--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Tue Nov 15 20:43:22 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/231/Drl-2-PC/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/231/Drl-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/231/Drl-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/231/Drl-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -4421.24         -4433.36
2      -4421.10         -4433.32
--------------------------------------
TOTAL    -4421.17         -4433.34
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/231/Drl-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/231/Drl-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/231/Drl-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.577215    0.003775    0.455433    0.691276    0.572222   1311.82   1350.45    1.000
r(A<->C){all}   0.103642    0.000483    0.062707    0.148720    0.102589    706.81    892.29    1.001
r(A<->G){all}   0.295245    0.001725    0.211423    0.372918    0.293411    879.76    890.90    1.000
r(A<->T){all}   0.058104    0.000590    0.013037    0.105953    0.056686    790.96    841.47    1.000
r(C<->G){all}   0.081232    0.000277    0.049604    0.114382    0.080516   1094.37   1121.22    1.001
r(C<->T){all}   0.402903    0.001995    0.317044    0.491890    0.401545    784.86    838.57    1.000
r(G<->T){all}   0.058874    0.000337    0.023970    0.095455    0.057941    633.68    884.90    1.000
pi(A){all}      0.210406    0.000075    0.193708    0.227794    0.210117   1173.35   1227.39    1.000
pi(C){all}      0.326708    0.000096    0.307595    0.345504    0.326573   1202.35   1233.44    1.000
pi(G){all}      0.262720    0.000089    0.244769    0.280911    0.262493   1193.71   1235.50    1.000
pi(T){all}      0.200165    0.000071    0.184814    0.217279    0.199879    996.19   1060.73    1.000
alpha{1,2}      0.044498    0.000654    0.000104    0.083744    0.045191   1044.80   1272.90    1.000
alpha{3}        3.829687    1.047641    2.111917    5.930029    3.727041   1375.57   1390.94    1.000
pinvar{all}     0.583219    0.000751    0.529972    0.635658    0.583728   1396.73   1405.84    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-4028.833658
Model 2: PositiveSelection	-4025.634988
Model 0: one-ratio	-4044.558612
Model 3: discrete	-4025.634988
Model 7: beta	-4034.355541
Model 8: beta&w>1	-4025.684767


Model 0 vs 1	31.449907999999596

Model 2 vs 1	6.39734000000044

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Drl-2-PC)

            Pr(w>1)     post mean +- SE for w

     7 K      1.000**       6.040
    10 L      0.933         5.635

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Drl-2-PC)

            Pr(w>1)     post mean +- SE for w

     7 K      0.962*        6.001 +- 2.943
    10 L      0.505         3.244 +- 3.077


Model 8 vs 7	17.34154799999942

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Drl-2-PC)

            Pr(w>1)     post mean +- SE for w

     7 K      1.000**       6.195
    10 L      0.884         5.482

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Drl-2-PC)

            Pr(w>1)     post mean +- SE for w

     7 K      0.990**       4.958 +- 3.047
    10 L      0.671         3.261 +- 3.093

>C1
MELLPLKSPLPILLLCLTISTSVSGYLNIFISHHEVMKLMGLEADLFYVH
EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
KPESICPSRISYYASSQLTQPCSLSTPKSIRSNGNGNCTSGSGSLSLFGG
IPTGSTITMASHGEKGNQRLRRITSVQPGALSYEELVKEGTFGRIYAGKL
GESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELPG
PPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHSL
GIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKWL
SLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAGF
RLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYI
>C2
MGLLTLDLIPILLLCLTISTSVSGYLNIFISHHEVMKLMGLEADLFYVHE
GAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALGT
PTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDTR
LHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGLV
ASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSYA
TIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYSK
PESICPSRISYYASSQLTQPCSLSTPKSIRSNGNGNCTSGSGSLSLFGGI
PTGSTITMASHGHEKGNQRLRRIPSVQPGALSYEELVKEGTFGRIYAGKL
GESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELPG
PPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHSL
GIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKWL
SLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAGF
RLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYI
>C3
MGLLPLILLLCLTMSTSVSGYLNIFISHHEVMKLMGLEADLFYVHEGAIN
TYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALGTPTLS
IPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDTRLHFK
RNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGLVASMM
YVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSYATIAS
LNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYSKPESI
CPSRISYYASSQLTQPCSLSTPKSIRSNGNGNCTSGSGSLSLFGGIPTGS
TITMASHGEKGNQRLRRIPSVQPGALSYEELVREGTFGRIYAGKLGESCE
ALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELPGPPEIA
YPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHSLGIVHK
DIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKWLSLESL
QKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAGFRLEQP
VNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYIooooo
>C4
MGLLPPPIPILLFCLAISTSVSGYLNIFISHHEVMKLMGLEADLFYVHEG
AINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNTDQEALGTP
TLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDTRL
HFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGLVA
SMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSYAT
IASLNKYPAESKKSCSIFDRFRSSPTPTPYATALLPMNLEQAAETIYSKP
ESICPSRISYYASSQLTQACSLSTPKSIRSNGNGHCTSGSGSLSLFGGIP
TGSTITMASHGDKGNQRLRRIPSVQPGALSYEELVKEGTFGRIFAGKLGE
SCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELPGPP
EIAYPYPSKGNLKIYLQKSRESSTALSTRQLVEFGLHITKGLAYLHSLGI
VHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKWLSL
ESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAGFRL
EQPVNCPDEFFTVMNCCWHSEAKQRPTPSQLLSYLQDFHADLGMYIoo
>C5
MGLLPPPLVLLLVCLTSVSGYLNIFISHHEVMKLMGLEADLFYVHEGAIN
TYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALGTPTLS
IPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRGPPRFNDTRLHFK
RNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGLVASMM
YVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSYATIAS
LNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYSKPESI
CPSRISYYASSQLTQACSLSTPKSIRSNGNGHCTSGSGSLSLFGGIPTGS
TITMASHGEKGNQRLRRIPSVQPGALSYEELVKEGTFGRIYAGKLGESCE
ALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELPGPPEIA
YPYPSKGNLKIYLQKSRESSTALSTRQLVEFGLHITKGLAYLHSLGIVHK
DIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKWLSLESL
QKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAGFRLEQP
VNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYIooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=654 

C1              MELLPLKSPLPILLLCLTISTSVSGYLNIFISHHEVMKLMGLEADLFYVH
C2              MGLLTLD-LIPILLLCLTISTSVSGYLNIFISHHEVMKLMGLEADLFYVH
C3              MGLLPLI-----LLLCLTMSTSVSGYLNIFISHHEVMKLMGLEADLFYVH
C4              MGLLPPP--IPILLFCLAISTSVSGYLNIFISHHEVMKLMGLEADLFYVH
C5              MGLLPPP--LVLLLVCL---TSVSGYLNIFISHHEVMKLMGLEADLFYVH
                * **.       **.**   ******************************

C1              EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
C2              EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
C3              EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
C4              EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNTDQEALG
C5              EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
                *******************************************.******

C1              TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
C2              TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
C3              TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
C4              TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
C5              TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRGPPRFNDT
                ******************************************.*******

C1              RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
C2              RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
C3              RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
C4              RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
C5              RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
                **************************************************

C1              VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
C2              VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
C3              VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
C4              VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
C5              VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
                **************************************************

C1              ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
C2              ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
C3              ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
C4              ATIASLNKYPAESKKSCSIFDRFRSSPTPTPYATALLPMNLEQAAETIYS
C5              ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
                ***********:*******************************:******

C1              KPESICPSRISYYASSQLTQPCSLSTPKSIRSNGNGNCTSGSGSLSLFGG
C2              KPESICPSRISYYASSQLTQPCSLSTPKSIRSNGNGNCTSGSGSLSLFGG
C3              KPESICPSRISYYASSQLTQPCSLSTPKSIRSNGNGNCTSGSGSLSLFGG
C4              KPESICPSRISYYASSQLTQACSLSTPKSIRSNGNGHCTSGSGSLSLFGG
C5              KPESICPSRISYYASSQLTQACSLSTPKSIRSNGNGHCTSGSGSLSLFGG
                ********************.***************:*************

C1              IPTGSTITMASHG-EKGNQRLRRITSVQPGALSYEELVKEGTFGRIYAGK
C2              IPTGSTITMASHGHEKGNQRLRRIPSVQPGALSYEELVKEGTFGRIYAGK
C3              IPTGSTITMASHG-EKGNQRLRRIPSVQPGALSYEELVREGTFGRIYAGK
C4              IPTGSTITMASHG-DKGNQRLRRIPSVQPGALSYEELVKEGTFGRIFAGK
C5              IPTGSTITMASHG-EKGNQRLRRIPSVQPGALSYEELVKEGTFGRIYAGK
                ************* :*********.*************:*******:***

C1              LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
C2              LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
C3              LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
C4              LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
C5              LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
                **************************************************

C1              GPPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
C2              GPPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
C3              GPPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
C4              GPPEIAYPYPSKGNLKIYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
C5              GPPEIAYPYPSKGNLKIYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
                ********:*******:*********************************

C1              LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
C2              LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
C3              LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
C4              LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
C5              LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
                **************************************************

C1              LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
C2              LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
C3              LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
C4              LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
C5              LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
                **************************************************

C1              FRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYI-
C2              FRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYI-
C3              FRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYIo
C4              FRLEQPVNCPDEFFTVMNCCWHSEAKQRPTPSQLLSYLQDFHADLGMYIo
C5              FRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYIo
                **********************.************************** 

C1              ----
C2              ----
C3              oooo
C4              o---
C5              oooo
                    




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  648 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  648 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13302]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [13302]--->[13168]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/231/Drl-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.372 Mb, Max= 30.919 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MELLPLKSPLPILLLCLTISTSVSGYLNIFISHHEVMKLMGLEADLFYVH
EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
KPESICPSRISYYASSQLTQPCSLSTPKSIRSNGNGNCTSGSGSLSLFGG
IPTGSTITMASHG-EKGNQRLRRITSVQPGALSYEELVKEGTFGRIYAGK
LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
GPPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
FRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYI-
----
>C2
MGLLTLD-LIPILLLCLTISTSVSGYLNIFISHHEVMKLMGLEADLFYVH
EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
KPESICPSRISYYASSQLTQPCSLSTPKSIRSNGNGNCTSGSGSLSLFGG
IPTGSTITMASHGHEKGNQRLRRIPSVQPGALSYEELVKEGTFGRIYAGK
LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
GPPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
FRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYI-
----
>C3
MGLLPLI-----LLLCLTMSTSVSGYLNIFISHHEVMKLMGLEADLFYVH
EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
KPESICPSRISYYASSQLTQPCSLSTPKSIRSNGNGNCTSGSGSLSLFGG
IPTGSTITMASHG-EKGNQRLRRIPSVQPGALSYEELVREGTFGRIYAGK
LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
GPPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
FRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYIo
oooo
>C4
MGLLPPP--IPILLFCLAISTSVSGYLNIFISHHEVMKLMGLEADLFYVH
EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNTDQEALG
TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
ATIASLNKYPAESKKSCSIFDRFRSSPTPTPYATALLPMNLEQAAETIYS
KPESICPSRISYYASSQLTQACSLSTPKSIRSNGNGHCTSGSGSLSLFGG
IPTGSTITMASHG-DKGNQRLRRIPSVQPGALSYEELVKEGTFGRIFAGK
LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
GPPEIAYPYPSKGNLKIYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
FRLEQPVNCPDEFFTVMNCCWHSEAKQRPTPSQLLSYLQDFHADLGMYIo
o---
>C5
MGLLPPP--LVLLLVCL---TSVSGYLNIFISHHEVMKLMGLEADLFYVH
EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRGPPRFNDT
RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
KPESICPSRISYYASSQLTQACSLSTPKSIRSNGNGHCTSGSGSLSLFGG
IPTGSTITMASHG-EKGNQRLRRIPSVQPGALSYEELVKEGTFGRIYAGK
LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
GPPEIAYPYPSKGNLKIYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
FRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYIo
oooo

FORMAT of file /tmp/tmp2059117015806567926aln Not Supported[FATAL:T-COFFEE]
>C1
MELLPLKSPLPILLLCLTISTSVSGYLNIFISHHEVMKLMGLEADLFYVH
EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
KPESICPSRISYYASSQLTQPCSLSTPKSIRSNGNGNCTSGSGSLSLFGG
IPTGSTITMASHG-EKGNQRLRRITSVQPGALSYEELVKEGTFGRIYAGK
LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
GPPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
FRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYI-
----
>C2
MGLLTLD-LIPILLLCLTISTSVSGYLNIFISHHEVMKLMGLEADLFYVH
EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
KPESICPSRISYYASSQLTQPCSLSTPKSIRSNGNGNCTSGSGSLSLFGG
IPTGSTITMASHGHEKGNQRLRRIPSVQPGALSYEELVKEGTFGRIYAGK
LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
GPPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
FRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYI-
----
>C3
MGLLPLI-----LLLCLTMSTSVSGYLNIFISHHEVMKLMGLEADLFYVH
EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
KPESICPSRISYYASSQLTQPCSLSTPKSIRSNGNGNCTSGSGSLSLFGG
IPTGSTITMASHG-EKGNQRLRRIPSVQPGALSYEELVREGTFGRIYAGK
LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
GPPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
FRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYIo
oooo
>C4
MGLLPPP--IPILLFCLAISTSVSGYLNIFISHHEVMKLMGLEADLFYVH
EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNTDQEALG
TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
ATIASLNKYPAESKKSCSIFDRFRSSPTPTPYATALLPMNLEQAAETIYS
KPESICPSRISYYASSQLTQACSLSTPKSIRSNGNGHCTSGSGSLSLFGG
IPTGSTITMASHG-DKGNQRLRRIPSVQPGALSYEELVKEGTFGRIFAGK
LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
GPPEIAYPYPSKGNLKIYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
FRLEQPVNCPDEFFTVMNCCWHSEAKQRPTPSQLLSYLQDFHADLGMYIo
o---
>C5
MGLLPPP--LVLLLVCL---TSVSGYLNIFISHHEVMKLMGLEADLFYVH
EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRGPPRFNDT
RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
KPESICPSRISYYASSQLTQACSLSTPKSIRSNGNGHCTSGSGSLSLFGG
IPTGSTITMASHG-EKGNQRLRRIPSVQPGALSYEELVKEGTFGRIYAGK
LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
GPPEIAYPYPSKGNLKIYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
FRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYIo
oooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:654 S:99 BS:654
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 99.07 C1	 C2	 99.07
TOP	    1    0	 99.07 C2	 C1	 99.07
BOT	    0    2	 99.22 C1	 C3	 99.22
TOP	    2    0	 99.22 C3	 C1	 99.22
BOT	    0    3	 97.37 C1	 C4	 97.37
TOP	    3    0	 97.37 C4	 C1	 97.37
BOT	    0    4	 98.13 C1	 C5	 98.13
TOP	    4    0	 98.13 C5	 C1	 98.13
BOT	    1    2	 99.38 C2	 C3	 99.38
TOP	    2    1	 99.38 C3	 C2	 99.38
BOT	    1    3	 97.68 C2	 C4	 97.68
TOP	    3    1	 97.68 C4	 C2	 97.68
BOT	    1    4	 98.13 C2	 C5	 98.13
TOP	    4    1	 98.13 C5	 C2	 98.13
BOT	    2    3	 97.52 C3	 C4	 97.52
TOP	    3    2	 97.52 C4	 C3	 97.52
BOT	    2    4	 98.60 C3	 C5	 98.60
TOP	    4    2	 98.60 C5	 C3	 98.60
BOT	    3    4	 98.29 C4	 C5	 98.29
TOP	    4    3	 98.29 C5	 C4	 98.29
AVG	 0	 C1	  *	 98.45
AVG	 1	 C2	  *	 98.57
AVG	 2	 C3	  *	 98.68
AVG	 3	 C4	  *	 97.72
AVG	 4	 C5	  *	 98.29
TOT	 TOT	  *	 98.34
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGAACTCCTTCCTCTGAAGTCGCCCCTCCCGATCCTGCTCCTATGCCT
C2              ATGGGACTCCTTACCCTGGAT---CTGATCCCGATCCTGCTCCTATGCCT
C3              ATGGGACTCCTTCCTCTGATC---------------CTGCTCCTATGCCT
C4              ATGGGACTCCTCCCGCCGCCC------ATCCCGATCCTGCTCTTCTGCCT
C5              ATGGGACTCCTCCCTCCGCCC------CTCGTGCTCCTCCTTGTATGCCT
                ****.****** .* * *                  ** **  *.*****

C1              AACCATTTCCACTTCGGTCAGCGGCTATCTGAACATTTTCATCAGCCACC
C2              CACCATTTCCACTTCGGTCAGCGGCTATCTGAACATTTTCATCAGCCACC
C3              AACCATGTCCACCTCGGTCAGCGGCTATCTGAACATTTTCATCAGCCACC
C4              GGCGATATCCACATCGGTCAGCGGCTATCTGAACATTTTCATCAGCCACC
C5              A---------ACGTCCGTCAGTGGCTATCTGAACATTTTCATCAGCCACC
                          ** ** ***** ****************************

C1              ACGAGGTGATGAAACTGATGGGACTCGAGGCGGACCTGTTCTATGTGCAC
C2              ACGAGGTGATGAAACTGATGGGACTCGAGGCGGACCTGTTCTATGTGCAC
C3              ACGAGGTGATGAAACTGATGGGACTCGAGGCGGACCTGTTCTATGTGCAC
C4              ACGAGGTGATGAAACTGATGGGACTCGAGGCGGACCTGTTCTATGTGCAC
C5              ACGAGGTGATGAAACTGATGGGACTCGAGGCGGACCTTTTCTATGTGCAC
                ************************************* ************

C1              GAGGGAGCCATCAACACATACGCAATGCACTTCACCGTCCCAGTGCCCGC
C2              GAGGGAGCCATCAACACATACGCAATGCACTTCACCGTTCCAGTGCCTGC
C3              GAGGGAGCCATCAACACATACGCAATGCACTTCACCGTTCCAGTGCCCGC
C4              GAGGGAGCCATCAACACATACGCGATGCACTTCACCGTCCCAGTGCCTGC
C5              GAGGGAGCCATCAACACATATGCGATGCACTTCACCGTTCCAGTGCCCGC
                ******************** **.************** ******** **

C1              GGATGTCCATGAGCTGGAGTTTTCCTGGCAGAGTCTGATTGCCTACCCAC
C2              GGATGTCCATGAGCTGGAGTTCTCCTGGCAGAGTCTGATTGCCTACCCAC
C3              GGATGTCCACGAGCTGGAGTTCTCCTGGCAGAGTCTGATTGCCTACCCAC
C4              GGATGTCCATGAGCTGGAGTTCTCCTGGCAGAGTCTCATCGCCTACCCGC
C5              GGATGTCCATGAGCTGGAGTTCTCCTGGCAGAGTCTCATTGCCTATCCAC
                ********* *********** ************** ** ***** **.*

C1              TGCCATACGCCATTAGTATTGAGTATAACAACGACCAGGAGGCACTGGGC
C2              TGCCATACGCCATTAGTATCGAGTACAACAACGACCAGGAGGCACTGGGC
C3              TGCCCTACGCCATTAGTATTGAGTACAACAACGACCAGGAGGCACTGGGC
C4              TGCCGTATGCCATCAGTATCGAGTACAACACCGACCAGGAGGCACTGGGC
C5              TGCCGTATGCTATAAGTATCGAGTACAACAACGACCAGGAGGCATTGGGC
                **** ** ** ** ***** ***** ****.************* *****

C1              ACGCCCACGTTGAGCATTCCGCACAAGGGTCTGGTGCCACAGGAGATCGA
C2              ACGCCCACGCTGAGCATTCCGCACAAGGGGCTGGTGCCACAGGAGATCGA
C3              ACGCCCACGCTGAGCATACCGCACAAGGGTCTGGTTCCACAGGAGATCGA
C4              ACGCCCACGCTGAGTATTCCGCACAAGGGTCTGGTGCCGCAGGAGATCGA
C5              ACACCCACGCTGAGTATTCCGCACAAGGGTCTGGTTCCACAGGAGATCGA
                **.****** **** **:*********** ***** **.***********

C1              GTCCTTCCTGGTTTACCTGCCCTGCACCGGAAATGCGAGCCTACAGATGC
C2              GTCCTTCCTGGTTTACCTGCCCTGCACCGGAAATGCGAGCCTACAGATGC
C3              GTCCTTCCTGGTTTACCTGCCCTGCACCGGAAATGCGAGCCTACAGATGC
C4              GTCCTTCCTGGTCTACCTGCCCTGCACCGGAAATGCGAGCCTGCAGATGC
C5              GTCCTTCCTGGTTTACCTGCCCTGCACGGGAAATGCGAGCCTGCAGATGC
                ************ ************** **************.*******

C1              CCGTCAATGTCAACATGGTAGTACGGGCTCCTCCTCGATTCAACGACACC
C2              CCGTCAATGTCAACATGGTGGTGCGTGCTCCTCCTCGATTCAACGACACC
C3              CCGTCAATGTCAACATGGTGGTGCGTGCTCCTCCGCGATTCAACGACACC
C4              CCGTCAATGTCAACATGGTGGTGCGAGCTCCACCCCGTTTCAACGACACC
C5              CCGTCAATGTCAACATGGTGGTGCGTGGCCCTCCTCGATTCAACGACACC
                *******************.**.** *  **:** **:************

C1              CGGCTCCACTTTAAGCGCAATAAGATCTGCGCCAAAGGCATCTCACCTGA
C2              CGGCTCCACTTCAAGCGCAATAAGATCTGCGCCAAAGGCATCTCACCTGA
C3              CGGCTCCACTTCAAGCGCAACAAGATCTGCGCCAAGGGCATCTCACCTGA
C4              CGGCTCCACTTCAAGCGCAACAAGATCTGCGCCAAAGGCATCTCACCCGA
C5              CGCCTCCACTTCAAGCGGAATAAGATCTGCGCCAAAGGCATCTCACCTGA
                ** ******** ***** ** **************.*********** **

C1              GCCCAATCAATCGCCGGCGCCAGCCCACGCACCCTCCCAAGGACCCGCCC
C2              GCCCAATCAATCGCCGGCGCCAGCCCACGCCCCCTCCCAAGGACCCGCCC
C3              GCCCAATCAATCGCCGGCGCCAGCCCATGCCCCCTCCCAAGGACCCGCCC
C4              GCCCAATCAATCGCCAGCCCCCGCCCACGCCCCCTCACAGGGACCCGCCC
C5              GCCCAATCAATCGCCAGCCCCCGCCCACGCTCCCTCGCAAGGACCCGCCC
                ***************.** **.***** ** ***** **.**********

C1              TCCTCAGTGCCGCCGCCTGTGCTCTGGGTTTGGTTTTGGCCGTGGGACTA
C2              TGCTCAGTGCCGCCGCCTGTGCTCTGGGCTTGGTTTTGGCCGTGGGTCTA
C3              TGCTCAGTGCCGCCGCCTGTGCTCTGGGTTTGGTTCTGGCCGTGGGTCTA
C4              TCCTGAGTGCCGCCGCCTGTGCCCTGGGTTTGGTTTTGGCCGTGGGCCTG
C5              TCCTGAGTGCAGCCGCCTGTGCTCTTGGTTTGGTTTTGGCCGTAGGTCTA
                * ** *****.*********** ** ** ****** *******.** **.

C1              GTGGCCAGCATGATGTATGTGAGGGCGCGCAAACAGCTTCGCCAGGACTC
C2              GTGGCCAGCATGATGTATGTGAGGGCGCGCAAACAGCTTCGCCAGGACTC
C3              GTGGCCAGCATGATGTATGTGAGGGCGCGCAAACAGCTTCGCCAGGACTC
C4              GTTGCCAGCATGATGTATGTTAGGGCGCGCAAACAGCTTCGCCAGGACTC
C5              GTGGCCAGCATGATGTATGTGAGGGCGCGCAAACAGCTTCGCCAGGACTC
                ** ***************** *****************************

C1              GCTACACACCAGTTTCACCACCGCAGCTTATGGCAGCCACCAAAACGTGT
C2              GCTACACACCAGCTTCACCACCGCAGCTTATGGCAGCCACCAAAACGTGT
C3              GCTGCACACCAGCTTCACCACCGCAGCTTATGGCAGCCACCAAAACGTGT
C4              GCTACACACCAGTTTCACCACCGCAGCTTATGGCAGCCACCAGAACGTGT
C5              GCTACACACCAGTTTCACCACCGCAGCTTATGGCAGCCACCAGAACGTGT
                ***.******** *****************************.*******

C1              TCATCCGACTGGATCCCCTGGGAAGACCGCCGAGTGCCACGGGATCCTAT
C2              TCATCCGGCTGGATCCCCTGGGAAGACCGCCGAGTGCCACGGGCTCCTAT
C3              TCATCCGCCTGGATCCCCTGGGAAGACCGCCGAGCGCCACTGGATCCTAT
C4              TCATCCGACTGGATCCCCTGGGAAGACCCCCGAGTGCCACGGGATCCTAT
C5              TCATCCGTCTGGATCCCCTGGGAAGACCGCCGAGTGCCACGGGATCCTAT
                ******* ******************** ***** ***** **.******

C1              GCGACCATTGCCAGCCTCAACAAATACCCTGCGGACAGCAAAAAGTCGTG
C2              GCGACCATTGCCAGCCTCAACAAATACCCTGCGGACAGCAAAAAGTCGTG
C3              GCGACCATTGCCAGCCTCAACAAATACCCTGCGGACAGCAAAAAGTCGTG
C4              GCCACCATAGCCAGCCTCAACAAATACCCTGCGGAGAGCAAGAAGTCGTG
C5              GCCACCATAGCCAGCCTCAACAAATACCCAGCGGACAGCAAGAAGTCATG
                ** *****:********************:***** *****.*****.**

C1              CAGCATATTCGACCGTTTCCGGAGCTCACCCACCCCCACGCCGTATGCCA
C2              CAGCATATTCGACCGTTTCCGGAGCTCACCCACCCCCACGCCGTATGCCA
C3              CAGCATATTCGACCGTTTCAGGAGCTCACCCACACCCACGCCGTATGCCA
C4              CAGCATATTCGACCGTTTCAGGAGCTCACCCACTCCCACGCCCTACGCCA
C5              CAGCATATTCGACCGTTTCAGGAGCTCACCCACACCCACGCCTTACGCCA
                *******************.************* ******** ** ****

C1              CCGCCCTGCTGCCCATGAACCTTGAACAGACCGCAGAGACGATTTACTCG
C2              CCGCCCTGCTGCCCATGAACCTCGAGCAGACCGCAGAGACGATTTACTCG
C3              CCGCCCTGCTGCCCATGAACCTGGAACAGACCGCAGAGACGATTTACTCC
C4              CTGCCCTGCTGCCCATGAACCTCGAACAGGCCGCAGAGACGATTTACTCG
C5              CTGCGTTGCTGCCCATGAACCTTGAACAGACCGCAGAGACGATTTACTCG
                * **  **************** **.***.******************* 

C1              AAGCCAGAGTCGATCTGTCCCTCGAGGATTTCCTACTACGCCTCCTCGCA
C2              AAGCCAGAGTCGATCTGTCCCTCGAGGATTTCCTACTACGCCTCCTCGCA
C3              AAGCCGGAGTCGATCTGTCCCTCGAGGATTTCCTACTACGCCTCCTCGCA
C4              AAGCCCGAGTCGATCTGTCCCTCGAGGATATCCTACTACGCCTCCTCGCA
C5              AAGCCAGAGTCGATCTGTCCCTCGAGGATTTCCTACTACGCCTCCTCGCA
                ***** ***********************:********************

C1              ACTGACCCAGCCTTGCAGCCTATCGACGCCGAAGAGCATCCGAAGCAACG
C2              ACTGACCCAGCCCTGCAGCCTCTCAACACCGAAGAGCATTCGCAGCAATG
C3              ACTGACCCAGCCTTGCAGCCTGTCGACGCCAAAGAGCATTCGCAGCAACG
C4              ACTGACCCAGGCCTGCAGTTTGTCAACGCCGAAGAGCATTCGAAGCAATG
C5              ACTGACCCAGGCCTGCAGTCTCTCCACGCCGAAGAGCATTCGTAGCAATG
                ********** * *****  * ** **.**.******** ** ***** *

C1              GCAATGGCAACTGCACCAGCGGAAGTGGCAGCCTAAGCCTTTTTGGAGGC
C2              GGAATGGCAACTGCACCAGCGGAAGTGGCAGCTTGAGCCTTTTTGGGGGC
C3              GCAATGGCAACTGCACCAGTGGAAGTGGCAGCCTCAGTCTTTTTGGTGGC
C4              GCAATGGTCATTGCACTAGCGGAAGTGGCAGCTTGAGTCTTTTTGGGGGA
C5              GCAATGGTCATTGCACTAGCGGAAGCGGAAGTTTAAGTCTTTTTGGGGGA
                * ***** .* ***** ** ***** **.**  * ** ******** **.

C1              ATCCCCACCGGCAGCACCATCACCATGGCCAGTCACGGG---GAGAAGGG
C2              ATCCCCACCGGCAGCACCATCACCATGGCCAGTCACGGCCATGAGAAGGG
C3              ATCCCCACCGGCAGCACCATCACCATGGCCAGTCACGGC---GAGAAGGG
C4              ATCCCCACTGGCAGCACCATCACAATGGCCAGTCACGGG---GACAAGGG
C5              ATCCCCACGGGAAGCACAATAACCATGGCCAGTCATGGC---GAGAAGGG
                ******** **.*****.**.**.*********** **    ** *****

C1              TAACCAACGGCTGCGACGGATAACCAGCGTCCAGCCCGGTGCCCTCAGCT
C2              CAACCAGCGGCTGCGACGGATACCCAGCGTCCAGCCGGGCGCCCTCAGCT
C3              CAACCAGCGGCTGCGACGGATACCCAGTGTCCAGCCCGGCGCCCTCAGCT
C4              AAACCAGAGGCTGCGACGCATCCCGAGTGTCCAGCCCGGTGCCCTCAGCT
C5              AAACCAGCGTCTGCGACGTATTCCCAGTGTCCAGCCGGGTGCCCTTAGCT
                 *****..* ******** ** .* ** ******** ** ***** ****

C1              ACGAGGAGCTGGTCAAGGAGGGCACCTTCGGCCGGATTTACGCCGGCAAG
C2              ATGAGGAGCTGGTCAAGGAGGGCACCTTCGGCAGGATCTATGCCGGCAAG
C3              ACGAGGAGCTGGTCAGGGAGGGCACCTTCGGCAGGATCTATGCCGGCAAG
C4              ACGAGGAGCTGGTCAAGGAGGGCACCTTCGGCAGGATCTTCGCCGGCAAG
C5              ATGAGGAGCTGGTCAAGGAAGGCACTTTTGGCAGGATATATGCCGGGAAG
                * *************.***.***** ** ***.**** *: ***** ***

C1              CTGGGCGAGTCATGCGAGGCGCTCGTAAAGACCGTCATCGATGGCGCATC
C2              CTGGGCGAGTCCTGCGAGGCGCTGGTGAAGACCGTCATCGATGGCGCCTC
C3              CTGGGCGAGTCCTGCGAGGCGCTGGTGAAGACCGTCATCGATGGCGCCTC
C4              CTGGGCGAGTCCTGCGAGGCGCTGGTGAAGACCGTCATCGACGGTGCCTC
C5              TTGGGTGAATCCTGTGAGGCACTCGTTAAGACAGTCATCGATGGGGCCTC
                 **** **.**.** *****.** ** *****.******** ** **.**

C1              GCTCACCCAGGTGGCCTGCCTGCTGCAGGACGCCTCCCTGCTGATCGGCG
C2              GCTCACCCAGGTGGCCTGCCTGCTGCAGGACGCCTCCCTGCTGATCGGCG
C3              GCTCACCCAGGTGGCCTGCCTGCTGCAGGACGCCTCCCTGCTGATCGGCG
C4              GCTCACCCAGGTGGCCTGTCTGCTGCAGGACGCCTCGCTCCTGATCGGCG
C5              GCTCACCCAAGTGGCATGTCTGCTGCAAGATGCCTCGCTACTGATTGGGG
                *********.*****.** ********.** ***** ** ***** ** *

C1              TCAGTCATCAGCACATCCTGGCACCGCTGTTGGCCAACACGGAGCTGCCG
C2              TCAGTCATCAGCACATCCTGGCACCGCTGCTGGCCAACACGGAGCTGCCG
C3              TCAGTCATCAGCACATCCTGGCACCGCTGCTGGCCAACACGGAGCTGCCG
C4              TCAGCCACCAGCACATCCTGGCCCCACTGCTGGCCAACACGGAGCTGCCG
C5              TCAGTCATCAGCATATATTGGCACCGCTGTTGGCTAACACAGAGCTGCCG
                **** ** ***** **. ****.**.*** **** *****.*********

C1              GGTCCACCGGAGATTGCCTATCCCCATCCGTCCAAGGGCAATCTCAAGAT
C2              GGTCCGCCGGAGATCGCCTATCCCCATCCATCCAAGGGCAATCTCAAGAT
C3              GGTCCGCCGGAGATAGCCTATCCCCATCCGTCCAAGGGCAATCTCAAGAT
C4              GGTCCGCCGGAGATCGCCTATCCCTATCCGTCCAAGGGCAATCTCAAAAT
C5              GGTCCACCGGAGATCGCCTATCCCTATCCGTCCAAGGGCAATCTCAAGAT
                *****.******** ********* ****.*****************.**

C1              GTACTTGCAAAAGTCGCGGGAATCGAGCACAGCATTGAGTACGCGCCAAC
C2              GTACTTGCAAAAGTCGCGGGAGTCGAGCACGGCATTGAGTACGCGCCAAC
C3              GTACTTGCAAAAGTCGCGGGAATCGAGCACGGCATTGAGTACGCGCCAGC
C4              ATACTTGCAAAAGTCTCGGGAATCGAGCACGGCACTAAGTACCCGGCAGC
C5              ATACTTGCAAAAATCGCGGGAGTCCAGCACGGCTTTGAGTACCCGGCAGC
                .***********.** *****.** *****.**: *.***** ** **.*

C1              TGGTTGAGTTTGGGCTGCACATCACCAAGGGATTGGCCTATCTGCACTCA
C2              TGGTCGAGTTTGGGCTGCACATCACCAAGGGATTGGCCTATCTGCACTCC
C3              TGGTTGAGTTTGGGCTGCACATCACCAAGGGATTGGCCTATCTGCACTCC
C4              TGGTGGAGTTTGGACTGCACATCACTAAGGGATTGGCCTATCTGCACTCC
C5              TGGTTGAGTTTGGGCTGCACATCACCAAGGGACTAGCCTATCTGCACTCT
                **** ********.*********** ****** *.************** 

C1              CTGGGAATCGTTCACAAGGACATTGCTACACGCAATTGCTACCTTGACGA
C2              CTGGGCATCGTGCACAAGGACATTGCCACACGCAACTGCTACCTGGACGA
C3              CTGGGAATCGTGCACAAGGACATTGCCACACGCAATTGCTACCTTGACGA
C4              CTGGGAATCGTCCACAAGGACATTGCCACACGCAATTGCTACCTTGACGA
C5              CTGGGAATTGTTCACAAGGACATTGCTACTCGCAATTGCTACCTTGACGA
                *****.** ** ************** **:***** ******** *****

C1              AGAGTCCTATGTGAAGATCTGCGATAGCGCCCTCTCTCGCGATCTCTTCC
C2              AGAGTCCTATGTGAAGATCTGCGACAGCGCCCTGTCCCGCGATCTCTTCC
C3              GGAGTCCTATGTGAAGATCTGCGACAGCGCCCTGTCCCGCGATCTCTTCC
C4              AGAGTCCTATGTGAAGATCTGCGATAGCGCCCTGTCGCGCGATCTCTTCC
C5              AGAGTCCTATGTGAAGATCTGCGATAGTGCCCTGTCCCGCGATCTCTTCC
                .*********************** ** ***** ** *************

C1              CAGACGACTACGACTGTCTGGGCGACAATGAGAATCGCCCGCTGAAGTGG
C2              CGGACGACTACGACTGCCTGGGCGACAATGAGAACCGGCCGCTGAAGTGG
C3              CGGACGACTACGACTGTCTGGGCGACAATGAGAATCGGCCACTGAAGTGG
C4              CAGACGATTACGACTGTTTGGGTGACAACGAGAATCGCCCCCTGAAGTGG
C5              CCGACGACTACGACTGTCTGGGTGACAATGAGAATCGCCCACTGAAGTGG
                * ***** ********  **** ***** ***** ** ** *********

C1              CTGTCGCTGGAATCCCTCCAGAAGCGGGTCTATGCCACCCAGGGCGACGT
C2              CTGTCGCTGGAGTCGCTCCAGAAACGGGTCTATGCCACGCAGGGCGATGT
C3              CTATCGCTGGAATCGCTCCAGAAACGGGTCTATGCCACCCAGGGCGATGT
C4              CTATCGCTGGAATCGCTCCAAAAAAGGGTTTACGCCACCCAGGGGGATGT
C5              CTATCGCTGGAATCTCTTCAGAAACGGGTGTACGCCACCCAGGGTGATGT
                **.********.** ** **.**..**** ** ***** ***** ** **

C1              GTGGGCCTTGGGCGTGACCTACTGGGAGCTGGTCACTCTGGCGCAGATGC
C2              GTGGGCCTTGGGGGTCACCTACTGGGAGCTGGTCACCCTGGCCCAGATGC
C3              GTGGGCCTTGGGCGTGACCTACTGGGAGCTGGTCACGCTGGCCCAGATGC
C4              GTGGGCGTTGGGCGTGACCTACTGGGAGCTGGTCACACTGGCCCAGATGC
C5              ATGGGCGTTGGGTGTGACCTATTGGGAGCTGGTCACACTGGCACAGATGC
                .***** ***** ** ***** ************** ***** *******

C1              CGCACGAGGAGGTGGATATATTCGAGCTTACCAATTACTTGGCTGCCGGC
C2              CGCACGAGGAGGTGGACATATTCGAGCTTACCAATTACTTGGCCGCCGGC
C3              CGCACGAGGAGGTGGATATATTCGAGCTTACCAATTACTTGGCTGCCGGC
C4              CGCACGAGGAGGTGGACATTTTCGAGCTTACCAATTACTTGGCTGCCGGC
C5              CACACGAGGAGGTGGATATATTCGAGCTTACCAATTACTTGGCTGCCGGT
                *.************** **:*********************** ***** 

C1              TTCCGGCTGGAGCAGCCAGTCAACTGCCCAGATGAATTCTTTACGGTTAT
C2              TTCCGGCTGGAGCAGCCCGTCAACTGCCCAGATGAATTCTTTACGGTCAT
C3              TTCCGGCTGGAGCAGCCCGTCAACTGCCCAGATGAATTCTTCACGGTCAT
C4              TTTCGGCTGGAGCAGCCGGTCAACTGCCCAGATGAATTCTTTACCGTTAT
C5              TTCCGGTTGGAGCAGCCCGTCAACTGCCCAGATGAATTCTTTACCGTTAT
                ** *** ********** *********************** ** ** **

C1              GAACTGCTGCTGGCACTGCGAGGCCAAACAGCGACCTACGCCCTCACAGT
C2              GAACTGCTGCTGGCACTGCGAGGCCAAACAGCGACCCACGCCCTCCCAGT
C3              GAACTGCTGCTGGCACTGCGAGGCCAAACAGCGACCCACACCCTCCCAGT
C4              GAACTGCTGCTGGCACAGCGAGGCCAAACAGCGACCTACGCCCTCACAGT
C5              GAACTGCTGTTGGCACTGCGAGGCCAAACAACGGCCCACGCCCTCGCAAC
                ********* ******:*************.**.** **.***** **. 

C1              TGCTATCGTATCTGCAGGACTTCCATGCGGATCTGGGCATGTACATC---
C2              TGCTATCGTATCTGCAGGACTTCCATGCGGATCTGGGCATGTACATC---
C3              TGCTATCGTATCTGCAGGACTTCCATGCGGATCTGGGCATGTACATC---
C4              TGCTCTCGTATCTGCAGGACTTCCATGCGGATCTGGGCATGTACATC---
C5              TGCTCTCGTATCTGCAGGACTTCCATGCGGATCTCGGTATGTACATC---
                ****.***************************** ** *********   

C1              ------------
C2              ------------
C3              ------------
C4              ------------
C5              ------------
                            



>C1
ATGGAACTCCTTCCTCTGAAGTCGCCCCTCCCGATCCTGCTCCTATGCCT
AACCATTTCCACTTCGGTCAGCGGCTATCTGAACATTTTCATCAGCCACC
ACGAGGTGATGAAACTGATGGGACTCGAGGCGGACCTGTTCTATGTGCAC
GAGGGAGCCATCAACACATACGCAATGCACTTCACCGTCCCAGTGCCCGC
GGATGTCCATGAGCTGGAGTTTTCCTGGCAGAGTCTGATTGCCTACCCAC
TGCCATACGCCATTAGTATTGAGTATAACAACGACCAGGAGGCACTGGGC
ACGCCCACGTTGAGCATTCCGCACAAGGGTCTGGTGCCACAGGAGATCGA
GTCCTTCCTGGTTTACCTGCCCTGCACCGGAAATGCGAGCCTACAGATGC
CCGTCAATGTCAACATGGTAGTACGGGCTCCTCCTCGATTCAACGACACC
CGGCTCCACTTTAAGCGCAATAAGATCTGCGCCAAAGGCATCTCACCTGA
GCCCAATCAATCGCCGGCGCCAGCCCACGCACCCTCCCAAGGACCCGCCC
TCCTCAGTGCCGCCGCCTGTGCTCTGGGTTTGGTTTTGGCCGTGGGACTA
GTGGCCAGCATGATGTATGTGAGGGCGCGCAAACAGCTTCGCCAGGACTC
GCTACACACCAGTTTCACCACCGCAGCTTATGGCAGCCACCAAAACGTGT
TCATCCGACTGGATCCCCTGGGAAGACCGCCGAGTGCCACGGGATCCTAT
GCGACCATTGCCAGCCTCAACAAATACCCTGCGGACAGCAAAAAGTCGTG
CAGCATATTCGACCGTTTCCGGAGCTCACCCACCCCCACGCCGTATGCCA
CCGCCCTGCTGCCCATGAACCTTGAACAGACCGCAGAGACGATTTACTCG
AAGCCAGAGTCGATCTGTCCCTCGAGGATTTCCTACTACGCCTCCTCGCA
ACTGACCCAGCCTTGCAGCCTATCGACGCCGAAGAGCATCCGAAGCAACG
GCAATGGCAACTGCACCAGCGGAAGTGGCAGCCTAAGCCTTTTTGGAGGC
ATCCCCACCGGCAGCACCATCACCATGGCCAGTCACGGG---GAGAAGGG
TAACCAACGGCTGCGACGGATAACCAGCGTCCAGCCCGGTGCCCTCAGCT
ACGAGGAGCTGGTCAAGGAGGGCACCTTCGGCCGGATTTACGCCGGCAAG
CTGGGCGAGTCATGCGAGGCGCTCGTAAAGACCGTCATCGATGGCGCATC
GCTCACCCAGGTGGCCTGCCTGCTGCAGGACGCCTCCCTGCTGATCGGCG
TCAGTCATCAGCACATCCTGGCACCGCTGTTGGCCAACACGGAGCTGCCG
GGTCCACCGGAGATTGCCTATCCCCATCCGTCCAAGGGCAATCTCAAGAT
GTACTTGCAAAAGTCGCGGGAATCGAGCACAGCATTGAGTACGCGCCAAC
TGGTTGAGTTTGGGCTGCACATCACCAAGGGATTGGCCTATCTGCACTCA
CTGGGAATCGTTCACAAGGACATTGCTACACGCAATTGCTACCTTGACGA
AGAGTCCTATGTGAAGATCTGCGATAGCGCCCTCTCTCGCGATCTCTTCC
CAGACGACTACGACTGTCTGGGCGACAATGAGAATCGCCCGCTGAAGTGG
CTGTCGCTGGAATCCCTCCAGAAGCGGGTCTATGCCACCCAGGGCGACGT
GTGGGCCTTGGGCGTGACCTACTGGGAGCTGGTCACTCTGGCGCAGATGC
CGCACGAGGAGGTGGATATATTCGAGCTTACCAATTACTTGGCTGCCGGC
TTCCGGCTGGAGCAGCCAGTCAACTGCCCAGATGAATTCTTTACGGTTAT
GAACTGCTGCTGGCACTGCGAGGCCAAACAGCGACCTACGCCCTCACAGT
TGCTATCGTATCTGCAGGACTTCCATGCGGATCTGGGCATGTACATC---
------------
>C2
ATGGGACTCCTTACCCTGGAT---CTGATCCCGATCCTGCTCCTATGCCT
CACCATTTCCACTTCGGTCAGCGGCTATCTGAACATTTTCATCAGCCACC
ACGAGGTGATGAAACTGATGGGACTCGAGGCGGACCTGTTCTATGTGCAC
GAGGGAGCCATCAACACATACGCAATGCACTTCACCGTTCCAGTGCCTGC
GGATGTCCATGAGCTGGAGTTCTCCTGGCAGAGTCTGATTGCCTACCCAC
TGCCATACGCCATTAGTATCGAGTACAACAACGACCAGGAGGCACTGGGC
ACGCCCACGCTGAGCATTCCGCACAAGGGGCTGGTGCCACAGGAGATCGA
GTCCTTCCTGGTTTACCTGCCCTGCACCGGAAATGCGAGCCTACAGATGC
CCGTCAATGTCAACATGGTGGTGCGTGCTCCTCCTCGATTCAACGACACC
CGGCTCCACTTCAAGCGCAATAAGATCTGCGCCAAAGGCATCTCACCTGA
GCCCAATCAATCGCCGGCGCCAGCCCACGCCCCCTCCCAAGGACCCGCCC
TGCTCAGTGCCGCCGCCTGTGCTCTGGGCTTGGTTTTGGCCGTGGGTCTA
GTGGCCAGCATGATGTATGTGAGGGCGCGCAAACAGCTTCGCCAGGACTC
GCTACACACCAGCTTCACCACCGCAGCTTATGGCAGCCACCAAAACGTGT
TCATCCGGCTGGATCCCCTGGGAAGACCGCCGAGTGCCACGGGCTCCTAT
GCGACCATTGCCAGCCTCAACAAATACCCTGCGGACAGCAAAAAGTCGTG
CAGCATATTCGACCGTTTCCGGAGCTCACCCACCCCCACGCCGTATGCCA
CCGCCCTGCTGCCCATGAACCTCGAGCAGACCGCAGAGACGATTTACTCG
AAGCCAGAGTCGATCTGTCCCTCGAGGATTTCCTACTACGCCTCCTCGCA
ACTGACCCAGCCCTGCAGCCTCTCAACACCGAAGAGCATTCGCAGCAATG
GGAATGGCAACTGCACCAGCGGAAGTGGCAGCTTGAGCCTTTTTGGGGGC
ATCCCCACCGGCAGCACCATCACCATGGCCAGTCACGGCCATGAGAAGGG
CAACCAGCGGCTGCGACGGATACCCAGCGTCCAGCCGGGCGCCCTCAGCT
ATGAGGAGCTGGTCAAGGAGGGCACCTTCGGCAGGATCTATGCCGGCAAG
CTGGGCGAGTCCTGCGAGGCGCTGGTGAAGACCGTCATCGATGGCGCCTC
GCTCACCCAGGTGGCCTGCCTGCTGCAGGACGCCTCCCTGCTGATCGGCG
TCAGTCATCAGCACATCCTGGCACCGCTGCTGGCCAACACGGAGCTGCCG
GGTCCGCCGGAGATCGCCTATCCCCATCCATCCAAGGGCAATCTCAAGAT
GTACTTGCAAAAGTCGCGGGAGTCGAGCACGGCATTGAGTACGCGCCAAC
TGGTCGAGTTTGGGCTGCACATCACCAAGGGATTGGCCTATCTGCACTCC
CTGGGCATCGTGCACAAGGACATTGCCACACGCAACTGCTACCTGGACGA
AGAGTCCTATGTGAAGATCTGCGACAGCGCCCTGTCCCGCGATCTCTTCC
CGGACGACTACGACTGCCTGGGCGACAATGAGAACCGGCCGCTGAAGTGG
CTGTCGCTGGAGTCGCTCCAGAAACGGGTCTATGCCACGCAGGGCGATGT
GTGGGCCTTGGGGGTCACCTACTGGGAGCTGGTCACCCTGGCCCAGATGC
CGCACGAGGAGGTGGACATATTCGAGCTTACCAATTACTTGGCCGCCGGC
TTCCGGCTGGAGCAGCCCGTCAACTGCCCAGATGAATTCTTTACGGTCAT
GAACTGCTGCTGGCACTGCGAGGCCAAACAGCGACCCACGCCCTCCCAGT
TGCTATCGTATCTGCAGGACTTCCATGCGGATCTGGGCATGTACATC---
------------
>C3
ATGGGACTCCTTCCTCTGATC---------------CTGCTCCTATGCCT
AACCATGTCCACCTCGGTCAGCGGCTATCTGAACATTTTCATCAGCCACC
ACGAGGTGATGAAACTGATGGGACTCGAGGCGGACCTGTTCTATGTGCAC
GAGGGAGCCATCAACACATACGCAATGCACTTCACCGTTCCAGTGCCCGC
GGATGTCCACGAGCTGGAGTTCTCCTGGCAGAGTCTGATTGCCTACCCAC
TGCCCTACGCCATTAGTATTGAGTACAACAACGACCAGGAGGCACTGGGC
ACGCCCACGCTGAGCATACCGCACAAGGGTCTGGTTCCACAGGAGATCGA
GTCCTTCCTGGTTTACCTGCCCTGCACCGGAAATGCGAGCCTACAGATGC
CCGTCAATGTCAACATGGTGGTGCGTGCTCCTCCGCGATTCAACGACACC
CGGCTCCACTTCAAGCGCAACAAGATCTGCGCCAAGGGCATCTCACCTGA
GCCCAATCAATCGCCGGCGCCAGCCCATGCCCCCTCCCAAGGACCCGCCC
TGCTCAGTGCCGCCGCCTGTGCTCTGGGTTTGGTTCTGGCCGTGGGTCTA
GTGGCCAGCATGATGTATGTGAGGGCGCGCAAACAGCTTCGCCAGGACTC
GCTGCACACCAGCTTCACCACCGCAGCTTATGGCAGCCACCAAAACGTGT
TCATCCGCCTGGATCCCCTGGGAAGACCGCCGAGCGCCACTGGATCCTAT
GCGACCATTGCCAGCCTCAACAAATACCCTGCGGACAGCAAAAAGTCGTG
CAGCATATTCGACCGTTTCAGGAGCTCACCCACACCCACGCCGTATGCCA
CCGCCCTGCTGCCCATGAACCTGGAACAGACCGCAGAGACGATTTACTCC
AAGCCGGAGTCGATCTGTCCCTCGAGGATTTCCTACTACGCCTCCTCGCA
ACTGACCCAGCCTTGCAGCCTGTCGACGCCAAAGAGCATTCGCAGCAACG
GCAATGGCAACTGCACCAGTGGAAGTGGCAGCCTCAGTCTTTTTGGTGGC
ATCCCCACCGGCAGCACCATCACCATGGCCAGTCACGGC---GAGAAGGG
CAACCAGCGGCTGCGACGGATACCCAGTGTCCAGCCCGGCGCCCTCAGCT
ACGAGGAGCTGGTCAGGGAGGGCACCTTCGGCAGGATCTATGCCGGCAAG
CTGGGCGAGTCCTGCGAGGCGCTGGTGAAGACCGTCATCGATGGCGCCTC
GCTCACCCAGGTGGCCTGCCTGCTGCAGGACGCCTCCCTGCTGATCGGCG
TCAGTCATCAGCACATCCTGGCACCGCTGCTGGCCAACACGGAGCTGCCG
GGTCCGCCGGAGATAGCCTATCCCCATCCGTCCAAGGGCAATCTCAAGAT
GTACTTGCAAAAGTCGCGGGAATCGAGCACGGCATTGAGTACGCGCCAGC
TGGTTGAGTTTGGGCTGCACATCACCAAGGGATTGGCCTATCTGCACTCC
CTGGGAATCGTGCACAAGGACATTGCCACACGCAATTGCTACCTTGACGA
GGAGTCCTATGTGAAGATCTGCGACAGCGCCCTGTCCCGCGATCTCTTCC
CGGACGACTACGACTGTCTGGGCGACAATGAGAATCGGCCACTGAAGTGG
CTATCGCTGGAATCGCTCCAGAAACGGGTCTATGCCACCCAGGGCGATGT
GTGGGCCTTGGGCGTGACCTACTGGGAGCTGGTCACGCTGGCCCAGATGC
CGCACGAGGAGGTGGATATATTCGAGCTTACCAATTACTTGGCTGCCGGC
TTCCGGCTGGAGCAGCCCGTCAACTGCCCAGATGAATTCTTCACGGTCAT
GAACTGCTGCTGGCACTGCGAGGCCAAACAGCGACCCACACCCTCCCAGT
TGCTATCGTATCTGCAGGACTTCCATGCGGATCTGGGCATGTACATC---
------------
>C4
ATGGGACTCCTCCCGCCGCCC------ATCCCGATCCTGCTCTTCTGCCT
GGCGATATCCACATCGGTCAGCGGCTATCTGAACATTTTCATCAGCCACC
ACGAGGTGATGAAACTGATGGGACTCGAGGCGGACCTGTTCTATGTGCAC
GAGGGAGCCATCAACACATACGCGATGCACTTCACCGTCCCAGTGCCTGC
GGATGTCCATGAGCTGGAGTTCTCCTGGCAGAGTCTCATCGCCTACCCGC
TGCCGTATGCCATCAGTATCGAGTACAACACCGACCAGGAGGCACTGGGC
ACGCCCACGCTGAGTATTCCGCACAAGGGTCTGGTGCCGCAGGAGATCGA
GTCCTTCCTGGTCTACCTGCCCTGCACCGGAAATGCGAGCCTGCAGATGC
CCGTCAATGTCAACATGGTGGTGCGAGCTCCACCCCGTTTCAACGACACC
CGGCTCCACTTCAAGCGCAACAAGATCTGCGCCAAAGGCATCTCACCCGA
GCCCAATCAATCGCCAGCCCCCGCCCACGCCCCCTCACAGGGACCCGCCC
TCCTGAGTGCCGCCGCCTGTGCCCTGGGTTTGGTTTTGGCCGTGGGCCTG
GTTGCCAGCATGATGTATGTTAGGGCGCGCAAACAGCTTCGCCAGGACTC
GCTACACACCAGTTTCACCACCGCAGCTTATGGCAGCCACCAGAACGTGT
TCATCCGACTGGATCCCCTGGGAAGACCCCCGAGTGCCACGGGATCCTAT
GCCACCATAGCCAGCCTCAACAAATACCCTGCGGAGAGCAAGAAGTCGTG
CAGCATATTCGACCGTTTCAGGAGCTCACCCACTCCCACGCCCTACGCCA
CTGCCCTGCTGCCCATGAACCTCGAACAGGCCGCAGAGACGATTTACTCG
AAGCCCGAGTCGATCTGTCCCTCGAGGATATCCTACTACGCCTCCTCGCA
ACTGACCCAGGCCTGCAGTTTGTCAACGCCGAAGAGCATTCGAAGCAATG
GCAATGGTCATTGCACTAGCGGAAGTGGCAGCTTGAGTCTTTTTGGGGGA
ATCCCCACTGGCAGCACCATCACAATGGCCAGTCACGGG---GACAAGGG
AAACCAGAGGCTGCGACGCATCCCGAGTGTCCAGCCCGGTGCCCTCAGCT
ACGAGGAGCTGGTCAAGGAGGGCACCTTCGGCAGGATCTTCGCCGGCAAG
CTGGGCGAGTCCTGCGAGGCGCTGGTGAAGACCGTCATCGACGGTGCCTC
GCTCACCCAGGTGGCCTGTCTGCTGCAGGACGCCTCGCTCCTGATCGGCG
TCAGCCACCAGCACATCCTGGCCCCACTGCTGGCCAACACGGAGCTGCCG
GGTCCGCCGGAGATCGCCTATCCCTATCCGTCCAAGGGCAATCTCAAAAT
ATACTTGCAAAAGTCTCGGGAATCGAGCACGGCACTAAGTACCCGGCAGC
TGGTGGAGTTTGGACTGCACATCACTAAGGGATTGGCCTATCTGCACTCC
CTGGGAATCGTCCACAAGGACATTGCCACACGCAATTGCTACCTTGACGA
AGAGTCCTATGTGAAGATCTGCGATAGCGCCCTGTCGCGCGATCTCTTCC
CAGACGATTACGACTGTTTGGGTGACAACGAGAATCGCCCCCTGAAGTGG
CTATCGCTGGAATCGCTCCAAAAAAGGGTTTACGCCACCCAGGGGGATGT
GTGGGCGTTGGGCGTGACCTACTGGGAGCTGGTCACACTGGCCCAGATGC
CGCACGAGGAGGTGGACATTTTCGAGCTTACCAATTACTTGGCTGCCGGC
TTTCGGCTGGAGCAGCCGGTCAACTGCCCAGATGAATTCTTTACCGTTAT
GAACTGCTGCTGGCACAGCGAGGCCAAACAGCGACCTACGCCCTCACAGT
TGCTCTCGTATCTGCAGGACTTCCATGCGGATCTGGGCATGTACATC---
------------
>C5
ATGGGACTCCTCCCTCCGCCC------CTCGTGCTCCTCCTTGTATGCCT
A---------ACGTCCGTCAGTGGCTATCTGAACATTTTCATCAGCCACC
ACGAGGTGATGAAACTGATGGGACTCGAGGCGGACCTTTTCTATGTGCAC
GAGGGAGCCATCAACACATATGCGATGCACTTCACCGTTCCAGTGCCCGC
GGATGTCCATGAGCTGGAGTTCTCCTGGCAGAGTCTCATTGCCTATCCAC
TGCCGTATGCTATAAGTATCGAGTACAACAACGACCAGGAGGCATTGGGC
ACACCCACGCTGAGTATTCCGCACAAGGGTCTGGTTCCACAGGAGATCGA
GTCCTTCCTGGTTTACCTGCCCTGCACGGGAAATGCGAGCCTGCAGATGC
CCGTCAATGTCAACATGGTGGTGCGTGGCCCTCCTCGATTCAACGACACC
CGCCTCCACTTCAAGCGGAATAAGATCTGCGCCAAAGGCATCTCACCTGA
GCCCAATCAATCGCCAGCCCCCGCCCACGCTCCCTCGCAAGGACCCGCCC
TCCTGAGTGCAGCCGCCTGTGCTCTTGGTTTGGTTTTGGCCGTAGGTCTA
GTGGCCAGCATGATGTATGTGAGGGCGCGCAAACAGCTTCGCCAGGACTC
GCTACACACCAGTTTCACCACCGCAGCTTATGGCAGCCACCAGAACGTGT
TCATCCGTCTGGATCCCCTGGGAAGACCGCCGAGTGCCACGGGATCCTAT
GCCACCATAGCCAGCCTCAACAAATACCCAGCGGACAGCAAGAAGTCATG
CAGCATATTCGACCGTTTCAGGAGCTCACCCACACCCACGCCTTACGCCA
CTGCGTTGCTGCCCATGAACCTTGAACAGACCGCAGAGACGATTTACTCG
AAGCCAGAGTCGATCTGTCCCTCGAGGATTTCCTACTACGCCTCCTCGCA
ACTGACCCAGGCCTGCAGTCTCTCCACGCCGAAGAGCATTCGTAGCAATG
GCAATGGTCATTGCACTAGCGGAAGCGGAAGTTTAAGTCTTTTTGGGGGA
ATCCCCACGGGAAGCACAATAACCATGGCCAGTCATGGC---GAGAAGGG
AAACCAGCGTCTGCGACGTATTCCCAGTGTCCAGCCGGGTGCCCTTAGCT
ATGAGGAGCTGGTCAAGGAAGGCACTTTTGGCAGGATATATGCCGGGAAG
TTGGGTGAATCCTGTGAGGCACTCGTTAAGACAGTCATCGATGGGGCCTC
GCTCACCCAAGTGGCATGTCTGCTGCAAGATGCCTCGCTACTGATTGGGG
TCAGTCATCAGCATATATTGGCACCGCTGTTGGCTAACACAGAGCTGCCG
GGTCCACCGGAGATCGCCTATCCCTATCCGTCCAAGGGCAATCTCAAGAT
ATACTTGCAAAAATCGCGGGAGTCCAGCACGGCTTTGAGTACCCGGCAGC
TGGTTGAGTTTGGGCTGCACATCACCAAGGGACTAGCCTATCTGCACTCT
CTGGGAATTGTTCACAAGGACATTGCTACTCGCAATTGCTACCTTGACGA
AGAGTCCTATGTGAAGATCTGCGATAGTGCCCTGTCCCGCGATCTCTTCC
CCGACGACTACGACTGTCTGGGTGACAATGAGAATCGCCCACTGAAGTGG
CTATCGCTGGAATCTCTTCAGAAACGGGTGTACGCCACCCAGGGTGATGT
ATGGGCGTTGGGTGTGACCTATTGGGAGCTGGTCACACTGGCACAGATGC
CACACGAGGAGGTGGATATATTCGAGCTTACCAATTACTTGGCTGCCGGT
TTCCGGTTGGAGCAGCCCGTCAACTGCCCAGATGAATTCTTTACCGTTAT
GAACTGCTGTTGGCACTGCGAGGCCAAACAACGGCCCACGCCCTCGCAAC
TGCTCTCGTATCTGCAGGACTTCCATGCGGATCTCGGTATGTACATC---
------------
>C1
MELLPLKSPLPILLLCLTISTSVSGYLNIFISHHEVMKLMGLEADLFYVH
EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
KPESICPSRISYYASSQLTQPCSLSTPKSIRSNGNGNCTSGSGSLSLFGG
IPTGSTITMASHGoEKGNQRLRRITSVQPGALSYEELVKEGTFGRIYAGK
LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
GPPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
FRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYI
>C2
MGLLTLDoLIPILLLCLTISTSVSGYLNIFISHHEVMKLMGLEADLFYVH
EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
KPESICPSRISYYASSQLTQPCSLSTPKSIRSNGNGNCTSGSGSLSLFGG
IPTGSTITMASHGHEKGNQRLRRIPSVQPGALSYEELVKEGTFGRIYAGK
LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
GPPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
FRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYI
>C3
MGLLPLIoooooLLLCLTMSTSVSGYLNIFISHHEVMKLMGLEADLFYVH
EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
KPESICPSRISYYASSQLTQPCSLSTPKSIRSNGNGNCTSGSGSLSLFGG
IPTGSTITMASHGoEKGNQRLRRIPSVQPGALSYEELVREGTFGRIYAGK
LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
GPPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
FRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYI
>C4
MGLLPPPooIPILLFCLAISTSVSGYLNIFISHHEVMKLMGLEADLFYVH
EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNTDQEALG
TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRAPPRFNDT
RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
ATIASLNKYPAESKKSCSIFDRFRSSPTPTPYATALLPMNLEQAAETIYS
KPESICPSRISYYASSQLTQACSLSTPKSIRSNGNGHCTSGSGSLSLFGG
IPTGSTITMASHGoDKGNQRLRRIPSVQPGALSYEELVKEGTFGRIFAGK
LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
GPPEIAYPYPSKGNLKIYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
FRLEQPVNCPDEFFTVMNCCWHSEAKQRPTPSQLLSYLQDFHADLGMYI
>C5
MGLLPPPooLVLLLVCLoooTSVSGYLNIFISHHEVMKLMGLEADLFYVH
EGAINTYAMHFTVPVPADVHELEFSWQSLIAYPLPYAISIEYNNDQEALG
TPTLSIPHKGLVPQEIESFLVYLPCTGNASLQMPVNVNMVVRGPPRFNDT
RLHFKRNKICAKGISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGL
VASMMYVRARKQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSY
ATIASLNKYPADSKKSCSIFDRFRSSPTPTPYATALLPMNLEQTAETIYS
KPESICPSRISYYASSQLTQACSLSTPKSIRSNGNGHCTSGSGSLSLFGG
IPTGSTITMASHGoEKGNQRLRRIPSVQPGALSYEELVKEGTFGRIYAGK
LGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELP
GPPEIAYPYPSKGNLKIYLQKSRESSTALSTRQLVEFGLHITKGLAYLHS
LGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKW
LSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAG
FRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYI


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/231/Drl-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 1962 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1479242139
      Setting output file names to "/opt/ADOPS/231/Drl-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 38266908
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0001817836
      Seed = 635953746
      Swapseed = 1479242139
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 34 unique site patterns
      Division 2 has 19 unique site patterns
      Division 3 has 122 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -5330.455551 -- -25.624409
         Chain 2 -- -5277.584938 -- -25.624409
         Chain 3 -- -5183.720264 -- -25.624409
         Chain 4 -- -5298.663424 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -5195.804135 -- -25.624409
         Chain 2 -- -5195.804135 -- -25.624409
         Chain 3 -- -5300.313295 -- -25.624409
         Chain 4 -- -5298.663424 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-5330.456] (-5277.585) (-5183.720) (-5298.663) * [-5195.804] (-5195.804) (-5300.313) (-5298.663) 
        500 -- [-4599.880] (-4626.580) (-4641.632) (-4641.948) * (-4637.864) (-4618.723) [-4621.071] (-4652.475) -- 0:00:00
       1000 -- [-4560.972] (-4599.847) (-4615.456) (-4615.900) * (-4595.229) (-4588.511) (-4597.642) [-4594.112] -- 0:00:00
       1500 -- [-4530.086] (-4548.780) (-4561.388) (-4561.367) * (-4563.738) (-4544.132) (-4561.124) [-4523.574] -- 0:11:05
       2000 -- (-4463.581) (-4485.950) (-4480.418) [-4447.720] * (-4529.083) (-4462.664) [-4453.435] (-4459.326) -- 0:08:19
       2500 -- (-4431.445) (-4463.557) (-4445.064) [-4432.333] * (-4468.242) (-4446.581) [-4430.929] (-4438.601) -- 0:06:39
       3000 -- (-4426.843) (-4461.417) [-4427.640] (-4441.633) * (-4438.863) (-4449.122) [-4429.400] (-4430.740) -- 0:05:32
       3500 -- (-4425.681) (-4446.963) [-4426.536] (-4425.779) * (-4427.922) (-4442.190) (-4425.597) [-4422.575] -- 0:04:44
       4000 -- [-4420.090] (-4439.290) (-4425.752) (-4425.346) * (-4422.352) (-4427.542) (-4429.371) [-4419.472] -- 0:04:09
       4500 -- (-4428.385) (-4431.927) (-4430.058) [-4429.116] * (-4421.528) (-4431.078) (-4433.623) [-4425.082] -- 0:03:41
       5000 -- (-4425.611) [-4427.827] (-4428.678) (-4431.102) * [-4422.617] (-4432.055) (-4427.139) (-4425.170) -- 0:06:38

      Average standard deviation of split frequencies: 0.052378

       5500 -- (-4431.601) (-4422.945) [-4430.368] (-4430.599) * (-4426.706) (-4422.994) [-4429.491] (-4425.796) -- 0:06:01
       6000 -- (-4423.155) (-4423.002) [-4422.856] (-4427.363) * [-4421.103] (-4430.890) (-4425.984) (-4425.237) -- 0:05:31
       6500 -- (-4426.687) (-4424.484) (-4427.186) [-4421.037] * [-4425.604] (-4426.894) (-4431.162) (-4427.098) -- 0:05:05
       7000 -- (-4430.995) (-4421.071) [-4423.693] (-4441.370) * (-4431.713) (-4425.415) [-4429.028] (-4424.420) -- 0:04:43
       7500 -- (-4428.203) [-4431.192] (-4426.861) (-4430.479) * (-4426.999) (-4424.443) [-4430.374] (-4427.127) -- 0:04:24
       8000 -- (-4426.039) (-4424.445) [-4424.389] (-4426.539) * (-4425.657) (-4426.253) (-4425.442) [-4428.670] -- 0:06:12
       8500 -- (-4429.204) [-4422.102] (-4427.539) (-4431.373) * (-4430.900) (-4432.872) [-4421.433] (-4427.477) -- 0:05:49
       9000 -- (-4429.088) [-4425.307] (-4429.077) (-4424.060) * (-4428.731) [-4421.628] (-4422.789) (-4424.069) -- 0:05:30
       9500 -- (-4429.098) (-4430.266) (-4421.224) [-4424.295] * (-4426.127) (-4424.039) [-4422.460] (-4427.789) -- 0:05:12
      10000 -- [-4425.027] (-4425.258) (-4429.536) (-4424.605) * [-4429.155] (-4425.358) (-4428.436) (-4426.300) -- 0:04:57

      Average standard deviation of split frequencies: 0.000000

      10500 -- (-4428.388) (-4424.577) [-4422.080] (-4420.908) * (-4428.169) (-4420.704) [-4423.164] (-4429.244) -- 0:04:42
      11000 -- [-4421.067] (-4433.210) (-4424.700) (-4432.567) * [-4426.275] (-4429.707) (-4422.805) (-4423.371) -- 0:04:29
      11500 -- (-4421.078) [-4423.307] (-4430.783) (-4428.188) * (-4424.285) (-4431.138) [-4421.834] (-4420.160) -- 0:05:43
      12000 -- (-4422.181) [-4427.049] (-4434.507) (-4429.585) * (-4423.692) (-4432.507) (-4423.834) [-4425.103] -- 0:05:29
      12500 -- (-4423.319) [-4422.146] (-4425.089) (-4422.551) * (-4423.863) (-4427.906) (-4424.838) [-4428.207] -- 0:05:16
      13000 -- (-4424.861) [-4424.271] (-4426.043) (-4428.803) * (-4430.713) (-4437.166) (-4428.152) [-4422.395] -- 0:05:03
      13500 -- (-4434.734) [-4425.973] (-4430.724) (-4428.052) * (-4426.293) (-4432.135) [-4426.281] (-4425.067) -- 0:04:52
      14000 -- (-4435.038) (-4423.215) (-4423.098) [-4422.374] * [-4418.950] (-4435.553) (-4426.545) (-4430.062) -- 0:04:41
      14500 -- (-4429.760) (-4423.902) [-4427.061] (-4436.505) * (-4421.497) (-4436.311) (-4430.933) [-4425.865] -- 0:04:31
      15000 -- (-4422.892) (-4421.295) [-4420.555] (-4421.709) * (-4422.300) (-4430.665) [-4422.107] (-4425.385) -- 0:05:28

      Average standard deviation of split frequencies: 0.019642

      15500 -- [-4426.481] (-4423.004) (-4423.934) (-4423.953) * [-4425.490] (-4432.532) (-4424.534) (-4429.103) -- 0:05:17
      16000 -- (-4433.660) [-4432.269] (-4432.992) (-4426.862) * (-4435.889) (-4430.753) (-4425.374) [-4429.323] -- 0:05:07
      16500 -- (-4421.152) (-4430.034) [-4425.831] (-4426.691) * (-4420.219) (-4421.323) [-4426.938] (-4428.416) -- 0:04:58
      17000 -- (-4426.422) (-4421.476) [-4425.039] (-4424.684) * (-4426.626) [-4422.271] (-4429.455) (-4431.620) -- 0:04:49
      17500 -- (-4427.466) [-4427.270] (-4425.199) (-4418.897) * (-4430.438) (-4428.079) (-4436.041) [-4436.060] -- 0:04:40
      18000 -- (-4426.629) (-4420.535) [-4424.990] (-4424.624) * (-4424.988) [-4421.316] (-4424.630) (-4437.440) -- 0:05:27
      18500 -- (-4420.927) [-4425.788] (-4429.993) (-4427.248) * (-4428.731) [-4423.481] (-4430.580) (-4421.293) -- 0:05:18
      19000 -- (-4425.168) [-4425.200] (-4426.313) (-4429.784) * (-4425.386) (-4420.590) (-4422.524) [-4423.327] -- 0:05:09
      19500 -- (-4423.844) (-4435.210) [-4424.285] (-4420.825) * [-4429.365] (-4420.627) (-4428.142) (-4421.906) -- 0:05:01
      20000 -- (-4429.749) [-4434.538] (-4430.088) (-4428.286) * (-4427.812) (-4420.777) (-4424.564) [-4426.387] -- 0:04:54

      Average standard deviation of split frequencies: 0.011405

      20500 -- (-4427.021) [-4424.055] (-4429.077) (-4427.243) * (-4432.070) (-4431.994) [-4421.982] (-4423.965) -- 0:04:46
      21000 -- [-4430.404] (-4421.514) (-4424.216) (-4424.880) * (-4428.839) (-4425.073) (-4420.309) [-4425.057] -- 0:04:39
      21500 -- (-4424.651) [-4423.320] (-4430.221) (-4421.523) * (-4422.143) (-4426.588) (-4429.999) [-4424.582] -- 0:05:18
      22000 -- [-4424.898] (-4421.699) (-4425.513) (-4427.793) * (-4424.139) (-4426.882) (-4429.614) [-4424.135] -- 0:05:11
      22500 -- (-4425.867) (-4429.510) (-4434.501) [-4423.079] * [-4424.310] (-4417.356) (-4420.639) (-4421.987) -- 0:05:04
      23000 -- (-4423.335) (-4422.434) (-4428.263) [-4425.049] * (-4426.420) [-4425.592] (-4430.045) (-4427.631) -- 0:04:57
      23500 -- (-4427.174) (-4428.425) [-4424.318] (-4427.682) * (-4427.459) [-4424.753] (-4427.061) (-4432.584) -- 0:04:50
      24000 -- (-4423.963) (-4428.186) (-4422.741) [-4428.805] * [-4430.545] (-4420.403) (-4425.312) (-4425.956) -- 0:05:25
      24500 -- (-4422.928) (-4424.058) [-4424.091] (-4429.872) * (-4431.814) [-4425.355] (-4425.732) (-4425.367) -- 0:05:18
      25000 -- [-4422.495] (-4425.469) (-4430.686) (-4426.634) * (-4425.513) (-4422.444) [-4425.869] (-4427.232) -- 0:05:12

      Average standard deviation of split frequencies: 0.006044

      25500 -- (-4424.329) (-4433.721) (-4424.382) [-4426.424] * (-4419.202) (-4418.474) [-4423.206] (-4429.549) -- 0:05:05
      26000 -- [-4427.364] (-4425.842) (-4423.771) (-4427.398) * [-4435.327] (-4422.119) (-4423.025) (-4429.018) -- 0:04:59
      26500 -- [-4428.404] (-4433.072) (-4425.459) (-4422.911) * [-4429.374] (-4425.493) (-4424.186) (-4423.443) -- 0:04:53
      27000 -- (-4421.701) [-4421.188] (-4420.261) (-4421.020) * (-4430.806) (-4428.207) (-4431.597) [-4423.439] -- 0:04:48
      27500 -- (-4424.838) (-4424.644) (-4425.966) [-4425.141] * [-4429.560] (-4416.064) (-4433.772) (-4427.565) -- 0:05:18
      28000 -- (-4426.557) (-4428.364) [-4427.282] (-4425.617) * (-4432.814) [-4420.235] (-4427.474) (-4426.262) -- 0:05:12
      28500 -- (-4433.831) [-4428.130] (-4421.388) (-4421.699) * [-4425.475] (-4423.155) (-4433.253) (-4426.858) -- 0:05:06
      29000 -- (-4436.495) (-4423.583) [-4423.165] (-4433.927) * (-4425.064) [-4421.747] (-4423.478) (-4432.214) -- 0:05:01
      29500 -- (-4426.019) [-4425.435] (-4424.620) (-4425.063) * (-4425.921) [-4426.912] (-4428.622) (-4426.453) -- 0:04:56
      30000 -- (-4431.689) (-4425.330) [-4421.484] (-4426.115) * (-4425.850) (-4431.313) (-4434.303) [-4417.640] -- 0:04:51

      Average standard deviation of split frequencies: 0.005124

      30500 -- [-4427.845] (-4428.438) (-4428.425) (-4433.410) * (-4422.182) [-4430.377] (-4438.347) (-4426.036) -- 0:04:46
      31000 -- (-4426.731) (-4421.461) [-4425.230] (-4436.886) * (-4425.848) [-4419.609] (-4423.029) (-4432.471) -- 0:05:12
      31500 -- (-4425.747) (-4431.680) (-4420.194) [-4425.820] * (-4427.499) (-4421.168) (-4431.816) [-4420.940] -- 0:05:07
      32000 -- (-4424.935) (-4427.857) (-4428.662) [-4424.391] * (-4427.726) [-4424.711] (-4423.400) (-4418.972) -- 0:05:02
      32500 -- (-4426.995) (-4423.060) (-4423.861) [-4426.685] * (-4427.176) (-4426.917) [-4424.737] (-4422.199) -- 0:04:57
      33000 -- (-4429.844) [-4430.314] (-4420.677) (-4428.647) * (-4423.925) (-4429.368) [-4429.432] (-4425.667) -- 0:04:53
      33500 -- (-4427.304) (-4425.134) (-4423.963) [-4424.886] * (-4430.161) [-4422.795] (-4437.415) (-4422.304) -- 0:04:48
      34000 -- (-4433.771) (-4424.524) (-4428.303) [-4423.457] * (-4428.305) [-4422.287] (-4436.426) (-4424.808) -- 0:05:12
      34500 -- (-4428.724) [-4423.294] (-4426.260) (-4421.891) * (-4418.724) (-4425.537) (-4434.892) [-4421.579] -- 0:05:07
      35000 -- [-4427.925] (-4424.324) (-4427.315) (-4422.544) * (-4422.853) (-4427.124) [-4423.824] (-4423.924) -- 0:05:03

      Average standard deviation of split frequencies: 0.013095

      35500 -- [-4420.238] (-4426.822) (-4425.146) (-4424.673) * (-4428.860) (-4425.417) [-4423.354] (-4430.901) -- 0:04:58
      36000 -- [-4422.829] (-4423.001) (-4429.705) (-4427.619) * (-4424.230) [-4425.435] (-4426.854) (-4429.001) -- 0:04:54
      36500 -- (-4426.790) (-4424.401) (-4429.249) [-4420.611] * [-4427.208] (-4424.357) (-4420.632) (-4426.748) -- 0:04:50
      37000 -- [-4421.984] (-4426.480) (-4425.981) (-4424.574) * (-4429.866) (-4424.987) [-4426.611] (-4424.351) -- 0:05:12
      37500 -- (-4423.813) (-4421.459) (-4426.160) [-4425.220] * (-4424.330) (-4433.727) (-4431.165) [-4424.336] -- 0:05:08
      38000 -- [-4419.811] (-4423.584) (-4422.142) (-4422.621) * (-4419.473) [-4423.848] (-4428.228) (-4422.191) -- 0:05:03
      38500 -- (-4428.441) [-4424.517] (-4423.943) (-4425.197) * [-4424.051] (-4422.676) (-4425.255) (-4425.253) -- 0:04:59
      39000 -- (-4430.611) (-4428.832) [-4419.838] (-4431.864) * (-4427.615) (-4423.583) (-4428.312) [-4422.424] -- 0:04:55
      39500 -- [-4424.811] (-4424.860) (-4434.558) (-4428.303) * (-4427.310) (-4427.020) [-4421.006] (-4421.580) -- 0:04:51
      40000 -- (-4430.198) (-4431.128) [-4423.929] (-4426.494) * (-4427.240) [-4428.586] (-4421.529) (-4429.136) -- 0:05:12

      Average standard deviation of split frequencies: 0.019320

      40500 -- (-4427.025) (-4421.608) (-4429.428) [-4424.852] * (-4425.504) [-4431.992] (-4423.875) (-4427.535) -- 0:05:07
      41000 -- [-4421.288] (-4424.733) (-4427.521) (-4428.212) * (-4429.876) (-4427.338) (-4429.341) [-4421.878] -- 0:05:04
      41500 -- (-4421.391) [-4426.163] (-4430.463) (-4434.639) * [-4422.891] (-4430.805) (-4426.562) (-4431.488) -- 0:05:00
      42000 -- (-4425.528) [-4420.966] (-4435.717) (-4426.744) * (-4424.741) (-4425.514) [-4424.388] (-4439.035) -- 0:04:56
      42500 -- (-4420.044) (-4423.369) (-4434.892) [-4430.147] * (-4423.568) (-4426.376) [-4433.922] (-4429.473) -- 0:04:52
      43000 -- (-4427.573) [-4428.915] (-4436.658) (-4429.773) * [-4425.400] (-4428.600) (-4420.961) (-4427.260) -- 0:04:49
      43500 -- (-4422.266) [-4420.432] (-4426.852) (-4422.373) * (-4423.534) [-4426.242] (-4420.735) (-4428.946) -- 0:05:07
      44000 -- (-4420.171) (-4427.838) (-4425.539) [-4422.786] * (-4427.283) [-4423.947] (-4426.075) (-4425.455) -- 0:05:04
      44500 -- (-4421.712) (-4437.893) (-4427.709) [-4422.199] * (-4425.763) (-4423.662) [-4421.495] (-4428.492) -- 0:05:00
      45000 -- (-4419.046) [-4427.031] (-4422.233) (-4428.933) * (-4425.667) [-4427.281] (-4425.441) (-4432.084) -- 0:04:57

      Average standard deviation of split frequencies: 0.017080

      45500 -- (-4426.776) (-4427.157) (-4423.531) [-4422.804] * (-4429.998) (-4428.841) (-4424.161) [-4427.234] -- 0:04:53
      46000 -- (-4429.750) (-4427.931) [-4418.267] (-4423.241) * [-4429.390] (-4425.109) (-4423.141) (-4428.207) -- 0:04:50
      46500 -- [-4423.799] (-4428.107) (-4427.726) (-4426.288) * (-4423.284) [-4429.679] (-4419.402) (-4428.183) -- 0:04:47
      47000 -- (-4427.759) (-4425.403) (-4426.212) [-4423.147] * (-4429.662) (-4427.700) (-4423.847) [-4422.747] -- 0:05:04
      47500 -- (-4421.034) (-4426.698) (-4428.994) [-4422.288] * (-4425.997) (-4424.406) [-4426.873] (-4420.441) -- 0:05:00
      48000 -- (-4426.935) (-4432.030) (-4425.214) [-4432.095] * (-4432.563) (-4429.843) (-4428.754) [-4420.432] -- 0:04:57
      48500 -- (-4428.782) [-4429.350] (-4433.219) (-4423.002) * (-4432.881) (-4421.021) [-4424.082] (-4430.163) -- 0:04:54
      49000 -- (-4426.814) [-4421.353] (-4422.873) (-4431.577) * (-4424.925) (-4425.248) (-4419.544) [-4424.015] -- 0:04:51
      49500 -- (-4427.639) (-4419.472) (-4424.653) [-4424.043] * [-4423.984] (-4429.374) (-4432.651) (-4420.860) -- 0:04:48
      50000 -- (-4422.395) (-4427.275) (-4422.856) [-4426.254] * (-4423.085) (-4425.116) (-4432.862) [-4430.423] -- 0:04:45

      Average standard deviation of split frequencies: 0.021709

      50500 -- (-4428.281) (-4430.705) (-4425.344) [-4424.721] * (-4426.934) (-4432.498) (-4438.222) [-4432.940] -- 0:05:00
      51000 -- (-4429.195) (-4427.267) [-4421.470] (-4422.565) * (-4419.709) (-4423.263) (-4425.706) [-4434.757] -- 0:04:57
      51500 -- (-4423.587) [-4420.392] (-4424.824) (-4420.237) * (-4424.645) (-4424.855) [-4427.366] (-4439.529) -- 0:04:54
      52000 -- (-4426.476) (-4430.120) [-4430.836] (-4424.378) * (-4420.671) [-4425.802] (-4422.147) (-4432.859) -- 0:04:51
      52500 -- (-4429.536) [-4428.665] (-4422.147) (-4425.228) * [-4427.132] (-4426.229) (-4426.181) (-4421.541) -- 0:04:48
      53000 -- (-4428.084) (-4437.285) [-4423.907] (-4424.000) * (-4429.066) (-4433.175) (-4425.556) [-4418.697] -- 0:04:45
      53500 -- (-4430.581) [-4427.400] (-4422.859) (-4423.137) * (-4425.084) (-4425.836) [-4423.105] (-4427.003) -- 0:05:00
      54000 -- (-4426.358) [-4429.204] (-4425.565) (-4425.390) * (-4423.534) (-4428.283) [-4424.043] (-4427.751) -- 0:04:57
      54500 -- (-4422.408) (-4431.763) (-4428.541) [-4426.836] * [-4425.519] (-4431.800) (-4427.955) (-4421.938) -- 0:04:54
      55000 -- (-4427.516) (-4432.613) [-4418.706] (-4426.921) * (-4423.279) (-4429.774) (-4430.464) [-4424.324] -- 0:04:52

      Average standard deviation of split frequencies: 0.004209

      55500 -- (-4429.989) (-4424.668) [-4427.322] (-4427.459) * [-4428.003] (-4427.703) (-4429.987) (-4427.229) -- 0:04:49
      56000 -- (-4421.277) [-4422.718] (-4427.664) (-4425.082) * (-4424.021) (-4421.726) (-4427.994) [-4425.466] -- 0:04:46
      56500 -- (-4429.525) [-4423.372] (-4425.607) (-4427.709) * (-4423.171) [-4427.948] (-4426.164) (-4427.426) -- 0:04:43
      57000 -- (-4426.075) (-4425.880) [-4425.860] (-4426.890) * (-4424.079) [-4424.847] (-4420.731) (-4425.422) -- 0:04:57
      57500 -- (-4426.555) (-4441.469) [-4427.380] (-4437.936) * (-4426.855) (-4426.614) [-4423.632] (-4424.353) -- 0:04:55
      58000 -- (-4422.190) [-4427.532] (-4427.615) (-4425.535) * [-4432.586] (-4426.771) (-4422.251) (-4430.409) -- 0:04:52
      58500 -- [-4424.262] (-4425.211) (-4423.642) (-4421.446) * [-4428.836] (-4426.694) (-4428.224) (-4424.499) -- 0:04:49
      59000 -- (-4424.869) (-4424.469) (-4426.310) [-4425.732] * (-4429.200) (-4425.296) (-4422.802) [-4430.095] -- 0:04:47
      59500 -- (-4424.212) [-4425.950] (-4422.506) (-4422.484) * (-4426.150) (-4424.669) (-4427.469) [-4424.897] -- 0:04:44
      60000 -- (-4440.080) (-4427.405) [-4422.772] (-4425.970) * [-4434.207] (-4421.534) (-4426.179) (-4426.768) -- 0:04:42

      Average standard deviation of split frequencies: 0.007770

      60500 -- (-4430.189) (-4428.681) [-4423.649] (-4429.045) * [-4431.747] (-4426.509) (-4424.291) (-4427.196) -- 0:04:55
      61000 -- [-4423.857] (-4425.061) (-4423.663) (-4434.226) * (-4429.031) (-4425.763) [-4420.278] (-4431.897) -- 0:04:52
      61500 -- (-4425.004) (-4422.365) (-4423.673) [-4426.999] * (-4428.564) (-4425.510) (-4426.815) [-4426.163] -- 0:04:49
      62000 -- [-4422.925] (-4430.062) (-4428.520) (-4427.665) * (-4424.936) [-4427.497] (-4422.496) (-4431.318) -- 0:04:47
      62500 -- (-4423.641) [-4424.987] (-4424.465) (-4423.533) * [-4424.013] (-4428.491) (-4424.771) (-4425.710) -- 0:04:45
      63000 -- (-4427.246) (-4427.859) [-4429.124] (-4423.154) * [-4427.020] (-4429.918) (-4423.643) (-4426.438) -- 0:04:42
      63500 -- [-4424.670] (-4424.845) (-4428.828) (-4426.869) * (-4426.815) [-4425.372] (-4421.634) (-4425.356) -- 0:04:40
      64000 -- [-4424.394] (-4424.077) (-4427.378) (-4426.357) * (-4429.721) (-4438.145) (-4424.212) [-4421.925] -- 0:04:52
      64500 -- (-4432.315) [-4424.014] (-4425.513) (-4427.977) * (-4424.852) [-4426.864] (-4420.368) (-4425.957) -- 0:04:50
      65000 -- [-4428.149] (-4428.102) (-4427.531) (-4431.913) * (-4426.165) [-4424.001] (-4421.651) (-4425.981) -- 0:04:47

      Average standard deviation of split frequencies: 0.007142

      65500 -- (-4423.691) (-4424.598) [-4421.639] (-4429.137) * (-4423.539) (-4423.104) (-4423.122) [-4421.855] -- 0:04:45
      66000 -- (-4428.699) (-4422.812) [-4425.277] (-4426.862) * (-4428.780) (-4433.399) [-4426.560] (-4426.190) -- 0:04:43
      66500 -- (-4425.721) [-4428.965] (-4423.398) (-4428.646) * [-4430.681] (-4426.688) (-4431.517) (-4423.434) -- 0:04:40
      67000 -- (-4436.971) [-4427.414] (-4431.327) (-4424.609) * (-4426.767) [-4424.442] (-4421.971) (-4422.808) -- 0:04:52
      67500 -- (-4426.006) (-4423.353) (-4428.149) [-4426.059] * (-4421.109) (-4421.781) (-4425.693) [-4421.671] -- 0:04:50
      68000 -- (-4423.869) (-4435.845) [-4426.264] (-4420.430) * (-4428.995) [-4423.860] (-4430.643) (-4426.540) -- 0:04:47
      68500 -- [-4426.791] (-4431.294) (-4426.662) (-4425.081) * (-4431.609) [-4423.826] (-4424.814) (-4420.557) -- 0:04:45
      69000 -- [-4425.893] (-4428.848) (-4423.668) (-4426.641) * (-4427.544) [-4432.240] (-4425.741) (-4426.046) -- 0:04:43
      69500 -- (-4427.309) (-4426.548) [-4423.859] (-4430.299) * (-4424.269) [-4424.015] (-4426.109) (-4424.443) -- 0:04:41
      70000 -- [-4422.723] (-4430.189) (-4422.446) (-4432.787) * (-4424.072) [-4424.610] (-4424.501) (-4423.781) -- 0:04:39

      Average standard deviation of split frequencies: 0.006671

      70500 -- [-4426.370] (-4432.750) (-4424.456) (-4422.753) * [-4430.710] (-4424.517) (-4428.372) (-4423.674) -- 0:04:50
      71000 -- (-4424.060) (-4439.834) (-4428.872) [-4421.741] * [-4425.699] (-4427.671) (-4426.358) (-4425.306) -- 0:04:47
      71500 -- [-4422.829] (-4429.220) (-4421.995) (-4422.908) * [-4423.784] (-4424.044) (-4428.318) (-4429.747) -- 0:04:45
      72000 -- [-4428.621] (-4425.196) (-4429.852) (-4423.266) * (-4425.462) [-4421.954] (-4434.306) (-4423.100) -- 0:04:43
      72500 -- (-4424.613) (-4432.588) (-4431.427) [-4422.225] * (-4429.778) [-4421.881] (-4431.752) (-4426.947) -- 0:04:41
      73000 -- [-4424.228] (-4423.233) (-4421.839) (-4428.492) * (-4433.658) (-4424.806) (-4436.188) [-4426.720] -- 0:04:39
      73500 -- (-4423.243) (-4424.727) [-4425.663] (-4428.352) * (-4425.706) [-4423.979] (-4431.666) (-4429.647) -- 0:04:37
      74000 -- [-4425.573] (-4426.098) (-4424.497) (-4427.122) * [-4426.428] (-4425.672) (-4424.686) (-4426.555) -- 0:04:47
      74500 -- (-4428.772) [-4426.950] (-4422.677) (-4427.542) * [-4422.719] (-4426.729) (-4426.883) (-4434.034) -- 0:04:45
      75000 -- (-4425.674) (-4432.447) [-4430.997] (-4427.763) * (-4422.047) [-4428.320] (-4427.635) (-4429.680) -- 0:04:43

      Average standard deviation of split frequencies: 0.009304

      75500 -- [-4430.088] (-4426.672) (-4431.269) (-4432.720) * [-4422.041] (-4423.655) (-4424.485) (-4425.813) -- 0:04:41
      76000 -- (-4438.136) (-4431.945) [-4428.977] (-4424.905) * (-4419.667) (-4428.882) (-4427.280) [-4422.312] -- 0:04:39
      76500 -- (-4437.051) [-4424.900] (-4429.498) (-4427.275) * [-4423.017] (-4432.138) (-4427.146) (-4423.250) -- 0:04:37
      77000 -- (-4435.171) (-4429.546) (-4427.669) [-4424.496] * (-4427.525) [-4427.037] (-4429.327) (-4422.852) -- 0:04:35
      77500 -- (-4432.110) [-4431.667] (-4422.009) (-4420.372) * (-4434.181) (-4424.261) [-4426.598] (-4428.626) -- 0:04:45
      78000 -- (-4422.118) (-4432.437) [-4423.593] (-4424.416) * [-4422.859] (-4429.282) (-4421.776) (-4425.381) -- 0:04:43
      78500 -- (-4423.171) [-4418.812] (-4434.205) (-4427.524) * (-4431.361) (-4421.446) (-4424.171) [-4420.952] -- 0:04:41
      79000 -- [-4421.148] (-4431.115) (-4422.732) (-4429.572) * (-4427.097) [-4427.095] (-4424.377) (-4422.260) -- 0:04:39
      79500 -- [-4424.337] (-4427.066) (-4423.151) (-4426.227) * (-4430.597) (-4425.281) (-4426.191) [-4428.646] -- 0:04:37
      80000 -- (-4434.112) (-4427.123) [-4424.324] (-4425.691) * (-4423.552) (-4432.496) (-4419.741) [-4424.756] -- 0:04:36

      Average standard deviation of split frequencies: 0.008766

      80500 -- (-4428.501) (-4422.146) [-4429.742] (-4433.488) * (-4425.475) (-4437.328) [-4428.646] (-4424.040) -- 0:04:45
      81000 -- (-4429.144) (-4422.146) [-4426.728] (-4428.734) * (-4432.703) (-4425.500) [-4428.277] (-4426.296) -- 0:04:43
      81500 -- (-4434.138) [-4421.412] (-4421.028) (-4430.265) * (-4426.720) (-4426.556) [-4428.191] (-4424.139) -- 0:04:41
      82000 -- (-4423.513) [-4423.563] (-4438.255) (-4428.596) * (-4430.262) (-4427.875) (-4430.858) [-4421.055] -- 0:04:39
      82500 -- (-4429.726) (-4426.505) [-4425.322] (-4425.736) * [-4427.442] (-4422.803) (-4426.374) (-4428.302) -- 0:04:38
      83000 -- (-4428.398) (-4426.822) [-4426.831] (-4425.325) * (-4423.636) (-4437.054) (-4420.166) [-4428.490] -- 0:04:36
      83500 -- (-4420.891) (-4424.387) (-4423.189) [-4429.540] * (-4421.607) (-4427.800) (-4426.005) [-4421.614] -- 0:04:34
      84000 -- [-4428.111] (-4429.201) (-4421.149) (-4421.118) * (-4426.525) (-4430.609) [-4427.917] (-4424.163) -- 0:04:43
      84500 -- (-4423.587) (-4425.957) (-4427.606) [-4425.380] * (-4426.121) (-4423.403) [-4426.789] (-4429.757) -- 0:04:41
      85000 -- [-4427.372] (-4426.413) (-4427.798) (-4422.510) * (-4418.645) (-4423.834) [-4424.466] (-4430.498) -- 0:04:39

      Average standard deviation of split frequencies: 0.008222

      85500 -- (-4423.523) (-4427.795) (-4439.318) [-4429.757] * (-4426.092) [-4421.581] (-4430.532) (-4424.224) -- 0:04:38
      86000 -- (-4433.044) (-4432.780) (-4432.184) [-4424.536] * (-4423.832) (-4425.815) (-4425.857) [-4427.716] -- 0:04:36
      86500 -- (-4427.014) (-4428.186) [-4426.519] (-4425.406) * (-4420.387) [-4421.164] (-4423.683) (-4425.730) -- 0:04:34
      87000 -- [-4424.666] (-4433.868) (-4423.419) (-4425.876) * [-4427.889] (-4425.756) (-4432.126) (-4432.387) -- 0:04:43
      87500 -- (-4430.260) (-4425.850) [-4430.711] (-4431.680) * (-4434.306) [-4432.158] (-4427.423) (-4422.493) -- 0:04:41
      88000 -- (-4428.161) [-4427.290] (-4435.847) (-4423.207) * (-4425.273) (-4425.882) (-4430.919) [-4419.169] -- 0:04:39
      88500 -- (-4425.022) (-4427.912) [-4428.088] (-4424.212) * (-4425.060) (-4435.804) (-4429.573) [-4427.992] -- 0:04:38
      89000 -- (-4426.537) [-4426.226] (-4428.408) (-4422.915) * [-4422.267] (-4425.538) (-4430.265) (-4426.117) -- 0:04:36
      89500 -- (-4425.657) [-4433.049] (-4426.977) (-4425.027) * (-4421.977) (-4431.367) [-4428.220] (-4425.934) -- 0:04:34
      90000 -- [-4424.449] (-4431.574) (-4424.356) (-4424.861) * (-4429.640) (-4430.456) (-4427.758) [-4421.825] -- 0:04:33

      Average standard deviation of split frequencies: 0.010399

      90500 -- [-4423.898] (-4427.699) (-4429.397) (-4429.917) * (-4430.185) (-4426.765) (-4432.062) [-4422.549] -- 0:04:41
      91000 -- [-4429.731] (-4424.326) (-4425.331) (-4426.751) * [-4426.750] (-4431.351) (-4420.767) (-4424.201) -- 0:04:39
      91500 -- (-4423.210) [-4424.338] (-4423.838) (-4427.609) * (-4423.689) [-4419.439] (-4425.888) (-4425.566) -- 0:04:38
      92000 -- (-4422.825) [-4422.280] (-4425.577) (-4427.515) * (-4428.742) (-4423.640) (-4425.828) [-4419.398] -- 0:04:36
      92500 -- [-4426.170] (-4429.318) (-4420.720) (-4424.514) * (-4420.876) [-4425.008] (-4427.355) (-4424.564) -- 0:04:34
      93000 -- (-4428.586) (-4433.703) (-4426.151) [-4427.228] * (-4426.577) (-4429.999) (-4422.309) [-4426.606] -- 0:04:33
      93500 -- (-4429.378) (-4426.086) (-4434.795) [-4428.604] * (-4426.204) (-4431.011) [-4424.589] (-4422.305) -- 0:04:31
      94000 -- (-4431.227) [-4430.900] (-4437.433) (-4434.100) * (-4425.257) (-4435.351) (-4425.241) [-4427.036] -- 0:04:39
      94500 -- [-4433.768] (-4423.413) (-4436.159) (-4421.328) * (-4427.526) [-4422.451] (-4421.924) (-4424.548) -- 0:04:37
      95000 -- (-4422.506) (-4421.561) (-4423.228) [-4429.391] * (-4427.268) [-4425.949] (-4430.705) (-4422.628) -- 0:04:36

      Average standard deviation of split frequencies: 0.007366

      95500 -- (-4422.937) (-4425.319) (-4432.916) [-4429.579] * (-4427.793) (-4424.863) [-4425.436] (-4422.443) -- 0:04:34
      96000 -- [-4422.425] (-4433.890) (-4426.735) (-4419.793) * (-4423.850) (-4427.077) (-4434.773) [-4425.483] -- 0:04:33
      96500 -- (-4424.659) (-4424.673) [-4423.510] (-4426.562) * [-4425.016] (-4423.326) (-4426.307) (-4421.506) -- 0:04:40
      97000 -- (-4428.140) (-4422.136) (-4421.144) [-4420.501] * (-4425.170) [-4417.670] (-4434.931) (-4418.552) -- 0:04:39
      97500 -- (-4431.312) (-4427.919) (-4421.614) [-4423.757] * (-4428.351) (-4425.576) [-4423.508] (-4429.229) -- 0:04:37
      98000 -- [-4425.434] (-4433.626) (-4420.316) (-4431.704) * (-4426.679) (-4425.297) [-4421.711] (-4429.082) -- 0:04:36
      98500 -- (-4424.273) (-4438.970) [-4425.835] (-4429.772) * [-4420.773] (-4439.600) (-4428.913) (-4423.595) -- 0:04:34
      99000 -- (-4434.181) (-4434.906) [-4431.058] (-4430.864) * (-4432.145) (-4422.759) (-4429.708) [-4429.993] -- 0:04:33
      99500 -- (-4433.563) (-4425.978) [-4427.588] (-4436.193) * (-4425.849) [-4421.798] (-4423.925) (-4424.056) -- 0:04:40
      100000 -- (-4435.657) (-4434.315) (-4427.686) [-4429.401] * (-4424.855) (-4423.719) (-4419.916) [-4433.095] -- 0:04:39

      Average standard deviation of split frequencies: 0.009366

      100500 -- [-4431.596] (-4423.968) (-4430.316) (-4424.198) * (-4437.013) (-4426.660) (-4431.972) [-4423.778] -- 0:04:37
      101000 -- (-4437.504) [-4429.389] (-4428.697) (-4429.072) * (-4429.635) [-4427.208] (-4427.837) (-4427.538) -- 0:04:35
      101500 -- (-4433.371) (-4430.429) (-4434.040) [-4428.193] * [-4424.691] (-4430.809) (-4425.455) (-4428.280) -- 0:04:34
      102000 -- (-4430.624) (-4432.549) (-4424.235) [-4433.578] * (-4424.477) (-4431.326) [-4429.012] (-4428.739) -- 0:04:32
      102500 -- (-4430.174) (-4429.123) (-4431.227) [-4423.515] * (-4425.739) [-4418.884] (-4427.797) (-4433.644) -- 0:04:40
      103000 -- (-4434.803) (-4431.861) (-4423.613) [-4425.707] * (-4433.595) (-4427.954) [-4426.497] (-4430.548) -- 0:04:38
      103500 -- [-4426.220] (-4431.579) (-4426.162) (-4434.446) * (-4420.841) [-4420.754] (-4423.380) (-4425.791) -- 0:04:37
      104000 -- (-4429.071) (-4430.123) [-4425.461] (-4425.327) * (-4426.725) [-4432.869] (-4429.739) (-4422.179) -- 0:04:35
      104500 -- [-4423.581] (-4428.402) (-4429.402) (-4431.190) * [-4428.218] (-4430.118) (-4429.667) (-4430.225) -- 0:04:34
      105000 -- (-4427.857) (-4422.498) (-4427.427) [-4425.425] * [-4421.775] (-4425.941) (-4430.060) (-4424.400) -- 0:04:32

      Average standard deviation of split frequencies: 0.008894

      105500 -- [-4429.447] (-4432.219) (-4423.018) (-4431.103) * (-4427.779) [-4424.715] (-4427.024) (-4423.509) -- 0:04:31
      106000 -- [-4429.791] (-4422.828) (-4426.391) (-4430.043) * [-4421.370] (-4426.762) (-4419.691) (-4420.816) -- 0:04:38
      106500 -- (-4423.372) (-4422.419) [-4428.468] (-4426.004) * (-4426.864) (-4425.273) (-4422.867) [-4420.984] -- 0:04:36
      107000 -- (-4420.918) [-4422.660] (-4429.152) (-4423.955) * [-4423.743] (-4424.727) (-4423.537) (-4424.318) -- 0:04:35
      107500 -- [-4421.421] (-4422.011) (-4432.765) (-4425.317) * (-4427.179) (-4424.773) [-4427.545] (-4423.290) -- 0:04:33
      108000 -- [-4427.018] (-4423.720) (-4429.330) (-4421.409) * (-4432.684) [-4421.975] (-4426.394) (-4427.112) -- 0:04:32
      108500 -- (-4430.922) (-4429.256) [-4427.708] (-4423.949) * (-4427.620) (-4424.750) [-4424.078] (-4422.605) -- 0:04:31
      109000 -- (-4424.454) [-4421.952] (-4425.118) (-4431.809) * (-4427.750) (-4421.698) (-4428.394) [-4421.445] -- 0:04:37
      109500 -- (-4427.733) (-4431.339) [-4431.563] (-4425.029) * (-4427.452) (-4424.593) (-4427.573) [-4421.082] -- 0:04:36
      110000 -- [-4425.984] (-4424.845) (-4423.708) (-4422.225) * (-4430.576) (-4425.478) (-4428.523) [-4429.698] -- 0:04:35

      Average standard deviation of split frequencies: 0.006390

      110500 -- (-4427.505) [-4422.309] (-4424.905) (-4422.231) * [-4427.708] (-4428.959) (-4425.150) (-4424.841) -- 0:04:33
      111000 -- (-4422.998) [-4425.796] (-4429.442) (-4434.520) * (-4427.188) (-4431.641) (-4432.123) [-4421.376] -- 0:04:32
      111500 -- [-4424.934] (-4422.767) (-4426.282) (-4432.706) * (-4428.665) (-4427.137) (-4423.979) [-4426.996] -- 0:04:30
      112000 -- [-4421.126] (-4420.375) (-4422.515) (-4424.472) * (-4427.435) (-4427.994) [-4419.845] (-4426.862) -- 0:04:37
      112500 -- (-4430.029) (-4430.408) [-4428.253] (-4425.704) * (-4424.573) (-4427.282) [-4423.989] (-4428.696) -- 0:04:36
      113000 -- [-4427.792] (-4433.628) (-4427.041) (-4430.187) * (-4427.440) [-4425.635] (-4419.773) (-4428.298) -- 0:04:34
      113500 -- (-4426.782) (-4424.001) (-4428.119) [-4418.345] * [-4425.375] (-4425.385) (-4426.902) (-4432.614) -- 0:04:33
      114000 -- [-4420.642] (-4423.375) (-4421.662) (-4424.738) * (-4427.205) [-4428.248] (-4425.798) (-4426.216) -- 0:04:32
      114500 -- (-4428.338) [-4427.658] (-4426.962) (-4424.198) * [-4427.256] (-4425.155) (-4428.182) (-4434.120) -- 0:04:30
      115000 -- [-4424.288] (-4423.663) (-4426.040) (-4433.235) * [-4425.485] (-4428.448) (-4429.482) (-4437.620) -- 0:04:29

      Average standard deviation of split frequencies: 0.006096

      115500 -- (-4426.891) [-4422.701] (-4430.555) (-4428.243) * (-4430.432) (-4425.462) [-4426.712] (-4432.037) -- 0:04:35
      116000 -- (-4426.823) (-4434.780) [-4430.903] (-4431.214) * [-4426.837] (-4425.058) (-4425.292) (-4435.706) -- 0:04:34
      116500 -- (-4425.699) [-4424.264] (-4428.842) (-4431.720) * [-4421.650] (-4426.873) (-4421.689) (-4431.588) -- 0:04:33
      117000 -- [-4425.511] (-4427.422) (-4427.615) (-4428.856) * (-4430.577) [-4426.644] (-4424.007) (-4433.127) -- 0:04:31
      117500 -- [-4422.446] (-4426.809) (-4426.714) (-4424.660) * (-4427.559) (-4430.365) [-4433.399] (-4427.432) -- 0:04:30
      118000 -- (-4429.675) (-4422.287) [-4423.113] (-4429.826) * (-4428.101) [-4426.581] (-4425.703) (-4427.951) -- 0:04:29
      118500 -- (-4426.058) [-4425.283] (-4426.022) (-4439.831) * [-4425.182] (-4427.011) (-4423.431) (-4422.250) -- 0:04:35
      119000 -- (-4429.504) (-4427.184) [-4422.212] (-4430.207) * (-4425.045) (-4428.107) (-4423.647) [-4420.484] -- 0:04:33
      119500 -- (-4426.377) (-4426.270) (-4432.603) [-4424.788] * (-4436.846) (-4429.408) (-4423.388) [-4430.021] -- 0:04:32
      120000 -- (-4429.318) (-4425.617) [-4430.371] (-4426.753) * (-4433.076) (-4429.148) (-4424.439) [-4423.666] -- 0:04:31

      Average standard deviation of split frequencies: 0.011720

      120500 -- (-4431.121) [-4426.929] (-4423.042) (-4425.005) * (-4423.777) [-4426.094] (-4428.958) (-4423.674) -- 0:04:30
      121000 -- (-4423.704) (-4420.906) (-4425.957) [-4423.905] * (-4425.742) (-4424.370) [-4421.571] (-4423.715) -- 0:04:28
      121500 -- [-4421.657] (-4427.133) (-4420.224) (-4423.324) * [-4421.117] (-4425.085) (-4423.290) (-4433.070) -- 0:04:27
      122000 -- (-4426.913) [-4424.186] (-4419.342) (-4428.440) * (-4422.106) (-4427.712) [-4424.016] (-4429.784) -- 0:04:33
      122500 -- (-4430.775) (-4419.815) [-4422.874] (-4423.213) * (-4419.442) [-4427.707] (-4424.434) (-4425.385) -- 0:04:32
      123000 -- (-4418.538) (-4426.641) [-4430.477] (-4423.093) * (-4428.978) (-4429.270) (-4421.213) [-4421.043] -- 0:04:30
      123500 -- (-4419.441) [-4423.953] (-4433.344) (-4427.046) * (-4428.310) (-4425.822) (-4422.496) [-4430.353] -- 0:04:29
      124000 -- [-4424.378] (-4437.583) (-4431.492) (-4424.877) * (-4425.506) [-4429.161] (-4421.725) (-4425.008) -- 0:04:28
      124500 -- [-4421.296] (-4426.062) (-4429.301) (-4425.235) * (-4424.464) (-4424.429) [-4427.196] (-4422.687) -- 0:04:27
      125000 -- (-4433.948) [-4417.365] (-4425.588) (-4424.014) * (-4434.879) [-4421.610] (-4428.635) (-4430.279) -- 0:04:26

      Average standard deviation of split frequencies: 0.013095

      125500 -- (-4431.321) [-4428.845] (-4426.450) (-4421.391) * (-4420.018) (-4425.363) [-4427.464] (-4426.616) -- 0:04:31
      126000 -- (-4431.364) (-4422.167) (-4425.341) [-4420.770] * (-4427.510) (-4422.399) (-4425.912) [-4424.046] -- 0:04:30
      126500 -- (-4424.741) [-4424.110] (-4421.672) (-4426.196) * [-4424.283] (-4420.402) (-4429.584) (-4421.299) -- 0:04:29
      127000 -- [-4429.140] (-4432.889) (-4428.449) (-4424.353) * (-4424.836) (-4424.075) (-4432.888) [-4426.727] -- 0:04:28
      127500 -- [-4424.075] (-4430.562) (-4431.009) (-4424.062) * [-4422.153] (-4425.861) (-4427.156) (-4420.698) -- 0:04:26
      128000 -- (-4428.362) (-4440.367) (-4426.930) [-4419.636] * (-4423.569) [-4426.777] (-4426.182) (-4419.899) -- 0:04:25
      128500 -- (-4426.623) (-4428.890) (-4429.076) [-4431.571] * (-4429.962) (-4423.597) (-4423.031) [-4420.971] -- 0:04:31
      129000 -- [-4423.666] (-4424.574) (-4427.014) (-4428.107) * (-4431.126) (-4425.478) (-4426.631) [-4425.013] -- 0:04:30
      129500 -- (-4423.419) [-4426.189] (-4430.095) (-4424.189) * (-4430.424) (-4421.237) (-4427.565) [-4421.116] -- 0:04:28
      130000 -- (-4421.808) (-4426.503) (-4421.690) [-4430.331] * [-4426.610] (-4423.888) (-4431.245) (-4425.280) -- 0:04:27

      Average standard deviation of split frequencies: 0.010823

      130500 -- [-4431.978] (-4431.584) (-4427.060) (-4426.034) * (-4419.508) (-4424.295) (-4425.209) [-4422.861] -- 0:04:26
      131000 -- (-4431.388) [-4431.928] (-4421.341) (-4425.164) * (-4424.114) [-4428.828] (-4434.887) (-4428.330) -- 0:04:25
      131500 -- (-4426.877) (-4421.445) (-4432.469) [-4429.789] * [-4421.483] (-4432.350) (-4428.373) (-4425.853) -- 0:04:24
      132000 -- (-4424.172) [-4428.685] (-4428.960) (-4428.297) * (-4429.051) (-4422.511) (-4424.228) [-4426.377] -- 0:04:29
      132500 -- (-4423.686) (-4423.743) [-4425.966] (-4423.296) * [-4425.822] (-4418.546) (-4427.250) (-4425.279) -- 0:04:28
      133000 -- (-4423.102) [-4419.051] (-4434.337) (-4421.968) * (-4427.718) (-4427.309) [-4424.152] (-4430.514) -- 0:04:27
      133500 -- [-4422.664] (-4423.820) (-4432.676) (-4429.627) * [-4423.339] (-4423.118) (-4424.704) (-4428.247) -- 0:04:26
      134000 -- (-4423.794) [-4423.279] (-4425.900) (-4431.368) * (-4421.160) (-4423.845) [-4427.521] (-4422.097) -- 0:04:24
      134500 -- [-4428.062] (-4427.411) (-4426.028) (-4430.078) * (-4418.162) (-4427.415) [-4427.129] (-4421.972) -- 0:04:23
      135000 -- (-4427.384) (-4432.728) [-4427.908] (-4421.953) * [-4423.310] (-4425.788) (-4437.667) (-4426.549) -- 0:04:29

      Average standard deviation of split frequencies: 0.008666

      135500 -- (-4427.872) (-4425.122) (-4425.186) [-4426.928] * (-4421.983) (-4425.016) [-4428.841] (-4424.919) -- 0:04:27
      136000 -- (-4422.346) (-4428.717) (-4427.905) [-4426.936] * (-4421.382) [-4422.439] (-4420.995) (-4423.528) -- 0:04:26
      136500 -- [-4429.044] (-4425.080) (-4431.663) (-4421.052) * (-4424.882) (-4422.420) (-4419.725) [-4422.507] -- 0:04:25
      137000 -- (-4423.944) [-4422.308] (-4422.355) (-4428.039) * (-4426.785) (-4421.290) [-4426.992] (-4425.934) -- 0:04:24
      137500 -- (-4424.764) (-4423.348) [-4421.675] (-4427.992) * (-4425.243) (-4425.320) (-4421.684) [-4420.940] -- 0:04:23
      138000 -- (-4419.060) [-4424.021] (-4422.920) (-4428.388) * [-4425.396] (-4422.317) (-4432.977) (-4426.503) -- 0:04:22
      138500 -- (-4433.234) (-4426.799) [-4418.090] (-4431.730) * (-4420.062) [-4429.522] (-4428.167) (-4418.664) -- 0:04:27
      139000 -- (-4427.000) (-4425.156) [-4422.807] (-4430.312) * [-4422.261] (-4423.882) (-4429.254) (-4426.353) -- 0:04:26
      139500 -- [-4424.058] (-4430.581) (-4424.735) (-4427.710) * [-4421.066] (-4424.774) (-4424.442) (-4431.505) -- 0:04:25
      140000 -- [-4422.851] (-4422.788) (-4434.758) (-4427.161) * (-4428.817) [-4422.700] (-4425.393) (-4431.047) -- 0:04:24

      Average standard deviation of split frequencies: 0.010054

      140500 -- (-4431.654) (-4421.743) (-4431.633) [-4425.639] * (-4419.585) (-4430.536) [-4429.905] (-4433.073) -- 0:04:23
      141000 -- (-4429.413) [-4417.402] (-4423.383) (-4419.319) * (-4425.919) (-4426.601) [-4419.631] (-4428.645) -- 0:04:21
      141500 -- (-4421.879) [-4424.785] (-4433.513) (-4426.071) * (-4423.495) (-4433.419) [-4428.592] (-4428.176) -- 0:04:20
      142000 -- (-4426.470) (-4420.094) (-4425.880) [-4426.050] * (-4420.833) [-4428.746] (-4433.029) (-4439.499) -- 0:04:25
      142500 -- (-4424.102) [-4422.397] (-4426.282) (-4424.915) * (-4421.059) (-4434.267) (-4427.111) [-4424.306] -- 0:04:24
      143000 -- [-4424.370] (-4430.930) (-4426.539) (-4422.076) * [-4426.304] (-4426.002) (-4436.351) (-4430.988) -- 0:04:23
      143500 -- (-4431.477) (-4431.799) [-4425.540] (-4423.865) * (-4422.044) (-4421.764) (-4427.691) [-4429.613] -- 0:04:22
      144000 -- [-4421.476] (-4427.342) (-4426.034) (-4430.751) * (-4422.402) (-4421.082) [-4427.876] (-4428.028) -- 0:04:21
      144500 -- [-4426.501] (-4421.837) (-4435.736) (-4426.916) * (-4426.389) (-4424.753) (-4427.192) [-4423.762] -- 0:04:20
      145000 -- (-4425.428) (-4427.464) (-4429.975) [-4429.085] * (-4422.159) (-4422.595) (-4424.632) [-4421.815] -- 0:04:25

      Average standard deviation of split frequencies: 0.011301

      145500 -- (-4428.895) [-4424.611] (-4424.296) (-4431.113) * (-4425.008) (-4425.350) (-4434.803) [-4423.441] -- 0:04:24
      146000 -- (-4421.471) (-4418.431) (-4431.247) [-4429.137] * (-4423.243) [-4422.152] (-4421.824) (-4427.185) -- 0:04:23
      146500 -- (-4440.740) (-4422.668) [-4425.302] (-4429.877) * (-4422.743) [-4419.285] (-4428.318) (-4424.048) -- 0:04:22
      147000 -- (-4427.818) (-4426.325) [-4432.065] (-4427.085) * (-4422.781) [-4419.850] (-4430.147) (-4428.717) -- 0:04:21
      147500 -- (-4427.739) [-4422.915] (-4425.230) (-4431.890) * (-4426.578) (-4424.374) (-4423.186) [-4424.375] -- 0:04:20
      148000 -- (-4423.961) (-4427.698) (-4422.003) [-4427.796] * (-4423.996) (-4430.599) [-4428.182] (-4426.721) -- 0:04:19
      148500 -- (-4427.498) (-4425.775) [-4424.348] (-4427.202) * [-4429.933] (-4427.357) (-4428.587) (-4421.753) -- 0:04:23
      149000 -- [-4427.008] (-4425.696) (-4421.708) (-4423.478) * (-4427.389) [-4426.754] (-4425.008) (-4427.765) -- 0:04:22
      149500 -- [-4423.671] (-4433.088) (-4420.347) (-4421.407) * [-4426.242] (-4422.405) (-4429.804) (-4427.645) -- 0:04:21
      150000 -- (-4426.267) [-4427.851] (-4422.077) (-4422.646) * (-4429.420) (-4422.685) (-4423.355) [-4423.437] -- 0:04:20

      Average standard deviation of split frequencies: 0.009386

      150500 -- (-4426.520) (-4421.572) [-4424.976] (-4433.184) * (-4423.625) [-4419.773] (-4423.467) (-4423.254) -- 0:04:19
      151000 -- (-4425.605) (-4423.195) [-4417.251] (-4424.827) * (-4425.602) [-4423.421] (-4425.261) (-4428.173) -- 0:04:18
      151500 -- (-4427.775) [-4428.528] (-4429.043) (-4425.222) * (-4421.826) [-4423.849] (-4425.156) (-4432.388) -- 0:04:23
      152000 -- (-4427.771) (-4427.326) (-4419.203) [-4424.246] * (-4425.925) [-4421.161] (-4423.492) (-4430.191) -- 0:04:22
      152500 -- [-4431.965] (-4423.578) (-4420.850) (-4426.904) * (-4428.967) (-4430.103) (-4427.245) [-4430.220] -- 0:04:21
      153000 -- (-4424.337) [-4422.492] (-4429.204) (-4426.625) * (-4427.048) (-4419.042) (-4426.049) [-4423.276] -- 0:04:20
      153500 -- (-4422.261) (-4424.529) [-4426.870] (-4421.254) * [-4427.879] (-4426.944) (-4422.765) (-4431.996) -- 0:04:19
      154000 -- (-4423.493) [-4424.820] (-4432.036) (-4426.880) * (-4427.400) [-4423.226] (-4421.061) (-4427.571) -- 0:04:18
      154500 -- [-4428.839] (-4429.900) (-4434.736) (-4426.533) * (-4425.057) (-4429.182) [-4425.729] (-4438.941) -- 0:04:17
      155000 -- (-4426.709) (-4433.518) [-4423.812] (-4422.358) * [-4422.771] (-4429.272) (-4420.176) (-4427.992) -- 0:04:21

      Average standard deviation of split frequencies: 0.007555

      155500 -- (-4426.145) (-4431.872) [-4423.745] (-4422.867) * (-4423.181) (-4424.481) [-4421.663] (-4431.769) -- 0:04:20
      156000 -- (-4429.607) (-4435.522) [-4428.270] (-4428.022) * (-4429.560) (-4432.867) [-4425.912] (-4425.184) -- 0:04:19
      156500 -- (-4431.371) (-4431.349) (-4422.217) [-4433.221] * [-4421.069] (-4422.158) (-4429.000) (-4422.578) -- 0:04:18
      157000 -- (-4423.430) (-4423.124) (-4420.953) [-4425.754] * [-4422.451] (-4424.031) (-4425.459) (-4424.495) -- 0:04:17
      157500 -- (-4427.395) (-4426.734) [-4422.319] (-4436.295) * (-4423.631) [-4425.695] (-4427.618) (-4427.485) -- 0:04:16
      158000 -- (-4430.481) (-4429.253) [-4422.205] (-4425.462) * (-4428.471) (-4422.786) (-4423.255) [-4427.060] -- 0:04:21
      158500 -- (-4433.771) (-4433.839) (-4425.593) [-4434.068] * (-4429.262) [-4420.831] (-4423.169) (-4426.847) -- 0:04:20
      159000 -- (-4430.921) (-4425.621) (-4431.968) [-4425.319] * (-4423.144) (-4425.095) (-4422.499) [-4427.000] -- 0:04:19
      159500 -- (-4431.092) [-4426.034] (-4432.602) (-4423.975) * (-4421.943) (-4425.730) (-4423.975) [-4424.291] -- 0:04:18
      160000 -- (-4427.706) [-4424.474] (-4428.375) (-4424.279) * [-4421.809] (-4430.309) (-4423.487) (-4427.652) -- 0:04:17

      Average standard deviation of split frequencies: 0.005868

      160500 -- (-4428.569) (-4430.485) (-4423.219) [-4420.921] * [-4425.428] (-4432.105) (-4420.466) (-4429.460) -- 0:04:16
      161000 -- (-4430.233) [-4424.344] (-4436.421) (-4422.174) * [-4427.670] (-4426.372) (-4429.020) (-4427.584) -- 0:04:20
      161500 -- [-4422.122] (-4429.402) (-4425.199) (-4424.670) * (-4423.495) [-4419.803] (-4428.143) (-4429.733) -- 0:04:19
      162000 -- (-4432.168) (-4422.888) (-4432.182) [-4419.539] * (-4435.823) (-4426.868) (-4424.344) [-4431.843] -- 0:04:18
      162500 -- (-4426.814) (-4423.023) (-4428.374) [-4419.575] * (-4427.078) (-4424.786) (-4427.083) [-4426.812] -- 0:04:17
      163000 -- (-4426.022) (-4427.476) (-4431.613) [-4423.326] * (-4425.720) [-4424.536] (-4422.950) (-4421.159) -- 0:04:16
      163500 -- [-4423.943] (-4427.532) (-4426.177) (-4428.222) * (-4420.762) (-4430.902) (-4424.943) [-4425.204] -- 0:04:15
      164000 -- [-4428.052] (-4430.681) (-4427.386) (-4427.699) * (-4424.960) (-4429.076) (-4424.373) [-4425.964] -- 0:04:14
      164500 -- [-4423.248] (-4425.691) (-4422.768) (-4425.106) * (-4430.830) [-4423.613] (-4424.049) (-4421.777) -- 0:04:19
      165000 -- (-4428.354) [-4423.034] (-4423.116) (-4427.162) * (-4434.550) [-4428.009] (-4423.563) (-4428.592) -- 0:04:18

      Average standard deviation of split frequencies: 0.005680

      165500 -- (-4429.533) [-4423.083] (-4426.192) (-4424.983) * (-4425.526) (-4423.651) (-4427.181) [-4424.328] -- 0:04:17
      166000 -- [-4428.078] (-4425.537) (-4428.980) (-4428.085) * (-4423.409) (-4428.990) (-4422.195) [-4428.235] -- 0:04:16
      166500 -- (-4435.933) (-4425.113) (-4427.060) [-4425.582] * (-4427.755) (-4418.244) (-4422.163) [-4429.169] -- 0:04:15
      167000 -- (-4435.771) (-4429.435) [-4420.122] (-4431.439) * (-4424.936) (-4429.188) (-4422.280) [-4423.948] -- 0:04:14
      167500 -- [-4425.667] (-4432.331) (-4437.208) (-4429.858) * [-4422.796] (-4423.917) (-4426.761) (-4433.156) -- 0:04:18
      168000 -- (-4426.595) (-4425.428) [-4424.915] (-4433.455) * (-4426.876) [-4424.467] (-4424.945) (-4423.281) -- 0:04:17
      168500 -- [-4428.724] (-4422.234) (-4421.958) (-4429.147) * [-4424.210] (-4425.840) (-4431.003) (-4433.110) -- 0:04:16
      169000 -- (-4426.903) (-4429.269) [-4425.647] (-4420.975) * [-4423.395] (-4423.986) (-4429.660) (-4428.959) -- 0:04:15
      169500 -- (-4430.837) (-4426.802) (-4426.235) [-4424.928] * (-4428.430) [-4420.331] (-4426.208) (-4438.566) -- 0:04:14
      170000 -- (-4427.854) (-4421.712) (-4427.946) [-4428.021] * [-4422.175] (-4425.532) (-4429.260) (-4430.348) -- 0:04:13

      Average standard deviation of split frequencies: 0.005524

      170500 -- (-4427.584) (-4426.257) [-4420.575] (-4430.585) * [-4431.560] (-4425.727) (-4424.037) (-4430.233) -- 0:04:12
      171000 -- (-4434.218) (-4431.416) [-4427.085] (-4426.597) * (-4426.877) (-4426.655) [-4430.808] (-4429.377) -- 0:04:16
      171500 -- [-4425.993] (-4428.216) (-4421.498) (-4427.274) * (-4428.102) [-4423.691] (-4431.390) (-4425.752) -- 0:04:16
      172000 -- [-4431.412] (-4432.861) (-4436.206) (-4425.506) * (-4422.191) (-4428.848) (-4429.907) [-4426.462] -- 0:04:15
      172500 -- (-4428.640) [-4426.016] (-4427.095) (-4430.240) * [-4426.208] (-4421.779) (-4425.621) (-4434.268) -- 0:04:14
      173000 -- (-4434.778) (-4424.048) [-4429.476] (-4423.110) * (-4424.570) (-4427.467) [-4428.228] (-4422.883) -- 0:04:13
      173500 -- (-4420.175) [-4429.489] (-4422.735) (-4438.220) * (-4421.690) (-4421.055) (-4424.032) [-4426.843] -- 0:04:12
      174000 -- (-4426.137) (-4427.116) (-4419.261) [-4425.632] * (-4425.924) (-4428.544) (-4429.043) [-4434.314] -- 0:04:11
      174500 -- (-4431.116) (-4427.290) [-4420.289] (-4424.570) * (-4418.225) [-4429.668] (-4426.879) (-4435.726) -- 0:04:15
      175000 -- [-4433.378] (-4425.397) (-4430.087) (-4423.541) * (-4430.116) [-4430.544] (-4426.454) (-4436.513) -- 0:04:14

      Average standard deviation of split frequencies: 0.004018

      175500 -- [-4429.718] (-4425.661) (-4437.599) (-4420.640) * [-4424.969] (-4424.283) (-4430.661) (-4436.426) -- 0:04:13
      176000 -- (-4431.064) (-4423.067) (-4429.061) [-4425.110] * (-4423.899) (-4424.940) (-4421.410) [-4429.301] -- 0:04:12
      176500 -- [-4426.865] (-4423.742) (-4424.255) (-4424.426) * (-4427.787) [-4425.307] (-4423.827) (-4427.820) -- 0:04:11
      177000 -- (-4431.891) (-4428.249) (-4428.273) [-4422.931] * (-4424.409) (-4419.293) (-4423.822) [-4418.927] -- 0:04:11
      177500 -- (-4429.416) (-4423.341) [-4424.381] (-4425.987) * [-4421.480] (-4424.849) (-4431.713) (-4429.410) -- 0:04:14
      178000 -- (-4428.819) (-4420.381) (-4423.701) [-4423.225] * [-4424.509] (-4420.077) (-4421.238) (-4428.326) -- 0:04:13
      178500 -- (-4427.957) [-4430.982] (-4421.085) (-4426.113) * (-4425.072) (-4425.826) [-4427.014] (-4426.421) -- 0:04:13
      179000 -- (-4421.391) [-4422.694] (-4425.677) (-4428.930) * (-4423.594) [-4423.627] (-4426.095) (-4430.899) -- 0:04:12
      179500 -- [-4426.589] (-4425.553) (-4423.233) (-4422.805) * (-4424.770) (-4424.335) [-4421.714] (-4428.510) -- 0:04:11
      180000 -- (-4423.683) (-4427.991) [-4422.011] (-4426.707) * (-4421.689) (-4425.500) [-4427.966] (-4427.571) -- 0:04:10

      Average standard deviation of split frequencies: 0.002609

      180500 -- (-4429.493) [-4423.923] (-4427.958) (-4428.723) * (-4422.377) (-4423.033) (-4424.338) [-4422.101] -- 0:04:09
      181000 -- [-4435.293] (-4420.261) (-4425.379) (-4427.726) * (-4425.623) (-4428.021) (-4426.257) [-4427.504] -- 0:04:13
      181500 -- (-4429.770) (-4425.775) (-4432.814) [-4426.775] * (-4426.429) (-4420.211) [-4423.668] (-4440.027) -- 0:04:12
      182000 -- (-4426.034) (-4428.850) (-4421.785) [-4425.019] * (-4424.728) [-4426.617] (-4428.616) (-4426.733) -- 0:04:11
      182500 -- (-4426.746) (-4426.970) (-4423.286) [-4425.918] * (-4419.905) (-4430.415) (-4427.547) [-4423.102] -- 0:04:10
      183000 -- (-4423.364) (-4424.528) (-4424.452) [-4420.416] * (-4433.970) (-4426.082) [-4424.313] (-4429.903) -- 0:04:10
      183500 -- (-4425.620) (-4421.179) (-4425.438) [-4422.057] * (-4431.633) (-4426.871) [-4430.778] (-4421.678) -- 0:04:09
      184000 -- (-4429.778) (-4427.880) (-4433.278) [-4423.816] * (-4426.648) [-4424.577] (-4425.441) (-4426.779) -- 0:04:12
      184500 -- (-4436.646) (-4423.113) (-4435.339) [-4423.435] * (-4431.176) (-4422.930) [-4426.788] (-4430.412) -- 0:04:11
      185000 -- (-4428.157) (-4429.220) (-4427.402) [-4423.813] * (-4431.414) [-4423.557] (-4425.712) (-4430.949) -- 0:04:11

      Average standard deviation of split frequencies: 0.003802

      185500 -- (-4426.221) (-4430.309) [-4423.826] (-4421.026) * [-4428.642] (-4428.797) (-4422.709) (-4430.711) -- 0:04:10
      186000 -- (-4427.058) [-4428.431] (-4421.589) (-4424.919) * (-4425.943) (-4431.156) [-4419.453] (-4426.933) -- 0:04:09
      186500 -- (-4428.710) (-4426.489) [-4431.956] (-4428.880) * (-4426.237) (-4421.391) [-4427.504] (-4427.064) -- 0:04:08
      187000 -- (-4423.004) [-4427.103] (-4434.159) (-4422.861) * [-4423.358] (-4429.759) (-4425.334) (-4429.833) -- 0:04:07
      187500 -- (-4426.115) (-4425.384) (-4427.268) [-4423.012] * (-4425.408) [-4426.855] (-4420.843) (-4427.190) -- 0:04:11
      188000 -- [-4426.251] (-4428.022) (-4428.567) (-4426.738) * (-4436.757) [-4422.757] (-4427.048) (-4423.843) -- 0:04:10
      188500 -- (-4426.006) (-4417.513) (-4422.182) [-4424.827] * [-4423.707] (-4429.757) (-4434.267) (-4423.080) -- 0:04:09
      189000 -- (-4422.153) (-4424.029) [-4423.580] (-4429.926) * (-4430.036) (-4423.654) (-4427.415) [-4424.578] -- 0:04:08
      189500 -- (-4423.390) (-4429.211) [-4426.087] (-4425.961) * (-4427.688) (-4422.758) [-4430.197] (-4425.670) -- 0:04:08
      190000 -- [-4420.439] (-4425.793) (-4420.451) (-4424.922) * (-4420.231) [-4428.078] (-4421.781) (-4423.864) -- 0:04:07

      Average standard deviation of split frequencies: 0.002472

      190500 -- (-4433.152) (-4425.136) [-4420.846] (-4422.757) * (-4428.937) (-4424.113) (-4429.829) [-4423.011] -- 0:04:10
      191000 -- (-4433.761) [-4426.742] (-4427.091) (-4420.325) * (-4425.916) (-4436.259) (-4426.998) [-4425.733] -- 0:04:09
      191500 -- [-4424.882] (-4424.512) (-4429.452) (-4423.915) * (-4427.339) [-4429.986] (-4423.164) (-4422.121) -- 0:04:09
      192000 -- (-4423.908) (-4426.549) [-4423.604] (-4433.509) * (-4427.638) [-4424.906] (-4422.025) (-4428.706) -- 0:04:08
      192500 -- [-4421.808] (-4436.942) (-4428.383) (-4434.415) * (-4422.946) (-4429.054) [-4421.110] (-4423.518) -- 0:04:07
      193000 -- (-4427.485) [-4424.518] (-4429.285) (-4427.146) * [-4419.290] (-4435.584) (-4420.876) (-4427.117) -- 0:04:06
      193500 -- (-4426.355) [-4421.679] (-4424.884) (-4426.021) * (-4422.041) (-4436.676) [-4437.246] (-4426.900) -- 0:04:05
      194000 -- (-4424.849) (-4423.735) (-4425.841) [-4425.916] * (-4428.021) (-4427.174) (-4429.164) [-4424.890] -- 0:04:09
      194500 -- [-4419.982] (-4428.820) (-4422.287) (-4424.385) * [-4429.556] (-4434.434) (-4426.725) (-4426.260) -- 0:04:08
      195000 -- (-4422.710) (-4430.874) (-4434.194) [-4428.282] * (-4427.994) [-4432.579] (-4422.411) (-4429.780) -- 0:04:07

      Average standard deviation of split frequencies: 0.004810

      195500 -- [-4426.929] (-4431.691) (-4429.690) (-4419.389) * (-4425.565) (-4427.561) (-4425.534) [-4426.943] -- 0:04:06
      196000 -- [-4423.377] (-4424.153) (-4432.740) (-4431.005) * (-4427.418) [-4432.378] (-4429.065) (-4427.337) -- 0:04:06
      196500 -- (-4426.511) (-4429.691) [-4426.267] (-4422.414) * [-4425.745] (-4426.743) (-4432.065) (-4422.444) -- 0:04:05
      197000 -- (-4420.912) (-4429.044) (-4425.177) [-4422.130] * [-4420.507] (-4424.361) (-4427.158) (-4431.964) -- 0:04:04
      197500 -- (-4422.691) (-4426.626) (-4429.786) [-4422.342] * (-4427.435) (-4426.425) [-4424.320] (-4426.870) -- 0:04:07
      198000 -- [-4424.560] (-4434.760) (-4427.270) (-4421.835) * (-4427.508) [-4423.549] (-4427.054) (-4425.754) -- 0:04:07
      198500 -- (-4418.764) [-4427.374] (-4420.032) (-4425.504) * (-4424.266) [-4424.037] (-4428.188) (-4429.396) -- 0:04:06
      199000 -- [-4421.902] (-4426.390) (-4424.245) (-4427.520) * (-4424.401) (-4424.268) (-4431.170) [-4428.344] -- 0:04:05
      199500 -- (-4425.442) (-4426.768) [-4423.940] (-4425.438) * [-4431.660] (-4422.599) (-4424.169) (-4431.245) -- 0:04:04
      200000 -- [-4423.107] (-4426.674) (-4422.664) (-4423.559) * (-4429.138) [-4423.782] (-4437.331) (-4431.164) -- 0:04:04

      Average standard deviation of split frequencies: 0.003524

      200500 -- (-4422.332) (-4428.366) [-4424.368] (-4427.391) * (-4430.211) [-4425.634] (-4427.880) (-4437.063) -- 0:04:07
      201000 -- (-4423.848) (-4426.533) (-4427.872) [-4422.010] * (-4425.082) (-4423.738) [-4426.015] (-4426.253) -- 0:04:06
      201500 -- (-4429.206) (-4429.714) (-4427.467) [-4427.081] * [-4428.951] (-4421.780) (-4423.381) (-4426.089) -- 0:04:05
      202000 -- (-4427.085) [-4425.697] (-4426.613) (-4430.663) * (-4430.688) [-4428.383] (-4429.359) (-4432.903) -- 0:04:04
      202500 -- (-4426.529) (-4423.280) [-4424.006] (-4433.757) * (-4432.649) (-4424.967) (-4426.310) [-4429.431] -- 0:04:04
      203000 -- (-4422.393) [-4423.438] (-4426.813) (-4432.428) * (-4434.526) [-4423.680] (-4426.979) (-4427.569) -- 0:04:03
      203500 -- (-4421.615) (-4424.423) (-4428.707) [-4427.675] * (-4438.088) (-4427.853) (-4426.231) [-4423.725] -- 0:04:02
      204000 -- (-4424.644) (-4435.845) [-4424.096] (-4427.670) * (-4431.768) [-4426.331] (-4421.068) (-4433.603) -- 0:04:05
      204500 -- (-4423.224) (-4442.423) [-4425.344] (-4433.975) * (-4435.378) [-4427.335] (-4424.228) (-4427.159) -- 0:04:05
      205000 -- (-4422.291) (-4435.185) [-4430.990] (-4426.490) * (-4437.393) (-4427.531) [-4426.786] (-4427.550) -- 0:04:04

      Average standard deviation of split frequencies: 0.001144

      205500 -- (-4428.383) (-4422.913) [-4421.857] (-4426.019) * (-4427.503) [-4428.074] (-4428.079) (-4430.021) -- 0:04:03
      206000 -- (-4424.744) (-4425.136) (-4431.530) [-4426.078] * (-4421.266) [-4421.981] (-4424.927) (-4428.129) -- 0:04:02
      206500 -- [-4424.644] (-4425.468) (-4432.189) (-4434.364) * (-4433.477) (-4422.077) (-4428.691) [-4425.817] -- 0:04:02
      207000 -- (-4426.371) (-4424.649) (-4431.942) [-4426.736] * [-4422.589] (-4423.459) (-4424.969) (-4428.203) -- 0:04:05
      207500 -- (-4423.640) (-4426.164) [-4430.930] (-4431.290) * (-4424.455) (-4431.553) [-4425.736] (-4423.920) -- 0:04:04
      208000 -- (-4423.809) (-4424.342) [-4424.240] (-4431.649) * (-4432.680) (-4425.806) (-4420.147) [-4420.060] -- 0:04:03
      208500 -- (-4423.747) [-4431.995] (-4432.734) (-4425.328) * (-4432.347) (-4434.638) [-4421.667] (-4421.216) -- 0:04:02
      209000 -- (-4429.115) [-4426.269] (-4425.622) (-4422.080) * [-4425.261] (-4418.874) (-4427.414) (-4421.580) -- 0:04:02
      209500 -- (-4430.989) (-4427.680) (-4423.436) [-4429.252] * (-4424.424) (-4425.652) [-4421.035] (-4424.400) -- 0:04:01
      210000 -- (-4427.007) (-4428.751) [-4425.657] (-4423.397) * (-4432.770) (-4429.885) [-4424.353] (-4421.179) -- 0:04:00

      Average standard deviation of split frequencies: 0.001119

      210500 -- (-4436.538) (-4425.438) [-4425.636] (-4428.884) * (-4418.948) (-4425.140) (-4431.283) [-4421.637] -- 0:04:03
      211000 -- (-4422.000) (-4432.950) [-4427.965] (-4421.851) * [-4423.497] (-4424.414) (-4436.815) (-4433.520) -- 0:04:03
      211500 -- (-4428.344) (-4432.947) (-4423.050) [-4426.591] * (-4432.182) (-4430.108) [-4430.520] (-4423.744) -- 0:04:02
      212000 -- (-4424.247) [-4425.479] (-4425.309) (-4426.906) * [-4425.595] (-4429.610) (-4430.030) (-4426.329) -- 0:04:01
      212500 -- (-4422.837) [-4426.156] (-4428.928) (-4426.654) * (-4426.136) (-4428.157) (-4425.489) [-4428.463] -- 0:04:00
      213000 -- (-4423.894) (-4425.849) (-4425.243) [-4427.275] * (-4417.936) (-4427.204) [-4422.358] (-4424.721) -- 0:04:00
      213500 -- (-4418.335) [-4422.650] (-4427.476) (-4423.172) * (-4420.439) [-4426.885] (-4421.507) (-4426.093) -- 0:04:03
      214000 -- (-4425.429) (-4424.692) [-4424.018] (-4429.299) * (-4434.008) [-4424.258] (-4425.808) (-4429.153) -- 0:04:02
      214500 -- [-4423.686] (-4427.214) (-4425.382) (-4429.737) * (-4428.918) (-4426.677) [-4423.004] (-4422.290) -- 0:04:01
      215000 -- (-4425.796) [-4420.622] (-4426.009) (-4434.720) * [-4424.474] (-4424.636) (-4427.190) (-4421.798) -- 0:04:00

      Average standard deviation of split frequencies: 0.001091

      215500 -- (-4418.164) (-4421.522) (-4420.667) [-4423.050] * (-4425.544) [-4424.111] (-4423.150) (-4426.484) -- 0:04:00
      216000 -- (-4428.162) (-4427.289) [-4421.817] (-4423.114) * [-4419.770] (-4427.719) (-4431.197) (-4423.919) -- 0:03:59
      216500 -- [-4431.616] (-4423.848) (-4428.631) (-4425.797) * [-4422.052] (-4428.268) (-4422.533) (-4425.247) -- 0:03:58
      217000 -- [-4427.810] (-4425.332) (-4430.638) (-4425.543) * (-4428.318) (-4423.099) (-4430.681) [-4423.795] -- 0:04:01
      217500 -- (-4425.097) [-4422.894] (-4417.815) (-4425.397) * (-4423.939) (-4427.429) (-4424.768) [-4420.333] -- 0:04:01
      218000 -- (-4431.378) (-4434.299) [-4422.464] (-4426.173) * (-4427.123) [-4419.754] (-4424.721) (-4429.563) -- 0:04:00
      218500 -- (-4429.314) (-4435.160) (-4423.209) [-4428.309] * (-4422.303) [-4429.554] (-4425.521) (-4431.528) -- 0:03:59
      219000 -- (-4428.543) (-4425.110) (-4429.066) [-4421.333] * [-4429.011] (-4420.155) (-4424.333) (-4431.986) -- 0:03:58
      219500 -- (-4425.016) (-4426.722) [-4424.835] (-4423.947) * [-4423.205] (-4421.095) (-4430.831) (-4428.298) -- 0:03:58
      220000 -- (-4429.126) (-4422.231) (-4420.281) [-4423.201] * (-4427.220) (-4416.629) [-4425.842] (-4429.994) -- 0:04:01

      Average standard deviation of split frequencies: 0.003204

      220500 -- (-4423.845) (-4427.725) [-4422.698] (-4428.667) * (-4427.589) (-4428.922) (-4425.198) [-4426.858] -- 0:04:00
      221000 -- (-4424.334) [-4425.638] (-4431.544) (-4424.372) * (-4423.110) (-4422.123) [-4424.959] (-4427.828) -- 0:03:59
      221500 -- (-4425.730) [-4423.472] (-4426.893) (-4425.561) * (-4422.315) (-4423.502) [-4428.343] (-4429.141) -- 0:03:58
      222000 -- (-4424.105) (-4421.513) (-4433.535) [-4427.562] * (-4422.340) (-4424.917) (-4425.017) [-4423.274] -- 0:03:58
      222500 -- (-4431.432) (-4425.901) [-4424.063] (-4423.136) * (-4427.619) (-4432.852) (-4421.486) [-4422.563] -- 0:03:57
      223000 -- [-4423.173] (-4423.951) (-4428.221) (-4423.492) * (-4427.694) [-4424.883] (-4423.516) (-4420.710) -- 0:03:56
      223500 -- (-4422.912) [-4423.840] (-4428.621) (-4422.125) * (-4427.194) (-4421.549) (-4428.135) [-4421.849] -- 0:03:59
      224000 -- (-4426.398) (-4425.120) [-4423.606] (-4420.954) * (-4426.081) [-4423.570] (-4427.659) (-4424.409) -- 0:03:59
      224500 -- (-4430.145) (-4432.670) [-4424.039] (-4425.996) * (-4425.665) (-4430.016) (-4423.991) [-4425.741] -- 0:03:58
      225000 -- (-4428.047) (-4427.803) [-4425.324] (-4429.681) * (-4424.943) (-4426.556) [-4419.964] (-4422.439) -- 0:03:57

      Average standard deviation of split frequencies: 0.005215

      225500 -- (-4434.535) [-4426.477] (-4418.436) (-4432.520) * (-4430.294) (-4422.690) (-4422.655) [-4425.353] -- 0:03:56
      226000 -- [-4425.129] (-4419.237) (-4430.691) (-4430.670) * (-4424.622) (-4422.403) (-4422.180) [-4421.671] -- 0:03:56
      226500 -- (-4427.057) (-4423.721) (-4429.395) [-4426.680] * [-4424.738] (-4426.678) (-4421.567) (-4427.425) -- 0:03:55
      227000 -- (-4425.557) [-4421.888] (-4431.751) (-4426.835) * (-4430.357) (-4429.983) (-4423.294) [-4421.551] -- 0:03:58
      227500 -- [-4418.285] (-4424.798) (-4429.432) (-4431.304) * (-4425.479) (-4426.762) [-4421.264] (-4421.996) -- 0:03:57
      228000 -- [-4425.426] (-4424.777) (-4427.163) (-4435.601) * [-4427.661] (-4423.100) (-4425.726) (-4423.024) -- 0:03:57
      228500 -- [-4422.887] (-4423.394) (-4425.727) (-4422.851) * (-4437.338) [-4420.990] (-4431.030) (-4425.343) -- 0:03:56
      229000 -- (-4424.575) (-4420.373) (-4426.041) [-4425.965] * (-4429.132) [-4426.400] (-4422.788) (-4429.395) -- 0:03:55
      229500 -- (-4423.614) (-4432.346) (-4426.712) [-4427.228] * (-4432.585) [-4428.064] (-4416.540) (-4425.525) -- 0:03:55
      230000 -- (-4419.292) (-4423.826) (-4427.591) [-4427.202] * (-4424.140) [-4424.271] (-4423.489) (-4431.849) -- 0:03:57

      Average standard deviation of split frequencies: 0.004087

      230500 -- (-4419.772) (-4424.855) [-4423.050] (-4426.630) * (-4428.365) (-4430.965) [-4428.157] (-4420.991) -- 0:03:57
      231000 -- [-4424.640] (-4433.991) (-4428.227) (-4428.884) * (-4427.149) (-4422.006) [-4422.414] (-4422.429) -- 0:03:56
      231500 -- (-4424.080) (-4427.711) [-4424.961] (-4424.551) * [-4424.709] (-4425.277) (-4423.342) (-4429.568) -- 0:03:55
      232000 -- (-4421.069) (-4425.772) [-4426.713] (-4426.372) * [-4420.307] (-4425.624) (-4434.768) (-4424.554) -- 0:03:55
      232500 -- [-4426.072] (-4426.786) (-4423.381) (-4432.244) * [-4425.863] (-4423.584) (-4423.595) (-4431.876) -- 0:03:54
      233000 -- (-4428.015) [-4428.079] (-4428.486) (-4432.470) * (-4425.712) [-4424.385] (-4422.540) (-4431.769) -- 0:03:53
      233500 -- [-4422.366] (-4427.695) (-4421.889) (-4431.120) * [-4422.501] (-4422.971) (-4419.674) (-4428.080) -- 0:03:56
      234000 -- (-4422.612) [-4425.020] (-4422.413) (-4423.767) * (-4431.070) (-4425.268) [-4421.581] (-4421.883) -- 0:03:55
      234500 -- (-4420.563) (-4420.998) (-4427.278) [-4423.890] * (-4428.471) [-4423.959] (-4432.076) (-4432.525) -- 0:03:55
      235000 -- [-4428.966] (-4430.768) (-4428.003) (-4429.828) * (-4421.304) [-4427.867] (-4437.834) (-4431.708) -- 0:03:54

      Average standard deviation of split frequencies: 0.003995

      235500 -- (-4426.933) (-4425.914) (-4423.662) [-4418.283] * [-4421.620] (-4429.683) (-4431.185) (-4426.867) -- 0:03:53
      236000 -- (-4428.575) [-4422.044] (-4420.285) (-4428.100) * [-4424.559] (-4427.135) (-4442.313) (-4425.479) -- 0:03:53
      236500 -- (-4430.977) (-4422.892) (-4427.888) [-4425.788] * (-4432.114) (-4428.792) (-4426.248) [-4425.560] -- 0:03:52
      237000 -- (-4425.288) [-4423.680] (-4429.099) (-4426.666) * [-4422.067] (-4424.494) (-4427.777) (-4426.108) -- 0:03:55
      237500 -- (-4430.515) [-4424.256] (-4431.392) (-4421.241) * [-4422.639] (-4429.910) (-4425.131) (-4440.007) -- 0:03:54
      238000 -- [-4432.789] (-4420.556) (-4433.783) (-4429.078) * [-4427.733] (-4422.885) (-4430.629) (-4422.975) -- 0:03:53
      238500 -- (-4419.692) (-4426.652) (-4420.106) [-4420.451] * (-4423.126) [-4422.565] (-4430.062) (-4423.269) -- 0:03:53
      239000 -- (-4420.164) (-4432.196) [-4423.699] (-4423.810) * [-4423.560] (-4424.878) (-4426.761) (-4427.231) -- 0:03:52
      239500 -- (-4423.194) (-4434.277) [-4423.350] (-4421.323) * [-4424.498] (-4423.648) (-4422.247) (-4426.057) -- 0:03:51
      240000 -- (-4425.659) (-4423.212) [-4420.636] (-4429.136) * (-4423.686) (-4431.408) [-4426.390] (-4427.227) -- 0:03:51

      Average standard deviation of split frequencies: 0.003917

      240500 -- [-4421.371] (-4423.221) (-4420.639) (-4426.386) * (-4421.939) [-4423.564] (-4424.765) (-4430.460) -- 0:03:53
      241000 -- (-4428.613) [-4426.582] (-4435.404) (-4425.366) * [-4430.144] (-4426.747) (-4423.360) (-4423.636) -- 0:03:53
      241500 -- (-4433.976) (-4420.186) (-4421.995) [-4429.195] * [-4426.297] (-4425.930) (-4429.287) (-4428.483) -- 0:03:52
      242000 -- (-4426.210) [-4426.039] (-4426.852) (-4426.579) * [-4425.319] (-4428.137) (-4422.659) (-4421.309) -- 0:03:51
      242500 -- [-4430.683] (-4431.409) (-4423.154) (-4428.270) * [-4427.190] (-4427.940) (-4425.639) (-4430.490) -- 0:03:51
      243000 -- (-4420.491) (-4424.681) (-4423.663) [-4423.662] * (-4425.796) (-4426.929) (-4428.706) [-4421.839] -- 0:03:50
      243500 -- [-4427.316] (-4428.627) (-4426.505) (-4425.258) * (-4425.694) (-4432.071) (-4427.917) [-4423.238] -- 0:03:53
      244000 -- (-4427.452) (-4424.842) [-4424.772] (-4428.361) * (-4432.918) [-4435.670] (-4423.247) (-4422.423) -- 0:03:52
      244500 -- [-4429.262] (-4434.190) (-4431.893) (-4425.776) * [-4426.562] (-4433.748) (-4430.013) (-4420.751) -- 0:03:51
      245000 -- [-4426.728] (-4423.557) (-4418.605) (-4431.164) * (-4433.643) [-4433.319] (-4430.786) (-4424.762) -- 0:03:51

      Average standard deviation of split frequencies: 0.003833

      245500 -- [-4423.924] (-4423.941) (-4428.930) (-4422.760) * (-4429.449) [-4424.237] (-4436.158) (-4426.889) -- 0:03:50
      246000 -- (-4431.771) (-4422.692) [-4428.143] (-4436.580) * (-4426.890) (-4426.654) (-4427.502) [-4425.367] -- 0:03:49
      246500 -- (-4433.390) (-4430.537) [-4422.090] (-4435.426) * (-4427.043) (-4422.792) (-4424.527) [-4425.243] -- 0:03:49
      247000 -- (-4428.581) (-4429.618) [-4421.317] (-4435.438) * [-4428.027] (-4432.645) (-4427.984) (-4426.843) -- 0:03:51
      247500 -- (-4427.659) (-4428.563) [-4426.365] (-4426.110) * (-4423.779) (-4424.969) [-4426.665] (-4424.573) -- 0:03:51
      248000 -- (-4430.282) (-4437.892) [-4421.814] (-4426.641) * (-4418.416) [-4431.530] (-4432.299) (-4431.141) -- 0:03:50
      248500 -- (-4438.747) (-4428.291) (-4423.539) [-4423.928] * (-4423.390) (-4424.446) [-4427.979] (-4427.408) -- 0:03:49
      249000 -- [-4421.771] (-4420.655) (-4431.006) (-4428.100) * (-4421.037) (-4420.371) [-4422.437] (-4430.866) -- 0:03:49
      249500 -- (-4426.646) [-4421.252] (-4423.065) (-4437.840) * (-4424.737) (-4425.802) (-4428.760) [-4426.113] -- 0:03:48
      250000 -- (-4425.230) (-4421.287) [-4426.862] (-4427.241) * [-4427.970] (-4431.993) (-4425.194) (-4426.424) -- 0:03:51

      Average standard deviation of split frequencies: 0.002821

      250500 -- (-4430.661) [-4422.385] (-4425.548) (-4431.599) * (-4424.327) (-4420.141) [-4427.983] (-4428.089) -- 0:03:50
      251000 -- (-4427.306) [-4433.544] (-4424.632) (-4433.473) * (-4427.268) [-4418.112] (-4428.205) (-4424.610) -- 0:03:49
      251500 -- (-4430.266) (-4430.329) [-4424.378] (-4422.471) * [-4423.818] (-4430.027) (-4422.732) (-4431.393) -- 0:03:49
      252000 -- (-4434.764) (-4432.229) [-4425.751] (-4429.929) * (-4425.045) (-4426.198) [-4431.890] (-4427.833) -- 0:03:48
      252500 -- (-4426.125) (-4428.259) [-4421.083] (-4426.347) * (-4421.515) [-4423.062] (-4427.916) (-4423.396) -- 0:03:47
      253000 -- (-4434.142) (-4422.597) (-4422.593) [-4427.612] * (-4425.202) [-4423.177] (-4422.762) (-4426.191) -- 0:03:47
      253500 -- [-4421.428] (-4426.367) (-4427.184) (-4423.570) * (-4422.484) (-4424.719) [-4425.762] (-4421.336) -- 0:03:49
      254000 -- [-4432.137] (-4423.834) (-4424.261) (-4426.044) * (-4429.365) (-4425.590) (-4431.939) [-4421.117] -- 0:03:49
      254500 -- (-4422.029) [-4431.317] (-4421.504) (-4426.868) * (-4423.937) [-4419.498] (-4430.441) (-4423.483) -- 0:03:48
      255000 -- [-4429.120] (-4431.257) (-4425.537) (-4429.781) * (-4422.966) (-4424.374) (-4421.685) [-4422.840] -- 0:03:47

      Average standard deviation of split frequencies: 0.001841

      255500 -- [-4424.013] (-4430.809) (-4438.626) (-4428.438) * (-4424.696) (-4427.466) [-4416.635] (-4429.966) -- 0:03:47
      256000 -- (-4426.509) (-4431.086) (-4425.751) [-4421.181] * (-4422.928) [-4420.075] (-4430.902) (-4424.795) -- 0:03:46
      256500 -- (-4425.741) (-4431.334) [-4426.101] (-4426.514) * [-4432.544] (-4426.456) (-4432.156) (-4421.991) -- 0:03:46
      257000 -- (-4424.007) [-4428.715] (-4423.017) (-4428.331) * (-4424.849) (-4425.010) (-4425.397) [-4428.120] -- 0:03:48
      257500 -- (-4425.779) (-4425.032) [-4423.688] (-4426.193) * (-4427.978) [-4425.546] (-4425.891) (-4423.556) -- 0:03:47
      258000 -- (-4428.900) (-4421.061) [-4429.865] (-4427.125) * (-4431.610) [-4421.626] (-4424.712) (-4423.290) -- 0:03:47
      258500 -- (-4419.534) (-4425.772) [-4425.350] (-4423.839) * (-4436.076) [-4421.733] (-4424.804) (-4421.629) -- 0:03:46
      259000 -- (-4426.965) (-4427.903) [-4422.287] (-4427.580) * (-4427.433) (-4420.087) [-4428.728] (-4428.126) -- 0:03:46
      259500 -- (-4429.991) [-4426.026] (-4432.098) (-4425.270) * (-4430.661) (-4426.088) [-4418.893] (-4422.960) -- 0:03:45
      260000 -- [-4426.562] (-4427.693) (-4423.166) (-4428.808) * (-4424.724) (-4425.046) (-4434.642) [-4432.544] -- 0:03:44

      Average standard deviation of split frequencies: 0.003617

      260500 -- [-4422.292] (-4429.522) (-4422.585) (-4428.258) * (-4420.362) [-4422.421] (-4436.185) (-4425.853) -- 0:03:47
      261000 -- [-4427.018] (-4427.417) (-4422.653) (-4422.175) * (-4424.893) [-4425.216] (-4422.870) (-4423.858) -- 0:03:46
      261500 -- [-4423.070] (-4424.488) (-4430.444) (-4426.438) * (-4417.860) [-4431.252] (-4429.124) (-4428.690) -- 0:03:45
      262000 -- (-4421.617) (-4427.821) [-4427.300] (-4426.875) * [-4425.211] (-4432.920) (-4428.901) (-4426.542) -- 0:03:45
      262500 -- (-4422.350) (-4426.336) [-4426.101] (-4420.362) * (-4426.266) (-4422.315) (-4423.787) [-4426.532] -- 0:03:44
      263000 -- (-4423.647) (-4431.975) [-4422.836] (-4423.869) * (-4428.431) (-4427.737) [-4422.394] (-4420.904) -- 0:03:44
      263500 -- [-4428.374] (-4433.164) (-4424.161) (-4427.490) * (-4432.124) (-4424.837) (-4423.103) [-4422.581] -- 0:03:46
      264000 -- (-4420.870) (-4427.650) (-4427.408) [-4422.818] * (-4425.629) (-4432.293) (-4420.656) [-4425.004] -- 0:03:45
      264500 -- (-4422.359) (-4424.982) (-4425.833) [-4425.871] * (-4424.149) [-4426.344] (-4424.010) (-4427.998) -- 0:03:45
      265000 -- (-4423.001) (-4435.394) [-4430.756] (-4424.323) * (-4422.443) (-4423.035) [-4434.512] (-4422.012) -- 0:03:44

      Average standard deviation of split frequencies: 0.004430

      265500 -- [-4422.013] (-4429.677) (-4422.426) (-4424.398) * (-4426.326) [-4421.920] (-4420.942) (-4422.009) -- 0:03:44
      266000 -- (-4430.639) (-4424.147) [-4426.747] (-4430.381) * (-4424.966) [-4425.709] (-4426.297) (-4429.480) -- 0:03:43
      266500 -- (-4426.427) [-4425.584] (-4421.332) (-4422.506) * (-4425.619) [-4428.628] (-4432.395) (-4423.398) -- 0:03:42
      267000 -- (-4428.727) (-4425.068) (-4426.027) [-4420.907] * (-4424.303) (-4425.727) (-4421.468) [-4424.473] -- 0:03:45
      267500 -- (-4429.599) [-4426.973] (-4438.041) (-4426.503) * (-4427.857) (-4421.109) [-4427.761] (-4421.309) -- 0:03:44
      268000 -- [-4423.431] (-4424.279) (-4428.816) (-4429.163) * (-4424.196) (-4422.675) (-4431.535) [-4423.896] -- 0:03:43
      268500 -- (-4419.350) (-4421.498) [-4422.372] (-4427.558) * [-4424.688] (-4426.787) (-4426.162) (-4427.677) -- 0:03:43
      269000 -- (-4429.787) (-4426.581) (-4423.168) [-4422.479] * (-4431.112) (-4435.369) [-4428.951] (-4428.576) -- 0:03:42
      269500 -- (-4425.270) (-4432.148) (-4424.236) [-4423.147] * (-4425.861) (-4436.719) (-4427.831) [-4428.070] -- 0:03:42
      270000 -- (-4426.161) (-4436.276) [-4428.161] (-4421.723) * [-4420.763] (-4432.972) (-4426.499) (-4429.311) -- 0:03:41

      Average standard deviation of split frequencies: 0.005225

      270500 -- (-4431.135) [-4425.891] (-4429.332) (-4427.443) * (-4429.393) (-4425.160) (-4421.223) [-4433.518] -- 0:03:43
      271000 -- (-4425.134) [-4423.735] (-4421.297) (-4423.886) * (-4433.339) (-4433.085) [-4423.469] (-4437.048) -- 0:03:43
      271500 -- [-4422.970] (-4426.978) (-4423.321) (-4423.810) * (-4432.474) [-4424.239] (-4426.195) (-4423.875) -- 0:03:42
      272000 -- [-4425.138] (-4424.588) (-4429.191) (-4423.438) * (-4428.213) (-4428.126) (-4421.737) [-4424.254] -- 0:03:42
      272500 -- [-4423.219] (-4422.408) (-4423.550) (-4422.234) * (-4421.766) (-4431.551) [-4422.869] (-4426.265) -- 0:03:41
      273000 -- (-4429.807) (-4422.437) (-4424.814) [-4429.291] * [-4424.341] (-4428.232) (-4423.963) (-4432.175) -- 0:03:41
      273500 -- (-4427.560) (-4425.426) (-4426.047) [-4423.125] * [-4419.807] (-4423.255) (-4426.681) (-4432.627) -- 0:03:43
      274000 -- (-4421.274) [-4425.505] (-4424.228) (-4421.200) * (-4426.852) (-4427.067) (-4436.294) [-4425.934] -- 0:03:42
      274500 -- (-4422.914) [-4424.494] (-4426.739) (-4428.406) * (-4424.383) (-4423.705) (-4431.163) [-4427.176] -- 0:03:42
      275000 -- [-4424.247] (-4423.547) (-4423.160) (-4430.760) * [-4421.158] (-4423.196) (-4431.006) (-4425.328) -- 0:03:41

      Average standard deviation of split frequencies: 0.006832

      275500 -- (-4429.140) [-4421.650] (-4423.083) (-4426.699) * [-4425.752] (-4425.547) (-4432.768) (-4423.724) -- 0:03:40
      276000 -- [-4421.808] (-4426.722) (-4428.288) (-4427.452) * (-4424.077) (-4423.892) [-4423.706] (-4425.875) -- 0:03:40
      276500 -- [-4419.592] (-4423.504) (-4423.130) (-4423.235) * (-4427.853) (-4421.347) [-4426.202] (-4427.580) -- 0:03:39
      277000 -- (-4421.041) (-4425.191) [-4425.564] (-4428.263) * [-4423.600] (-4422.694) (-4428.713) (-4421.424) -- 0:03:41
      277500 -- (-4432.367) (-4426.440) (-4429.029) [-4433.315] * (-4427.182) [-4432.346] (-4423.612) (-4424.159) -- 0:03:41
      278000 -- (-4428.348) (-4439.955) [-4423.086] (-4425.848) * (-4428.307) [-4423.680] (-4424.039) (-4423.068) -- 0:03:40
      278500 -- (-4431.879) [-4423.399] (-4424.476) (-4428.235) * (-4421.978) (-4426.622) (-4424.690) [-4423.607] -- 0:03:40
      279000 -- [-4433.828] (-4433.236) (-4427.010) (-4429.388) * (-4423.050) (-4427.459) [-4421.958] (-4431.968) -- 0:03:39
      279500 -- (-4430.107) (-4427.256) (-4419.859) [-4426.037] * [-4427.195] (-4422.601) (-4424.863) (-4427.109) -- 0:03:39
      280000 -- [-4430.025] (-4422.125) (-4425.119) (-4427.131) * (-4421.972) (-4426.439) [-4426.195] (-4430.670) -- 0:03:38

      Average standard deviation of split frequencies: 0.005039

      280500 -- (-4423.622) (-4431.598) [-4420.519] (-4427.836) * (-4431.820) (-4430.154) [-4423.816] (-4431.721) -- 0:03:40
      281000 -- (-4426.586) (-4430.961) [-4424.594] (-4421.934) * (-4429.439) (-4423.990) (-4423.198) [-4422.518] -- 0:03:40
      281500 -- [-4428.153] (-4428.622) (-4424.748) (-4418.947) * (-4423.191) [-4423.352] (-4428.115) (-4427.787) -- 0:03:39
      282000 -- [-4424.318] (-4430.680) (-4425.149) (-4425.826) * (-4433.461) (-4421.421) [-4423.865] (-4423.133) -- 0:03:38
      282500 -- [-4421.447] (-4426.536) (-4421.127) (-4420.545) * (-4424.673) (-4426.605) (-4426.220) [-4425.818] -- 0:03:38
      283000 -- (-4432.682) [-4421.564] (-4421.799) (-4423.058) * (-4422.426) (-4429.557) (-4419.428) [-4424.670] -- 0:03:37
      283500 -- (-4435.054) (-4425.602) (-4422.039) [-4424.355] * (-4425.156) (-4429.139) [-4421.877] (-4426.304) -- 0:03:37
      284000 -- (-4430.505) [-4423.633] (-4424.355) (-4431.307) * (-4427.265) (-4429.898) [-4426.884] (-4423.028) -- 0:03:39
      284500 -- (-4424.868) (-4429.505) (-4425.841) [-4426.780] * [-4427.627] (-4424.690) (-4427.342) (-4423.128) -- 0:03:38
      285000 -- (-4426.761) (-4423.810) (-4421.623) [-4424.749] * (-4429.239) (-4424.939) [-4431.366] (-4429.278) -- 0:03:38

      Average standard deviation of split frequencies: 0.004121

      285500 -- (-4427.784) (-4422.498) [-4426.211] (-4424.259) * (-4421.139) [-4426.107] (-4425.222) (-4427.482) -- 0:03:37
      286000 -- (-4424.696) [-4422.882] (-4421.696) (-4430.924) * [-4423.892] (-4428.569) (-4426.679) (-4430.200) -- 0:03:37
      286500 -- (-4423.986) (-4426.481) (-4434.151) [-4426.734] * (-4431.398) [-4425.968] (-4424.712) (-4425.503) -- 0:03:36
      287000 -- (-4421.065) (-4426.606) (-4427.476) [-4431.465] * (-4429.779) (-4440.160) [-4424.703] (-4426.173) -- 0:03:38
      287500 -- (-4425.826) [-4424.797] (-4432.961) (-4429.167) * (-4422.644) (-4436.354) [-4426.587] (-4422.949) -- 0:03:38
      288000 -- (-4427.724) (-4429.296) (-4428.585) [-4422.729] * (-4435.195) (-4428.981) [-4431.040] (-4425.727) -- 0:03:37
      288500 -- [-4422.446] (-4430.346) (-4433.606) (-4421.443) * (-4427.705) (-4422.757) (-4427.857) [-4423.149] -- 0:03:37
      289000 -- [-4426.276] (-4426.445) (-4426.844) (-4423.196) * (-4424.373) (-4422.813) [-4423.240] (-4424.666) -- 0:03:36
      289500 -- [-4421.840] (-4431.505) (-4426.357) (-4426.742) * (-4424.444) (-4426.526) [-4421.515] (-4422.246) -- 0:03:35
      290000 -- (-4432.070) (-4426.857) [-4423.852] (-4428.308) * [-4422.724] (-4425.446) (-4432.417) (-4422.621) -- 0:03:35

      Average standard deviation of split frequencies: 0.004865

      290500 -- (-4430.748) [-4422.361] (-4426.339) (-4426.648) * (-4426.044) (-4433.835) [-4426.015] (-4422.189) -- 0:03:37
      291000 -- (-4423.769) (-4424.063) [-4419.774] (-4425.398) * (-4430.976) (-4424.272) [-4423.239] (-4424.491) -- 0:03:36
      291500 -- [-4425.524] (-4429.752) (-4428.987) (-4426.029) * (-4426.466) (-4430.150) [-4431.246] (-4424.427) -- 0:03:36
      292000 -- (-4424.546) (-4424.434) (-4428.836) [-4421.169] * (-4428.232) [-4428.629] (-4441.207) (-4425.703) -- 0:03:35
      292500 -- (-4431.157) (-4427.745) (-4427.910) [-4418.472] * (-4423.226) (-4425.444) [-4427.241] (-4426.600) -- 0:03:35
      293000 -- (-4424.249) [-4423.392] (-4426.893) (-4431.449) * (-4431.576) [-4422.541] (-4430.654) (-4420.964) -- 0:03:34
      293500 -- (-4428.090) (-4420.733) (-4429.559) [-4420.563] * (-4423.741) [-4420.253] (-4430.444) (-4424.461) -- 0:03:34
      294000 -- (-4430.746) (-4424.437) [-4424.541] (-4423.189) * (-4422.790) (-4421.598) (-4425.096) [-4425.833] -- 0:03:36
      294500 -- (-4423.291) (-4423.813) [-4421.380] (-4421.986) * (-4425.758) (-4422.753) [-4426.381] (-4425.005) -- 0:03:35
      295000 -- (-4425.829) [-4421.837] (-4432.728) (-4423.384) * (-4425.980) (-4427.043) (-4423.216) [-4426.043] -- 0:03:35

      Average standard deviation of split frequencies: 0.007167

      295500 -- [-4424.175] (-4424.390) (-4424.858) (-4424.045) * (-4429.212) (-4424.426) [-4424.935] (-4431.251) -- 0:03:34
      296000 -- [-4429.662] (-4423.779) (-4432.392) (-4421.816) * (-4429.032) [-4428.518] (-4427.613) (-4431.785) -- 0:03:34
      296500 -- (-4430.848) [-4423.502] (-4428.102) (-4425.362) * (-4434.543) [-4426.063] (-4425.728) (-4437.822) -- 0:03:33
      297000 -- (-4427.621) (-4422.493) [-4421.759] (-4426.755) * (-4431.797) (-4422.113) (-4429.269) [-4428.481] -- 0:03:35
      297500 -- (-4426.004) (-4423.719) (-4425.663) [-4422.964] * (-4434.192) (-4422.735) [-4419.636] (-4426.396) -- 0:03:34
      298000 -- [-4418.274] (-4423.737) (-4423.352) (-4429.488) * [-4421.522] (-4424.403) (-4425.695) (-4427.764) -- 0:03:34
      298500 -- (-4423.529) [-4426.565] (-4421.288) (-4426.131) * (-4425.725) (-4425.196) [-4426.065] (-4434.080) -- 0:03:33
      299000 -- (-4422.774) (-4427.333) [-4422.980] (-4425.760) * (-4425.654) [-4427.697] (-4424.993) (-4437.993) -- 0:03:33
      299500 -- (-4428.621) (-4429.403) (-4422.793) [-4426.258] * [-4429.672] (-4419.563) (-4427.114) (-4423.659) -- 0:03:32
      300000 -- (-4427.678) (-4427.726) [-4420.466] (-4425.111) * (-4440.695) (-4426.505) (-4431.250) [-4419.974] -- 0:03:32

      Average standard deviation of split frequencies: 0.006271

      300500 -- (-4427.385) [-4430.272] (-4424.828) (-4428.679) * [-4422.294] (-4428.924) (-4420.729) (-4419.281) -- 0:03:34
      301000 -- (-4421.952) (-4424.755) (-4427.419) [-4429.171] * (-4425.448) (-4426.953) [-4422.814] (-4422.321) -- 0:03:33
      301500 -- (-4421.242) (-4426.157) [-4424.322] (-4428.712) * (-4422.769) [-4421.392] (-4421.642) (-4423.939) -- 0:03:33
      302000 -- (-4420.758) [-4432.764] (-4426.491) (-4429.678) * (-4419.639) (-4422.685) (-4429.899) [-4425.027] -- 0:03:32
      302500 -- [-4429.749] (-4429.982) (-4422.872) (-4436.938) * (-4429.726) (-4425.387) (-4428.126) [-4421.967] -- 0:03:32
      303000 -- [-4423.403] (-4431.121) (-4427.094) (-4433.716) * (-4427.926) (-4433.004) [-4424.749] (-4424.462) -- 0:03:31
      303500 -- (-4422.945) (-4425.308) (-4427.068) [-4427.885] * (-4430.893) (-4431.878) (-4421.196) [-4427.687] -- 0:03:31
      304000 -- (-4428.659) (-4427.702) (-4429.314) [-4424.966] * [-4427.942] (-4435.781) (-4431.252) (-4429.063) -- 0:03:32
      304500 -- (-4425.639) (-4421.876) [-4420.649] (-4432.326) * (-4429.578) (-4444.855) [-4426.315] (-4426.646) -- 0:03:32
      305000 -- (-4425.887) (-4430.762) (-4420.945) [-4422.917] * (-4436.515) (-4424.387) [-4420.190] (-4425.865) -- 0:03:31

      Average standard deviation of split frequencies: 0.005392

      305500 -- (-4422.165) [-4423.956] (-4426.274) (-4429.270) * (-4432.815) (-4425.159) [-4424.549] (-4435.871) -- 0:03:31
      306000 -- (-4422.978) [-4427.965] (-4426.721) (-4425.510) * (-4433.865) (-4428.944) (-4419.609) [-4429.127] -- 0:03:30
      306500 -- [-4426.125] (-4430.452) (-4429.403) (-4431.815) * (-4433.990) [-4425.855] (-4423.341) (-4436.862) -- 0:03:30
      307000 -- (-4430.435) (-4427.029) (-4432.710) [-4424.227] * (-4428.758) [-4426.248] (-4422.586) (-4421.860) -- 0:03:32
      307500 -- [-4427.172] (-4432.556) (-4422.444) (-4424.041) * (-4434.713) (-4423.964) (-4423.011) [-4426.795] -- 0:03:31
      308000 -- (-4420.717) (-4432.135) (-4424.496) [-4428.476] * (-4421.842) (-4430.047) [-4430.925] (-4429.625) -- 0:03:31
      308500 -- (-4426.877) (-4422.293) [-4431.256] (-4424.248) * [-4423.030] (-4424.310) (-4429.665) (-4427.591) -- 0:03:30
      309000 -- [-4420.094] (-4427.950) (-4429.449) (-4422.146) * [-4424.269] (-4430.017) (-4430.029) (-4424.798) -- 0:03:30
      309500 -- (-4430.109) [-4420.825] (-4420.865) (-4430.585) * (-4430.102) (-4427.496) (-4425.953) [-4425.553] -- 0:03:29
      310000 -- (-4423.262) (-4420.675) [-4423.693] (-4423.932) * (-4425.617) [-4428.086] (-4426.129) (-4425.414) -- 0:03:29

      Average standard deviation of split frequencies: 0.004552

      310500 -- [-4419.545] (-4422.581) (-4433.295) (-4430.331) * (-4426.879) (-4427.147) [-4422.755] (-4421.240) -- 0:03:30
      311000 -- (-4427.492) (-4419.955) (-4428.979) [-4423.306] * (-4425.610) (-4426.297) [-4422.205] (-4427.518) -- 0:03:30
      311500 -- (-4421.904) [-4420.372] (-4428.151) (-4425.567) * (-4420.590) (-4425.981) (-4432.290) [-4422.228] -- 0:03:29
      312000 -- (-4424.556) [-4429.844] (-4424.398) (-4430.255) * (-4426.232) (-4426.818) [-4428.228] (-4424.339) -- 0:03:29
      312500 -- (-4432.431) (-4417.483) (-4425.029) [-4426.977] * (-4424.236) (-4424.006) [-4427.526] (-4423.637) -- 0:03:29
      313000 -- (-4422.644) [-4427.988] (-4426.704) (-4420.519) * [-4420.935] (-4424.703) (-4426.259) (-4425.172) -- 0:03:28
      313500 -- [-4420.216] (-4430.654) (-4422.543) (-4429.132) * (-4428.743) [-4421.797] (-4426.218) (-4419.798) -- 0:03:28
      314000 -- (-4420.864) (-4424.424) [-4420.202] (-4426.514) * (-4424.221) (-4432.773) (-4429.067) [-4421.946] -- 0:03:29
      314500 -- [-4426.846] (-4428.263) (-4429.021) (-4421.139) * (-4433.281) (-4421.582) (-4428.014) [-4422.457] -- 0:03:29
      315000 -- (-4420.862) [-4425.479] (-4426.833) (-4422.692) * (-4419.803) [-4424.470] (-4423.734) (-4424.737) -- 0:03:28

      Average standard deviation of split frequencies: 0.004475

      315500 -- (-4423.015) (-4421.218) [-4424.315] (-4426.558) * (-4425.148) [-4431.622] (-4425.691) (-4424.117) -- 0:03:28
      316000 -- (-4428.949) (-4430.932) (-4419.737) [-4422.794] * [-4422.093] (-4434.803) (-4429.286) (-4436.101) -- 0:03:27
      316500 -- (-4422.654) (-4426.131) [-4424.293] (-4427.742) * [-4425.742] (-4426.057) (-4430.032) (-4426.826) -- 0:03:27
      317000 -- (-4431.802) (-4425.212) (-4427.713) [-4427.793] * (-4424.754) [-4423.983] (-4420.205) (-4427.946) -- 0:03:28
      317500 -- (-4427.918) (-4425.195) [-4424.672] (-4428.132) * [-4425.935] (-4421.292) (-4425.454) (-4425.841) -- 0:03:28
      318000 -- (-4428.718) (-4425.218) (-4428.060) [-4424.824] * (-4426.956) (-4422.819) (-4425.612) [-4422.287] -- 0:03:28
      318500 -- (-4428.226) (-4423.417) [-4421.526] (-4424.719) * [-4421.901] (-4426.364) (-4425.095) (-4430.572) -- 0:03:27
      319000 -- (-4420.745) (-4423.078) (-4417.925) [-4424.587] * [-4427.990] (-4425.101) (-4427.612) (-4428.385) -- 0:03:27
      319500 -- [-4425.716] (-4438.607) (-4426.059) (-4429.899) * (-4428.616) (-4432.785) (-4426.858) [-4418.618] -- 0:03:26
      320000 -- (-4426.848) (-4434.791) [-4423.050] (-4424.180) * (-4432.712) [-4424.201] (-4422.905) (-4426.000) -- 0:03:26

      Average standard deviation of split frequencies: 0.005880

      320500 -- (-4417.379) (-4437.102) [-4429.817] (-4422.059) * (-4426.876) (-4426.362) (-4422.287) [-4421.786] -- 0:03:27
      321000 -- [-4423.015] (-4440.001) (-4418.343) (-4430.488) * (-4433.689) (-4422.852) [-4424.217] (-4423.380) -- 0:03:27
      321500 -- (-4423.140) (-4429.148) [-4418.362] (-4422.969) * (-4430.804) [-4422.895] (-4422.673) (-4435.096) -- 0:03:26
      322000 -- [-4423.843] (-4421.822) (-4425.236) (-4436.052) * (-4434.293) (-4424.196) [-4430.328] (-4429.768) -- 0:03:26
      322500 -- (-4423.875) (-4427.625) (-4428.745) [-4422.467] * (-4427.895) [-4420.343] (-4422.345) (-4424.501) -- 0:03:25
      323000 -- (-4418.313) [-4422.854] (-4423.863) (-4430.668) * (-4422.053) (-4430.651) [-4421.661] (-4419.941) -- 0:03:25
      323500 -- (-4419.219) [-4427.131] (-4431.781) (-4437.177) * [-4429.472] (-4426.872) (-4426.693) (-4421.953) -- 0:03:24
      324000 -- (-4422.200) (-4425.957) [-4415.796] (-4430.296) * [-4423.667] (-4428.484) (-4425.349) (-4427.039) -- 0:03:26
      324500 -- [-4423.055] (-4417.876) (-4421.063) (-4422.909) * (-4426.096) [-4427.964] (-4424.396) (-4426.239) -- 0:03:26
      325000 -- [-4428.517] (-4430.989) (-4421.867) (-4428.260) * (-4437.825) [-4432.872] (-4428.898) (-4422.879) -- 0:03:25

      Average standard deviation of split frequencies: 0.005784

      325500 -- [-4430.626] (-4426.971) (-4429.351) (-4427.655) * [-4421.854] (-4435.488) (-4425.545) (-4423.814) -- 0:03:25
      326000 -- [-4421.231] (-4425.744) (-4425.701) (-4429.261) * (-4426.372) (-4435.523) (-4420.454) [-4423.001] -- 0:03:24
      326500 -- (-4423.621) [-4419.797] (-4427.841) (-4428.960) * [-4424.255] (-4430.420) (-4434.024) (-4427.561) -- 0:03:24
      327000 -- (-4432.175) (-4425.720) (-4434.813) [-4429.679] * (-4420.369) (-4433.585) [-4428.013] (-4427.512) -- 0:03:23
      327500 -- (-4429.107) (-4425.932) [-4429.209] (-4428.453) * [-4422.668] (-4430.735) (-4432.924) (-4429.685) -- 0:03:25
      328000 -- [-4426.691] (-4423.459) (-4432.937) (-4422.476) * (-4431.787) (-4431.309) [-4427.274] (-4428.150) -- 0:03:24
      328500 -- [-4424.416] (-4425.833) (-4426.434) (-4424.265) * (-4423.697) [-4427.577] (-4426.463) (-4427.844) -- 0:03:24
      329000 -- (-4424.805) [-4418.702] (-4417.156) (-4431.818) * [-4426.231] (-4426.980) (-4429.221) (-4421.703) -- 0:03:23
      329500 -- (-4437.973) (-4424.770) (-4420.708) [-4430.842] * (-4423.874) (-4421.651) (-4427.101) [-4428.732] -- 0:03:23
      330000 -- (-4434.212) (-4429.079) (-4423.979) [-4423.574] * [-4422.473] (-4432.774) (-4421.585) (-4429.617) -- 0:03:23

      Average standard deviation of split frequencies: 0.005702

      330500 -- (-4436.032) (-4425.656) (-4425.537) [-4427.435] * (-4424.427) (-4425.539) (-4428.724) [-4423.764] -- 0:03:24
      331000 -- (-4439.781) [-4424.635] (-4425.440) (-4424.256) * (-4427.184) (-4422.068) (-4420.781) [-4424.001] -- 0:03:24
      331500 -- (-4437.669) [-4423.949] (-4426.623) (-4421.305) * (-4428.832) [-4421.890] (-4427.480) (-4428.723) -- 0:03:23
      332000 -- [-4427.056] (-4421.393) (-4425.188) (-4420.703) * [-4422.295] (-4423.615) (-4425.299) (-4428.598) -- 0:03:23
      332500 -- (-4430.297) (-4430.653) (-4428.753) [-4420.154] * (-4428.975) (-4425.012) (-4429.242) [-4424.322] -- 0:03:22
      333000 -- (-4420.936) (-4421.216) (-4425.838) [-4421.627] * [-4428.401] (-4426.945) (-4427.177) (-4425.374) -- 0:03:22
      333500 -- [-4431.890] (-4428.748) (-4428.079) (-4424.450) * [-4426.937] (-4423.619) (-4425.427) (-4427.804) -- 0:03:21
      334000 -- (-4421.270) (-4427.432) [-4426.067] (-4426.083) * (-4424.629) (-4434.062) [-4421.236] (-4421.325) -- 0:03:23
      334500 -- (-4423.495) (-4430.307) (-4435.490) [-4425.390] * (-4432.481) (-4425.239) (-4419.740) [-4428.088] -- 0:03:22
      335000 -- (-4429.497) (-4425.533) (-4430.994) [-4423.364] * [-4424.888] (-4422.175) (-4422.308) (-4426.862) -- 0:03:22

      Average standard deviation of split frequencies: 0.004209

      335500 -- (-4427.979) [-4423.393] (-4435.496) (-4430.502) * [-4423.907] (-4424.756) (-4424.432) (-4429.103) -- 0:03:22
      336000 -- (-4426.665) (-4428.908) [-4428.853] (-4426.990) * (-4432.654) (-4427.331) [-4425.562] (-4429.013) -- 0:03:21
      336500 -- (-4426.118) (-4424.495) (-4427.689) [-4422.455] * (-4436.304) (-4426.003) (-4426.313) [-4422.139] -- 0:03:21
      337000 -- (-4427.090) (-4426.751) [-4421.893] (-4425.865) * [-4424.606] (-4431.863) (-4415.965) (-4426.214) -- 0:03:20
      337500 -- (-4431.737) (-4426.074) [-4424.809] (-4424.123) * (-4423.743) [-4428.214] (-4423.054) (-4438.694) -- 0:03:22
      338000 -- [-4426.435] (-4429.213) (-4422.758) (-4425.484) * (-4424.576) [-4420.995] (-4423.776) (-4426.642) -- 0:03:21
      338500 -- (-4429.772) [-4424.390] (-4429.787) (-4422.545) * [-4421.349] (-4418.347) (-4425.325) (-4434.245) -- 0:03:21
      339000 -- (-4426.608) (-4425.145) (-4437.425) [-4423.174] * (-4428.604) (-4423.748) (-4424.960) [-4438.044] -- 0:03:20
      339500 -- (-4425.298) [-4427.655] (-4433.105) (-4425.276) * (-4419.600) [-4424.189] (-4420.610) (-4431.123) -- 0:03:20
      340000 -- (-4430.570) [-4429.764] (-4432.194) (-4426.185) * (-4427.825) (-4427.644) [-4422.265] (-4422.022) -- 0:03:19

      Average standard deviation of split frequencies: 0.004151

      340500 -- [-4427.812] (-4434.154) (-4431.284) (-4430.542) * [-4419.580] (-4423.278) (-4418.824) (-4427.517) -- 0:03:21
      341000 -- [-4424.467] (-4428.557) (-4423.630) (-4424.667) * [-4417.322] (-4428.400) (-4422.556) (-4433.449) -- 0:03:20
      341500 -- (-4422.263) [-4424.159] (-4433.515) (-4434.896) * (-4421.518) (-4433.439) (-4427.228) [-4431.802] -- 0:03:20
      342000 -- (-4420.246) [-4424.038] (-4434.944) (-4429.320) * (-4425.728) (-4436.977) (-4423.869) [-4428.113] -- 0:03:20
      342500 -- [-4426.866] (-4428.293) (-4425.365) (-4429.115) * (-4433.106) (-4430.256) [-4433.619] (-4424.528) -- 0:03:19
      343000 -- (-4423.849) (-4433.902) (-4422.996) [-4423.887] * (-4426.151) (-4423.172) [-4427.767] (-4424.836) -- 0:03:19
      343500 -- (-4425.870) (-4430.470) (-4429.195) [-4427.185] * (-4423.632) [-4425.894] (-4422.580) (-4422.245) -- 0:03:18
      344000 -- [-4421.835] (-4425.134) (-4423.537) (-4426.286) * (-4417.814) (-4429.046) (-4425.946) [-4420.181] -- 0:03:20
      344500 -- (-4422.595) (-4421.953) [-4420.943] (-4426.001) * (-4421.058) (-4433.269) [-4422.410] (-4424.113) -- 0:03:19
      345000 -- (-4429.417) [-4423.789] (-4425.534) (-4424.886) * (-4426.880) (-4427.927) (-4424.713) [-4422.183] -- 0:03:19

      Average standard deviation of split frequencies: 0.004087

      345500 -- (-4427.391) (-4422.427) [-4423.275] (-4428.427) * (-4430.689) (-4424.526) [-4424.185] (-4426.119) -- 0:03:18
      346000 -- [-4428.233] (-4424.613) (-4427.735) (-4432.510) * (-4425.204) [-4424.976] (-4428.400) (-4433.703) -- 0:03:18
      346500 -- (-4422.494) (-4429.233) [-4425.478] (-4421.369) * (-4422.129) (-4420.180) (-4425.391) [-4423.145] -- 0:03:18
      347000 -- (-4432.772) (-4420.492) [-4427.391] (-4423.298) * (-4427.130) (-4422.645) (-4425.187) [-4423.361] -- 0:03:19
      347500 -- (-4429.083) (-4419.586) (-4424.708) [-4423.237] * [-4426.055] (-4425.706) (-4428.838) (-4429.471) -- 0:03:19
      348000 -- [-4426.913] (-4426.108) (-4427.951) (-4422.692) * [-4422.406] (-4424.894) (-4423.703) (-4424.404) -- 0:03:18
      348500 -- [-4424.514] (-4427.444) (-4428.683) (-4429.783) * (-4422.531) [-4428.430] (-4428.054) (-4427.596) -- 0:03:18
      349000 -- (-4427.020) [-4428.384] (-4430.959) (-4423.006) * (-4422.264) (-4422.643) [-4424.323] (-4424.096) -- 0:03:17
      349500 -- (-4423.200) (-4429.470) [-4425.146] (-4422.586) * (-4423.817) (-4430.746) [-4421.810] (-4427.146) -- 0:03:17
      350000 -- (-4423.084) (-4432.027) (-4419.344) [-4425.406] * (-4423.240) [-4425.299] (-4423.250) (-4422.097) -- 0:03:16

      Average standard deviation of split frequencies: 0.004033

      350500 -- (-4429.480) (-4434.627) [-4421.889] (-4421.950) * (-4424.047) [-4425.637] (-4421.930) (-4429.542) -- 0:03:18
      351000 -- (-4427.083) (-4426.736) (-4427.539) [-4422.010] * (-4430.763) (-4424.323) [-4422.863] (-4422.253) -- 0:03:17
      351500 -- (-4429.203) (-4427.256) (-4422.793) [-4422.504] * (-4440.647) [-4422.145] (-4429.873) (-4428.290) -- 0:03:17
      352000 -- (-4427.308) [-4428.628] (-4423.543) (-4429.888) * (-4425.500) [-4421.252] (-4422.703) (-4424.488) -- 0:03:16
      352500 -- (-4426.241) (-4422.266) [-4421.175] (-4423.040) * (-4427.065) (-4427.324) (-4422.806) [-4419.222] -- 0:03:16
      353000 -- (-4423.995) [-4424.110] (-4428.227) (-4431.318) * (-4427.8