054 0.1861 1.5879 CC 932.254632 1 0.0018 790 | 2/14
34 h-m-p 0.0211 8.0000 0.1329 +++CCC 932.126759 2 1.7133 814 | 2/14
35 h-m-p 1.6000 8.0000 0.0256 YC 932.121642 1 0.8387 844 | 2/14
36 h-m-p 1.6000 8.0000 0.0057 YC 932.121416 1 1.0080 874 | 2/14
37 h-m-p 1.6000 8.0000 0.0012 Y 932.121409 0 1.0655 903 | 2/14
38 h-m-p 1.6000 8.0000 0.0000 Y 932.121409 0 1.0470 932 | 2/14
39 h-m-p 1.6000 8.0000 0.0000 Y 932.121409 0 1.1848 961 | 2/14
40 h-m-p 1.6000 8.0000 0.0000 C 932.121409 0 0.4418 990 | 2/14
41 h-m-p 0.4302 8.0000 0.0000 -C 932.121409 0 0.0269 1020
Out..
lnL = -932.121409
1021 lfun, 3063 eigenQcodon, 22462 P(t)
Time used: 0:09
Model 2: PositiveSelection
TREE # 1
(1, 2, (3, (4, (5, (6, 7))))); MP score: 88
initial w for M2:NSpselection reset.
0.079489 0.055374 0.101636 0.041531 0.026200 0.064483 0.239563 0.176647 0.117664 0.000000 0.000001 2.514520 1.131355 0.291249 0.418683 2.981222
ntime & nrate & np: 11 3 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.678592
np = 16
lnL0 = -993.275925
Iterating by ming2
Initial: fx= 993.275925
x= 0.07949 0.05537 0.10164 0.04153 0.02620 0.06448 0.23956 0.17665 0.11766 0.00000 0.00000 2.51452 1.13136 0.29125 0.41868 2.98122
1 h-m-p 0.0000 0.0000 198.4872 ++ 993.275590 m 0.0000 21 | 2/16
2 h-m-p 0.0000 0.0027 84.7158 +++YCCCCC 989.238364 5 0.0014 52 | 2/16
3 h-m-p 0.0005 0.0027 148.2131 +YCYCCC 973.947294 5 0.0025 80 | 2/16
4 h-m-p 0.0000 0.0001 306.5173 ++ 972.976698 m 0.0001 99 | 2/16
5 h-m-p 0.0017 0.0109 23.6057 +YYCC 971.372999 3 0.0061 123 | 2/16
6 h-m-p 0.0004 0.0019 335.9885 YCCCCC 968.871780 5 0.0007 151 | 2/16
7 h-m-p 0.0004 0.0022 300.9596 CCCC 966.731545 3 0.0007 176 | 2/16
8 h-m-p 0.0013 0.0064 111.7138 YCCCC 963.448548 4 0.0031 202 | 2/16
9 h-m-p 0.0010 0.0049 54.0485 CYCCC 962.735340 4 0.0015 228 | 2/16
10 h-m-p 0.0015 0.0172 57.0751 +CYCCCC 959.070415 5 0.0077 257 | 2/16
11 h-m-p 0.0315 0.1577 7.3992 YCYCCC 954.776005 5 0.0794 284 | 2/16
12 h-m-p 0.0060 0.0301 62.0061 +YCCCC 947.236109 4 0.0191 311 | 2/16
13 h-m-p 0.1832 0.9161 3.2937 CYCC 943.099031 3 0.1959 335 | 2/16
14 h-m-p 0.2109 1.0543 1.2619 YCYCCC 937.490054 5 0.5707 362 | 2/16
15 h-m-p 0.2944 1.5989 2.4462 CCCCC 933.941239 4 0.4638 389 | 2/16
16 h-m-p 0.4820 2.4099 0.4623 YCCCC 932.248649 4 0.9670 415 | 2/16
17 h-m-p 0.1818 0.9091 0.6303 +YCC 931.602883 2 0.6075 452 | 2/16
18 h-m-p 1.0676 8.0000 0.3587 YCCC 931.261474 3 0.7633 490 | 2/16
19 h-m-p 0.2222 1.1108 0.2959 ++ 931.059268 m 1.1108 523 | 2/16
20 h-m-p 1.3403 8.0000 0.2452 CCC 930.938006 2 1.5440 560 | 2/16
21 h-m-p 1.6000 8.0000 0.2311 CC 930.852162 1 1.4653 595 | 2/16
22 h-m-p 1.3401 8.0000 0.2526 CYC 930.795290 2 1.4064 631 | 2/16
23 h-m-p 1.6000 8.0000 0.1512 YCCC 930.733023 3 3.0288 669 | 2/16
24 h-m-p 1.6000 8.0000 0.1122 YCCC 930.674506 3 3.1344 707 | 2/16
25 h-m-p 1.0890 5.4448 0.2412 YC 930.636842 1 1.7344 741 | 2/16
26 h-m-p 1.6000 8.0000 0.2412 CCC 930.613548 2 2.2098 778 | 2/16
27 h-m-p 1.6000 8.0000 0.2277 CC 930.599584 1 2.0222 813 | 2/16
28 h-m-p 1.6000 8.0000 0.0980 CC 930.588905 1 2.4935 848 | 2/16
29 h-m-p 1.6000 8.0000 0.0831 C 930.583609 0 1.6000 881 | 2/16
30 h-m-p 1.6000 8.0000 0.0522 YC 930.580752 1 2.5911 915 | 2/16
31 h-m-p 1.6000 8.0000 0.0321 +YC 930.575411 1 4.7029 950 | 2/16
32 h-m-p 0.8250 8.0000 0.1830 +CC 930.572251 1 2.8032 986 | 2/16
33 h-m-p 1.6000 8.0000 0.0428 +YC 930.570372 1 5.1273 1021 | 2/16
34 h-m-p 1.6000 8.0000 0.1193 ++ 930.559493 m 8.0000 1054 | 2/16
35 h-m-p 1.6000 8.0000 0.4488 C 930.556945 0 1.6955 1087 | 2/16
36 h-m-p 1.6000 8.0000 0.3126 CC 930.555714 1 2.3025 1122 | 2/16
37 h-m-p 1.6000 8.0000 0.3430 CC 930.555148 1 2.4328 1157 | 2/16
38 h-m-p 1.6000 8.0000 0.3588 YC 930.554834 1 2.5191 1191 | 2/16
39 h-m-p 1.6000 8.0000 0.3652 C 930.554723 0 2.3685 1224 | 2/16
40 h-m-p 1.6000 8.0000 0.3165 Y 930.554675 0 2.6631 1257 | 2/16
41 h-m-p 1.6000 8.0000 0.3567 Y 930.554654 0 2.5681 1290 | 2/16
42 h-m-p 1.6000 8.0000 0.3387 C 930.554646 0 2.4818 1323 | 2/16
43 h-m-p 1.6000 8.0000 0.3494 Y 930.554642 0 2.6664 1356 | 2/16
44 h-m-p 1.6000 8.0000 0.3460 C 930.554640 0 2.4264 1389 | 2/16
45 h-m-p 1.6000 8.0000 0.3471 Y 930.554640 0 2.7041 1422 | 2/16
46 h-m-p 1.6000 8.0000 0.3494 C 930.554640 0 2.4206 1455 | 2/16
47 h-m-p 1.6000 8.0000 0.3510 Y 930.554640 0 2.7205 1488 | 2/16
48 h-m-p 1.6000 8.0000 0.3412 C 930.554639 0 2.3606 1521 | 2/16
49 h-m-p 1.6000 8.0000 0.3840 Y 930.554639 0 3.0602 1554 | 2/16
50 h-m-p 1.6000 8.0000 0.1753 C 930.554639 0 1.5717 1587 | 2/16
51 h-m-p 0.3477 8.0000 0.7926 Y 930.554639 0 0.7015 1620 | 2/16
52 h-m-p 1.6000 8.0000 0.0134 C 930.554639 0 1.5376 1653 | 2/16
53 h-m-p 0.0618 8.0000 0.3325 ++C 930.554639 0 1.3513 1688 | 2/16
54 h-m-p 1.6000 8.0000 0.0352 C 930.554639 0 1.6000 1721 | 2/16
55 h-m-p 0.6870 8.0000 0.0819 ++ 930.554639 m 8.0000 1754 | 2/16
56 h-m-p 0.0072 0.8741 91.0511 -------------.. | 2/16
57 h-m-p 0.0137 6.8455 0.0014 ------Y 930.554639 0 0.0000 1823 | 2/16
58 h-m-p 0.0160 8.0000 0.0010 --Y 930.554639 0 0.0004 1858 | 2/16
59 h-m-p 0.0160 8.0000 0.0004 --------Y 930.554639 0 0.0000 1899
Out..
lnL = -930.554639
1900 lfun, 7600 eigenQcodon, 62700 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -941.078768 S = -894.009868 -39.825095
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 91 patterns 0:29
did 20 / 91 patterns 0:29
did 30 / 91 patterns 0:29
did 40 / 91 patterns 0:29
did 50 / 91 patterns 0:29
did 60 / 91 patterns 0:29
did 70 / 91 patterns 0:29
did 80 / 91 patterns 0:29
did 90 / 91 patterns 0:29
did 91 / 91 patterns 0:29
Time used: 0:29
Model 3: discrete
TREE # 1
(1, 2, (3, (4, (5, (6, 7))))); MP score: 88
0.079490 0.055373 0.101637 0.041531 0.026198 0.064484 0.239567 0.176650 0.117664 0.000001 0.000000 2.537429 0.960589 0.897086 0.030876 0.079425 0.108166
ntime & nrate & np: 11 4 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 14.843070
np = 17
lnL0 = -942.655709
Iterating by ming2
Initial: fx= 942.655709
x= 0.07949 0.05537 0.10164 0.04153 0.02620 0.06448 0.23957 0.17665 0.11766 0.00000 0.00000 2.53743 0.96059 0.89709 0.03088 0.07943 0.10817
1 h-m-p 0.0000 0.0000 218.0707 ++ 942.655397 m 0.0000 22 | 2/17
2 h-m-p 0.0000 0.0007 141.2599 ++++ 938.683048 m 0.0007 44 | 2/17
3 h-m-p 0.0002 0.0012 55.3006 +YCCC 937.921090 3 0.0008 70 | 2/17
4 h-m-p 0.0001 0.0004 46.3112 ++ 937.557290 m 0.0004 90 | 2/17
5 h-m-p 0.0021 0.0602 8.7760 YCCC 937.519740 3 0.0011 115 | 2/17
6 h-m-p 0.0014 0.0358 6.6734 +CCCC 937.324333 3 0.0097 142 | 2/17
7 h-m-p 0.0004 0.0020 80.8145 YCCC 937.175911 3 0.0007 167 | 2/17
8 h-m-p 0.0027 0.0137 9.1271 CCC 937.159717 2 0.0010 191 | 2/17
9 h-m-p 0.0019 0.0503 4.6830 YC 937.141180 1 0.0030 212 | 2/17
10 h-m-p 0.0024 0.1157 5.9161 +CCC 937.038211 2 0.0154 237 | 2/17
11 h-m-p 0.0026 0.0216 35.0181 YCCC 936.866011 3 0.0047 262 | 2/17
12 h-m-p 0.0012 0.0062 99.5327 YC 936.546028 1 0.0029 283 | 2/17
13 h-m-p 0.0581 0.2906 1.1332 YCC 936.533894 2 0.0115 306 | 2/17
14 h-m-p 0.0037 1.8496 4.1574 +++CYC 935.317512 2 0.2739 332 | 2/17
15 h-m-p 0.1524 0.7618 0.1164 ++ 934.885378 m 0.7618 352 | 3/17
16 h-m-p 0.1519 1.6542 0.5709 +CCC 934.592394 2 0.8069 392 | 3/17
17 h-m-p 0.1750 0.8748 0.4563 +CC 934.349764 1 0.7230 429 | 2/17
18 h-m-p 0.0003 0.0015 48.0202 CCC 934.341164 2 0.0004 467 | 2/17
19 h-m-p 0.0211 0.3436 0.9098 +++ 934.119744 m 0.3436 488 | 3/17
20 h-m-p 0.1133 4.1003 2.7576 +YCCC 933.098144 3 0.9512 529 | 3/17
21 h-m-p 1.6000 8.0000 0.4852 CYC 932.845229 2 1.2469 552 | 3/17
22 h-m-p 1.3018 8.0000 0.4647 +CCC 931.744731 2 4.8449 591 | 3/17
23 h-m-p 0.9672 4.8358 1.1100 YCCC 931.228813 3 1.8325 630 | 3/17
24 h-m-p 1.6000 8.0000 0.9604 YCCCCC 930.927950 5 1.6892 659 | 3/17
25 h-m-p 0.8578 8.0000 1.8912 YCCC 930.693912 3 1.8842 698 | 3/17
26 h-m-p 1.6000 8.0000 1.5309 CCC 930.587576 2 1.7675 722 | 3/17
27 h-m-p 1.6000 8.0000 0.9971 CCC 930.562368 2 2.1262 746 | 3/17
28 h-m-p 1.6000 8.0000 0.7198 YCC 930.555968 2 1.2292 783 | 3/17
29 h-m-p 1.6000 8.0000 0.4620 YC 930.554730 1 1.1167 818 | 3/17
30 h-m-p 1.6000 8.0000 0.0971 C 930.554649 0 1.4449 852 | 3/17
31 h-m-p 1.6000 8.0000 0.0042 C 930.554640 0 1.7541 886 | 3/17
32 h-m-p 1.0330 8.0000 0.0072 C 930.554640 0 1.3618 920 | 3/17
33 h-m-p 1.6000 8.0000 0.0002 Y 930.554640 0 1.2469 954 | 3/17
34 h-m-p 1.6000 8.0000 0.0001 Y 930.554640 0 1.1918 988 | 3/17
35 h-m-p 1.6000 8.0000 0.0000 Y 930.554640 0 0.7919 1022 | 3/17
36 h-m-p 1.6000 8.0000 0.0000 C 930.554640 0 2.0163 1056 | 3/17
37 h-m-p 1.6000 8.0000 0.0000 ----------C 930.554640 0 0.0000 1100
Out..
lnL = -930.554640
1101 lfun, 4404 eigenQcodon, 36333 P(t)
Time used: 0:41
Model 7: beta
TREE # 1
(1, 2, (3, (4, (5, (6, 7))))); MP score: 88
0.079489 0.055373 0.101636 0.041530 0.026198 0.064484 0.239565 0.176649 0.117664 0.000001 0.000000 2.537426 0.496071 1.323761
ntime & nrate & np: 11 1 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 8.973094
np = 14
lnL0 = -949.876922
Iterating by ming2
Initial: fx= 949.876922
x= 0.07949 0.05537 0.10164 0.04153 0.02620 0.06448 0.23956 0.17665 0.11766 0.00000 0.00000 2.53743 0.49607 1.32376
1 h-m-p 0.0000 0.0000 203.3085 ++ 949.876619 m 0.0000 19 | 2/14
2 h-m-p 0.0000 0.0013 78.2984 ++++ 946.843972 m 0.0013 38 | 2/14
3 h-m-p 0.0003 0.0016 130.3924 CCCC 945.328087 3 0.0005 61 | 2/14
4 h-m-p 0.0003 0.0017 229.4591 YCYCCC 939.842264 5 0.0008 86 | 2/14
5 h-m-p 0.0020 0.0099 15.8137 YYCC 939.680835 3 0.0014 107 | 2/14
6 h-m-p 0.0013 0.0175 16.5564 CC 939.579595 1 0.0013 126 | 2/14
7 h-m-p 0.0021 0.0203 9.7192 YCC 939.528354 2 0.0016 146 | 2/14
8 h-m-p 0.0013 0.1084 11.7840 ++CCCC 938.740489 3 0.0249 171 | 2/14
9 h-m-p 0.0013 0.0067 114.6463 CCCC 938.283734 3 0.0014 194 | 2/14
10 h-m-p 0.0053 0.0263 15.7576 YCCC 938.171012 3 0.0029 216 | 2/14
11 h-m-p 0.0242 0.1435 1.9041 CCC 938.144488 2 0.0079 237 | 2/14
12 h-m-p 0.0143 3.2977 1.0440 ++YCCC 936.198635 3 0.4788 261 | 2/14
13 h-m-p 0.4846 2.7080 1.0314 CYCC 935.900989 3 0.4117 283 | 2/14
14 h-m-p 0.6175 3.0875 0.1953 YCCC 935.668238 3 1.2322 305 | 2/14
15 h-m-p 0.8844 4.4219 0.1015 YC 935.594877 1 2.1067 335 | 2/14
16 h-m-p 1.6000 8.0000 0.0724 CC 935.567675 1 1.8893 366 | 2/14
17 h-m-p 1.6000 8.0000 0.0563 YC 935.545339 1 2.9045 396 | 2/14
18 h-m-p 1.6000 8.0000 0.0631 YC 935.524573 1 3.3661 426 | 2/14
19 h-m-p 1.5250 8.0000 0.1393 YC 935.497525 1 3.1516 456 | 2/14
20 h-m-p 1.6000 8.0000 0.0871 C 935.494654 0 1.7130 485 | 2/14
21 h-m-p 1.6000 8.0000 0.0226 C 935.494470 0 1.4356 514 | 2/14
22 h-m-p 1.6000 8.0000 0.0008 C 935.494443 0 2.2394 543 | 2/14
23 h-m-p 0.4696 8.0000 0.0037 +C 935.494437 0 1.7789 573 | 2/14
24 h-m-p 1.6000 8.0000 0.0009 C 935.494437 0 1.4532 602 | 2/14
25 h-m-p 1.6000 8.0000 0.0001 Y 935.494437 0 1.1016 631 | 2/14
26 h-m-p 1.6000 8.0000 0.0000 Y 935.494437 0 0.4000 660 | 2/14
27 h-m-p 1.1080 8.0000 0.0000 Y 935.494437 0 0.2770 689 | 2/14
28 h-m-p 0.1644 8.0000 0.0000 ----------Y 935.494437 0 0.0000 728
Out..
lnL = -935.494437
729 lfun, 8019 eigenQcodon, 80190 P(t)
Time used: 1:06
Model 8: beta&w>1
TREE # 1
(1, 2, (3, (4, (5, (6, 7))))); MP score: 88
initial w for M8:NSbetaw>1 reset.
0.079491 0.055375 0.101637 0.041532 0.026199 0.064485 0.239564 0.176648 0.117664 0.000000 0.000002 2.568781 0.900000 0.225525 1.016293 2.374037
ntime & nrate & np: 11 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 7.158738
np = 16
lnL0 = -953.858152
Iterating by ming2
Initial: fx= 953.858152
x= 0.07949 0.05537 0.10164 0.04153 0.02620 0.06448 0.23956 0.17665 0.11766 0.00000 0.00000 2.56878 0.90000 0.22553 1.01629 2.37404
1 h-m-p 0.0000 0.0000 246.9241 ++ 953.857628 m 0.0000 21 | 2/16
2 h-m-p 0.0000 0.0003 326.0971 +++ 941.859522 m 0.0003 41 | 2/16
3 h-m-p 0.0002 0.0009 52.6909 ++ 940.817376 m 0.0009 60 | 2/16
4 h-m-p 0.0006 0.0031 61.9611 YYC 940.272855 2 0.0005 81 | 2/16
5 h-m-p 0.0001 0.0007 25.9140 YCCC 940.202267 3 0.0003 105 | 2/16
6 h-m-p 0.0008 0.0341 9.8000 YCC 940.145355 2 0.0012 127 | 2/16
7 h-m-p 0.0011 0.0096 10.9213 ++ 939.662228 m 0.0096 146 | 2/16
8 h-m-p 0.0012 0.0178 87.8706 +YYCCCC 937.974219 5 0.0049 174 | 2/16
9 h-m-p 0.0016 0.0081 185.1951 CCCCC 936.139830 4 0.0025 201 | 2/16
10 h-m-p 0.0034 0.0172 12.2378 CCC 936.101325 2 0.0011 224 | 2/16
11 h-m-p 0.0017 0.0609 8.0649 YC 936.042335 1 0.0037 244 | 2/16
12 h-m-p 0.0032 0.0873 9.2232 ++CCCC 935.412651 3 0.0426 271 | 2/16
13 h-m-p 0.0045 0.0225 77.2127 YCCC 934.214910 3 0.0097 295 | 2/16
14 h-m-p 1.1893 5.9465 0.5579 CCCCC 933.207678 4 1.4582 322 | 2/16
15 h-m-p 0.8548 8.0000 0.9517 CYCCC 932.803188 4 0.7390 362 | 2/16
16 h-m-p 0.9332 8.0000 0.7537 YCCC 932.309224 3 2.0191 400 | 2/16
17 h-m-p 1.6000 8.0000 0.5867 YCCC 931.974564 3 2.9031 438 | 2/16
18 h-m-p 1.6000 8.0000 0.6807 +CCC 931.550003 2 5.4977 476 | 2/16
19 h-m-p 1.6000 8.0000 1.4829 YCCC 931.167597 3 3.1946 514 | 2/16
20 h-m-p 1.5613 7.8063 2.0165 CCCC 931.036479 3 1.8470 539 | 2/16
21 h-m-p 1.6000 8.0000 1.4694 YCC 930.966782 2 3.4021 561 | 2/16
22 h-m-p 1.6000 8.0000 2.6279 YCC 930.899510 2 2.7180 583 | 2/16
23 h-m-p 1.6000 8.0000 2.7701 CCC 930.863358 2 2.4934 606 | 2/16
24 h-m-p 1.6000 8.0000 2.9855 CCC 930.844759 2 2.3157 629 | 2/16
25 h-m-p 1.6000 8.0000 1.3797 YC 930.841044 1 2.5565 649 | 2/16
26 h-m-p 1.6000 8.0000 0.7561 +C 930.833156 0 6.6053 669 | 2/16
27 h-m-p 1.6000 8.0000 1.1650 ++ 930.789874 m 8.0000 702 | 2/16
28 h-m-p 0.7270 3.6352 10.1256 CYCCC 930.733825 4 1.3595 728 | 2/16
29 h-m-p 0.4470 2.2349 10.2449 ++ 930.685287 m 2.2349 747 | 3/16
30 h-m-p 0.0452 0.2261 38.1038 CCC 930.637657 2 0.0164 770 | 3/16
31 h-m-p 0.7752 3.8758 0.2421 CC 930.628700 1 1.0152 791 | 3/16
32 h-m-p 1.0191 6.3760 0.2412 YCC 930.626888 2 0.7720 826 | 3/16
33 h-m-p 1.6000 8.0000 0.0079 C 930.626455 0 1.4972 858 | 3/16
34 h-m-p 1.6000 8.0000 0.0067 C 930.626404 0 1.8138 890 | 3/16
35 h-m-p 1.6000 8.0000 0.0033 C 930.626396 0 1.5699 922 | 3/16
36 h-m-p 1.6000 8.0000 0.0010 C 930.626396 0 1.4171 954 | 3/16
37 h-m-p 1.6000 8.0000 0.0002 C 930.626396 0 1.3074 986 | 3/16
38 h-m-p 1.6000 8.0000 0.0000 Y 930.626396 0 0.9787 1018 | 3/16
39 h-m-p 1.6000 8.0000 0.0000 -C 930.626396 0 0.1000 1051
Out..
lnL = -930.626396
1052 lfun, 12624 eigenQcodon, 127292 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -940.735919 S = -893.985410 -40.358131
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 91 patterns 1:46
did 20 / 91 patterns 1:46
did 30 / 91 patterns 1:46
did 40 / 91 patterns 1:47
did 50 / 91 patterns 1:47
did 60 / 91 patterns 1:47
did 70 / 91 patterns 1:47
did 80 / 91 patterns 1:47
did 90 / 91 patterns 1:48
did 91 / 91 patterns 1:48
Time used: 1:48
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=122
D_melanogaster_CG7787-PA MTEEADFSEQITDGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQK
D_sechellia_CG7787-PA MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK
D_yakuba_CG7787-PA MTEEADFSEQIVDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK
D_erecta_CG7787-PA MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGAYNQEKVDVPLMMQK
D_elegans_CG7787-PA MTEVTDFSEQISNGKNILNVRCQFCNSLMLKAQEGTYSQEEVEVPLMMQK
D_takahashii_CG7787-PA MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK
D_takahashii_CG7787-PA MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK
*** :***:** :*** ********.********::. *:*:**** **
D_melanogaster_CG7787-PA QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
D_sechellia_CG7787-PA QDRSADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
D_yakuba_CG7787-PA QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTLDGRKFLVCADCERGPV
D_erecta_CG7787-PA QDQTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV
D_elegans_CG7787-PA QDRTADSLNSEPLKDFWLVKDMMMFENIGFSNTVDGRKFLVCADCERGPV
D_takahashii_CG7787-PA QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV
D_takahashii_CG7787-PA QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV
**::******************* *******:*:****************
D_melanogaster_CG7787-PA GYHDLSTRHCYLALKRVVHKDT
D_sechellia_CG7787-PA GYHDLSTRHCYLALKRVVHKDT
D_yakuba_CG7787-PA GYHDLSTRHCFLALKRVVHKDT
D_erecta_CG7787-PA GYHDLSTRHCFLALQRVVHKDT
D_elegans_CG7787-PA GYHDLSTRHCFLALKRVVHKDS
D_takahashii_CG7787-PA GYHDLTTRHCFLALKRVVHKDS
D_takahashii_CG7787-PA GYHDLTTRHCFLALKRVVHKDS
*****:****:***:******:
>D_melanogaster_CG7787-PA ATGACAGAGGAAGCTGATTTTAGCGAGCAAATCACCGATGGGAAAAACAA ATCAAATGTGCGCTGCCAGTTTTGCAACTGTTTGATGCTGAAAGCACAAG AGGGCACCTACAACCAGGAGGAGGTGGATGTGCCACTGATGACGCAGAAG CAGGATCGAACGGCGGACAGCCTAAACAGCGAGCCACTGAAAGACTTCTG GCTGGTCAAGGACATGATGACATTCGAGAACATCGGGTTCTCCAACACGG TGGACGGCAGAAAGTTTCTGGTTTGCGCGGACTGCGAGCGAGGACCTGTG GGCTACCATGATCTGAGCACCCGCCACTGCTATCTGGCCCTCAAGAGGGT GGTGCACAAGGACACC >D_sechellia_CG7787-PA ATGACAGAGGAAGCTGATTTTAGCGAGCAAATCACCGATGGGAAAAACAA ATCAAATGTGCGCTGCCAGTTTTGCAACAGCTTGATGCTGAAAGCCCAAG AGGGCACCTACAATCAGGAGGAGGTGGATGTGCCGCTGATGATGCAGAAG CAGGATCGATCGGCGGACAGCCTAAACAGCGAGCCACTGAAGGACTTCTG GCTGGTCAAGGACATGATGACGTTCGAGAACATCGGCTTCTCCAATACGG TGGACGGCAGAAAGTTCCTGGTTTGCGCGGACTGCGAGCGAGGACCCGTG GGCTACCATGATCTGAGCACCCGACACTGCTACCTGGCCCTCAAGAGGGT GGTGCACAAGGACACC >D_yakuba_CG7787-PA ATGACCGAGGAAGCTGATTTCAGCGAGCAAATCGTTGATGGAAAAAACAA ATCAAATGTGCGCTGCCAGTTCTGCAACAGTTTGATGCTGAAAGCCCAAG AGGGCACCTACAACCAGGAGGAGGTGGATGTGCCACTGATGATGCAGAAG CAGGACCGAACAGCGGACAGCCTAAACAGCGAGCCACTGAAGGACTTCTG GCTGGTTAAGGACATGATGACGTTCGAGAACATCGGCTTCTCCAACACGC TGGACGGCAGGAAGTTCCTGGTTTGTGCGGACTGCGAGCGAGGACCCGTG GGCTACCATGATCTGAGCACCCGCCACTGCTTCCTGGCCCTCAAGAGGGT GGTCCACAAGGACACC >D_erecta_CG7787-PA ATGACAGAGGAAGCCGATTTTAGCGAGCAAATCACAGATGGAAAAAACAA ATCAAATGTGCGCTGCCAGTTCTGCAACAGTTTGATGCTGAAAGCCCAGG AGGGCGCCTACAACCAGGAGAAGGTGGATGTGCCACTGATGATGCAGAAA CAGGACCAAACGGCGGACAGCCTGAACAGCGAGCCACTGAAGGACTTCTG GCTGGTCAAGGACATGATGACGTTCGAGAACATCGGGTTCTCCAACACGG TGGACGGCAGAAAGTTCCTGGTTTGTGCAGACTGCGAGCGAGGACCCGTG GGCTACCATGATCTGAGCACCCGCCACTGCTTCCTGGCCCTCCAAAGGGT GGTTCACAAGGACACC >D_elegans_CG7787-PA ATGACGGAGGTTACTGATTTTAGTGAGCAAATATCCAATGGAAAGAACAT ATTAAATGTGCGCTGCCAGTTCTGCAATAGTTTGATGCTCAAGGCCCAAG AGGGAACCTACAGCCAGGAGGAAGTGGAAGTGCCCCTGATGATGCAAAAA CAGGACAGGACGGCGGACAGTCTGAACAGCGAGCCACTGAAGGACTTTTG GCTGGTCAAGGACATGATGATGTTCGAGAATATTGGATTCTCCAACACGG TGGATGGCAGGAAGTTCCTGGTTTGTGCGGATTGCGAGCGAGGACCAGTG GGCTATCATGATCTGAGCACCCGCCACTGTTTCCTGGCCCTCAAAAGAGT GGTCCACAAGGACTCC >D_takahashii_CG7787-PA ATGACAGAAGAGGCTGATTTTAGTGACCAAATAGTTGATGGAAAGAACAA ATCAAATGTGCGCTGCCAGTTCTGCAATAGTTTGATGCTCAAGGCTCAGG AGGGCACCTTCAGCGCGGAGGAAGTGGAAGTGCCCCTGATGATGCAAAAA CAGGACAGAACGGCGGACAGTCTGAACAGCGAGCCATTGAAGGACTTCTG GCTGGTCAAGGACATGATGACGTTCGAGAATATCGGATTCTCCCACACAG TGGACGGCAGGAAGTTCCTGGTTTGTGCGGATTGCGAGCGAGGACCCGTT GGCTATCATGATCTGACCACCCGCCACTGCTTCCTGGCCCTCAAGAGGGT GGTCCACAAGGACTCC >D_takahashii_CG7787-PA ATGACAGAAGAGGCTGATTTTAGTGACCAAATAGTTGATGGAAAGAACAA ATCAAATGTGCGCTGCCAGTTCTGCAATAGTTTGATGCTCAAGGCTCAGG AGGGCACCTTCAGCGCGGAGGAAGTGGAAGTGCCCCTGATGATGCAAAAA CAGGACAGAACGGCGGACAGTCTGAACAGCGAGCCATTGAAGGACTTCTG GCTGGTCAAGGACATGATGACGTTCGAGAATATCGGATTCTCCCACACAG TGGACGGCAGGAAGTTCCTGGTTTGTGCGGATTGCGAGCGAGGACCCGTT GGCTATCATGATCTGACCACCCGCCACTGCTTCCTGGCCCTCAAGAGGGT GGTCCACAAGGACTCC
>D_melanogaster_CG7787-PA MTEEADFSEQITDGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCYLALKRVVHKDT >D_sechellia_CG7787-PA MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK QDRSADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCYLALKRVVHKDT >D_yakuba_CG7787-PA MTEEADFSEQIVDGKNKSNVRCQFCNSLMLKAQEGTYNQEEVDVPLMMQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSNTLDGRKFLVCADCERGPV GYHDLSTRHCFLALKRVVHKDT >D_erecta_CG7787-PA MTEEADFSEQITDGKNKSNVRCQFCNSLMLKAQEGAYNQEKVDVPLMMQK QDQTADSLNSEPLKDFWLVKDMMTFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCFLALQRVVHKDT >D_elegans_CG7787-PA MTEVTDFSEQISNGKNILNVRCQFCNSLMLKAQEGTYSQEEVEVPLMMQK QDRTADSLNSEPLKDFWLVKDMMMFENIGFSNTVDGRKFLVCADCERGPV GYHDLSTRHCFLALKRVVHKDS >D_takahashii_CG7787-PA MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV GYHDLTTRHCFLALKRVVHKDS >D_takahashii_CG7787-PA MTEEADFSDQIVDGKNKSNVRCQFCNSLMLKAQEGTFSAEEVEVPLMMQK QDRTADSLNSEPLKDFWLVKDMMTFENIGFSHTVDGRKFLVCADCERGPV GYHDLTTRHCFLALKRVVHKDS
#NEXUS
[ID: 4142185320]
begin taxa;
dimensions ntax=7;
taxlabels
D_melanogaster_CG7787-PA
D_sechellia_CG7787-PA
D_yakuba_CG7787-PA
D_erecta_CG7787-PA
D_elegans_CG7787-PA
D_takahashii_CG7787-PA
D_takahashii_CG7787-PA
;
end;
begin trees;
translate
1 D_melanogaster_CG7787-PA,
2 D_sechellia_CG7787-PA,
3 D_yakuba_CG7787-PA,
4 D_erecta_CG7787-PA,
5 D_elegans_CG7787-PA,
6 D_takahashii_CG7787-PA,
7 D_takahashii_CG7787-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.03766385,2:0.02830031,(3:0.03483174,(4:0.04783192,(5:0.09091753,(6:0.002333815,7:0.002366123)1.000:0.07186526)1.000:0.1134587)0.658:0.01366869)1.000:0.03325575);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.03766385,2:0.02830031,(3:0.03483174,(4:0.04783192,(5:0.09091753,(6:0.002333815,7:0.002366123):0.07186526):0.1134587):0.01366869):0.03325575);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -989.69 -1000.18
2 -989.69 -1005.95
--------------------------------------
TOTAL -989.69 -1005.26
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/187/CG7787-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.502640 0.006819 0.350610 0.662763 0.495768 973.99 1177.79 1.000
r(A<->C){all} 0.085149 0.001040 0.025399 0.144695 0.082751 689.28 725.95 1.000
r(A<->G){all} 0.213591 0.002693 0.118886 0.317510 0.209635 513.55 567.93 1.000
r(A<->T){all} 0.124657 0.002129 0.046321 0.221326 0.120679 583.33 631.22 1.001
r(C<->G){all} 0.047780 0.000457 0.012457 0.092048 0.044890 720.65 803.32 1.000
r(C<->T){all} 0.504052 0.005507 0.356224 0.640697 0.504914 505.67 507.53 1.000
r(G<->T){all} 0.024770 0.000375 0.000013 0.063040 0.020486 639.27 740.12 1.001
pi(A){all} 0.276425 0.000482 0.237161 0.322955 0.275207 1202.09 1208.53 1.000
pi(C){all} 0.245294 0.000436 0.203830 0.284975 0.245152 1068.52 1113.89 1.000
pi(G){all} 0.290386 0.000478 0.248135 0.333666 0.290106 1070.03 1198.75 1.000
pi(T){all} 0.187895 0.000373 0.152645 0.227427 0.187187 956.08 1032.48 1.000
alpha{1,2} 0.111209 0.005437 0.000352 0.238301 0.103786 912.97 1000.81 1.003
alpha{3} 1.632596 0.477607 0.627431 3.068261 1.490353 1181.74 1341.37 1.000
pinvar{all} 0.157514 0.011390 0.000023 0.355689 0.142369 1025.40 1028.99 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/187/CG7787-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 7 ls = 122
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 2 0 1 2 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 0 0 0 1 1 | Cys TGT 1 0 1 1 2 1
TTC 3 4 7 6 5 7 | TCC 1 1 1 1 3 2 | TAC 2 3 2 2 1 0 | TGC 5 5 4 4 3 4
Leu TTA 0 0 0 0 1 0 | TCA 1 1 1 1 0 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 2 | TCG 0 1 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 1 1 1 1 2 2 | CCC 0 1 1 1 1 2 | CAC 2 2 2 2 2 3 | CGC 2 1 2 2 2 2
CTA 1 1 1 0 0 0 | CCA 2 1 2 2 2 1 | Gln CAA 2 2 2 3 3 2 | CGA 2 3 2 1 1 1
CTG 7 7 8 8 7 6 | CCG 0 1 0 0 0 0 | CAG 4 4 4 5 3 3 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 1 0 | Thr ACT 0 0 0 0 1 0 | Asn AAT 1 3 1 1 4 3 | Ser AGT 0 0 1 1 3 3
ATC 2 2 2 2 0 1 | ACC 4 4 4 2 2 3 | AAC 6 4 6 6 3 2 | AGC 4 5 4 4 3 2
ATA 0 0 0 0 2 1 | ACA 2 1 1 2 0 2 | Lys AAA 4 3 3 4 2 2 | Arg AGA 1 1 0 1 1 1
Met ATG 5 6 6 6 7 6 | ACG 3 2 2 3 3 2 | AAG 5 6 6 5 6 7 | AGG 1 1 2 1 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 3 2 2 3 | Ala GCT 1 1 1 0 0 2 | Asp GAT 5 5 4 4 4 4 | Gly GGT 0 0 0 0 0 0
GTC 1 1 1 1 2 2 | GCC 1 2 2 4 2 1 | GAC 6 6 7 7 5 7 | GGC 3 4 4 3 2 3
GTA 0 0 0 0 0 0 | GCA 1 0 0 1 0 0 | Glu GAA 1 1 1 1 2 3 | GGA 1 1 2 2 4 3
GTG 7 7 5 6 6 5 | GCG 2 2 2 1 2 3 | GAG 8 8 8 7 7 6 | GGG 2 1 0 1 0 0
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------
Phe TTT 1 | Ser TCT 0 | Tyr TAT 1 | Cys TGT 1
TTC 7 | TCC 2 | TAC 0 | TGC 4
Leu TTA 0 | TCA 1 | *** TAA 0 | *** TGA 0
TTG 2 | TCG 0 | TAG 0 | Trp TGG 1
------------------------------------------------------
Leu CTT 0 | Pro CCT 0 | His CAT 1 | Arg CGT 0
CTC 2 | CCC 2 | CAC 3 | CGC 2
CTA 0 | CCA 1 | Gln CAA 2 | CGA 1
CTG 6 | CCG 0 | CAG 3 | CGG 0
------------------------------------------------------
Ile ATT 0 | Thr ACT 0 | Asn AAT 3 | Ser AGT 3
ATC 1 | ACC 3 | AAC 2 | AGC 2
ATA 1 | ACA 2 | Lys AAA 2 | Arg AGA 1
Met ATG 6 | ACG 2 | AAG 7 | AGG 2
------------------------------------------------------
Val GTT 3 | Ala GCT 2 | Asp GAT 4 | Gly GGT 0
GTC 2 | GCC 1 | GAC 7 | GGC 3
GTA 0 | GCA 0 | Glu GAA 3 | GGA 3
GTG 5 | GCG 3 | GAG 6 | GGG 0
------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG7787-PA
position 1: T:0.15574 C:0.20492 A:0.31148 G:0.32787
position 2: T:0.26230 C:0.15574 A:0.39344 G:0.18852
position 3: T:0.12295 C:0.35246 A:0.14754 G:0.37705
Average T:0.18033 C:0.23770 A:0.28415 G:0.29781
#2: D_sechellia_CG7787-PA
position 1: T:0.15574 C:0.20492 A:0.31148 G:0.32787
position 2: T:0.27049 C:0.14754 A:0.39344 G:0.18852
position 3: T:0.10656 C:0.37705 A:0.12295 G:0.39344
Average T:0.17760 C:0.24317 A:0.27596 G:0.30328
#3: D_yakuba_CG7787-PA
position 1: T:0.14754 C:0.21311 A:0.31148 G:0.32787
position 2: T:0.28689 C:0.13934 A:0.38525 G:0.18852
position 3: T:0.09836 C:0.40984 A:0.12295 G:0.36885
Average T:0.17760 C:0.25410 A:0.27322 G:0.29508
#4: D_erecta_CG7787-PA
position 1: T:0.14754 C:0.21311 A:0.31148 G:0.32787
position 2: T:0.27869 C:0.14754 A:0.39344 G:0.18033
position 3: T:0.09016 C:0.39344 A:0.14754 G:0.36885
Average T:0.17213 C:0.25137 A:0.28415 G:0.29235
#5: D_elegans_CG7787-PA
position 1: T:0.16393 C:0.19672 A:0.32787 G:0.31148
position 2: T:0.31148 C:0.13115 A:0.36066 G:0.19672
position 3: T:0.17213 C:0.31148 A:0.14754 G:0.36885
Average T:0.21585 C:0.21311 A:0.27869 G:0.29235
#6: D_takahashii_CG7787-PA
position 1: T:0.16393 C:0.18852 A:0.30328 G:0.34426
position 2: T:0.29508 C:0.15574 A:0.36066 G:0.18852
position 3: T:0.15574 C:0.35246 A:0.13934 G:0.35246
Average T:0.20492 C:0.23224 A:0.26776 G:0.29508
#7: D_takahashii_CG7787-PA
position 1: T:0.16393 C:0.18852 A:0.30328 G:0.34426
position 2: T:0.29508 C:0.15574 A:0.36066 G:0.18852
position 3: T:0.15574 C:0.35246 A:0.13934 G:0.35246
Average T:0.20492 C:0.23224 A:0.26776 G:0.29508
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 10 | Ser S TCT 0 | Tyr Y TAT 4 | Cys C TGT 7
TTC 39 | TCC 11 | TAC 10 | TGC 29
Leu L TTA 1 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 9 | TCG 1 | TAG 0 | Trp W TGG 7
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 1 | His H CAT 7 | Arg R CGT 0
CTC 10 | CCC 8 | CAC 16 | CGC 13
CTA 3 | CCA 11 | Gln Q CAA 16 | CGA 11
CTG 49 | CCG 1 | CAG 26 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 1 | Thr T ACT 1 | Asn N AAT 16 | Ser S AGT 11
ATC 10 | ACC 22 | AAC 29 | AGC 24
ATA 4 | ACA 10 | Lys K AAA 20 | Arg R AGA 6
Met M ATG 42 | ACG 17 | AAG 42 | AGG 11
------------------------------------------------------------------------------
Val V GTT 15 | Ala A GCT 7 | Asp D GAT 30 | Gly G GGT 0
GTC 10 | GCC 13 | GAC 45 | GGC 22
GTA 0 | GCA 2 | Glu E GAA 12 | GGA 16
GTG 41 | GCG 15 | GAG 50 | GGG 4
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15691 C:0.20141 A:0.31148 G:0.33021
position 2: T:0.28571 C:0.14754 A:0.37822 G:0.18852
position 3: T:0.12881 C:0.36417 A:0.13817 G:0.36885
Average T:0.19048 C:0.23770 A:0.27596 G:0.29586
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG7787-PA
D_sechellia_CG7787-PA 0.0608 (0.0105 0.1724)
D_yakuba_CG7787-PA 0.0762 (0.0211 0.2769) 0.0725 (0.0175 0.2417)
D_erecta_CG7787-PA 0.0880 (0.0246 0.2797) 0.0748 (0.0210 0.2811) 0.1174 (0.0246 0.2094)
D_elegans_CG7787-PA 0.0621 (0.0501 0.8063) 0.0561 (0.0445 0.7932) 0.0744 (0.0445 0.5977) 0.0952 (0.0536 0.5626)
D_takahashii_CG7787-PA 0.0690 (0.0501 0.7266) 0.0665 (0.0464 0.6979) 0.0711 (0.0354 0.4983) 0.1189 (0.0555 0.4669) 0.1884 (0.0518 0.2747)
D_takahashii_CG7787-PA 0.0690 (0.0501 0.7266) 0.0665 (0.0464 0.6979) 0.0711 (0.0354 0.4983) 0.1189 (0.0555 0.4669) 0.1884 (0.0518 0.2747)-1.0000 (0.0000 0.0000)
Model 0: one-ratio
TREE # 1: (1, 2, (3, (4, (5, (6, 7))))); MP score: 88
lnL(ntime: 11 np: 13): -950.499344 +0.000000
8..1 8..2 8..9 9..3 9..10 10..4 10..11 11..5 11..12 12..6 12..7
0.082363 0.059297 0.059226 0.094393 0.008880 0.109931 0.226462 0.184628 0.149404 0.000004 0.000004 0.821927 0.061752
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.97459
(1: 0.082363, 2: 0.059297, (3: 0.094393, (4: 0.109931, (5: 0.184628, (6: 0.000004, 7: 0.000004): 0.149404): 0.226462): 0.008880): 0.059226);
(D_melanogaster_CG7787-PA: 0.082363, D_sechellia_CG7787-PA: 0.059297, (D_yakuba_CG7787-PA: 0.094393, (D_erecta_CG7787-PA: 0.109931, (D_elegans_CG7787-PA: 0.184628, (D_takahashii_CG7787-PA: 0.000004, D_takahashii_CG7787-PA: 0.000004): 0.149404): 0.226462): 0.008880): 0.059226);
Detailed output identifying parameters
kappa (ts/tv) = 0.82193
omega (dN/dS) = 0.06175
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.082 306.0 60.0 0.0618 0.0079 0.1274 2.4 7.6
8..2 0.059 306.0 60.0 0.0618 0.0057 0.0917 1.7 5.5
8..9 0.059 306.0 60.0 0.0618 0.0057 0.0916 1.7 5.5
9..3 0.094 306.0 60.0 0.0618 0.0090 0.1460 2.8 8.8
9..10 0.009 306.0 60.0 0.0618 0.0008 0.0137 0.3 0.8
10..4 0.110 306.0 60.0 0.0618 0.0105 0.1700 3.2 10.2
10..11 0.226 306.0 60.0 0.0618 0.0216 0.3503 6.6 21.0
11..5 0.185 306.0 60.0 0.0618 0.0176 0.2856 5.4 17.1
11..12 0.149 306.0 60.0 0.0618 0.0143 0.2311 4.4 13.9
12..6 0.000 306.0 60.0 0.0618 0.0000 0.0000 0.0 0.0
12..7 0.000 306.0 60.0 0.0618 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0931
tree length for dS: 1.5074
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, (3, (4, (5, (6, 7))))); MP score: 88
lnL(ntime: 11 np: 14): -932.121409 +0.000000
8..1 8..2 8..9 9..3 9..10 10..4 10..11 11..5 11..12 12..6 12..7
0.078455 0.059407 0.062678 0.092064 0.002820 0.111366 0.237156 0.188382 0.142469 0.000004 0.000004 2.514520 0.979291 0.065153
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.97480
(1: 0.078455, 2: 0.059407, (3: 0.092064, (4: 0.111366, (5: 0.188382, (6: 0.000004, 7: 0.000004): 0.142469): 0.237156): 0.002820): 0.062678);
(D_melanogaster_CG7787-PA: 0.078455, D_sechellia_CG7787-PA: 0.059407, (D_yakuba_CG7787-PA: 0.092064, (D_erecta_CG7787-PA: 0.111366, (D_elegans_CG7787-PA: 0.188382, (D_takahashii_CG7787-PA: 0.000004, D_takahashii_CG7787-PA: 0.000004): 0.142469): 0.237156): 0.002820): 0.062678);
Detailed output identifying parameters
kappa (ts/tv) = 2.51452
dN/dS (w) for site classes (K=2)
p: 0.97929 0.02071
w: 0.06515 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.078 292.0 74.0 0.0845 0.0082 0.0970 2.4 7.2
8..2 0.059 292.0 74.0 0.0845 0.0062 0.0734 1.8 5.4
8..9 0.063 292.0 74.0 0.0845 0.0065 0.0775 1.9 5.7
9..3 0.092 292.0 74.0 0.0845 0.0096 0.1138 2.8 8.4
9..10 0.003 292.0 74.0 0.0845 0.0003 0.0035 0.1 0.3
10..4 0.111 292.0 74.0 0.0845 0.0116 0.1376 3.4 10.2
10..11 0.237 292.0 74.0 0.0845 0.0248 0.2931 7.2 21.7
11..5 0.188 292.0 74.0 0.0845 0.0197 0.2328 5.7 17.2
11..12 0.142 292.0 74.0 0.0845 0.0149 0.1761 4.3 13.0
12..6 0.000 292.0 74.0 0.0845 0.0000 0.0000 0.0 0.0
12..7 0.000 292.0 74.0 0.0845 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, (3, (4, (5, (6, 7))))); MP score: 88
lnL(ntime: 11 np: 16): -930.554639 +0.000000
8..1 8..2 8..9 9..3 9..10 10..4 10..11 11..5 11..12 12..6 12..7
0.080049 0.059734 0.070621 0.084819 0.004653 0.121089 0.246890 0.202831 0.138270 0.000004 0.000004 2.537429 0.990842 0.000000 0.072016 4.286994
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.00896
(1: 0.080049, 2: 0.059734, (3: 0.084819, (4: 0.121089, (5: 0.202831, (6: 0.000004, 7: 0.000004): 0.138270): 0.246890): 0.004653): 0.070621);
(D_melanogaster_CG7787-PA: 0.080049, D_sechellia_CG7787-PA: 0.059734, (D_yakuba_CG7787-PA: 0.084819, (D_erecta_CG7787-PA: 0.121089, (D_elegans_CG7787-PA: 0.202831, (D_takahashii_CG7787-PA: 0.000004, D_takahashii_CG7787-PA: 0.000004): 0.138270): 0.246890): 0.004653): 0.070621);
Detailed output identifying parameters
kappa (ts/tv) = 2.53743
dN/dS (w) for site classes (K=3)
p: 0.99084 0.00000 0.00916
w: 0.07202 1.00000 4.28699
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.080 291.8 74.2 0.1106 0.0101 0.0917 3.0 6.8
8..2 0.060 291.8 74.2 0.1106 0.0076 0.0685 2.2 5.1
8..9 0.071 291.8 74.2 0.1106 0.0090 0.0809 2.6 6.0
9..3 0.085 291.8 74.2 0.1106 0.0108 0.0972 3.1 7.2
9..10 0.005 291.8 74.2 0.1106 0.0006 0.0053 0.2 0.4
10..4 0.121 291.8 74.2 0.1106 0.0154 0.1388 4.5 10.3
10..11 0.247 291.8 74.2 0.1106 0.0313 0.2830 9.1 21.0
11..5 0.203 291.8 74.2 0.1106 0.0257 0.2325 7.5 17.2
11..12 0.138 291.8 74.2 0.1106 0.0175 0.1585 5.1 11.8
12..6 0.000 291.8 74.2 0.1106 0.0000 0.0000 0.0 0.0
12..7 0.000 291.8 74.2 0.1106 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG7787-PA)
Pr(w>1) post mean +- SE for w
12 T 1.000** 4.287
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG7787-PA)
Pr(w>1) post mean +- SE for w
12 T 0.903 4.881 +- 2.927
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.143 0.141 0.128 0.113 0.100 0.088 0.080 0.073 0.068 0.065
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.009 0.988
sum of density on p0-p1 = 1.000000
Time used: 0:29
Model 3: discrete (3 categories)
TREE # 1: (1, 2, (3, (4, (5, (6, 7))))); MP score: 88
lnL(ntime: 11 np: 17): -930.554640 +0.000000
8..1 8..2 8..9 9..3 9..10 10..4 10..11 11..5 11..12 12..6 12..7
0.080049 0.059734 0.070621 0.084819 0.004654 0.121089 0.246890 0.202831 0.138270 0.000004 0.000004 2.537426 0.000000 0.990842 0.000001 0.072016 4.286992
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.00896
(1: 0.080049, 2: 0.059734, (3: 0.084819, (4: 0.121089, (5: 0.202831, (6: 0.000004, 7: 0.000004): 0.138270): 0.246890): 0.004654): 0.070621);
(D_melanogaster_CG7787-PA: 0.080049, D_sechellia_CG7787-PA: 0.059734, (D_yakuba_CG7787-PA: 0.084819, (D_erecta_CG7787-PA: 0.121089, (D_elegans_CG7787-PA: 0.202831, (D_takahashii_CG7787-PA: 0.000004, D_takahashii_CG7787-PA: 0.000004): 0.138270): 0.246890): 0.004654): 0.070621);
Detailed output identifying parameters
kappa (ts/tv) = 2.53743
dN/dS (w) for site classes (K=3)
p: 0.00000 0.99084 0.00916
w: 0.00000 0.07202 4.28699
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.080 291.8 74.2 0.1106 0.0101 0.0917 3.0 6.8
8..2 0.060 291.8 74.2 0.1106 0.0076 0.0685 2.2 5.1
8..9 0.071 291.8 74.2 0.1106 0.0090 0.0809 2.6 6.0
9..3 0.085 291.8 74.2 0.1106 0.0108 0.0972 3.1 7.2
9..10 0.005 291.8 74.2 0.1106 0.0006 0.0053 0.2 0.4
10..4 0.121 291.8 74.2 0.1106 0.0154 0.1388 4.5 10.3
10..11 0.247 291.8 74.2 0.1106 0.0313 0.2830 9.1 21.0
11..5 0.203 291.8 74.2 0.1106 0.0257 0.2325 7.5 17.2
11..12 0.138 291.8 74.2 0.1106 0.0175 0.1585 5.1 11.8
12..6 0.000 291.8 74.2 0.1106 0.0000 0.0000 0.0 0.0
12..7 0.000 291.8 74.2 0.1106 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG7787-PA)
Pr(w>1) post mean +- SE for w
12 T 1.000** 4.287
Time used: 0:41
Model 7: beta (10 categories)
TREE # 1: (1, 2, (3, (4, (5, (6, 7))))); MP score: 88
lnL(ntime: 11 np: 14): -935.494437 +0.000000
8..1 8..2 8..9 9..3 9..10 10..4 10..11 11..5 11..12 12..6 12..7
0.078691 0.059678 0.061816 0.093054 0.004449 0.108632 0.232415 0.183589 0.146252 0.000004 0.000004 2.568781 0.436955 3.985505
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.96858
(1: 0.078691, 2: 0.059678, (3: 0.093054, (4: 0.108632, (5: 0.183589, (6: 0.000004, 7: 0.000004): 0.146252): 0.232415): 0.004449): 0.061816);
(D_melanogaster_CG7787-PA: 0.078691, D_sechellia_CG7787-PA: 0.059678, (D_yakuba_CG7787-PA: 0.093054, (D_erecta_CG7787-PA: 0.108632, (D_elegans_CG7787-PA: 0.183589, (D_takahashii_CG7787-PA: 0.000004, D_takahashii_CG7787-PA: 0.000004): 0.146252): 0.232415): 0.004449): 0.061816);
Detailed output identifying parameters
kappa (ts/tv) = 2.56878
Parameters in M7 (beta):
p = 0.43695 q = 3.98550
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00022 0.00267 0.00871 0.01922 0.03531 0.05863 0.09195 0.14066 0.21779 0.37671
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.079 291.7 74.3 0.0952 0.0090 0.0940 2.6 7.0
8..2 0.060 291.7 74.3 0.0952 0.0068 0.0713 2.0 5.3
8..9 0.062 291.7 74.3 0.0952 0.0070 0.0739 2.1 5.5
9..3 0.093 291.7 74.3 0.0952 0.0106 0.1112 3.1 8.3
9..10 0.004 291.7 74.3 0.0952 0.0005 0.0053 0.1 0.4
10..4 0.109 291.7 74.3 0.0952 0.0124 0.1298 3.6 9.6
10..11 0.232 291.7 74.3 0.0952 0.0264 0.2777 7.7 20.6
11..5 0.184 291.7 74.3 0.0952 0.0209 0.2194 6.1 16.3
11..12 0.146 291.7 74.3 0.0952 0.0166 0.1748 4.9 13.0
12..6 0.000 291.7 74.3 0.0952 0.0000 0.0000 0.0 0.0
12..7 0.000 291.7 74.3 0.0952 0.0000 0.0000 0.0 0.0
Time used: 1:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, (3, (4, (5, (6, 7))))); MP score: 88
lnL(ntime: 11 np: 16): -930.626396 +0.000000
8..1 8..2 8..9 9..3 9..10 10..4 10..11 11..5 11..12 12..6 12..7
0.080125 0.059780 0.070746 0.084787 0.004744 0.121195 0.247106 0.203053 0.138343 0.000004 0.000004 2.540812 0.990875 7.809549 99.000000 4.325716
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.00989
(1: 0.080125, 2: 0.059780, (3: 0.084787, (4: 0.121195, (5: 0.203053, (6: 0.000004, 7: 0.000004): 0.138343): 0.247106): 0.004744): 0.070746);
(D_melanogaster_CG7787-PA: 0.080125, D_sechellia_CG7787-PA: 0.059780, (D_yakuba_CG7787-PA: 0.084787, (D_erecta_CG7787-PA: 0.121195, (D_elegans_CG7787-PA: 0.203053, (D_takahashii_CG7787-PA: 0.000004, D_takahashii_CG7787-PA: 0.000004): 0.138343): 0.247106): 0.004744): 0.070746);
Detailed output identifying parameters
kappa (ts/tv) = 2.54081
Parameters in M8 (beta&w>1):
p0 = 0.99088 p = 7.80955 q = 99.00000
(p1 = 0.00912) w = 4.32572
dN/dS (w) for site classes (K=11)
p: 0.09909 0.09909 0.09909 0.09909 0.09909 0.09909 0.09909 0.09909 0.09909 0.09909 0.00912
w: 0.03688 0.04767 0.05498 0.06132 0.06739 0.07361 0.08039 0.08838 0.09900 0.11843 4.32572
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.080 291.8 74.2 0.1116 0.0102 0.0916 3.0 6.8
8..2 0.060 291.8 74.2 0.1116 0.0076 0.0683 2.2 5.1
8..9 0.071 291.8 74.2 0.1116 0.0090 0.0808 2.6 6.0
9..3 0.085 291.8 74.2 0.1116 0.0108 0.0969 3.2 7.2
9..10 0.005 291.8 74.2 0.1116 0.0006 0.0054 0.2 0.4
10..4 0.121 291.8 74.2 0.1116 0.0155 0.1385 4.5 10.3
10..11 0.247 291.8 74.2 0.1116 0.0315 0.2824 9.2 20.9
11..5 0.203 291.8 74.2 0.1116 0.0259 0.2321 7.6 17.2
11..12 0.138 291.8 74.2 0.1116 0.0176 0.1581 5.1 11.7
12..6 0.000 291.8 74.2 0.1116 0.0000 0.0000 0.0 0.0
12..7 0.000 291.8 74.2 0.1116 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG7787-PA)
Pr(w>1) post mean +- SE for w
12 T 1.000** 4.325
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG7787-PA)
Pr(w>1) post mean +- SE for w
12 T 0.978* 4.945 +- 2.835
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 0.997 0.003 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.003 0.018 0.055 0.114 0.189 0.270 0.351
ws: 0.162 0.150 0.130 0.112 0.096 0.084 0.075 0.068 0.063 0.060
Time used: 1:48
Model 1: NearlyNeutral -932.121409
Model 2: PositiveSelection -930.554639
Model 0: one-ratio -950.499344
Model 3: discrete -930.55464
Model 7: beta -935.494437
Model 8: beta&w>1 -930.626396
Model 0 vs 1 36.75586999999996
Model 2 vs 1 3.133540000000039
Model 8 vs 7 9.736081999999897
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG7787-PA)
Pr(w>1) post mean +- SE for w
12 T 1.000** 4.325
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG7787-PA)
Pr(w>1) post mean +- SE for w
12 T 0.978* 4.945 +- 2.835
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
