--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Tue Nov 08 17:03:59 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/166/CG5174-PB/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3353.89 -3369.07 2 -3354.35 -3367.46 -------------------------------------- TOTAL -3354.09 -3368.56 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.705890 0.004421 0.571323 0.829272 0.701419 1255.72 1344.24 1.001 r(A<->C){all} 0.075168 0.000285 0.045704 0.111124 0.073760 1005.40 1061.69 1.000 r(A<->G){all} 0.205639 0.000875 0.152266 0.269385 0.204229 789.38 819.61 1.000 r(A<->T){all} 0.090334 0.000534 0.045138 0.133426 0.088583 621.92 894.37 1.001 r(C<->G){all} 0.074110 0.000216 0.046232 0.102487 0.073503 972.97 984.69 1.000 r(C<->T){all} 0.461108 0.001585 0.379539 0.534046 0.460163 640.87 785.81 1.001 r(G<->T){all} 0.093641 0.000400 0.056298 0.133442 0.092403 1118.39 1120.00 1.001 pi(A){all} 0.258116 0.000169 0.232439 0.282712 0.257908 1014.91 1038.27 1.000 pi(C){all} 0.274320 0.000164 0.250856 0.300275 0.273987 1188.95 1207.14 1.001 pi(G){all} 0.268123 0.000170 0.242735 0.293978 0.267938 1233.34 1246.40 1.000 pi(T){all} 0.199441 0.000134 0.176593 0.220637 0.199205 1058.98 1136.01 1.000 alpha{1,2} 0.163709 0.000705 0.112804 0.214446 0.161292 912.04 1016.46 1.003 alpha{3} 2.542699 0.608396 1.210670 4.103541 2.422947 1250.00 1375.50 1.000 pinvar{all} 0.439988 0.002523 0.342189 0.538213 0.444141 1078.67 1273.00 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -3176.077347 Model 2: PositiveSelection -3175.436621 Model 0: one-ratio -3203.862092 Model 3: discrete -3172.386565 Model 7: beta -3175.763239 Model 8: beta&w>1 -3172.46162 Model 0 vs 1 55.56948999999986 Model 2 vs 1 1.2814520000001721 Model 8 vs 7 6.603237999999692 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG5174-PB) Pr(w>1) post mean +- SE for w 34 N 0.993** 4.347 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG5174-PB) Pr(w>1) post mean +- SE for w 34 N 0.987* 1.516 +- 0.252 35 D 0.812 1.347 +- 0.386 42 G 0.504 0.980 +- 0.568 149 K 0.686 1.207 +- 0.484 158 E 0.561 1.078 +- 0.512
>C1 MSESEPNSLEFIEDPYLPSIDDLTSTPSLDLETNDAVLDWYGDGQEESEA ELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIAAKLANQAPSSSMAKR FRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTKF DNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEEE INTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQSV EQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQMK NSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSPT DSLPKo >C2 MSESEPNSLEFIEDPYLPSIDDLTSTPSLDLETNEAVLDWYGDGQEESEA ELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIAAKLANQAPSSSMAKR FRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSKGTQF HNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEEE INTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQSV EQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQMK NSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSPT DSLPKo >C3 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETSESVLDWYEDGQEESEA ELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIGAKLANQAPSSSMAKR FRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIAHRSRGTKF DNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEEE INTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQSV EQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQMK NSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSPT DSITKo >C4 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETTEAVLDWYEDGQEESEA ELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIGAKLANQAPSSSMAKR FRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTKL DNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEEE INTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQSV EQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQMK NSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSPT DSLooo >C5 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLEASEAVLDWYGDGQEESEA DFYLRNLTLDQIFYDVDSDYSNSLELQAVEAEFIGAKLANQAPSSSMAKR FRLKFFTKRSMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTKF DNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRADWTQELARVEEE INTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKESTVYQSV EQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQMK NSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSPT DSLTKo >C6 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETNDAVLDWYGDEQEDSEA ELYLRNLTLDQIFYDVDSDYTNNLELQTVETEFIGAKLANQAPSSSIAKR FRLKFFTKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGNRSRGTKF DNTANLSDPASPAASVASAEIAAEFAALTVEEKEQRRAEWSQELARVEEE INTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKESTVYQSV EQSLGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKFSQMK NSESMRSIEASVGSAYENVKTKVTSRSGSVSSFQDALDENNTSSGLNSPT DSoooo >C7 MSESEPNSLEFIEDPYLPGIDDLTSTPSLDLETPEAALDWYGDEQEESEA ELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQTPSSSIAKR FRLKFFTKRTMRDVRVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTKF DNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEEE INTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIRNLKESTVYQSV EQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQMK NSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSPT DSLTKo >C8 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLEANDATLDWYGDGEEESEA ELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAKR FRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTKF DNTANLSEPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEEE INTLRTVLASKTRHACDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQSV EQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQMK NSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSPT DSLTKo >C9 MSESEPNSLDFIEDSYLPGIDDLTSTPSLDLEAHDATIDWYDDGQEDSEA ELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAKR FRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTKF DNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEEE INTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQSV EQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQMK NSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDAMDEHNTSSGLNSPT DSLTKo >C10 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDPEATDAVLDWHGDGQEEESE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFAKRSMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGQRSRGTS LDNTANLSEPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTK CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=357 C1 MSESEPNSLEFIEDPYLPSIDDLTSTPSLDLETNDAVLDWYGDGQEE-SE C2 MSESEPNSLEFIEDPYLPSIDDLTSTPSLDLETNEAVLDWYGDGQEE-SE C3 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETSESVLDWYEDGQEE-SE C4 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETTEAVLDWYEDGQEE-SE C5 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLEASEAVLDWYGDGQEE-SE C6 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETNDAVLDWYGDEQED-SE C7 MSESEPNSLEFIEDPYLPGIDDLTSTPSLDLETPEAALDWYGDEQEE-SE C8 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLEANDATLDWYGDGEEE-SE C9 MSESEPNSLDFIEDSYLPGIDDLTSTPSLDLEAHDATIDWYDDGQED-SE C10 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDPEATDAVLDWHGDGQEEESE *********:****.***.*********** *: ::.:**: * :*: ** C1 AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIAAKLANQAPSSSMAK C2 AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIAAKLANQAPSSSMAK C3 AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIGAKLANQAPSSSMAK C4 AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIGAKLANQAPSSSMAK C5 ADFYLRNLTLDQIFYDVDSDYSNSLELQAVEAEFIGAKLANQAPSSSMAK C6 AELYLRNLTLDQIFYDVDSDYTNNLELQTVETEFIGAKLANQAPSSSIAK C7 AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQTPSSSIAK C8 AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK C9 AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK C10 AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK *::******************:*.****:**::**.******:****:** C1 RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK C2 RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSKGTQ C3 RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIAHRSRGTK C4 RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK C5 RFRLKFFTKRSMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK C6 RFRLKFFTKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGNRSRGTK C7 RFRLKFFTKRTMRDVRVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK C8 RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK C9 RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK C10 RFRLKFFAKRSMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGQRSRGTS *******:**:****:**************************.:**:**. C1 FDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE C2 FHNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE C3 FDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE C4 LDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE C5 FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRADWTQELARVEE C6 FDNTANLSDPASPAASVASAEIAAEFAALTVEEKEQRRAEWSQELARVEE C7 FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE C8 FDNTANLSEPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE C9 FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE C10 LDNTANLSEPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE :.******:***** **************:*********:*:******** C1 EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQS C2 EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS C3 EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS C4 EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS C5 EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKESTVYQS C6 EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKESTVYQS C7 EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIRNLKESTVYQS C8 EINTLRTVLASKTRHACDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS C9 EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS C10 EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS ****************.*****************:***::****:***** C1 VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM C2 VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM C3 VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM C4 VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM C5 VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM C6 VEQSLGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKFSQM C7 VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM C8 VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM C9 VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM C10 VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM ****:*****:*:*********************************:*** C1 KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP C2 KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP C3 KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP C4 KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP C5 KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP C6 KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFQDALDENNTSSGLNSP C7 KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP C8 KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP C9 KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDAMDEHNTSSGLNSP C10 KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP ********************************** **:**:********* C1 TDSLPKo C2 TDSLPKo C3 TDSITKo C4 TDSLooo C5 TDSLTKo C6 TDSoooo C7 TDSLTKo C8 TDSLTKo C9 TDSLTKo C10 TDSLTK- *** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 356 type PROTEIN Struct Unchecked Input File /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 356 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [32184] Library Relaxation: Multi_proc [72] Relaxation Summary: [32184]--->[32160] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/166/CG5174-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.610 Mb, Max= 31.529 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MSESEPNSLEFIEDPYLPSIDDLTSTPSLDLETNDAVLDWYGDGQEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIAAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQS VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLPKo >C2 MSESEPNSLEFIEDPYLPSIDDLTSTPSLDLETNEAVLDWYGDGQEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIAAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSKGTQ FHNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLPKo >C3 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETSESVLDWYEDGQEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIGAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIAHRSRGTK FDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSITKo >C4 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETTEAVLDWYEDGQEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIGAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK LDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLooo >C5 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLEASEAVLDWYGDGQEE-SE ADFYLRNLTLDQIFYDVDSDYSNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFTKRSMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRADWTQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKESTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTKo >C6 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETNDAVLDWYGDEQED-SE AELYLRNLTLDQIFYDVDSDYTNNLELQTVETEFIGAKLANQAPSSSIAK RFRLKFFTKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGNRSRGTK FDNTANLSDPASPAASVASAEIAAEFAALTVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKESTVYQS VEQSLGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKFSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFQDALDENNTSSGLNSP TDSoooo >C7 MSESEPNSLEFIEDPYLPGIDDLTSTPSLDLETPEAALDWYGDEQEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQTPSSSIAK RFRLKFFTKRTMRDVRVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIRNLKESTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTKo >C8 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLEANDATLDWYGDGEEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSEPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHACDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTKo >C9 MSESEPNSLDFIEDSYLPGIDDLTSTPSLDLEAHDATIDWYDDGQED-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDAMDEHNTSSGLNSP TDSLTKo >C10 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDPEATDAVLDWHGDGQEEESE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFAKRSMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGQRSRGTS LDNTANLSEPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTK- FORMAT of file /tmp/tmp1530164032604149277aln Not Supported[FATAL:T-COFFEE] >C1 MSESEPNSLEFIEDPYLPSIDDLTSTPSLDLETNDAVLDWYGDGQEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIAAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQS VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLPKo >C2 MSESEPNSLEFIEDPYLPSIDDLTSTPSLDLETNEAVLDWYGDGQEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIAAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSKGTQ FHNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLPKo >C3 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETSESVLDWYEDGQEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIGAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIAHRSRGTK FDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSITKo >C4 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETTEAVLDWYEDGQEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIGAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK LDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLooo >C5 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLEASEAVLDWYGDGQEE-SE ADFYLRNLTLDQIFYDVDSDYSNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFTKRSMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRADWTQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKESTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTKo >C6 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETNDAVLDWYGDEQED-SE AELYLRNLTLDQIFYDVDSDYTNNLELQTVETEFIGAKLANQAPSSSIAK RFRLKFFTKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGNRSRGTK FDNTANLSDPASPAASVASAEIAAEFAALTVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKESTVYQS VEQSLGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKFSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFQDALDENNTSSGLNSP TDSoooo >C7 MSESEPNSLEFIEDPYLPGIDDLTSTPSLDLETPEAALDWYGDEQEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQTPSSSIAK RFRLKFFTKRTMRDVRVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIRNLKESTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTKo >C8 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLEANDATLDWYGDGEEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSEPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHACDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTKo >C9 MSESEPNSLDFIEDSYLPGIDDLTSTPSLDLEAHDATIDWYDDGQED-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDAMDEHNTSSGLNSP TDSLTKo >C10 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDPEATDAVLDWHGDGQEEESE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFAKRSMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGQRSRGTS LDNTANLSEPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTK- input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:357 S:99 BS:357 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # SEQ_INDEX C7 6 # SEQ_INDEX C8 7 # SEQ_INDEX C9 8 # SEQ_INDEX C10 9 # PW_SEQ_DISTANCES BOT 0 1 98.60 C1 C2 98.60 TOP 1 0 98.60 C2 C1 98.60 BOT 0 2 96.91 C1 C3 96.91 TOP 2 0 96.91 C3 C1 96.91 BOT 0 3 97.19 C1 C4 97.19 TOP 3 0 97.19 C4 C1 97.19 BOT 0 4 94.10 C1 C5 94.10 TOP 4 0 94.10 C5 C1 94.10 BOT 0 5 92.98 C1 C6 92.98 TOP 5 0 92.98 C6 C1 92.98 BOT 0 6 94.66 C1 C7 94.66 TOP 6 0 94.66 C7 C1 94.66 BOT 0 7 95.79 C1 C8 95.79 TOP 7 0 95.79 C8 C1 95.79 BOT 0 8 94.10 C1 C9 94.10 TOP 8 0 94.10 C9 C1 94.10 BOT 0 9 94.65 C1 C10 94.65 TOP 9 0 94.65 C10 C1 94.65 BOT 1 2 96.63 C2 C3 96.63 TOP 2 1 96.63 C3 C2 96.63 BOT 1 3 96.91 C2 C4 96.91 TOP 3 1 96.91 C4 C2 96.91 BOT 1 4 93.82 C2 C5 93.82 TOP 4 1 93.82 C5 C2 93.82 BOT 1 5 92.13 C2 C6 92.13 TOP 5 1 92.13 C6 C2 92.13 BOT 1 6 94.38 C2 C7 94.38 TOP 6 1 94.38 C7 C2 94.38 BOT 1 7 94.94 C2 C8 94.94 TOP 7 1 94.94 C8 C2 94.94 BOT 1 8 93.26 C2 C9 93.26 TOP 8 1 93.26 C9 C2 93.26 BOT 1 9 94.08 C2 C10 94.08 TOP 9 1 94.08 C10 C2 94.08 BOT 2 3 98.03 C3 C4 98.03 TOP 3 2 98.03 C4 C3 98.03 BOT 2 4 94.94 C3 C5 94.94 TOP 4 2 94.94 C5 C3 94.94 BOT 2 5 92.70 C3 C6 92.70 TOP 5 2 92.70 C6 C3 92.70 BOT 2 6 94.66 C3 C7 94.66 TOP 6 2 94.66 C7 C3 94.66 BOT 2 7 95.51 C3 C8 95.51 TOP 7 2 95.51 C8 C3 95.51 BOT 2 8 94.38 C3 C9 94.38 TOP 8 2 94.38 C9 C3 94.38 BOT 2 9 94.65 C3 C10 94.65 TOP 9 2 94.65 C10 C3 94.65 BOT 3 4 94.66 C4 C5 94.66 TOP 4 3 94.66 C5 C4 94.66 BOT 3 5 93.54 C4 C6 93.54 TOP 5 3 93.54 C6 C4 93.54 BOT 3 6 94.66 C4 C7 94.66 TOP 6 3 94.66 C7 C4 94.66 BOT 3 7 95.51 C4 C8 95.51 TOP 7 3 95.51 C8 C4 95.51 BOT 3 8 94.38 C4 C9 94.38 TOP 8 3 94.38 C9 C4 94.38 BOT 3 9 95.49 C4 C10 95.49 TOP 9 3 95.49 C10 C4 95.49 BOT 4 5 93.54 C5 C6 93.54 TOP 5 4 93.54 C6 C5 93.54 BOT 4 6 95.79 C5 C7 95.79 TOP 6 4 95.79 C7 C5 95.79 BOT 4 7 96.07 C5 C8 96.07 TOP 7 4 96.07 C8 C5 96.07 BOT 4 8 95.22 C5 C9 95.22 TOP 8 4 95.22 C9 C5 95.22 BOT 4 9 95.77 C5 C10 95.77 TOP 9 4 95.77 C10 C5 95.77 BOT 5 6 94.66 C6 C7 94.66 TOP 6 5 94.66 C7 C6 94.66 BOT 5 7 94.10 C6 C8 94.10 TOP 7 5 94.10 C8 C6 94.10 BOT 5 8 93.54 C6 C9 93.54 TOP 8 5 93.54 C9 C6 93.54 BOT 5 9 93.24 C6 C10 93.24 TOP 9 5 93.24 C10 C6 93.24 BOT 6 7 95.79 C7 C8 95.79 TOP 7 6 95.79 C8 C7 95.79 BOT 6 8 94.94 C7 C9 94.94 TOP 8 6 94.94 C9 C7 94.94 BOT 6 9 94.65 C7 C10 94.65 TOP 9 6 94.65 C10 C7 94.65 BOT 7 8 97.19 C8 C9 97.19 TOP 8 7 97.19 C9 C8 97.19 BOT 7 9 97.18 C8 C10 97.18 TOP 9 7 97.18 C10 C8 97.18 BOT 8 9 95.77 C9 C10 95.77 TOP 9 8 95.77 C10 C9 95.77 AVG 0 C1 * 95.44 AVG 1 C2 * 94.97 AVG 2 C3 * 95.38 AVG 3 C4 * 95.60 AVG 4 C5 * 94.88 AVG 5 C6 * 93.38 AVG 6 C7 * 94.91 AVG 7 C8 * 95.79 AVG 8 C9 * 94.76 AVG 9 C10 * 95.05 TOT TOT * 95.02 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAGCGAATCGGAACCGAATAGCCTGGAGTTCATTGAAGACCCCTATCT C2 ATGAGCGAATCGGAACCGAATAGCCTGGAGTTCATTGAAGATCCCTATCT C3 ATGAGCGAATCCGAACCTAATAGCCTGGAGTTCATTGAAGACTCCTATCT C4 ATGAGCGAATCGGAACCGAATAGCCTGGAGTTCATTGAAGACTCCTATCT C5 ATGAGCGAATCGGAACCCAATAGCCTGGAGTTCATTGAAGACTCCTATCT C6 ATGAGCGAATCGGAACCCAATAGCCTGGAGTTCATTGAAGACTCCTACCT C7 ATGAGCGAATCGGAGCCCAATAGCCTGGAGTTCATCGAGGACCCCTACCT C8 ATGAGCGAATCGGAACCCAATAGCCTGGAGTTCATTGAGGACTCGTACCT C9 ATGAGCGAATCGGAACCCAATAGCCTGGATTTTATTGAGGACTCTTACCT C10 ATGAGCGAATCGGAACCCAATAGCCTGGAGTTCATCGAGGACTCCTACCT *********** **.** *********** ** ** **.** * ** ** C1 GCCAAGCATTGATGATCTCACCAGCACACCGTCACTGGATCTGGAAACCA C2 GCCAAGCATCGATGATCTCACCAGCACACCGTCACTGGATCTGGAAACCA C3 GCCTGGCATCGATGATCTCACCAGCACACCGTCGCTGGATCTGGAAACTA C4 GCCTGGCATCGATGATCTCACCAGCACACCGTCGCTGGATCTGGAAACTA C5 GCCAGGCATCGATGATCTCACCAGCACACCATCCCTGGATCTGGAAGCTA C6 GCCAGGCATCGATGATCTCACCAGCACACCTTCCTTGGATCTGGAAACCA C7 GCCGGGCATCGATGATCTCACCAGCACACCTTCACTGGATCTGGAAACGC C8 ACCAGGCATCGATGATCTCACCAGCACACCTTCTCTGGATCTGGAAGCTA C9 GCCAGGCATCGATGATCTCACCAGCACACCTTCGCTGGATCTGGAAGCGC C10 GCCAGGCATCGATGATCTCACCAGCACACCTTCCCTGGATCCGGAAGCCA .** .**** ******************** ** ****** ****.* . C1 ATGATGCCGTCTTGGACTGGTATGGCGATGGGCAGGAGGAG---AGCGAG C2 ATGAAGCCGTCTTGGACTGGTATGGCGATGGGCAGGAGGAG---AGCGAG C3 GCGAATCCGTCTTGGACTGGTACGAAGATGGGCAGGAGGAG---AGCGAA C4 CCGAAGCCGTCTTGGACTGGTATGAAGATGGGCAGGAGGAG---AGCGAA C5 GCGAAGCCGTCTTGGACTGGTATGGAGACGGGCAGGAGGAG---AGCGAA C6 ATGATGCCGTCTTGGATTGGTATGGTGATGAGCAGGAGGAC---TCTGAA C7 CAGAAGCCGCATTGGATTGGTATGGCGACGAGCAGGAGGAG---AGTGAA C8 ATGATGCCACCTTAGATTGGTATGGAGATGGAGAGGAGGAG---AGTGAA C9 ATGATGCCACCATAGATTGGTACGACGATGGGCAGGAGGAT---AGTGAA C10 CCGATGCCGTCTTGGATTGGCACGGCGATGGCCAGGAGGAGGAGAGTGAA **: **. .:*.** *** * *. ** *. ******* : **. C1 GCTGAGCTATATTTGCGTAATCTGACGCTAGACCAGATATTCTACGATGT C2 GCTGAGCTATATCTGCGTAATCTGACGCTAGACCAGATATTCTACGATGT C3 GCTGAGCTATATCTGCGTAATCTGACGCTCGACCAGATATTCTACGATGT C4 GCTGAGCTATACCTGCGTAATCTGACGTTAGACCAGATATTCTACGATGT C5 GCTGATTTTTATCTGCGTAACCTGACTCTGGACCAGATCTTCTACGATGT C6 GCTGAGCTATATCTACGTAATCTGACTTTGGATCAGATCTTCTATGATGT C7 GCGGAGCTTTATCTGCGTAATTTGACGCTGGATCAGATCTTCTACGATGT C8 GCGGAGCTGTATCTGCGGAATCTGACTCTGGATCAGATATTCTACGATGT C9 GCGGAGCTGTATTTGCGTAATCTGACTCTCGATCAGATCTTCTACGATGT C10 GCCGAGCTCTATCTGCGTAATTTGACTCTCGATCAGATCTTCTACGATGT ** ** * ** *.** ** **** * ** *****.***** ***** C1 GGATTCGGACTACACCAACAGCCTGGAATTGCAGGCAGTGGAGGCGGACT C2 GGATTCGGACTACACCAACAGCCTAGAACTGCAGGCAGTGGAGGCGGACT C3 GGATTCGGACTACACGAATAGCCTGGAACTGCAGGCCGTGGAGGCGGACT C4 GGATTCAGACTATACCAACAGCCTGGAACTGCAGGCAGTGGAGGCGGACT C5 GGATTCAGACTACTCCAACAGCCTGGAACTGCAGGCAGTGGAGGCGGAGT C6 AGATTCAGACTACACTAATAACCTGGAATTGCAGACAGTGGAAACAGAGT C7 GGATTCGGATTATACCAACAGCCTGGAGCTGCAGGCAGTGGAAGCTGAGT C8 GGATTCGGACTACACCAACAGCCTGGAGCTGCAGGCAGTGGAGGCTGAGT C9 GGATTCCGATTACACCAACAGCCTGGAGCTGCAGGCCGTGGAGGCCGAGT C10 GGACTCGGACTACACCAATAGCCTGGAACTGCAGGCCGTGGAGGCGGAGT .** ** ** ** :* ** *.***.**. *****.*.*****..* ** * C1 TCATTGCCGCCAAGTTGGCCAATCAAGCGCCATCGTCTTCGATGGCCAAA C2 TCATTGCCGCCAAGTTGGCCAATCAAGCGCCATCGTCTTCGATGGCCAAA C3 TCATTGGTGCCAAGTTGGCCAATCAAGCACCATCCTCATCGATGGCCAAA C4 TCATTGGCGCCAAGTTGGCCAATCAAGCACCATCATCTTCGATGGCCAAA C5 TCATTGGCGCCAAGTTGGCCAACCAGGCACCCTCTTCCTCGATGGCCAAA C6 TCATTGGCGCCAAGTTGGCTAACCAAGCACCCTCTTCCTCGATAGCCAAA C7 TCATTGGAGCCAAGTTGGCCAACCAGACACCCTCATCGTCCATCGCCAAA C8 TCATTGGCGCCAAGTTGGCCAATCAGGCGCCCTCCTCCTCCATGGCCAAA C9 TCATTGGCGCCAAGTTGGCCAACCAGGCACCCAGTTCCTCGATGGCCAAA C10 TCATTGGCGCCAAGTTGGCCAACCAGGCACCCTCCTCCTCGATGGCCAAG ****** *********** ** **..*.**.: ** ** ** *****. C1 CGCTTCCGCTTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT C2 CGCTTCCGCTTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT C3 CGCTTCCGGTTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT C4 CGCTTCCGGTTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT C5 CGCTTCCGGCTAAAGTTCTTCACCAAGCGAAGCATGCGTGACGTTAAAGT C6 CGTTTCCGCTTAAAGTTCTTTACCAAGCGAACGATGCGCGACGTAAAGGT C7 CGCTTTCGCTTGAAGTTCTTCACCAAGCGAACCATGCGCGACGTTAGGGT C8 CGTTTCCGCCTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT C9 CGCTTCCGCCTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT C10 CGCTTCCGGCTAAAGTTCTTTGCCAAGCGAAGCATGCGCGACGTTAAGGT ** ** ** *.******** .********* ***** *****:*..** C1 CACGTTCATAGACTTCTCCAAACCGTATCTGGCCAAAATATCAAACAGTG C2 CACGTTCATAGACTTCTCCAAACCGTATCTGGCCAAAATATCGAACAGTG C3 CACGTTCATAGACTTCTCCAAGCCGTATCTGGCGAAAATATCGAACAGTG C4 CACGTTCATAGACTTCTCCAAACCGTATCTGGCCAAAATATCGAACAGTG C5 CACGTTCATAGACTTCTCCAAGCCATATCTGGCCAAAATATCGAACAGTG C6 CACGTTCATAGACTTCTCCAAACCGTATCTGGCTAAAATATCGAACAGTG C7 CACGTTCATAGACTTCTCGAAACCGTATCTCGCCAAGATATCGAACAGTG C8 CACGTTCATAGACTTCTCCAAACCATATCTGGCCAAGATATCGAACAGTG C9 CACGTTCATAGACTTTTCCAAACCGTATCTGGCCAAGATATCGAATAGTG C10 CACGTTCATAGACTTCTCCAAGCCGTATCTGGCCAAAATATCGAACAGTG *************** ** **.**.***** ** **.*****.** **** C1 ATAACTACAAGAGATTCCTCAACATTGGGCATAGAAGTAGAGGTACCAAA C2 ATAACTACAAGAGATTCCTCAACATTGGGCATAGAAGTAAAGGTACCCAA C3 ATAACTACAAGAGATTCCTCAACATTGCGCATAGAAGTAGAGGTACCAAA C4 ATAACTACAAGAGATTCCTCAACATTGGGCATAGAAGTAGAGGTACCAAA C5 ATAACTACAAGAGATTTCTCAACATTGGGCATAGAAGTAGAGGTACCAAA C6 ATAATTACAAGAGATTTCTCAACATTGGGAATAGAAGTAGAGGTACCAAA C7 ACAATTACAAGAGATTTCTCAACATCGGGCATAGAAGTAGAGGTACCAAA C8 ATAACTACAAGAGATTTCTCAACATTGGGCATAGAAGTAGAGGTACCAAA C9 ATAACTACAAGAGATTTCTCAACATTGGGCATAGAAGTAGAGGTACCAAA C10 ATAACTACAAGAGATTTCTCAACATTGGGCAAAGAAGTAGAGGTACCAGT * ** *********** ******** * *.*:*******.*******..: C1 TTCGATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCTAATTCTGT C2 TTCCATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCTAATTCTGT C3 TTCGATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCTAATTCTGT C4 TTAGATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCTAATTCTGT C5 TTCGATAATACAGCCAATCTGTCGGACCCAGCATCTCCAGCAGCTTCTGT C6 TTCGATAATACAGCCAACCTTTCGGATCCAGCATCTCCAGCAGCTTCTGT C7 TTCGATAATACAGCTAACCTTTCGGACCCAGCATCTCCAGCAGCTTCTGT C8 TTCGATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCAGCTTCTGT C9 TTCGATAATACAGCCAACCTTTCGGATCCAGCATCTCCAGCAGCTTCTGT C10 TTGGATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCAGCTTCTGT ** ********** ** ** ***** **************:..****** C1 GGCATCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTTTCCGTCGAGGAGA C2 GGCATCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTCTCCGTCGAGGAGA C3 GGCGTCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTTTCCGTCGAGGAAA C4 GGCATCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTTTCCGTCGAGGAAA C5 GGCATCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTTTCCGTGGAGGAGA C6 GGCATCTGCAGAAATTGCCGCCGAGTTTGCCGCGCTTACCGTCGAGGAGA C7 GGCATCCGCAGAAATTGCTGCCGAGTTTGCTGCGCTTTCCGTCGAGGAGA C8 GGCATCCGCAGAAATTGCCGCCGAGTTTGCTGCGCTTTCCGTGGAGGAGA C9 GGCATCCGCAGAAATTGCCGCCGAGTTTGCTGCGCTTTCCGTGGAGGAGA C10 GGCATCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTTTCCGTGGAGGAGA ***.** *********** ******** ** ***** :**** *****.* C1 AGGAGCAGCGTCGGGCTGAGTGGAGTCAGGAGCTCGCCCGCGTTGAGGAA C2 AGGAGCAGCGTCGGGCTGAGTGGAGTCAGGAGCTCGCCCGCGTTGAGGAA C3 AGGAGCAGCGTCGGGCCGAGTGGAGTCAGGAGCTCGCCCGCGTTGAGGAG C4 AGGAGCAGCGTCGGGCCGAGTGGAGTCAGGAGCTCGCCCGCGTTGAGGAA C5 AGGAGCAGCGTCGGGCTGATTGGACTCAGGAACTGGCCCGCGTTGAGGAG C6 AGGAGCAGCGTCGGGCTGAGTGGAGTCAGGAGCTAGCCCGCGTAGAGGAG C7 AGGAGCAACGTCGGGCTGAATGGAGTCAGGAGCTTGCCCGCGTGGAGGAG C8 AGGAACAGCGCCGGGCCGAGTGGAGTCAGGAGCTGGCCCGCGTTGAGGAG C9 AGGAACAGCGTCGGGCTGAGTGGAGTCAGGAGCTAGCTCGCGTTGAGGAG C10 AGGAGCAGCGTCGTGCTGAATGGAGTCAGGAGCTCGCCCGCGTTGAGGAG ****.**.** ** ** ** **** ******.** ** ***** *****. C1 GAGATCAATACGCTGCGAACTGTCCTAGCCTCCAAGACGCGCCATGCCTC C2 GAGATCAACACGCTGCGAACCGTTCTAGCCTCCAAGACGCGCCATGCCTC C3 GAGATCAACACGCTGCGAACTGTCCTAGCGTCTAAGACGCGCCATGCCTC C4 GAGATCAACACGCTGCGAACCGTCCTAGCCTCTAAGACGCGCCATGCCTC C5 GAGATCAACACGCTGCGCACCGTCCTCGCCTCGAAGACGCGCCATGCCTC C6 GAGATTAACACGCTGCGTACAGTTCTGGCCTCGAAGACGCGCCATGCCTC C7 GAGATCAACACGCTGCGCACCGTTCTCGCATCGAAGACGCGTCATGCCTC C8 GAGATTAACACGCTGCGTACCGTTCTCGCCTCGAAGACGCGCCATGCCTG C9 GAGATCAATACGCTGCGCACCGTTCTCGCCTCAAAGACGCGCCACGCCTC C10 GAGATCAACACGCTGCGCACCGTTCTCGCCTCGAAGACGCGCCATGCCTC ***** ** ******** ** ** ** ** ** ******** ** **** C1 CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG C2 CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG C3 CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG C4 CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG C5 CGATCTCAAGCGCAAGCTGGGCATTACCGTCTGGAAGGAGGTGACGGACG C6 CGATCTCAAGCGCAAGCTGGGCATTACCGTCTGGAAAGAGGTGACGGACG C7 CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG C8 CGATCTCAAGCGTAAACTGGGCATCACCGTCTGGAAGGAGGTTACGGACG C9 CGATCTCAAGCGCAAACTTGGCATAACCGTCTGGAAGGAGGTGACGGATG C10 CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG ************ **.** ***** ***********.***** ***** * C1 ACGTGAACCAGGGCCTTAAGAACCTCAAGGAGAGCACTGTTTACCAATCG C2 ACATGAACCAGGGCCTTAAGAACCTCAAGGAGAGCACTGTTTACCAATCG C3 ACATGAACCAGGGCCTTAAGAACCTCAAGGAGAGCACTGTTTACCAATCG C4 ACATGAACCAGGGCCTTAAGAACCTCAAGGAGAGCACTGTTTACCAATCG C5 ACATGAACCAGGGCATCAAGAACCTTAAAGAGAGCACTGTTTACCAATCG C6 ACATGAACCAGGGCATTAAGAACCTCAAAGAGAGCACTGTTTACCAATCG C7 ACATGAACCAGGGCATTAGGAACCTCAAGGAGAGCACTGTTTACCAATCG C8 ACATGAACCAGGGCATTAAGAACCTCAAAGAGACCACTGTTTACCAATCG C9 ATATGAACCAGGGCATTAAGAACCTCAAAGAGACCACTGTTTACCAATCG C10 ACATGAACCAGGGCATCAAGAACCTCAAGGAAACCACTGTTTACCAATCG * .***********.* *.****** **.**.* **************** C1 GTGGAGCAGAGCGTGGGCACGTTTACTAAAACGGTGTACGAGGCACCACT C2 GTGGAGCAGAGCGTGGGCACGTTTACTAAAACGGTGTACGAGGCACCACT C3 GTGGAGCAGAGCGTGGGCACGTTTACTAAAACGGTGTACGAGGCACCACT C4 GTGGAGCAGAGTGTGGGCACGTTTACTAAAACGGTGTACGAGGCACCACT C5 GTGGAGCAGAGCGTGGGCACGTTTACTAAAGCCGTGCACGAGGCACCCCT C6 GTGGAGCAGAGCTTGGGCACGTTTACTAAAGCCGTGCACGAAGCACCCCT C7 GTGGAGCAGAGCGTGGGCACGTTTACTAAAGCCGTGCACGAGGCACCCTT C8 GTGGAGCAGAGCGTGGGCACGTTTACTAAAGCCGTGCACGAGGCACCCCT C9 GTGGAGCAGAGCGTGGGCACGTTTACTAAAGCCGTGCACGAGGCACCCCT C10 GTGGAGCAGAGCGTGGGCACGTTTACTAAAGCCGTGCACGAGGCACCCCT *********** *****************.* *** ****.*****. * C1 ATACCAACGCACTGAGTCGGTGCTAAAGTCCACGGGCGAGAAGACCGCCT C2 ATACCAACGCACTGAGTCGGTGCTAAAGTCCACGGGCGAGAAGACCGCCT C3 ATACCAACGCACTGAGTCGGTGTTAAAGTCCACGGGCGAGAAGACCGCCT C4 ATACCAACGCACTGAGTCGGTGCTAAAGTCCACGGGCGAGAAGACCGCCT C5 ATACCAACGCACGGAGTCTGTGCTCAAGTCCACGGGCGAGAAGACCGCCT C6 ATACCAACGCACTGAGTCTGTGCTGAAGTCGACGGGTGAGAAGACCGCCT C7 GTACCAACGCACTGAATCCGTGCTGAAGTCCACGGGCGAAAAGACAGCCT C8 ATACCAACGCACTGAGTCTGTGCTGAAGTCCACGGGCGAGAAGACCGCCT C9 ATACCAACGCACGGAGTCGGTGCTGAAGTCGACGGGCGAGAAGACCGCCT C10 ATACCAACGCACGGAGTCTGTGCTCAAGTCCACGGGCGAGAAGACCGCCT .*********** **.** *** * ***** ***** **.*****.**** C1 CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG C2 CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG C3 CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG C4 CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG C5 CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG C6 CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAATTTTCGCAAATG C7 CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG C8 CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG C9 CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAATTGTCGCAAATG C10 CGGTGTTTGGCAGCATCACCAGCGGCATTTCGTCGAAACTGTCGCAAATG ********************** *************** * ********* C1 AAAAACTCCGAATCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA C2 AAAAACTCCGAATCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA C3 AAAAACTCTGAATCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA C4 AAAAACTCCGAATCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA C5 AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA C6 AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTAGGCTCTGCCTA C7 AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA C8 AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA C9 AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA C10 AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA ******** **.**************************.*********** C1 CGAGAACGTTAAAACCAAGGTGACATCCCGCTCGGGTTCGGTGTCCAGTT C2 CGAGAACGTTAAAACCAAGGTGACATCCCGCTCGGGTTCGGTATCCAGTT C3 CGAGAACGTTAAAACCAAGGTGACATCCCGCTCGGGTTCGGTATCCAGTT C4 CGAGAACGTTAAAACTAAGGTGACATCCCGCTCGGGTTCGGTATCCAGTT C5 CGAGAACGTTAAAACCAAGGTGACATCCCGCTCGGGTTCGGTATCCAGTT C6 CGAGAACGTTAAAACTAAGGTGACATCCCGTTCGGGTTCTGTATCCAGTT C7 CGAGAACGTTAAAACCAAGGTGACATCCCGGTCGGGTTCGGTATCCAGTT C8 CGAGAACGTTAAAACCAAGGTGACATCCCGTTCGGGATCGGTTTCCAGTT C9 TGAGAACGTTAAAACCAAGGTGACATCCCGGTCGGGCTCGGTTTCCAGTT C10 CGAGAACGTTAAAACCAAGGTGACATCCCGTTCGGGCTCGGTATCCAGTT ************** ************** ***** ** ** ******* C1 TCCCAGATGCCCTGGACGAGAATAACACATCCTCGGGTCTGAATTCACCC C2 TCCCAGATGCTCTGGACGAGAACAACACATCCTCGGGTCTGAATTCACCC C3 TCCCAGATGCCCTGGACGAGAACAACACATCCTCGGGTCTGAATTCACCC C4 TCCCAGATGCCCTGGACGAGAACAACACATCCTCGGGTCTGAATTCACCC C5 TTCCAGACGCCTTGGACGAGAACAACACATCCTCGGGCCTGAATTCACCC C6 TCCAAGACGCCCTGGACGAGAATAACACATCATCGGGCCTGAATTCACCT C7 TCCCAGACGCCCTGGACGAGAACAACACATCCTCGGGCCTGAACTCACCC C8 TCCCAGACGCCCTGGACGAGAACAACACATCCTCGGGCCTGAACTCACCC C9 TCCCAGACGCCATGGACGAGCACAACACATCCTCGGGCCTGAACTCACCC C10 TTCCAGACGCCTTGGACGAGAACAACACATCCTCGGGCCTGAACTCACCC * *.*** ** ********.* ********.***** ***** ***** C1 ACAGACTCACTCCCGAAA--- C2 ACAGACTCGCTCCCTAAA--- C3 ACAGACTCAATCACTAAA--- C4 ACAGACTCACTC--------- C5 ACAGACTCACTTACTAAA--- C6 ACAGACTCA------------ C7 ACAGACTCACTCACTAAA--- C8 ACAGACTCACTCACTAAA--- C9 ACAGACTCACTTACTAAA--- C10 ACAGACTCACTTACTAAA--- ********. >C1 ATGAGCGAATCGGAACCGAATAGCCTGGAGTTCATTGAAGACCCCTATCT GCCAAGCATTGATGATCTCACCAGCACACCGTCACTGGATCTGGAAACCA ATGATGCCGTCTTGGACTGGTATGGCGATGGGCAGGAGGAG---AGCGAG GCTGAGCTATATTTGCGTAATCTGACGCTAGACCAGATATTCTACGATGT GGATTCGGACTACACCAACAGCCTGGAATTGCAGGCAGTGGAGGCGGACT TCATTGCCGCCAAGTTGGCCAATCAAGCGCCATCGTCTTCGATGGCCAAA CGCTTCCGCTTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT CACGTTCATAGACTTCTCCAAACCGTATCTGGCCAAAATATCAAACAGTG ATAACTACAAGAGATTCCTCAACATTGGGCATAGAAGTAGAGGTACCAAA TTCGATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCTAATTCTGT GGCATCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTTTCCGTCGAGGAGA AGGAGCAGCGTCGGGCTGAGTGGAGTCAGGAGCTCGCCCGCGTTGAGGAA GAGATCAATACGCTGCGAACTGTCCTAGCCTCCAAGACGCGCCATGCCTC CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG ACGTGAACCAGGGCCTTAAGAACCTCAAGGAGAGCACTGTTTACCAATCG GTGGAGCAGAGCGTGGGCACGTTTACTAAAACGGTGTACGAGGCACCACT ATACCAACGCACTGAGTCGGTGCTAAAGTCCACGGGCGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG AAAAACTCCGAATCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA CGAGAACGTTAAAACCAAGGTGACATCCCGCTCGGGTTCGGTGTCCAGTT TCCCAGATGCCCTGGACGAGAATAACACATCCTCGGGTCTGAATTCACCC ACAGACTCACTCCCGAAA--- >C2 ATGAGCGAATCGGAACCGAATAGCCTGGAGTTCATTGAAGATCCCTATCT GCCAAGCATCGATGATCTCACCAGCACACCGTCACTGGATCTGGAAACCA ATGAAGCCGTCTTGGACTGGTATGGCGATGGGCAGGAGGAG---AGCGAG GCTGAGCTATATCTGCGTAATCTGACGCTAGACCAGATATTCTACGATGT GGATTCGGACTACACCAACAGCCTAGAACTGCAGGCAGTGGAGGCGGACT TCATTGCCGCCAAGTTGGCCAATCAAGCGCCATCGTCTTCGATGGCCAAA CGCTTCCGCTTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT CACGTTCATAGACTTCTCCAAACCGTATCTGGCCAAAATATCGAACAGTG ATAACTACAAGAGATTCCTCAACATTGGGCATAGAAGTAAAGGTACCCAA TTCCATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCTAATTCTGT GGCATCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTCTCCGTCGAGGAGA AGGAGCAGCGTCGGGCTGAGTGGAGTCAGGAGCTCGCCCGCGTTGAGGAA GAGATCAACACGCTGCGAACCGTTCTAGCCTCCAAGACGCGCCATGCCTC CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG ACATGAACCAGGGCCTTAAGAACCTCAAGGAGAGCACTGTTTACCAATCG GTGGAGCAGAGCGTGGGCACGTTTACTAAAACGGTGTACGAGGCACCACT ATACCAACGCACTGAGTCGGTGCTAAAGTCCACGGGCGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG AAAAACTCCGAATCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA CGAGAACGTTAAAACCAAGGTGACATCCCGCTCGGGTTCGGTATCCAGTT TCCCAGATGCTCTGGACGAGAACAACACATCCTCGGGTCTGAATTCACCC ACAGACTCGCTCCCTAAA--- >C3 ATGAGCGAATCCGAACCTAATAGCCTGGAGTTCATTGAAGACTCCTATCT GCCTGGCATCGATGATCTCACCAGCACACCGTCGCTGGATCTGGAAACTA GCGAATCCGTCTTGGACTGGTACGAAGATGGGCAGGAGGAG---AGCGAA GCTGAGCTATATCTGCGTAATCTGACGCTCGACCAGATATTCTACGATGT GGATTCGGACTACACGAATAGCCTGGAACTGCAGGCCGTGGAGGCGGACT TCATTGGTGCCAAGTTGGCCAATCAAGCACCATCCTCATCGATGGCCAAA CGCTTCCGGTTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT CACGTTCATAGACTTCTCCAAGCCGTATCTGGCGAAAATATCGAACAGTG ATAACTACAAGAGATTCCTCAACATTGCGCATAGAAGTAGAGGTACCAAA TTCGATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCTAATTCTGT GGCGTCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTTTCCGTCGAGGAAA AGGAGCAGCGTCGGGCCGAGTGGAGTCAGGAGCTCGCCCGCGTTGAGGAG GAGATCAACACGCTGCGAACTGTCCTAGCGTCTAAGACGCGCCATGCCTC CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG ACATGAACCAGGGCCTTAAGAACCTCAAGGAGAGCACTGTTTACCAATCG GTGGAGCAGAGCGTGGGCACGTTTACTAAAACGGTGTACGAGGCACCACT ATACCAACGCACTGAGTCGGTGTTAAAGTCCACGGGCGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG AAAAACTCTGAATCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA CGAGAACGTTAAAACCAAGGTGACATCCCGCTCGGGTTCGGTATCCAGTT TCCCAGATGCCCTGGACGAGAACAACACATCCTCGGGTCTGAATTCACCC ACAGACTCAATCACTAAA--- >C4 ATGAGCGAATCGGAACCGAATAGCCTGGAGTTCATTGAAGACTCCTATCT GCCTGGCATCGATGATCTCACCAGCACACCGTCGCTGGATCTGGAAACTA CCGAAGCCGTCTTGGACTGGTATGAAGATGGGCAGGAGGAG---AGCGAA GCTGAGCTATACCTGCGTAATCTGACGTTAGACCAGATATTCTACGATGT GGATTCAGACTATACCAACAGCCTGGAACTGCAGGCAGTGGAGGCGGACT TCATTGGCGCCAAGTTGGCCAATCAAGCACCATCATCTTCGATGGCCAAA CGCTTCCGGTTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT CACGTTCATAGACTTCTCCAAACCGTATCTGGCCAAAATATCGAACAGTG ATAACTACAAGAGATTCCTCAACATTGGGCATAGAAGTAGAGGTACCAAA TTAGATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCTAATTCTGT GGCATCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTTTCCGTCGAGGAAA AGGAGCAGCGTCGGGCCGAGTGGAGTCAGGAGCTCGCCCGCGTTGAGGAA GAGATCAACACGCTGCGAACCGTCCTAGCCTCTAAGACGCGCCATGCCTC CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG ACATGAACCAGGGCCTTAAGAACCTCAAGGAGAGCACTGTTTACCAATCG GTGGAGCAGAGTGTGGGCACGTTTACTAAAACGGTGTACGAGGCACCACT ATACCAACGCACTGAGTCGGTGCTAAAGTCCACGGGCGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG AAAAACTCCGAATCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA CGAGAACGTTAAAACTAAGGTGACATCCCGCTCGGGTTCGGTATCCAGTT TCCCAGATGCCCTGGACGAGAACAACACATCCTCGGGTCTGAATTCACCC ACAGACTCACTC--------- >C5 ATGAGCGAATCGGAACCCAATAGCCTGGAGTTCATTGAAGACTCCTATCT GCCAGGCATCGATGATCTCACCAGCACACCATCCCTGGATCTGGAAGCTA GCGAAGCCGTCTTGGACTGGTATGGAGACGGGCAGGAGGAG---AGCGAA GCTGATTTTTATCTGCGTAACCTGACTCTGGACCAGATCTTCTACGATGT GGATTCAGACTACTCCAACAGCCTGGAACTGCAGGCAGTGGAGGCGGAGT TCATTGGCGCCAAGTTGGCCAACCAGGCACCCTCTTCCTCGATGGCCAAA CGCTTCCGGCTAAAGTTCTTCACCAAGCGAAGCATGCGTGACGTTAAAGT CACGTTCATAGACTTCTCCAAGCCATATCTGGCCAAAATATCGAACAGTG ATAACTACAAGAGATTTCTCAACATTGGGCATAGAAGTAGAGGTACCAAA TTCGATAATACAGCCAATCTGTCGGACCCAGCATCTCCAGCAGCTTCTGT GGCATCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTTTCCGTGGAGGAGA AGGAGCAGCGTCGGGCTGATTGGACTCAGGAACTGGCCCGCGTTGAGGAG GAGATCAACACGCTGCGCACCGTCCTCGCCTCGAAGACGCGCCATGCCTC CGATCTCAAGCGCAAGCTGGGCATTACCGTCTGGAAGGAGGTGACGGACG ACATGAACCAGGGCATCAAGAACCTTAAAGAGAGCACTGTTTACCAATCG GTGGAGCAGAGCGTGGGCACGTTTACTAAAGCCGTGCACGAGGCACCCCT ATACCAACGCACGGAGTCTGTGCTCAAGTCCACGGGCGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA CGAGAACGTTAAAACCAAGGTGACATCCCGCTCGGGTTCGGTATCCAGTT TTCCAGACGCCTTGGACGAGAACAACACATCCTCGGGCCTGAATTCACCC ACAGACTCACTTACTAAA--- >C6 ATGAGCGAATCGGAACCCAATAGCCTGGAGTTCATTGAAGACTCCTACCT GCCAGGCATCGATGATCTCACCAGCACACCTTCCTTGGATCTGGAAACCA ATGATGCCGTCTTGGATTGGTATGGTGATGAGCAGGAGGAC---TCTGAA GCTGAGCTATATCTACGTAATCTGACTTTGGATCAGATCTTCTATGATGT AGATTCAGACTACACTAATAACCTGGAATTGCAGACAGTGGAAACAGAGT TCATTGGCGCCAAGTTGGCTAACCAAGCACCCTCTTCCTCGATAGCCAAA CGTTTCCGCTTAAAGTTCTTTACCAAGCGAACGATGCGCGACGTAAAGGT CACGTTCATAGACTTCTCCAAACCGTATCTGGCTAAAATATCGAACAGTG ATAATTACAAGAGATTTCTCAACATTGGGAATAGAAGTAGAGGTACCAAA TTCGATAATACAGCCAACCTTTCGGATCCAGCATCTCCAGCAGCTTCTGT GGCATCTGCAGAAATTGCCGCCGAGTTTGCCGCGCTTACCGTCGAGGAGA AGGAGCAGCGTCGGGCTGAGTGGAGTCAGGAGCTAGCCCGCGTAGAGGAG GAGATTAACACGCTGCGTACAGTTCTGGCCTCGAAGACGCGCCATGCCTC CGATCTCAAGCGCAAGCTGGGCATTACCGTCTGGAAAGAGGTGACGGACG ACATGAACCAGGGCATTAAGAACCTCAAAGAGAGCACTGTTTACCAATCG GTGGAGCAGAGCTTGGGCACGTTTACTAAAGCCGTGCACGAAGCACCCCT ATACCAACGCACTGAGTCTGTGCTGAAGTCGACGGGTGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAATTTTCGCAAATG AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTAGGCTCTGCCTA CGAGAACGTTAAAACTAAGGTGACATCCCGTTCGGGTTCTGTATCCAGTT TCCAAGACGCCCTGGACGAGAATAACACATCATCGGGCCTGAATTCACCT ACAGACTCA------------ >C7 ATGAGCGAATCGGAGCCCAATAGCCTGGAGTTCATCGAGGACCCCTACCT GCCGGGCATCGATGATCTCACCAGCACACCTTCACTGGATCTGGAAACGC CAGAAGCCGCATTGGATTGGTATGGCGACGAGCAGGAGGAG---AGTGAA GCGGAGCTTTATCTGCGTAATTTGACGCTGGATCAGATCTTCTACGATGT GGATTCGGATTATACCAACAGCCTGGAGCTGCAGGCAGTGGAAGCTGAGT TCATTGGAGCCAAGTTGGCCAACCAGACACCCTCATCGTCCATCGCCAAA CGCTTTCGCTTGAAGTTCTTCACCAAGCGAACCATGCGCGACGTTAGGGT CACGTTCATAGACTTCTCGAAACCGTATCTCGCCAAGATATCGAACAGTG ACAATTACAAGAGATTTCTCAACATCGGGCATAGAAGTAGAGGTACCAAA TTCGATAATACAGCTAACCTTTCGGACCCAGCATCTCCAGCAGCTTCTGT GGCATCCGCAGAAATTGCTGCCGAGTTTGCTGCGCTTTCCGTCGAGGAGA AGGAGCAACGTCGGGCTGAATGGAGTCAGGAGCTTGCCCGCGTGGAGGAG GAGATCAACACGCTGCGCACCGTTCTCGCATCGAAGACGCGTCATGCCTC CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG ACATGAACCAGGGCATTAGGAACCTCAAGGAGAGCACTGTTTACCAATCG GTGGAGCAGAGCGTGGGCACGTTTACTAAAGCCGTGCACGAGGCACCCTT GTACCAACGCACTGAATCCGTGCTGAAGTCCACGGGCGAAAAGACAGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA CGAGAACGTTAAAACCAAGGTGACATCCCGGTCGGGTTCGGTATCCAGTT TCCCAGACGCCCTGGACGAGAACAACACATCCTCGGGCCTGAACTCACCC ACAGACTCACTCACTAAA--- >C8 ATGAGCGAATCGGAACCCAATAGCCTGGAGTTCATTGAGGACTCGTACCT ACCAGGCATCGATGATCTCACCAGCACACCTTCTCTGGATCTGGAAGCTA ATGATGCCACCTTAGATTGGTATGGAGATGGAGAGGAGGAG---AGTGAA GCGGAGCTGTATCTGCGGAATCTGACTCTGGATCAGATATTCTACGATGT GGATTCGGACTACACCAACAGCCTGGAGCTGCAGGCAGTGGAGGCTGAGT TCATTGGCGCCAAGTTGGCCAATCAGGCGCCCTCCTCCTCCATGGCCAAA CGTTTCCGCCTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT CACGTTCATAGACTTCTCCAAACCATATCTGGCCAAGATATCGAACAGTG ATAACTACAAGAGATTTCTCAACATTGGGCATAGAAGTAGAGGTACCAAA TTCGATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCAGCTTCTGT GGCATCCGCAGAAATTGCCGCCGAGTTTGCTGCGCTTTCCGTGGAGGAGA AGGAACAGCGCCGGGCCGAGTGGAGTCAGGAGCTGGCCCGCGTTGAGGAG GAGATTAACACGCTGCGTACCGTTCTCGCCTCGAAGACGCGCCATGCCTG CGATCTCAAGCGTAAACTGGGCATCACCGTCTGGAAGGAGGTTACGGACG ACATGAACCAGGGCATTAAGAACCTCAAAGAGACCACTGTTTACCAATCG GTGGAGCAGAGCGTGGGCACGTTTACTAAAGCCGTGCACGAGGCACCCCT ATACCAACGCACTGAGTCTGTGCTGAAGTCCACGGGCGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA CGAGAACGTTAAAACCAAGGTGACATCCCGTTCGGGATCGGTTTCCAGTT TCCCAGACGCCCTGGACGAGAACAACACATCCTCGGGCCTGAACTCACCC ACAGACTCACTCACTAAA--- >C9 ATGAGCGAATCGGAACCCAATAGCCTGGATTTTATTGAGGACTCTTACCT GCCAGGCATCGATGATCTCACCAGCACACCTTCGCTGGATCTGGAAGCGC ATGATGCCACCATAGATTGGTACGACGATGGGCAGGAGGAT---AGTGAA GCGGAGCTGTATTTGCGTAATCTGACTCTCGATCAGATCTTCTACGATGT GGATTCCGATTACACCAACAGCCTGGAGCTGCAGGCCGTGGAGGCCGAGT TCATTGGCGCCAAGTTGGCCAACCAGGCACCCAGTTCCTCGATGGCCAAA CGCTTCCGCCTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT CACGTTCATAGACTTTTCCAAACCGTATCTGGCCAAGATATCGAATAGTG ATAACTACAAGAGATTTCTCAACATTGGGCATAGAAGTAGAGGTACCAAA TTCGATAATACAGCCAACCTTTCGGATCCAGCATCTCCAGCAGCTTCTGT GGCATCCGCAGAAATTGCCGCCGAGTTTGCTGCGCTTTCCGTGGAGGAGA AGGAACAGCGTCGGGCTGAGTGGAGTCAGGAGCTAGCTCGCGTTGAGGAG GAGATCAATACGCTGCGCACCGTTCTCGCCTCAAAGACGCGCCACGCCTC CGATCTCAAGCGCAAACTTGGCATAACCGTCTGGAAGGAGGTGACGGATG ATATGAACCAGGGCATTAAGAACCTCAAAGAGACCACTGTTTACCAATCG GTGGAGCAGAGCGTGGGCACGTTTACTAAAGCCGTGCACGAGGCACCCCT ATACCAACGCACGGAGTCGGTGCTGAAGTCGACGGGCGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAATTGTCGCAAATG AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA TGAGAACGTTAAAACCAAGGTGACATCCCGGTCGGGCTCGGTTTCCAGTT TCCCAGACGCCATGGACGAGCACAACACATCCTCGGGCCTGAACTCACCC ACAGACTCACTTACTAAA--- >C10 ATGAGCGAATCGGAACCCAATAGCCTGGAGTTCATCGAGGACTCCTACCT GCCAGGCATCGATGATCTCACCAGCACACCTTCCCTGGATCCGGAAGCCA CCGATGCCGTCTTGGATTGGCACGGCGATGGCCAGGAGGAGGAGAGTGAA GCCGAGCTCTATCTGCGTAATTTGACTCTCGATCAGATCTTCTACGATGT GGACTCGGACTACACCAATAGCCTGGAACTGCAGGCCGTGGAGGCGGAGT TCATTGGCGCCAAGTTGGCCAACCAGGCACCCTCCTCCTCGATGGCCAAG CGCTTCCGGCTAAAGTTCTTTGCCAAGCGAAGCATGCGCGACGTTAAGGT CACGTTCATAGACTTCTCCAAGCCGTATCTGGCCAAAATATCGAACAGTG ATAACTACAAGAGATTTCTCAACATTGGGCAAAGAAGTAGAGGTACCAGT TTGGATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCAGCTTCTGT GGCATCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTTTCCGTGGAGGAGA AGGAGCAGCGTCGTGCTGAATGGAGTCAGGAGCTCGCCCGCGTTGAGGAG GAGATCAACACGCTGCGCACCGTTCTCGCCTCGAAGACGCGCCATGCCTC CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG ACATGAACCAGGGCATCAAGAACCTCAAGGAAACCACTGTTTACCAATCG GTGGAGCAGAGCGTGGGCACGTTTACTAAAGCCGTGCACGAGGCACCCCT ATACCAACGCACGGAGTCTGTGCTCAAGTCCACGGGCGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGCGGCATTTCGTCGAAACTGTCGCAAATG AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA CGAGAACGTTAAAACCAAGGTGACATCCCGTTCGGGCTCGGTATCCAGTT TTCCAGACGCCTTGGACGAGAACAACACATCCTCGGGCCTGAACTCACCC ACAGACTCACTTACTAAA--- >C1 MSESEPNSLEFIEDPYLPSIDDLTSTPSLDLETNDAVLDWYGDGQEEoSE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIAAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQS VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLPK >C2 MSESEPNSLEFIEDPYLPSIDDLTSTPSLDLETNEAVLDWYGDGQEEoSE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIAAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSKGTQ FHNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLPK >C3 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETSESVLDWYEDGQEEoSE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIGAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIAHRSRGTK FDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSITK >C4 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETTEAVLDWYEDGQEEoSE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIGAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK LDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLoo >C5 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLEASEAVLDWYGDGQEEoSE ADFYLRNLTLDQIFYDVDSDYSNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFTKRSMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRADWTQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKESTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTK >C6 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETNDAVLDWYGDEQEDoSE AELYLRNLTLDQIFYDVDSDYTNNLELQTVETEFIGAKLANQAPSSSIAK RFRLKFFTKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGNRSRGTK FDNTANLSDPASPAASVASAEIAAEFAALTVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKESTVYQS VEQSLGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKFSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFQDALDENNTSSGLNSP TDSooo >C7 MSESEPNSLEFIEDPYLPGIDDLTSTPSLDLETPEAALDWYGDEQEEoSE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQTPSSSIAK RFRLKFFTKRTMRDVRVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIRNLKESTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTK >C8 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLEANDATLDWYGDGEEEoSE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSEPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHACDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTK >C9 MSESEPNSLDFIEDSYLPGIDDLTSTPSLDLEAHDATIDWYDDGQEDoSE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDAMDEHNTSSGLNSP TDSLTK >C10 MSESEPNSLEFIEDSYLPGIDDLTSTPSLDPEATDAVLDWHGDGQEEESE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFAKRSMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGQRSRGTS LDNTANLSEPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTK MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 10 taxa and 1071 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Taxon 8 -> C8 Taxon 9 -> C9 Taxon 10 -> C10 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1478623793 Setting output file names to "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 515721894 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 2257368510 Seed = 1440740851 Swapseed = 1478623793 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 44 unique site patterns Division 2 has 28 unique site patterns Division 3 has 138 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -4606.261800 -- -24.412588 Chain 2 -- -4595.716611 -- -24.412588 Chain 3 -- -4733.787794 -- -24.412588 Chain 4 -- -4746.450515 -- -24.412588 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -4660.685963 -- -24.412588 Chain 2 -- -4718.541184 -- -24.412588 Chain 3 -- -4663.466655 -- -24.412588 Chain 4 -- -4671.918005 -- -24.412588 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-4606.262] (-4595.717) (-4733.788) (-4746.451) * [-4660.686] (-4718.541) (-4663.467) (-4671.918) 500 -- (-3498.969) (-3508.887) (-3510.571) [-3505.441] * (-3528.669) (-3516.983) [-3507.660] (-3523.768) -- 0:33:19 1000 -- (-3448.454) (-3465.278) (-3478.294) [-3436.065] * (-3477.931) (-3484.210) [-3432.760] (-3458.457) -- 0:16:39 1500 -- (-3399.697) (-3441.803) (-3431.522) [-3387.394] * (-3445.069) (-3429.203) [-3398.607] (-3403.902) -- 0:11:05 2000 -- [-3379.153] (-3393.125) (-3394.313) (-3385.993) * (-3429.967) (-3397.372) (-3377.083) [-3372.633] -- 0:08:19 2500 -- (-3365.954) (-3385.417) [-3373.282] (-3366.669) * (-3426.702) (-3362.341) (-3389.744) [-3365.903] -- 0:13:18 3000 -- (-3369.898) (-3373.840) [-3363.439] (-3375.664) * (-3415.738) (-3363.940) (-3366.657) [-3365.043] -- 0:11:04 3500 -- (-3361.804) [-3367.371] (-3359.626) (-3365.492) * (-3378.385) (-3362.185) (-3382.675) [-3360.435] -- 0:09:29 4000 -- [-3357.950] (-3360.077) (-3360.758) (-3360.627) * (-3370.140) (-3360.188) (-3361.621) [-3358.323] -- 0:08:18 4500 -- (-3358.853) (-3362.913) [-3359.386] (-3362.826) * (-3355.068) (-3355.438) (-3372.860) [-3356.299] -- 0:11:03 5000 -- (-3367.021) (-3361.231) [-3357.161] (-3362.290) * [-3351.842] (-3362.815) (-3370.885) (-3360.483) -- 0:09:57 Average standard deviation of split frequencies: 0.072524 5500 -- (-3357.588) [-3361.387] (-3361.411) (-3358.611) * (-3367.637) [-3354.716] (-3370.225) (-3366.075) -- 0:09:02 6000 -- [-3358.034] (-3362.117) (-3367.308) (-3352.352) * (-3366.003) (-3358.779) [-3368.590] (-3365.736) -- 0:08:17 6500 -- [-3364.271] (-3362.995) (-3369.748) (-3363.739) * (-3368.404) [-3365.676] (-3361.305) (-3363.822) -- 0:10:11 7000 -- [-3360.043] (-3367.224) (-3369.739) (-3352.321) * (-3370.770) (-3366.540) [-3354.194] (-3357.228) -- 0:09:27 7500 -- (-3363.390) (-3370.078) [-3359.145] (-3355.955) * (-3368.195) (-3366.538) (-3363.445) [-3359.803] -- 0:08:49 8000 -- (-3363.767) [-3362.517] (-3359.930) (-3354.212) * (-3363.838) [-3366.290] (-3364.536) (-3352.259) -- 0:10:20 8500 -- [-3358.499] (-3364.591) (-3362.559) (-3365.888) * (-3369.861) (-3366.618) (-3357.212) [-3353.777] -- 0:09:43 9000 -- [-3355.862] (-3358.063) (-3360.761) (-3360.437) * (-3359.875) (-3380.703) (-3365.497) [-3353.799] -- 0:09:10 9500 -- (-3353.574) (-3368.068) (-3367.784) [-3355.891] * (-3359.017) (-3355.774) (-3363.321) [-3357.576] -- 0:08:41 10000 -- (-3364.202) (-3379.521) [-3360.091] (-3364.699) * [-3352.162] (-3373.797) (-3360.568) (-3359.759) -- 0:09:54 Average standard deviation of split frequencies: 0.044194 10500 -- (-3371.182) (-3365.335) [-3359.018] (-3359.057) * [-3364.491] (-3371.399) (-3358.219) (-3363.960) -- 0:09:25 11000 -- (-3369.537) (-3356.760) [-3358.799] (-3357.774) * (-3364.698) (-3355.840) [-3361.108] (-3361.179) -- 0:08:59 11500 -- (-3366.642) [-3358.284] (-3356.621) (-3356.772) * (-3357.609) (-3360.210) [-3358.020] (-3360.743) -- 0:08:35 12000 -- (-3359.195) (-3365.746) (-3361.326) [-3354.772] * (-3362.780) (-3363.486) (-3368.041) [-3354.659] -- 0:09:36 12500 -- [-3361.286] (-3361.327) (-3360.022) (-3358.339) * (-3360.401) (-3356.668) [-3359.766] (-3355.215) -- 0:09:13 13000 -- (-3362.711) (-3359.447) (-3362.018) [-3362.961] * (-3362.107) (-3354.918) (-3357.549) [-3356.774] -- 0:08:51 13500 -- (-3360.841) [-3359.937] (-3355.928) (-3362.375) * (-3357.553) (-3357.242) [-3359.242] (-3357.478) -- 0:08:31 14000 -- (-3365.069) (-3354.702) (-3359.535) [-3357.563] * [-3359.161] (-3353.823) (-3365.977) (-3355.689) -- 0:09:23 14500 -- (-3369.334) (-3351.332) [-3359.050] (-3361.124) * (-3355.728) (-3368.096) (-3357.741) [-3358.475] -- 0:09:03 15000 -- (-3361.433) (-3357.725) [-3358.221] (-3362.883) * (-3354.196) (-3361.829) [-3363.163] (-3358.449) -- 0:08:45 Average standard deviation of split frequencies: 0.042557 15500 -- (-3360.262) (-3366.256) [-3357.008] (-3369.000) * (-3362.877) [-3359.400] (-3363.849) (-3359.625) -- 0:08:28 16000 -- (-3356.326) (-3362.318) (-3368.709) [-3359.780] * (-3376.605) [-3362.571] (-3364.773) (-3360.002) -- 0:09:13 16500 -- [-3353.302] (-3356.136) (-3363.699) (-3360.854) * [-3360.454] (-3362.402) (-3363.712) (-3361.909) -- 0:08:56 17000 -- (-3367.766) (-3357.516) (-3356.952) [-3358.659] * (-3367.235) (-3355.831) (-3356.179) [-3359.444] -- 0:08:40 17500 -- (-3368.103) (-3359.424) [-3357.766] (-3360.453) * (-3357.168) (-3366.044) (-3358.979) [-3360.974] -- 0:08:25 18000 -- (-3360.424) (-3357.798) [-3354.801] (-3361.394) * (-3362.537) [-3356.945] (-3363.148) (-3362.957) -- 0:09:05 18500 -- (-3356.939) [-3357.256] (-3364.062) (-3366.095) * [-3358.703] (-3360.453) (-3363.820) (-3364.031) -- 0:08:50 19000 -- (-3370.430) (-3360.100) (-3363.228) [-3364.576] * (-3366.651) (-3368.560) [-3358.483] (-3357.424) -- 0:08:36 19500 -- (-3359.361) (-3365.325) [-3357.829] (-3359.265) * [-3354.577] (-3357.452) (-3358.120) (-3362.277) -- 0:08:22 20000 -- (-3360.981) (-3373.671) (-3361.141) [-3359.405] * (-3359.530) (-3356.590) [-3355.799] (-3367.576) -- 0:08:59 Average standard deviation of split frequencies: 0.054744 20500 -- (-3363.042) (-3383.301) [-3360.030] (-3357.875) * (-3366.387) [-3354.484] (-3361.520) (-3355.170) -- 0:08:45 21000 -- (-3371.098) (-3358.971) [-3362.756] (-3355.859) * [-3355.003] (-3360.197) (-3366.092) (-3368.344) -- 0:08:32 21500 -- (-3363.031) [-3353.138] (-3355.503) (-3364.131) * [-3359.220] (-3355.589) (-3360.688) (-3365.195) -- 0:08:20 22000 -- (-3374.961) [-3362.371] (-3359.763) (-3358.208) * (-3363.211) [-3362.697] (-3364.343) (-3358.971) -- 0:08:53 22500 -- (-3370.991) [-3364.362] (-3358.441) (-3357.880) * (-3357.964) [-3354.172] (-3367.709) (-3363.663) -- 0:08:41 23000 -- (-3363.844) (-3366.556) [-3365.100] (-3362.371) * (-3353.648) (-3355.309) (-3363.516) [-3354.446] -- 0:08:29 23500 -- [-3360.199] (-3364.067) (-3357.217) (-3364.353) * (-3356.940) [-3366.175] (-3357.753) (-3362.977) -- 0:08:18 24000 -- (-3372.960) (-3354.947) [-3360.664] (-3358.051) * (-3364.858) (-3373.197) [-3355.912] (-3363.268) -- 0:08:48 24500 -- (-3363.037) [-3356.770] (-3369.466) (-3352.051) * [-3362.272] (-3365.456) (-3366.063) (-3354.037) -- 0:08:37 25000 -- (-3355.740) (-3356.252) (-3353.030) [-3363.680] * (-3368.643) (-3362.129) (-3361.988) [-3355.572] -- 0:08:26 Average standard deviation of split frequencies: 0.039888 25500 -- (-3362.490) (-3360.443) (-3363.659) [-3357.154] * [-3360.139] (-3364.700) (-3359.383) (-3366.014) -- 0:08:16 26000 -- (-3360.840) (-3372.003) [-3356.166] (-3363.459) * (-3358.435) (-3360.819) [-3355.820] (-3374.278) -- 0:08:44 26500 -- [-3357.812] (-3360.165) (-3360.895) (-3365.330) * [-3356.757] (-3358.865) (-3357.520) (-3367.590) -- 0:08:34 27000 -- (-3362.347) (-3356.454) (-3367.040) [-3365.537] * (-3355.486) [-3352.474] (-3359.411) (-3355.368) -- 0:08:24 27500 -- (-3375.895) (-3355.812) [-3360.059] (-3360.701) * [-3362.904] (-3360.255) (-3369.076) (-3365.891) -- 0:08:50 28000 -- (-3362.833) [-3360.740] (-3363.515) (-3364.385) * (-3362.327) (-3361.472) (-3355.140) [-3355.884] -- 0:08:40 28500 -- (-3366.673) (-3354.207) (-3358.009) [-3356.420] * (-3368.082) (-3354.647) [-3359.024] (-3356.416) -- 0:08:31 29000 -- (-3365.110) (-3354.733) [-3356.898] (-3358.404) * (-3364.699) [-3358.521] (-3356.880) (-3359.229) -- 0:08:22 29500 -- (-3364.020) (-3355.958) (-3358.298) [-3359.454] * [-3356.700] (-3360.501) (-3366.306) (-3353.747) -- 0:08:46 30000 -- (-3363.436) (-3366.998) (-3358.225) [-3357.887] * [-3361.774] (-3368.920) (-3362.233) (-3375.063) -- 0:08:37 Average standard deviation of split frequencies: 0.030744 30500 -- [-3353.966] (-3357.033) (-3358.873) (-3363.052) * (-3361.710) [-3365.384] (-3358.209) (-3361.821) -- 0:08:28 31000 -- (-3367.596) (-3360.978) (-3358.174) [-3359.243] * (-3362.836) (-3367.759) [-3361.160] (-3360.091) -- 0:08:20 31500 -- (-3362.535) [-3356.435] (-3362.912) (-3356.301) * [-3354.408] (-3361.096) (-3360.250) (-3357.851) -- 0:08:42 32000 -- (-3358.630) (-3358.263) (-3359.138) [-3362.902] * (-3357.414) (-3365.959) [-3357.048] (-3362.900) -- 0:08:34 32500 -- (-3361.585) [-3359.050] (-3363.443) (-3373.041) * (-3358.591) (-3360.337) (-3369.079) [-3362.744] -- 0:08:26 33000 -- (-3361.971) (-3370.612) [-3357.059] (-3362.515) * [-3362.353] (-3376.316) (-3361.727) (-3358.887) -- 0:08:18 33500 -- (-3360.315) (-3368.208) [-3356.974] (-3377.114) * [-3363.935] (-3363.969) (-3351.631) (-3364.935) -- 0:08:39 34000 -- (-3378.482) (-3356.471) (-3369.999) [-3365.832] * (-3364.395) [-3356.639] (-3367.806) (-3356.398) -- 0:08:31 34500 -- (-3373.980) (-3359.118) (-3373.902) [-3363.890] * (-3358.987) (-3364.964) (-3370.990) [-3368.632] -- 0:08:23 35000 -- [-3362.447] (-3359.841) (-3373.358) (-3357.508) * (-3366.766) (-3366.993) [-3359.397] (-3368.564) -- 0:08:16 Average standard deviation of split frequencies: 0.026189 35500 -- (-3364.540) [-3355.468] (-3366.847) (-3362.662) * [-3359.630] (-3365.132) (-3357.191) (-3360.139) -- 0:08:36 36000 -- (-3355.810) (-3357.100) (-3369.095) [-3361.759] * [-3358.501] (-3359.939) (-3358.002) (-3368.635) -- 0:08:28 36500 -- (-3358.875) (-3365.973) (-3358.804) [-3360.616] * (-3361.000) [-3355.181] (-3355.760) (-3360.388) -- 0:08:21 37000 -- (-3355.889) (-3370.018) (-3359.856) [-3358.778] * [-3358.553] (-3363.181) (-3364.710) (-3367.106) -- 0:08:14 37500 -- (-3367.593) (-3364.534) [-3365.928] (-3363.965) * (-3356.935) (-3360.967) (-3351.303) [-3359.655] -- 0:08:33 38000 -- [-3358.498] (-3368.571) (-3357.298) (-3359.203) * [-3353.646] (-3361.980) (-3366.427) (-3359.550) -- 0:08:26 38500 -- (-3361.650) (-3370.972) [-3356.254] (-3356.980) * [-3359.914] (-3367.529) (-3361.064) (-3361.730) -- 0:08:19 39000 -- (-3367.649) (-3361.922) [-3362.177] (-3364.894) * (-3358.708) [-3364.050] (-3354.640) (-3366.058) -- 0:08:12 39500 -- [-3356.432] (-3363.253) (-3358.907) (-3360.013) * (-3362.245) [-3355.896] (-3355.605) (-3369.693) -- 0:08:30 40000 -- [-3366.598] (-3361.643) (-3351.881) (-3367.152) * (-3364.973) (-3363.179) (-3357.695) [-3354.915] -- 0:08:23 Average standard deviation of split frequencies: 0.021896 40500 -- [-3359.346] (-3361.050) (-3363.638) (-3357.402) * [-3366.168] (-3370.757) (-3358.364) (-3366.393) -- 0:08:17 41000 -- (-3363.544) [-3358.433] (-3370.221) (-3367.329) * (-3372.629) (-3361.444) (-3358.661) [-3362.987] -- 0:08:11 41500 -- (-3363.149) (-3370.959) (-3354.277) [-3355.080] * [-3361.652] (-3367.189) (-3354.813) (-3364.267) -- 0:08:28 42000 -- (-3361.220) [-3349.046] (-3356.278) (-3356.033) * (-3362.286) (-3360.309) [-3354.784] (-3366.255) -- 0:08:21 42500 -- (-3365.343) (-3359.955) (-3356.036) [-3357.218] * (-3356.715) [-3360.464] (-3358.945) (-3359.170) -- 0:08:15 43000 -- (-3361.468) [-3357.337] (-3358.794) (-3365.322) * (-3360.164) (-3358.171) (-3377.193) [-3359.326] -- 0:08:09 43500 -- (-3358.997) (-3365.093) (-3364.163) [-3361.003] * [-3359.351] (-3368.497) (-3371.716) (-3364.194) -- 0:08:25 44000 -- [-3357.236] (-3372.834) (-3356.650) (-3356.700) * [-3353.000] (-3364.821) (-3361.468) (-3365.177) -- 0:08:19 44500 -- (-3359.271) (-3363.445) (-3360.155) [-3352.267] * [-3360.226] (-3357.307) (-3361.975) (-3353.680) -- 0:08:13 45000 -- (-3376.715) (-3359.699) (-3356.673) [-3355.255] * [-3354.482] (-3355.477) (-3357.101) (-3359.048) -- 0:08:08 Average standard deviation of split frequencies: 0.012525 45500 -- (-3353.770) (-3359.379) [-3360.688] (-3356.766) * (-3353.600) (-3366.447) [-3360.822] (-3359.795) -- 0:08:23 46000 -- (-3354.081) (-3369.417) [-3364.672] (-3366.993) * [-3359.336] (-3367.415) (-3361.554) (-3350.893) -- 0:08:17 46500 -- (-3359.910) [-3355.397] (-3366.351) (-3366.499) * (-3358.718) [-3369.753] (-3354.490) (-3360.201) -- 0:08:12 47000 -- (-3359.475) (-3357.325) (-3364.666) [-3369.126] * [-3357.662] (-3366.578) (-3362.575) (-3359.527) -- 0:08:26 47500 -- [-3358.255] (-3357.467) (-3357.216) (-3368.195) * (-3356.438) [-3359.433] (-3359.194) (-3354.820) -- 0:08:21 48000 -- [-3354.423] (-3356.997) (-3362.803) (-3375.986) * (-3357.667) [-3359.573] (-3358.329) (-3368.372) -- 0:08:15 48500 -- (-3365.348) [-3354.882] (-3370.716) (-3368.128) * (-3362.820) (-3365.944) [-3358.044] (-3367.617) -- 0:08:10 49000 -- [-3355.543] (-3362.599) (-3364.087) (-3371.605) * (-3359.920) [-3358.741] (-3363.338) (-3352.808) -- 0:08:24 49500 -- [-3354.454] (-3355.246) (-3372.957) (-3367.934) * (-3368.725) (-3362.509) (-3363.634) [-3350.917] -- 0:08:19 50000 -- (-3373.658) (-3355.265) (-3360.121) [-3355.277] * (-3364.369) (-3365.812) [-3357.725] (-3355.752) -- 0:08:13 Average standard deviation of split frequencies: 0.016541 50500 -- (-3356.596) (-3354.742) (-3358.888) [-3358.849] * (-3366.705) [-3359.947] (-3360.077) (-3366.344) -- 0:08:08 51000 -- (-3364.488) [-3355.893] (-3360.887) (-3357.424) * (-3358.273) (-3358.709) (-3358.800) [-3356.345] -- 0:08:22 51500 -- (-3368.344) [-3351.862] (-3357.511) (-3361.532) * (-3359.374) (-3357.299) (-3368.613) [-3360.607] -- 0:08:17 52000 -- [-3369.240] (-3363.516) (-3367.959) (-3361.003) * [-3356.887] (-3362.507) (-3357.356) (-3361.583) -- 0:08:12 52500 -- (-3365.531) (-3356.749) [-3353.194] (-3360.513) * (-3364.823) [-3362.711] (-3366.397) (-3365.019) -- 0:08:07 53000 -- (-3366.436) [-3360.253] (-3360.863) (-3362.082) * (-3362.277) (-3361.345) [-3358.842] (-3362.675) -- 0:08:20 53500 -- (-3360.588) (-3356.984) [-3355.225] (-3358.345) * (-3362.282) [-3365.443] (-3367.663) (-3363.330) -- 0:08:15 54000 -- (-3376.105) (-3358.780) (-3356.983) [-3354.170] * (-3365.095) (-3358.557) [-3365.500] (-3361.278) -- 0:08:10 54500 -- (-3367.374) (-3359.702) (-3362.766) [-3354.950] * (-3374.869) [-3357.286] (-3362.768) (-3366.256) -- 0:08:05 55000 -- (-3368.862) (-3355.993) [-3357.200] (-3352.891) * (-3362.962) [-3356.464] (-3368.424) (-3364.592) -- 0:08:18 Average standard deviation of split frequencies: 0.023570 55500 -- (-3359.248) (-3366.138) [-3357.950] (-3358.438) * [-3364.700] (-3355.648) (-3368.380) (-3367.034) -- 0:08:13 56000 -- (-3353.719) [-3356.287] (-3367.218) (-3370.210) * [-3364.313] (-3367.078) (-3363.717) (-3365.785) -- 0:08:08 56500 -- [-3350.803] (-3354.406) (-3366.285) (-3358.607) * (-3361.905) (-3362.499) [-3352.894] (-3353.954) -- 0:08:04 57000 -- (-3363.294) (-3352.259) (-3368.817) [-3361.283] * [-3363.971] (-3363.794) (-3358.498) (-3355.171) -- 0:08:16 57500 -- (-3360.843) (-3355.244) (-3369.047) [-3362.298] * (-3356.508) (-3361.414) (-3363.383) [-3360.281] -- 0:08:11 58000 -- [-3356.802] (-3356.089) (-3374.067) (-3369.190) * (-3356.378) [-3352.103] (-3362.381) (-3356.728) -- 0:08:07 58500 -- (-3358.291) (-3367.441) (-3366.482) [-3360.804] * (-3360.715) [-3361.228] (-3371.452) (-3366.289) -- 0:08:02 59000 -- (-3355.946) (-3361.315) [-3357.817] (-3360.034) * (-3371.467) (-3366.338) (-3363.374) [-3370.835] -- 0:08:14 59500 -- [-3359.856] (-3356.369) (-3356.628) (-3361.967) * (-3378.187) [-3360.746] (-3371.150) (-3350.447) -- 0:08:10 60000 -- [-3360.114] (-3357.819) (-3356.173) (-3365.871) * (-3356.853) (-3367.569) (-3360.713) [-3355.115] -- 0:08:05 Average standard deviation of split frequencies: 0.019426 60500 -- (-3368.853) [-3361.756] (-3359.055) (-3360.095) * (-3369.393) (-3358.487) (-3361.571) [-3353.550] -- 0:08:01 61000 -- (-3356.708) [-3359.129] (-3364.903) (-3358.869) * [-3354.568] (-3373.342) (-3363.537) (-3355.066) -- 0:08:12 61500 -- [-3358.179] (-3364.704) (-3361.044) (-3365.985) * (-3358.601) (-3356.004) [-3364.207] (-3356.640) -- 0:08:08 62000 -- (-3370.252) (-3357.224) [-3359.986] (-3365.314) * [-3353.157] (-3355.508) (-3357.738) (-3364.016) -- 0:08:04 62500 -- (-3363.183) [-3361.621] (-3361.449) (-3359.000) * [-3359.699] (-3365.296) (-3363.746) (-3368.559) -- 0:08:00 63000 -- [-3361.630] (-3360.175) (-3360.938) (-3353.778) * [-3355.689] (-3362.683) (-3373.001) (-3362.450) -- 0:08:10 63500 -- [-3359.351] (-3353.789) (-3362.589) (-3360.911) * [-3359.750] (-3357.754) (-3361.422) (-3355.869) -- 0:08:06 64000 -- (-3359.990) (-3361.269) [-3355.104] (-3362.785) * (-3367.093) (-3360.037) (-3365.995) [-3358.223] -- 0:08:02 64500 -- [-3354.375] (-3359.402) (-3352.532) (-3367.829) * [-3354.142] (-3362.971) (-3365.627) (-3370.734) -- 0:07:58 65000 -- (-3370.912) (-3355.551) (-3371.385) [-3359.861] * [-3354.280] (-3358.530) (-3359.850) (-3360.660) -- 0:08:09 Average standard deviation of split frequencies: 0.022142 65500 -- (-3359.745) (-3363.768) (-3361.203) [-3355.746] * [-3362.077] (-3355.978) (-3364.790) (-3364.127) -- 0:08:05 66000 -- (-3357.712) (-3363.791) [-3359.681] (-3364.911) * (-3354.880) (-3370.843) [-3357.687] (-3368.689) -- 0:08:01 66500 -- (-3372.664) (-3363.097) (-3355.521) [-3354.836] * [-3358.771] (-3367.456) (-3361.774) (-3371.271) -- 0:08:11 67000 -- (-3378.203) (-3353.052) [-3351.006] (-3354.596) * (-3360.707) (-3373.229) (-3366.887) [-3356.112] -- 0:08:07 67500 -- [-3356.635] (-3354.915) (-3362.049) (-3360.551) * (-3357.831) (-3369.005) [-3354.477] (-3369.133) -- 0:08:03 68000 -- (-3370.703) [-3360.129] (-3361.616) (-3352.692) * [-3363.106] (-3362.965) (-3367.112) (-3362.668) -- 0:07:59 68500 -- (-3358.236) (-3361.441) [-3361.798] (-3360.972) * (-3355.868) [-3359.333] (-3367.918) (-3363.833) -- 0:08:09 69000 -- (-3360.956) (-3359.839) [-3362.452] (-3361.145) * (-3367.334) (-3362.236) [-3361.234] (-3362.701) -- 0:08:05 69500 -- [-3353.211] (-3358.473) (-3366.847) (-3358.190) * [-3356.515] (-3363.805) (-3363.792) (-3360.938) -- 0:08:01 70000 -- (-3357.929) (-3365.994) (-3357.769) [-3359.803] * [-3364.872] (-3353.554) (-3371.268) (-3357.478) -- 0:07:58 Average standard deviation of split frequencies: 0.022681 70500 -- (-3365.392) (-3358.770) [-3353.628] (-3362.393) * (-3361.496) (-3358.645) [-3357.852] (-3358.314) -- 0:08:07 71000 -- (-3361.038) (-3362.124) (-3364.073) [-3361.492] * (-3364.351) (-3360.607) [-3363.796] (-3362.785) -- 0:08:04 71500 -- (-3364.081) (-3372.347) (-3362.177) [-3356.247] * [-3360.526] (-3360.325) (-3360.754) (-3359.491) -- 0:08:00 72000 -- (-3362.864) [-3360.905] (-3361.465) (-3361.593) * (-3370.011) (-3353.648) (-3356.889) [-3355.403] -- 0:07:56 72500 -- [-3365.808] (-3362.664) (-3368.891) (-3360.065) * (-3361.005) [-3358.645] (-3361.633) (-3355.754) -- 0:08:06 73000 -- (-3359.703) [-3358.083] (-3366.792) (-3358.185) * (-3359.274) (-3357.415) (-3360.416) [-3360.427] -- 0:08:02 73500 -- (-3361.728) (-3358.883) (-3364.216) [-3363.385] * [-3372.280] (-3360.285) (-3372.841) (-3374.612) -- 0:07:59 74000 -- (-3375.492) (-3359.637) (-3358.246) [-3362.685] * (-3356.988) (-3371.438) (-3359.649) [-3360.231] -- 0:07:55 74500 -- (-3367.817) [-3363.991] (-3360.926) (-3369.608) * (-3361.141) (-3354.558) (-3360.705) [-3355.981] -- 0:08:04 75000 -- (-3362.560) (-3368.078) (-3363.867) [-3365.682] * (-3356.843) (-3355.060) (-3352.833) [-3356.643] -- 0:08:00 Average standard deviation of split frequencies: 0.017919 75500 -- [-3357.233] (-3355.687) (-3371.482) (-3359.744) * (-3365.362) [-3358.478] (-3361.800) (-3357.752) -- 0:07:57 76000 -- (-3359.374) [-3358.577] (-3361.895) (-3355.127) * (-3368.488) [-3354.141] (-3354.314) (-3352.106) -- 0:07:54 76500 -- (-3360.580) [-3362.032] (-3366.236) (-3365.277) * (-3360.274) [-3360.044] (-3360.693) (-3354.717) -- 0:08:02 77000 -- [-3354.092] (-3355.105) (-3359.093) (-3360.293) * [-3359.378] (-3365.115) (-3356.351) (-3356.077) -- 0:07:59 77500 -- (-3367.096) (-3354.255) [-3357.049] (-3366.646) * [-3356.800] (-3367.321) (-3358.521) (-3359.137) -- 0:07:56 78000 -- (-3363.260) [-3369.120] (-3359.271) (-3369.793) * (-3353.042) (-3357.803) [-3352.650] (-3367.014) -- 0:07:52 78500 -- (-3365.541) (-3353.821) (-3357.554) [-3361.412] * (-3358.454) (-3369.569) (-3363.685) [-3356.234] -- 0:08:01 79000 -- [-3360.215] (-3358.524) (-3359.770) (-3358.005) * (-3370.797) (-3367.462) (-3365.568) [-3359.009] -- 0:07:57 79500 -- (-3359.845) (-3363.378) (-3355.127) [-3362.924] * [-3360.238] (-3364.327) (-3361.958) (-3360.261) -- 0:07:54 80000 -- (-3365.974) [-3351.015] (-3360.466) (-3357.604) * (-3357.133) (-3378.084) (-3357.323) [-3355.256] -- 0:07:51 Average standard deviation of split frequencies: 0.021427 80500 -- (-3375.303) (-3361.179) (-3354.619) [-3357.517] * (-3353.079) (-3369.024) (-3364.444) [-3359.562] -- 0:07:59 81000 -- [-3360.219] (-3361.746) (-3363.089) (-3372.302) * [-3360.805] (-3357.590) (-3358.468) (-3360.984) -- 0:07:56 81500 -- (-3357.522) [-3359.108] (-3360.714) (-3360.218) * (-3359.976) [-3352.785] (-3366.066) (-3357.239) -- 0:07:53 82000 -- [-3356.717] (-3359.174) (-3362.708) (-3355.892) * [-3367.498] (-3364.270) (-3352.743) (-3355.395) -- 0:07:50 82500 -- [-3358.687] (-3373.345) (-3360.128) (-3362.385) * (-3367.633) (-3354.767) [-3363.394] (-3360.685) -- 0:07:58 83000 -- (-3356.733) (-3362.143) (-3356.511) [-3361.724] * (-3358.104) (-3358.442) [-3351.923] (-3360.015) -- 0:07:55 83500 -- [-3357.963] (-3358.347) (-3356.006) (-3363.021) * [-3363.173] (-3366.217) (-3367.361) (-3358.744) -- 0:07:51 84000 -- (-3355.857) [-3354.391] (-3364.820) (-3364.373) * [-3364.126] (-3386.938) (-3356.954) (-3358.576) -- 0:07:48 84500 -- (-3363.650) (-3355.723) (-3375.889) [-3372.574] * (-3380.321) (-3364.306) (-3359.906) [-3359.861] -- 0:07:56 85000 -- (-3353.914) (-3374.463) [-3361.969] (-3367.694) * [-3358.242] (-3363.076) (-3361.648) (-3361.619) -- 0:07:53 Average standard deviation of split frequencies: 0.026798 85500 -- [-3354.170] (-3365.528) (-3363.620) (-3360.579) * (-3359.952) [-3356.751] (-3367.272) (-3356.706) -- 0:07:50 86000 -- (-3354.822) [-3368.608] (-3370.608) (-3366.072) * (-3361.759) [-3357.701] (-3360.005) (-3369.001) -- 0:07:58 86500 -- (-3362.720) [-3359.207] (-3356.021) (-3367.106) * (-3355.405) (-3375.228) (-3367.048) [-3359.669] -- 0:07:55 87000 -- (-3376.610) [-3355.722] (-3364.866) (-3355.430) * (-3363.834) [-3353.145] (-3367.925) (-3366.451) -- 0:07:52 87500 -- (-3365.522) (-3358.564) (-3366.537) [-3357.762] * [-3363.173] (-3366.725) (-3362.581) (-3361.779) -- 0:07:49 88000 -- [-3355.260] (-3358.363) (-3367.361) (-3362.112) * [-3353.354] (-3357.774) (-3364.354) (-3358.572) -- 0:07:56 88500 -- [-3356.368] (-3356.617) (-3366.749) (-3357.916) * [-3352.073] (-3362.637) (-3363.236) (-3362.457) -- 0:07:53 89000 -- (-3364.828) (-3363.855) [-3355.747] (-3360.466) * (-3351.717) [-3361.593] (-3366.527) (-3358.769) -- 0:07:50 89500 -- [-3354.990] (-3353.463) (-3365.084) (-3365.872) * (-3357.972) (-3359.903) [-3359.177] (-3360.337) -- 0:07:47 90000 -- (-3369.189) (-3361.190) [-3367.268] (-3364.058) * (-3359.721) (-3354.571) (-3360.589) [-3356.483] -- 0:07:55 Average standard deviation of split frequencies: 0.024841 90500 -- (-3360.033) (-3353.798) [-3358.380] (-3360.380) * [-3358.375] (-3357.251) (-3364.816) (-3358.054) -- 0:07:52 91000 -- (-3359.047) (-3361.201) [-3360.699] (-3362.923) * (-3364.058) (-3363.965) [-3362.090] (-3356.234) -- 0:07:49 91500 -- (-3360.584) (-3352.753) [-3356.543] (-3361.754) * (-3362.017) (-3371.285) [-3364.243] (-3357.794) -- 0:07:46 92000 -- (-3354.037) [-3354.130] (-3353.195) (-3363.520) * (-3361.172) (-3367.276) [-3357.259] (-3367.853) -- 0:07:53 92500 -- (-3355.830) (-3354.277) (-3360.467) [-3360.609] * (-3365.116) (-3366.069) (-3362.930) [-3357.486] -- 0:07:50 93000 -- [-3360.909] (-3356.551) (-3359.642) (-3369.002) * [-3356.461] (-3359.813) (-3363.917) (-3362.651) -- 0:07:48 93500 -- (-3368.103) (-3356.987) (-3360.466) [-3357.060] * (-3364.835) (-3353.612) (-3366.068) [-3354.177] -- 0:07:45 94000 -- [-3362.378] (-3369.570) (-3363.513) (-3362.861) * (-3354.027) [-3353.839] (-3355.329) (-3355.636) -- 0:07:52 94500 -- (-3361.039) (-3376.811) (-3356.135) [-3362.733] * [-3359.220] (-3364.932) (-3364.590) (-3360.170) -- 0:07:49 95000 -- (-3359.052) (-3366.366) [-3357.171] (-3355.298) * [-3352.805] (-3367.377) (-3362.166) (-3369.210) -- 0:07:46 Average standard deviation of split frequencies: 0.022915 95500 -- (-3368.584) (-3354.391) (-3358.144) [-3362.682] * (-3357.260) (-3369.613) (-3362.132) [-3364.926] -- 0:07:44 96000 -- (-3359.927) [-3360.756] (-3359.635) (-3361.421) * (-3362.736) (-3358.688) (-3363.324) [-3362.275] -- 0:07:50 96500 -- (-3354.817) [-3362.247] (-3359.707) (-3356.618) * (-3360.205) [-3359.380] (-3370.173) (-3365.733) -- 0:07:48 97000 -- [-3354.555] (-3363.791) (-3359.986) (-3361.033) * (-3357.644) (-3367.459) (-3362.038) [-3357.653] -- 0:07:45 97500 -- (-3354.401) (-3359.029) [-3356.013] (-3358.218) * (-3369.967) (-3362.682) [-3362.802] (-3358.201) -- 0:07:42 98000 -- (-3360.417) (-3358.103) [-3357.690] (-3365.658) * [-3358.156] (-3376.050) (-3357.116) (-3360.487) -- 0:07:49 98500 -- (-3363.558) (-3365.635) [-3354.607] (-3363.282) * (-3355.460) (-3363.255) (-3360.194) [-3356.768] -- 0:07:46 99000 -- (-3357.310) (-3356.666) (-3364.812) [-3361.762] * [-3357.145] (-3364.897) (-3363.951) (-3360.440) -- 0:07:44 99500 -- (-3356.259) (-3356.921) [-3359.450] (-3366.846) * (-3373.766) (-3374.056) (-3357.944) [-3362.535] -- 0:07:41 100000 -- [-3355.369] (-3362.504) (-3360.269) (-3363.684) * (-3359.059) (-3361.456) (-3359.331) [-3357.996] -- 0:07:47 Average standard deviation of split frequencies: 0.025495 100500 -- (-3358.004) (-3360.686) [-3358.474] (-3364.418) * (-3362.985) [-3357.349] (-3361.491) (-3361.236) -- 0:07:45 101000 -- (-3367.958) [-3358.952] (-3363.558) (-3363.387) * [-3355.242] (-3359.744) (-3364.345) (-3365.469) -- 0:07:42 101500 -- (-3362.622) (-3374.568) [-3366.566] (-3374.522) * (-3357.525) (-3362.189) (-3368.463) [-3363.312] -- 0:07:40 102000 -- (-3367.244) (-3363.593) [-3351.681] (-3365.396) * (-3362.584) [-3351.759] (-3376.789) (-3362.674) -- 0:07:46 102500 -- (-3362.353) [-3361.387] (-3359.652) (-3361.234) * (-3361.729) [-3356.746] (-3358.615) (-3362.898) -- 0:07:44 103000 -- [-3358.750] (-3364.836) (-3361.699) (-3368.635) * (-3369.694) (-3364.188) (-3366.557) [-3356.401] -- 0:07:41 103500 -- [-3359.331] (-3363.970) (-3368.130) (-3364.286) * (-3373.454) (-3353.206) [-3357.346] (-3363.395) -- 0:07:39 104000 -- [-3353.617] (-3370.089) (-3361.228) (-3362.913) * (-3359.717) [-3355.930] (-3366.273) (-3373.929) -- 0:07:45 104500 -- [-3354.063] (-3363.899) (-3355.898) (-3364.133) * (-3367.459) (-3366.836) [-3361.526] (-3373.953) -- 0:07:42 105000 -- [-3353.808] (-3361.273) (-3363.024) (-3356.952) * (-3362.278) (-3363.543) (-3355.912) [-3360.100] -- 0:07:40 Average standard deviation of split frequencies: 0.022730 105500 -- [-3352.847] (-3364.026) (-3365.043) (-3361.662) * (-3352.480) [-3361.293] (-3361.134) (-3375.141) -- 0:07:46 106000 -- [-3363.235] (-3360.126) (-3354.141) (-3362.427) * (-3361.812) (-3376.588) (-3356.681) [-3353.773] -- 0:07:43 106500 -- [-3362.114] (-3367.550) (-3358.903) (-3359.794) * (-3356.408) (-3375.994) [-3351.690] (-3364.794) -- 0:07:41 107000 -- [-3357.568] (-3369.112) (-3355.538) (-3358.256) * (-3361.843) [-3367.298] (-3360.541) (-3361.266) -- 0:07:39 107500 -- (-3361.611) [-3356.290] (-3358.690) (-3367.278) * (-3358.559) (-3364.943) [-3357.440] (-3357.587) -- 0:07:44 108000 -- [-3353.627] (-3362.893) (-3355.415) (-3371.054) * (-3366.588) (-3363.131) (-3356.003) [-3359.665] -- 0:07:42 108500 -- (-3356.611) [-3355.032] (-3364.397) (-3368.314) * (-3358.622) (-3364.609) (-3355.952) [-3368.496] -- 0:07:40 109000 -- (-3355.685) [-3353.325] (-3363.652) (-3365.221) * (-3370.580) [-3366.816] (-3359.955) (-3364.490) -- 0:07:37 109500 -- (-3371.762) [-3363.502] (-3356.573) (-3375.424) * (-3375.542) (-3360.094) (-3358.315) [-3360.264] -- 0:07:43 110000 -- (-3363.715) (-3355.313) [-3358.355] (-3365.163) * (-3374.907) (-3372.364) [-3360.345] (-3361.587) -- 0:07:41 Average standard deviation of split frequencies: 0.025085 110500 -- (-3361.922) (-3365.801) [-3354.630] (-3359.686) * (-3364.668) (-3366.199) [-3353.025] (-3362.407) -- 0:07:38 111000 -- (-3362.783) (-3359.881) [-3353.903] (-3356.389) * (-3365.089) (-3361.525) [-3355.668] (-3363.349) -- 0:07:36 111500 -- (-3383.302) (-3363.846) [-3361.356] (-3364.730) * (-3372.926) (-3362.342) [-3355.328] (-3362.997) -- 0:07:42 112000 -- (-3363.981) (-3369.069) [-3367.297] (-3357.448) * (-3370.040) (-3362.292) (-3361.408) [-3366.416] -- 0:07:39 112500 -- (-3366.553) (-3369.071) (-3366.162) [-3365.898] * [-3358.473] (-3362.718) (-3362.442) (-3361.864) -- 0:07:37 113000 -- (-3364.131) (-3362.663) [-3364.632] (-3355.929) * (-3378.778) (-3365.170) [-3359.384] (-3366.689) -- 0:07:35 113500 -- (-3362.425) (-3361.969) [-3354.525] (-3358.008) * (-3360.594) (-3364.762) (-3365.901) [-3354.414] -- 0:07:40 114000 -- (-3368.938) [-3357.909] (-3362.758) (-3364.969) * (-3361.850) (-3365.854) (-3366.488) [-3359.412] -- 0:07:38 114500 -- (-3363.753) (-3360.420) (-3361.556) [-3369.817] * (-3366.437) (-3360.179) (-3364.673) [-3363.997] -- 0:07:36 115000 -- (-3357.966) (-3355.400) (-3355.529) [-3355.547] * (-3359.484) (-3368.674) [-3361.191] (-3362.243) -- 0:07:34 Average standard deviation of split frequencies: 0.022125 115500 -- (-3363.967) (-3362.457) (-3363.509) [-3356.858] * (-3358.899) [-3367.781] (-3357.812) (-3364.892) -- 0:07:39 116000 -- (-3360.728) (-3365.127) (-3365.649) [-3360.979] * (-3359.774) [-3357.900] (-3356.676) (-3370.486) -- 0:07:37 116500 -- (-3360.801) [-3366.822] (-3354.216) (-3358.114) * (-3355.903) [-3362.692] (-3361.708) (-3361.093) -- 0:07:35 117000 -- (-3359.055) (-3359.696) (-3364.599) [-3357.608] * [-3359.753] (-3369.129) (-3359.673) (-3356.126) -- 0:07:32 117500 -- (-3369.649) (-3361.995) [-3369.160] (-3361.131) * (-3365.187) [-3357.383] (-3366.426) (-3356.396) -- 0:07:38 118000 -- (-3357.389) [-3356.714] (-3364.991) (-3358.751) * (-3366.471) [-3360.573] (-3363.582) (-3358.249) -- 0:07:35 118500 -- (-3358.912) (-3359.225) [-3358.923] (-3359.891) * (-3366.199) (-3365.780) [-3355.488] (-3361.277) -- 0:07:33 119000 -- (-3358.296) [-3352.245] (-3358.838) (-3364.163) * (-3363.991) (-3363.398) [-3357.637] (-3365.742) -- 0:07:31 119500 -- (-3357.210) (-3355.691) (-3362.419) [-3364.001] * (-3367.480) [-3362.760] (-3365.402) (-3364.336) -- 0:07:36 120000 -- (-3362.144) [-3358.133] (-3371.495) (-3364.411) * (-3364.314) [-3359.612] (-3356.957) (-3357.743) -- 0:07:34 Average standard deviation of split frequencies: 0.023440 120500 -- (-3358.268) (-3358.793) (-3362.961) [-3363.140] * (-3368.858) [-3367.680] (-3359.194) (-3360.134) -- 0:07:32 121000 -- (-3364.766) (-3360.907) (-3365.939) [-3360.933] * (-3358.384) [-3368.529] (-3375.069) (-3363.894) -- 0:07:30 121500 -- (-3365.865) (-3359.375) [-3355.516] (-3360.753) * [-3363.454] (-3357.511) (-3361.223) (-3358.810) -- 0:07:35 122000 -- [-3360.596] (-3373.914) (-3359.662) (-3354.919) * (-3362.829) (-3364.528) (-3360.344) [-3364.667] -- 0:07:33 122500 -- (-3368.617) (-3359.408) [-3361.755] (-3359.142) * (-3365.596) [-3361.706] (-3363.285) (-3359.418) -- 0:07:31 123000 -- [-3355.654] (-3357.471) (-3359.691) (-3362.053) * (-3358.540) [-3362.736] (-3364.151) (-3360.762) -- 0:07:29 123500 -- (-3358.506) (-3365.789) [-3353.448] (-3364.107) * [-3361.910] (-3360.818) (-3357.594) (-3361.679) -- 0:07:34 124000 -- (-3365.787) (-3367.270) (-3361.030) [-3363.644] * (-3355.068) [-3354.330] (-3358.938) (-3360.382) -- 0:07:32 124500 -- (-3361.031) (-3365.014) [-3354.670] (-3354.977) * (-3357.876) [-3357.180] (-3354.097) (-3361.974) -- 0:07:30 125000 -- [-3358.283] (-3366.351) (-3366.634) (-3362.938) * (-3358.333) (-3364.634) [-3361.224] (-3370.321) -- 0:07:34 Average standard deviation of split frequencies: 0.019538 125500 -- (-3358.962) [-3360.310] (-3355.613) (-3364.211) * (-3353.550) (-3365.238) (-3364.033) [-3364.707] -- 0:07:32 126000 -- (-3354.620) (-3356.527) [-3357.404] (-3358.210) * [-3359.182] (-3367.832) (-3359.282) (-3355.708) -- 0:07:30 126500 -- [-3353.415] (-3360.363) (-3365.343) (-3375.044) * (-3368.547) (-3363.055) (-3357.369) [-3358.075] -- 0:07:28 127000 -- [-3360.752] (-3357.015) (-3367.309) (-3370.773) * (-3364.878) [-3361.216] (-3362.378) (-3365.715) -- 0:07:33 127500 -- [-3354.637] (-3355.206) (-3367.392) (-3373.528) * (-3373.145) (-3358.525) [-3360.965] (-3364.712) -- 0:07:31 128000 -- (-3362.640) (-3363.635) [-3356.884] (-3361.828) * (-3367.386) (-3358.594) (-3373.095) [-3356.137] -- 0:07:29 128500 -- [-3360.875] (-3356.492) (-3358.111) (-3365.178) * (-3359.667) (-3362.098) (-3363.393) [-3357.011] -- 0:07:27 129000 -- [-3352.690] (-3367.076) (-3369.211) (-3356.103) * (-3359.038) [-3357.763] (-3365.145) (-3361.698) -- 0:07:32 129500 -- (-3358.551) (-3356.973) [-3358.678] (-3369.104) * [-3356.837] (-3365.773) (-3362.659) (-3368.097) -- 0:07:30 130000 -- (-3368.216) [-3363.581] (-3361.633) (-3361.786) * (-3362.383) (-3359.532) (-3366.132) [-3356.295] -- 0:07:28 Average standard deviation of split frequencies: 0.018439 130500 -- (-3370.829) (-3356.481) [-3363.642] (-3365.549) * (-3363.938) (-3353.179) [-3361.597] (-3361.784) -- 0:07:26 131000 -- [-3360.013] (-3362.504) (-3360.126) (-3361.783) * (-3368.820) (-3359.752) (-3363.164) [-3356.529] -- 0:07:31 131500 -- [-3359.124] (-3357.086) (-3366.555) (-3360.644) * [-3362.093] (-3363.882) (-3361.178) (-3362.439) -- 0:07:29 132000 -- [-3355.323] (-3363.854) (-3362.616) (-3370.279) * (-3357.806) (-3360.640) (-3361.671) [-3355.037] -- 0:07:27 132500 -- (-3363.374) (-3362.163) [-3356.257] (-3367.064) * (-3361.651) (-3365.485) (-3359.842) [-3354.112] -- 0:07:25 133000 -- (-3361.049) [-3359.218] (-3361.043) (-3357.280) * (-3360.641) (-3360.710) [-3359.958] (-3352.060) -- 0:07:29 133500 -- (-3370.941) [-3358.499] (-3363.625) (-3365.932) * (-3364.277) (-3362.871) (-3354.326) [-3364.621] -- 0:07:27 134000 -- [-3360.255] (-3357.967) (-3359.968) (-3355.440) * (-3364.920) [-3365.470] (-3360.309) (-3361.367) -- 0:07:25 134500 -- [-3357.629] (-3366.910) (-3352.631) (-3369.423) * (-3362.437) [-3356.412] (-3366.896) (-3375.946) -- 0:07:24 135000 -- (-3363.480) [-3356.336] (-3356.933) (-3377.774) * [-3357.028] (-3354.232) (-3364.142) (-3366.084) -- 0:07:28 Average standard deviation of split frequencies: 0.017716 135500 -- (-3358.902) [-3352.224] (-3358.939) (-3361.407) * (-3355.586) (-3357.141) [-3359.606] (-3358.478) -- 0:07:26 136000 -- [-3356.406] (-3358.636) (-3354.297) (-3366.081) * [-3357.667] (-3367.955) (-3361.138) (-3359.360) -- 0:07:24 136500 -- (-3364.679) (-3362.504) [-3356.117] (-3362.736) * (-3356.103) [-3364.748] (-3357.426) (-3360.838) -- 0:07:22 137000 -- (-3362.951) (-3364.149) [-3361.457] (-3353.913) * (-3357.217) (-3367.132) (-3374.537) [-3355.080] -- 0:07:27 137500 -- (-3360.279) (-3362.178) [-3361.883] (-3356.589) * [-3360.672] (-3359.811) (-3362.972) (-3356.660) -- 0:07:25 138000 -- (-3356.734) (-3355.197) [-3357.503] (-3358.373) * [-3358.059] (-3357.349) (-3360.882) (-3365.516) -- 0:07:23 138500 -- [-3367.596] (-3372.535) (-3362.287) (-3357.600) * (-3360.600) [-3365.677] (-3368.762) (-3364.497) -- 0:07:21 139000 -- (-3362.014) (-3362.119) (-3367.868) [-3355.871] * [-3359.363] (-3357.420) (-3368.610) (-3368.348) -- 0:07:25 139500 -- (-3363.432) (-3362.080) (-3367.716) [-3367.422] * (-3363.523) (-3362.800) (-3365.401) [-3360.289] -- 0:07:24 140000 -- [-3358.579] (-3366.417) (-3358.765) (-3367.113) * (-3356.364) [-3357.457] (-3370.382) (-3357.024) -- 0:07:22 Average standard deviation of split frequencies: 0.016384 140500 -- [-3361.097] (-3358.895) (-3356.669) (-3371.801) * [-3359.659] (-3358.285) (-3371.108) (-3358.796) -- 0:07:20 141000 -- (-3365.523) (-3359.706) [-3353.613] (-3361.143) * (-3369.502) [-3356.220] (-3365.709) (-3373.186) -- 0:07:24 141500 -- (-3360.294) [-3358.836] (-3358.185) (-3368.025) * (-3364.276) (-3355.658) (-3354.286) [-3358.552] -- 0:07:22 142000 -- (-3369.352) (-3367.035) [-3357.012] (-3366.777) * [-3358.087] (-3362.497) (-3365.815) (-3359.014) -- 0:07:21 142500 -- (-3360.937) (-3365.387) [-3355.799] (-3368.892) * (-3359.441) (-3358.459) (-3365.210) [-3356.033] -- 0:07:19 143000 -- (-3376.556) (-3357.397) [-3357.807] (-3364.207) * [-3355.057] (-3362.657) (-3359.465) (-3361.276) -- 0:07:23 143500 -- [-3368.630] (-3363.619) (-3352.784) (-3360.017) * (-3364.886) [-3352.400] (-3359.481) (-3359.812) -- 0:07:21 144000 -- (-3359.798) (-3360.235) [-3359.862] (-3355.136) * (-3362.441) [-3357.097] (-3369.023) (-3367.407) -- 0:07:19 144500 -- [-3357.979] (-3363.985) (-3353.701) (-3357.571) * (-3359.300) (-3363.929) (-3355.651) [-3364.979] -- 0:07:24 145000 -- [-3362.106] (-3358.013) (-3352.763) (-3357.072) * (-3358.006) (-3363.254) [-3356.242] (-3371.034) -- 0:07:22 Average standard deviation of split frequencies: 0.013274 145500 -- [-3357.443] (-3368.640) (-3356.270) (-3359.103) * (-3352.914) (-3368.197) (-3370.766) [-3361.969] -- 0:07:20 146000 -- (-3355.936) (-3377.838) [-3355.932] (-3367.818) * (-3362.978) (-3373.330) [-3355.535] (-3356.795) -- 0:07:18 146500 -- (-3365.137) [-3363.815] (-3350.246) (-3362.704) * (-3366.888) (-3358.437) [-3359.733] (-3363.054) -- 0:07:22 147000 -- (-3361.420) (-3362.868) (-3360.955) [-3367.946] * (-3367.429) [-3362.219] (-3357.753) (-3368.749) -- 0:07:21 147500 -- [-3352.527] (-3363.805) (-3357.162) (-3365.897) * (-3363.451) [-3362.260] (-3354.338) (-3370.555) -- 0:07:19 148000 -- (-3360.374) [-3358.615] (-3353.939) (-3361.090) * [-3365.331] (-3360.723) (-3361.954) (-3363.602) -- 0:07:17 148500 -- [-3355.868] (-3363.767) (-3358.278) (-3359.819) * (-3362.302) [-3353.541] (-3359.480) (-3367.695) -- 0:07:21 149000 -- (-3364.108) (-3362.393) (-3362.360) [-3354.330] * (-3362.019) [-3355.763] (-3357.774) (-3357.618) -- 0:07:19 149500 -- (-3365.130) [-3356.542] (-3363.590) (-3367.753) * (-3358.714) [-3355.842] (-3357.517) (-3360.284) -- 0:07:18 150000 -- [-3358.100] (-3360.950) (-3368.276) (-3379.842) * (-3360.553) (-3355.039) [-3357.440] (-3359.096) -- 0:07:16 Average standard deviation of split frequencies: 0.012863 150500 -- (-3358.098) (-3356.752) (-3366.931) [-3356.992] * (-3358.188) (-3353.501) [-3361.083] (-3355.189) -- 0:07:20 151000 -- (-3364.653) (-3359.152) (-3368.448) [-3354.165] * [-3359.853] (-3361.732) (-3355.975) (-3360.570) -- 0:07:18 151500 -- [-3356.406] (-3357.620) (-3365.327) (-3370.398) * (-3361.196) (-3362.411) [-3356.243] (-3365.165) -- 0:07:16 152000 -- (-3367.851) [-3355.483] (-3356.184) (-3366.043) * [-3358.613] (-3359.805) (-3363.408) (-3365.200) -- 0:07:15 152500 -- (-3361.692) (-3358.920) (-3351.616) [-3360.288] * [-3358.466] (-3358.921) (-3367.998) (-3367.250) -- 0:07:19 153000 -- [-3353.822] (-3359.947) (-3368.683) (-3370.692) * (-3360.977) (-3370.207) (-3367.131) [-3356.982] -- 0:07:17 153500 -- (-3366.953) [-3366.623] (-3370.030) (-3371.186) * (-3361.475) [-3357.950] (-3366.326) (-3354.069) -- 0:07:15 154000 -- (-3354.915) [-3360.788] (-3371.758) (-3364.009) * [-3360.362] (-3357.774) (-3367.613) (-3368.645) -- 0:07:13 154500 -- (-3364.434) [-3359.153] (-3369.628) (-3368.295) * (-3357.751) (-3359.869) [-3358.655] (-3357.137) -- 0:07:17 155000 -- (-3363.015) [-3357.567] (-3359.639) (-3364.657) * [-3356.594] (-3371.031) (-3355.760) (-3358.998) -- 0:07:16 Average standard deviation of split frequencies: 0.013766 155500 -- (-3363.434) [-3363.426] (-3356.578) (-3356.438) * [-3361.286] (-3355.699) (-3364.152) (-3357.672) -- 0:07:14 156000 -- (-3365.243) (-3361.525) [-3354.702] (-3361.498) * (-3359.031) [-3358.204] (-3356.341) (-3364.021) -- 0:07:12 156500 -- (-3370.969) (-3356.678) (-3359.483) [-3357.909] * (-3358.907) [-3363.186] (-3368.086) (-3362.593) -- 0:07:16 157000 -- (-3367.434) (-3359.534) [-3364.657] (-3355.757) * (-3361.915) [-3358.595] (-3366.648) (-3363.635) -- 0:07:14 157500 -- [-3362.419] (-3353.279) (-3354.092) (-3364.976) * (-3366.753) (-3360.945) (-3365.559) [-3353.519] -- 0:07:13 158000 -- (-3363.153) [-3359.088] (-3376.971) (-3364.159) * (-3369.865) [-3358.706] (-3361.371) (-3368.443) -- 0:07:11 158500 -- [-3364.283] (-3361.201) (-3366.409) (-3359.871) * (-3371.063) [-3351.785] (-3365.606) (-3368.599) -- 0:07:15 159000 -- [-3351.584] (-3356.508) (-3367.304) (-3360.841) * (-3374.289) (-3356.957) [-3352.918] (-3375.528) -- 0:07:13 159500 -- (-3354.105) (-3360.753) (-3367.109) [-3361.883] * (-3360.930) (-3364.300) [-3356.464] (-3368.942) -- 0:07:12 160000 -- (-3359.172) (-3361.575) (-3367.297) [-3361.447] * (-3355.013) [-3358.754] (-3370.788) (-3364.371) -- 0:07:10 Average standard deviation of split frequencies: 0.012714 160500 -- [-3357.811] (-3363.988) (-3360.323) (-3362.062) * (-3356.272) (-3356.491) [-3352.975] (-3366.464) -- 0:07:14 161000 -- (-3356.326) (-3358.395) [-3354.905] (-3355.920) * (-3359.657) [-3356.175] (-3358.987) (-3371.428) -- 0:07:12 161500 -- (-3363.938) (-3365.942) (-3370.294) [-3362.418] * (-3361.999) [-3369.303] (-3356.074) (-3363.396) -- 0:07:10 162000 -- (-3361.232) (-3365.398) [-3359.979] (-3359.699) * (-3360.133) (-3352.489) [-3361.954] (-3367.022) -- 0:07:09 162500 -- (-3357.757) [-3352.805] (-3363.370) (-3359.696) * (-3359.011) (-3357.456) [-3360.378] (-3373.116) -- 0:07:12 163000 -- [-3365.198] (-3360.158) (-3366.318) (-3360.987) * (-3367.895) [-3359.291] (-3360.290) (-3358.166) -- 0:07:11 163500 -- [-3356.537] (-3362.733) (-3362.539) (-3360.940) * (-3368.257) (-3362.334) (-3363.245) [-3355.095] -- 0:07:09 164000 -- [-3349.872] (-3375.790) (-3352.084) (-3365.109) * (-3377.087) (-3358.246) [-3360.923] (-3356.345) -- 0:07:08 164500 -- [-3358.426] (-3367.347) (-3361.274) (-3368.490) * [-3367.474] (-3359.743) (-3353.494) (-3359.818) -- 0:07:11 165000 -- [-3362.606] (-3360.269) (-3358.867) (-3365.517) * (-3368.014) [-3355.830] (-3359.537) (-3366.485) -- 0:07:10 Average standard deviation of split frequencies: 0.015461 165500 -- (-3358.842) [-3358.804] (-3365.136) (-3364.660) * (-3362.759) (-3365.975) (-3356.007) [-3354.947] -- 0:07:08 166000 -- (-3363.713) (-3359.034) [-3357.943] (-3362.558) * (-3358.987) (-3369.507) (-3354.627) [-3357.112] -- 0:07:12 166500 -- (-3358.758) (-3356.806) [-3358.343] (-3359.760) * [-3359.753] (-3359.659) (-3361.190) (-3357.522) -- 0:07:10 167000 -- (-3365.352) [-3357.338] (-3360.441) (-3356.039) * (-3369.502) (-3356.833) [-3363.624] (-3364.036) -- 0:07:08 167500 -- [-3356.976] (-3369.250) (-3368.125) (-3359.608) * (-3374.069) (-3361.829) (-3359.441) [-3352.854] -- 0:07:07 168000 -- [-3361.219] (-3362.489) (-3361.925) (-3368.776) * (-3358.046) (-3366.001) [-3361.173] (-3361.893) -- 0:07:10 168500 -- (-3357.275) (-3362.550) (-3360.168) [-3355.769] * (-3366.678) (-3361.143) (-3364.042) [-3367.388] -- 0:07:09 169000 -- (-3355.372) (-3364.664) [-3364.493] (-3370.036) * (-3367.283) (-3359.497) [-3358.820] (-3363.072) -- 0:07:07 169500 -- (-3354.344) (-3375.432) [-3362.617] (-3359.170) * [-3359.766] (-3361.036) (-3359.576) (-3361.687) -- 0:07:06 170000 -- (-3358.620) (-3367.115) [-3355.662] (-3355.337) * (-3374.710) (-3356.461) [-3363.172] (-3361.016) -- 0:07:09 Average standard deviation of split frequencies: 0.013504 170500 -- (-3363.340) [-3362.345] (-3353.901) (-3364.279) * (-3357.808) (-3362.502) [-3356.739] (-3364.957) -- 0:07:08 171000 -- [-3362.645] (-3357.416) (-3356.154) (-3365.477) * (-3352.058) [-3359.919] (-3363.605) (-3359.877) -- 0:07:06 171500 -- (-3358.645) (-3360.608) (-3360.708) [-3364.012] * (-3361.417) (-3367.646) [-3360.265] (-3364.145) -- 0:07:05 172000 -- [-3355.479] (-3364.668) (-3362.022) (-3354.834) * (-3366.088) [-3354.635] (-3364.965) (-3359.122) -- 0:07:08 172500 -- (-3370.696) (-3359.468) [-3359.588] (-3365.535) * (-3367.138) (-3355.979) (-3367.092) [-3365.226] -- 0:07:06 173000 -- (-3367.334) [-3358.096] (-3367.132) (-3360.041) * (-3359.519) [-3358.897] (-3355.631) (-3361.252) -- 0:07:05 173500 -- (-3366.526) (-3363.360) [-3356.903] (-3355.983) * (-3361.587) [-3358.711] (-3369.591) (-3366.118) -- 0:07:03 174000 -- [-3359.115] (-3357.495) (-3358.965) (-3360.982) * [-3360.172] (-3356.986) (-3363.561) (-3360.171) -- 0:07:07 174500 -- (-3355.769) (-3361.242) [-3355.210] (-3366.354) * (-3354.976) [-3353.548] (-3359.117) (-3362.227) -- 0:07:05 175000 -- (-3353.273) [-3359.412] (-3357.204) (-3358.639) * (-3352.239) (-3354.191) (-3357.153) [-3357.138] -- 0:07:04 Average standard deviation of split frequencies: 0.013690 175500 -- (-3362.418) (-3357.472) [-3358.831] (-3365.329) * (-3366.244) (-3358.585) (-3358.574) [-3365.013] -- 0:07:02 176000 -- (-3373.554) [-3362.869] (-3360.810) (-3361.447) * (-3366.333) (-3353.677) (-3363.706) [-3354.681] -- 0:07:06 176500 -- (-3363.642) (-3356.292) [-3358.873] (-3361.042) * (-3370.758) (-3361.197) (-3366.740) [-3352.137] -- 0:07:04 177000 -- (-3366.056) (-3354.294) [-3358.989] (-3357.447) * (-3363.483) (-3367.432) (-3360.213) [-3359.937] -- 0:07:03 177500 -- (-3364.889) (-3359.459) [-3353.277] (-3357.730) * (-3366.414) (-3367.892) [-3355.307] (-3366.075) -- 0:07:01 178000 -- (-3366.713) (-3369.928) (-3363.541) [-3359.396] * (-3362.479) (-3361.866) [-3355.127] (-3363.626) -- 0:07:04 178500 -- (-3361.005) (-3360.334) (-3358.004) [-3361.619] * (-3358.891) [-3359.579] (-3362.201) (-3361.205) -- 0:07:03 179000 -- (-3355.308) (-3355.499) (-3355.933) [-3355.608] * (-3377.128) [-3357.866] (-3361.095) (-3362.333) -- 0:07:01 179500 -- (-3366.732) (-3360.428) [-3360.033] (-3363.533) * (-3369.023) (-3371.147) [-3362.347] (-3357.234) -- 0:07:00 180000 -- (-3362.512) (-3366.069) (-3354.550) [-3350.256] * [-3351.987] (-3374.947) (-3356.264) (-3363.034) -- 0:07:03 Average standard deviation of split frequencies: 0.012177 180500 -- (-3366.336) [-3364.653] (-3358.926) (-3361.031) * (-3354.076) (-3361.201) (-3356.283) [-3358.701] -- 0:07:02 181000 -- (-3365.556) [-3353.489] (-3354.416) (-3362.526) * (-3365.481) [-3357.249] (-3367.126) (-3364.122) -- 0:07:00 181500 -- (-3359.895) (-3360.348) [-3356.033] (-3363.549) * (-3365.751) (-3359.979) [-3363.495] (-3367.091) -- 0:06:59 182000 -- [-3356.683] (-3365.030) (-3363.422) (-3369.597) * (-3369.567) (-3355.151) (-3362.272) [-3365.178] -- 0:07:02 182500 -- (-3359.452) (-3357.468) [-3365.313] (-3361.555) * (-3358.143) (-3358.302) (-3370.681) [-3353.866] -- 0:07:01 183000 -- (-3366.203) [-3354.846] (-3352.534) (-3364.347) * [-3361.037] (-3364.353) (-3366.183) (-3368.985) -- 0:06:59 183500 -- (-3360.655) (-3372.402) [-3352.265] (-3360.592) * [-3365.856] (-3370.931) (-3367.628) (-3369.129) -- 0:06:58 184000 -- (-3358.539) (-3367.984) (-3361.103) [-3367.808] * [-3352.071] (-3364.998) (-3366.794) (-3371.717) -- 0:07:01 184500 -- (-3372.210) [-3361.436] (-3354.752) (-3355.900) * [-3362.488] (-3358.864) (-3367.654) (-3358.228) -- 0:06:59 185000 -- [-3356.463] (-3358.959) (-3357.396) (-3358.219) * (-3364.066) [-3363.288] (-3365.102) (-3367.736) -- 0:06:58 Average standard deviation of split frequencies: 0.014080 185500 -- (-3361.468) (-3366.328) [-3353.167] (-3357.514) * [-3359.792] (-3359.813) (-3360.924) (-3355.454) -- 0:06:57 186000 -- [-3363.252] (-3365.475) (-3358.335) (-3358.718) * (-3360.824) [-3363.013] (-3367.018) (-3368.929) -- 0:07:00 186500 -- (-3368.542) (-3359.131) [-3353.462] (-3360.536) * (-3360.754) [-3360.514] (-3363.173) (-3367.464) -- 0:06:58 187000 -- [-3355.675] (-3355.127) (-3359.238) (-3365.705) * (-3365.934) [-3370.398] (-3366.555) (-3369.342) -- 0:06:57 187500 -- (-3366.455) [-3363.559] (-3366.526) (-3371.626) * (-3368.714) (-3365.538) [-3358.208] (-3363.778) -- 0:06:56 188000 -- (-3361.626) (-3364.911) [-3363.200] (-3356.730) * (-3361.366) (-3359.195) (-3364.556) [-3358.338] -- 0:06:58 188500 -- (-3365.664) (-3359.672) [-3361.985] (-3368.648) * (-3364.222) (-3361.366) (-3359.888) [-3360.917] -- 0:06:57 189000 -- (-3360.830) (-3360.860) [-3364.106] (-3360.021) * (-3359.247) [-3360.647] (-3356.838) (-3361.969) -- 0:06:56 189500 -- [-3351.664] (-3359.989) (-3364.059) (-3358.276) * (-3360.130) (-3368.484) [-3357.458] (-3363.528) -- 0:06:54 190000 -- (-3363.289) (-3355.974) (-3357.925) [-3357.660] * [-3355.186] (-3365.560) (-3357.982) (-3371.483) -- 0:06:57 Average standard deviation of split frequencies: 0.013736 190500 -- [-3361.091] (-3362.749) (-3361.313) (-3365.262) * (-3355.246) [-3359.130] (-3359.480) (-3363.702) -- 0:06:56 191000 -- [-3355.302] (-3371.614) (-3360.538) (-3358.515) * (-3363.446) [-3349.671] (-3355.461) (-3360.841) -- 0:06:55 191500 -- (-3367.642) (-3360.306) (-3362.995) [-3355.393] * [-3358.678] (-3356.835) (-3373.077) (-3361.670) -- 0:06:57 192000 -- (-3373.187) (-3361.156) [-3360.018] (-3363.687) * [-3356.199] (-3355.553) (-3368.286) (-3370.520) -- 0:06:56 192500 -- (-3362.813) [-3364.778] (-3372.763) (-3362.810) * (-3369.048) [-3354.789] (-3363.562) (-3362.262) -- 0:06:55 193000 -- (-3360.995) [-3351.888] (-3357.885) (-3357.269) * (-3364.919) (-3368.080) [-3360.901] (-3357.982) -- 0:06:53 193500 -- [-3356.335] (-3352.793) (-3370.311) (-3363.733) * (-3360.272) (-3360.241) [-3360.687] (-3361.338) -- 0:06:56 194000 -- (-3360.468) (-3359.170) [-3358.826] (-3360.506) * (-3364.796) (-3364.116) (-3359.142) [-3356.764] -- 0:06:55 194500 -- (-3367.294) [-3351.292] (-3364.723) (-3363.783) * (-3363.938) (-3365.543) [-3352.167] (-3353.678) -- 0:06:54 195000 -- (-3367.077) (-3362.519) (-3370.865) [-3360.281] * (-3373.316) (-3358.027) [-3355.684] (-3359.342) -- 0:06:52 Average standard deviation of split frequencies: 0.013629 195500 -- (-3355.584) (-3362.776) (-3360.424) [-3361.918] * (-3367.287) (-3370.473) [-3357.543] (-3357.704) -- 0:06:55 196000 -- [-3355.950] (-3366.273) (-3360.443) (-3361.422) * (-3358.711) [-3361.850] (-3362.318) (-3352.270) -- 0:06:54 196500 -- (-3369.186) (-3356.663) [-3360.538] (-3375.719) * (-3365.427) [-3362.158] (-3356.480) (-3366.561) -- 0:06:52 197000 -- (-3357.338) [-3362.171] (-3361.166) (-3382.840) * (-3362.374) [-3363.959] (-3359.233) (-3363.927) -- 0:06:51 197500 -- (-3361.533) [-3360.125] (-3362.392) (-3376.316) * (-3358.027) (-3366.538) [-3359.320] (-3368.167) -- 0:06:54 198000 -- (-3369.797) (-3363.506) [-3361.018] (-3359.705) * (-3354.812) (-3350.016) [-3351.832] (-3365.339) -- 0:06:53 198500 -- (-3371.545) [-3356.450] (-3360.289) (-3365.362) * (-3369.828) (-3362.779) [-3355.098] (-3367.883) -- 0:06:51 199000 -- [-3358.892] (-3351.551) (-3362.081) (-3356.379) * (-3359.384) [-3359.503] (-3360.600) (-3356.103) -- 0:06:50 199500 -- (-3363.208) [-3362.478] (-3367.232) (-3356.135) * (-3366.425) (-3369.305) [-3364.225] (-3359.939) -- 0:06:53 200000 -- (-3362.476) (-3364.408) (-3368.114) [-3356.961] * (-3359.500) (-3368.933) (-3358.015) [-3354.009] -- 0:06:52 Average standard deviation of split frequencies: 0.011746 200500 -- (-3370.975) (-3357.042) [-3361.733] (-3363.695) * (-3362.763) (-3363.461) (-3364.550) [-3360.852] -- 0:06:50 201000 -- (-3365.126) (-3358.477) (-3364.112) [-3362.861] * (-3356.652) [-3360.248] (-3358.451) (-3350.756) -- 0:06:49 201500 -- (-3361.248) (-3367.417) (-3364.002) [-3363.625] * [-3353.522] (-3362.095) (-3359.183) (-3360.396) -- 0:06:52 202000 -- (-3356.523) [-3355.787] (-3358.545) (-3361.778) * [-3359.785] (-3357.288) (-3370.761) (-3359.583) -- 0:06:50 202500 -- (-3364.188) (-3352.828) [-3355.444] (-3353.644) * (-3362.401) (-3354.305) (-3363.159) [-3358.535] -- 0:06:49 203000 -- (-3364.927) (-3361.428) (-3353.059) [-3361.462] * (-3360.127) [-3358.414] (-3364.105) (-3371.236) -- 0:06:48 203500 -- [-3366.607] (-3372.582) (-3357.039) (-3359.181) * (-3353.370) (-3358.514) (-3366.875) [-3355.893] -- 0:06:50 204000 -- [-3370.158] (-3358.912) (-3357.129) (-3365.412) * (-3356.296) (-3364.946) (-3358.506) [-3356.310] -- 0:06:49 204500 -- (-3359.916) [-3358.433] (-3365.281) (-3365.349) * [-3359.182] (-3362.067) (-3356.056) (-3357.958) -- 0:06:48 205000 -- (-3360.781) (-3363.299) (-3362.921) [-3356.894] * (-3357.088) [-3362.230] (-3353.518) (-3362.769) -- 0:06:47 Average standard deviation of split frequencies: 0.011696 205500 -- (-3356.302) (-3360.780) [-3362.581] (-3357.634) * (-3359.273) (-3357.950) (-3358.878) [-3362.033] -- 0:06:49 206000 -- (-3361.771) (-3359.262) [-3353.020] (-3361.149) * [-3355.683] (-3366.656) (-3360.219) (-3355.471) -- 0:06:48 206500 -- (-3352.795) (-3357.737) [-3359.478] (-3359.381) * (-3356.786) (-3361.967) [-3353.738] (-3359.693) -- 0:06:47 207000 -- (-3352.784) (-3357.133) [-3360.703] (-3365.942) * [-3356.961] (-3357.380) (-3355.841) (-3359.900) -- 0:06:46 207500 -- (-3371.188) [-3356.728] (-3361.298) (-3366.150) * (-3361.980) (-3357.400) (-3368.794) [-3355.382] -- 0:06:48 208000 -- (-3359.628) (-3367.805) (-3362.467) [-3357.027] * (-3373.060) [-3361.556] (-3361.859) (-3359.408) -- 0:06:47 208500 -- (-3363.948) (-3367.560) [-3354.201] (-3359.300) * (-3366.467) (-3360.532) (-3376.307) [-3357.002] -- 0:06:46 209000 -- (-3353.740) (-3354.990) [-3358.374] (-3356.297) * (-3363.430) (-3362.962) (-3363.920) [-3358.182] -- 0:06:44 209500 -- [-3363.362] (-3357.297) (-3367.271) (-3359.707) * (-3360.015) [-3369.017] (-3362.855) (-3363.713) -- 0:06:47 210000 -- (-3361.606) (-3357.792) [-3364.127] (-3361.236) * (-3360.853) (-3357.607) (-3371.141) [-3355.169] -- 0:06:46 Average standard deviation of split frequencies: 0.011188 210500 -- (-3372.511) (-3360.757) (-3355.859) [-3361.015] * (-3359.143) (-3358.224) [-3363.600] (-3361.297) -- 0:06:45 211000 -- (-3355.201) (-3364.468) [-3359.044] (-3363.336) * (-3362.641) (-3355.408) (-3361.340) [-3359.001] -- 0:06:43 211500 -- (-3367.721) (-3354.895) (-3364.086) [-3359.048] * (-3361.763) (-3359.917) (-3370.041) [-3366.106] -- 0:06:46 212000 -- (-3365.604) [-3357.049] (-3352.111) (-3358.042) * (-3362.574) [-3360.908] (-3373.677) (-3354.821) -- 0:06:45 212500 -- (-3367.144) (-3357.296) [-3367.326] (-3355.699) * (-3358.709) (-3367.864) (-3360.767) [-3352.409] -- 0:06:43 213000 -- (-3358.448) (-3360.257) [-3364.222] (-3367.356) * (-3357.500) (-3367.838) [-3359.934] (-3359.942) -- 0:06:42 213500 -- (-3366.939) (-3358.208) [-3358.144] (-3358.538) * (-3359.133) [-3363.146] (-3361.676) (-3357.263) -- 0:06:45 214000 -- (-3358.910) [-3360.330] (-3365.913) (-3359.655) * (-3360.948) (-3369.778) [-3355.102] (-3360.210) -- 0:06:44 214500 -- [-3355.735] (-3366.500) (-3360.283) (-3368.444) * (-3362.288) [-3360.415] (-3362.951) (-3356.249) -- 0:06:42 215000 -- (-3363.670) (-3364.980) [-3357.180] (-3357.451) * (-3364.374) [-3358.181] (-3362.450) (-3361.664) -- 0:06:45 Average standard deviation of split frequencies: 0.011397 215500 -- [-3363.254] (-3361.274) (-3359.291) (-3355.410) * [-3355.221] (-3368.718) (-3363.002) (-3362.475) -- 0:06:44 216000 -- (-3357.620) (-3357.505) [-3365.630] (-3356.803) * [-3359.008] (-3358.221) (-3365.967) (-3352.324) -- 0:06:42 216500 -- (-3357.606) (-3363.041) (-3360.466) [-3364.259] * [-3361.678] (-3361.257) (-3356.495) (-3370.643) -- 0:06:41 217000 -- [-3355.463] (-3365.141) (-3357.502) (-3362.167) * (-3365.015) (-3364.494) (-3360.650) [-3356.254] -- 0:06:44 217500 -- (-3353.400) [-3359.009] (-3377.783) (-3362.136) * (-3361.058) (-3361.131) (-3363.107) [-3361.199] -- 0:06:42 218000 -- (-3358.011) [-3356.705] (-3366.751) (-3363.022) * (-3361.168) [-3366.678] (-3368.957) (-3364.425) -- 0:06:41 218500 -- [-3356.898] (-3359.676) (-3366.992) (-3369.030) * (-3363.733) (-3371.486) (-3366.043) [-3357.734] -- 0:06:40 219000 -- (-3365.122) [-3366.722] (-3362.540) (-3363.255) * (-3363.336) (-3355.696) (-3363.873) [-3356.976] -- 0:06:42 219500 -- (-3360.227) (-3359.251) (-3364.353) [-3360.897] * (-3363.827) (-3365.308) [-3355.783] (-3370.384) -- 0:06:41 220000 -- (-3368.462) [-3359.648] (-3362.376) (-3371.262) * (-3366.096) (-3360.863) [-3360.670] (-3360.500) -- 0:06:40 Average standard deviation of split frequencies: 0.011631 220500 -- (-3359.877) [-3355.252] (-3363.462) (-3373.381) * (-3369.732) [-3362.871] (-3363.690) (-3363.410) -- 0:06:39 221000 -- (-3361.193) (-3358.046) (-3367.348) [-3357.805] * (-3359.510) (-3364.449) [-3357.754] (-3356.777) -- 0:06:41 221500 -- (-3361.266) (-3359.191) [-3371.035] (-3357.491) * (-3370.951) (-3358.412) [-3360.451] (-3361.359) -- 0:06:40 222000 -- (-3358.542) [-3356.860] (-3359.382) (-3364.898) * (-3374.021) (-3362.308) [-3359.474] (-3358.476) -- 0:06:39 222500 -- [-3351.351] (-3363.897) (-3360.696) (-3370.539) * [-3359.167] (-3357.912) (-3375.141) (-3361.392) -- 0:06:38 223000 -- [-3352.933] (-3368.994) (-3371.046) (-3361.642) * [-3363.429] (-3358.654) (-3363.347) (-3354.439) -- 0:06:40 223500 -- (-3363.265) [-3356.686] (-3362.902) (-3362.847) * (-3368.677) [-3356.116] (-3361.849) (-3359.524) -- 0:06:39 224000 -- (-3360.443) [-3359.026] (-3355.654) (-3357.813) * (-3386.642) [-3361.982] (-3371.746) (-3355.655) -- 0:06:38 224500 -- [-3351.999] (-3355.984) (-3362.482) (-3364.084) * [-3354.421] (-3359.691) (-3371.804) (-3359.522) -- 0:06:37 225000 -- (-3367.420) [-3356.223] (-3359.483) (-3362.060) * (-3357.946) (-3356.614) (-3368.070) [-3365.065] -- 0:06:39 Average standard deviation of split frequencies: 0.011588 225500 -- (-3360.791) (-3363.279) [-3361.854] (-3356.126) * (-3357.974) [-3361.519] (-3356.220) (-3375.926) -- 0:06:38 226000 -- [-3358.191] (-3357.924) (-3362.997) (-3368.270) * (-3355.705) [-3361.285] (-3362.269) (-3360.808) -- 0:06:37 226500 -- (-3361.623) (-3355.924) [-3362.788] (-3361.991) * (-3361.775) (-3370.552) [-3357.292] (-3372.766) -- 0:06:36 227000 -- (-3368.268) [-3358.941] (-3356.124) (-3375.261) * (-3363.578) [-3364.538] (-3358.732) (-3366.726) -- 0:06:38 227500 -- [-3359.014] (-3357.065) (-3358.602) (-3360.769) * (-3376.320) (-3363.133) (-3369.396) [-3365.106] -- 0:06:37 228000 -- (-3361.297) [-3362.449] (-3375.333) (-3365.396) * (-3356.882) (-3359.080) (-3352.634) [-3362.747] -- 0:06:36 228500 -- (-3363.862) (-3358.821) (-3370.808) [-3369.607] * (-3360.752) (-3357.723) [-3361.373] (-3364.875) -- 0:06:35 229000 -- (-3365.089) (-3363.698) (-3366.168) [-3374.005] * (-3362.645) (-3358.957) [-3362.745] (-3366.262) -- 0:06:37 229500 -- [-3356.498] (-3353.802) (-3364.658) (-3360.430) * [-3358.394] (-3368.431) (-3366.683) (-3363.396) -- 0:06:36 230000 -- (-3356.929) (-3360.657) [-3363.574] (-3365.790) * (-3361.778) [-3354.974] (-3372.487) (-3361.442) -- 0:06:35 Average standard deviation of split frequencies: 0.009764 230500 -- (-3363.416) (-3373.408) (-3362.879) [-3362.960] * [-3357.834] (-3359.473) (-3370.838) (-3365.151) -- 0:06:33 231000 -- (-3362.261) (-3366.772) [-3361.272] (-3360.752) * (-3354.705) [-3362.633] (-3356.608) (-3362.371) -- 0:06:36 231500 -- (-3356.591) [-3371.513] (-3359.436) (-3374.744) * (-3358.910) (-3356.430) [-3357.851] (-3368.998) -- 0:06:35 232000 -- (-3354.168) (-3360.030) [-3360.104] (-3382.426) * (-3362.910) (-3360.309) [-3358.236] (-3364.400) -- 0:06:33 232500 -- (-3359.843) (-3358.604) (-3359.957) [-3358.811] * (-3363.945) [-3361.099] (-3361.753) (-3355.056) -- 0:06:32 233000 -- (-3363.523) (-3365.845) [-3355.473] (-3358.461) * (-3364.236) [-3357.288] (-3369.043) (-3364.375) -- 0:06:35 233500 -- [-3358.215] (-3357.887) (-3362.510) (-3363.414) * [-3356.722] (-3358.868) (-3366.592) (-3361.888) -- 0:06:33 234000 -- (-3365.497) [-3357.070] (-3364.137) (-3357.390) * (-3361.813) [-3362.112] (-3360.686) (-3360.318) -- 0:06:32 234500 -- (-3357.912) (-3362.544) [-3363.562] (-3367.347) * (-3358.727) [-3352.200] (-3361.974) (-3361.444) -- 0:06:31 235000 -- (-3364.797) (-3359.247) (-3366.569) [-3359.577] * (-3364.202) (-3351.797) (-3356.871) [-3356.883] -- 0:06:33 Average standard deviation of split frequencies: 0.009100 235500 -- (-3359.076) [-3357.589] (-3358.101) (-3357.061) * (-3362.221) (-3360.002) (-3361.963) [-3359.313] -- 0:06:32 236000 -- [-3355.119] (-3366.301) (-3359.430) (-3360.717) * (-3363.483) (-3357.865) [-3355.850] (-3360.770) -- 0:06:31 236500 -- [-3363.349] (-3369.556) (-3353.256) (-3355.168) * (-3362.242) [-3355.799] (-3365.121) (-3365.588) -- 0:06:30 237000 -- (-3364.890) (-3363.177) (-3355.595) [-3370.340] * (-3363.311) (-3359.314) [-3359.003] (-3353.832) -- 0:06:32 237500 -- (-3364.386) [-3360.799] (-3359.791) (-3361.262) * (-3367.236) [-3355.103] (-3365.924) (-3365.361) -- 0:06:31 238000 -- (-3356.982) (-3368.200) [-3361.908] (-3360.716) * [-3365.202] (-3360.850) (-3365.891) (-3367.084) -- 0:06:30 238500 -- (-3358.730) (-3361.332) (-3366.913) [-3360.636] * (-3371.617) [-3353.209] (-3360.549) (-3365.410) -- 0:06:29 239000 -- (-3366.893) (-3366.730) [-3358.465] (-3360.591) * (-3364.602) (-3367.340) [-3355.525] (-3374.355) -- 0:06:31 239500 -- (-3355.238) (-3358.529) [-3359.284] (-3362.103) * [-3353.269] (-3359.759) (-3363.870) (-3357.881) -- 0:06:30 240000 -- [-3373.204] (-3379.238) (-3366.505) (-3363.702) * [-3357.482] (-3359.719) (-3362.986) (-3357.556) -- 0:06:29 Average standard deviation of split frequencies: 0.008488 240500 -- [-3359.626] (-3355.605) (-3362.994) (-3364.624) * (-3363.641) (-3359.941) (-3356.053) [-3355.066] -- 0:06:31 241000 -- (-3367.981) [-3353.375] (-3365.281) (-3359.725) * (-3357.531) (-3360.700) [-3354.588] (-3363.992) -- 0:06:30 241500 -- (-3371.749) (-3356.778) (-3366.719) [-3357.885] * (-3356.177) (-3358.399) [-3356.619] (-3361.035) -- 0:06:29 242000 -- (-3361.470) (-3357.587) [-3367.903] (-3357.787) * (-3354.800) (-3364.140) [-3356.351] (-3367.826) -- 0:06:28 242500 -- (-3366.668) (-3360.524) [-3363.446] (-3362.443) * [-3360.224] (-3356.269) (-3358.286) (-3360.265) -- 0:06:30 243000 -- [-3370.398] (-3368.726) (-3368.444) (-3359.115) * [-3366.338] (-3357.219) (-3356.884) (-3364.072) -- 0:06:29 243500 -- (-3360.600) (-3362.332) (-3360.269) [-3364.994] * (-3358.479) (-3356.627) (-3365.595) [-3367.148] -- 0:06:28 244000 -- (-3358.833) [-3359.355] (-3367.561) (-3361.303) * (-3357.573) [-3355.423] (-3365.330) (-3358.991) -- 0:06:27 244500 -- (-3360.057) [-3362.223] (-3361.456) (-3356.661) * (-3358.248) (-3364.137) (-3372.221) [-3366.409] -- 0:06:29 245000 -- [-3363.257] (-3359.397) (-3363.294) (-3350.129) * (-3361.368) (-3362.039) [-3355.971] (-3358.210) -- 0:06:28 Average standard deviation of split frequencies: 0.009794 245500 -- (-3361.878) (-3357.453) (-3366.476) [-3352.987] * (-3356.907) (-3363.508) (-3357.171) [-3357.904] -- 0:06:27 246000 -- (-3364.697) [-3354.073] (-3362.470) (-3360.409) * (-3360.383) (-3363.495) (-3365.922) [-3352.673] -- 0:06:26 246500 -- (-3363.408) [-3363.304] (-3362.277) (-3360.089) * [-3360.560] (-3362.616) (-3360.055) (-3362.270) -- 0:06:28 247000 -- (-3363.237) (-3363.886) [-3354.666] (-3355.116) * [-3357.782] (-3354.756) (-3360.697) (-3363.724) -- 0:06:27 247500 -- (-3366.404) [-3357.459] (-3354.807) (-3364.239) * (-3358.681) (-3356.090) [-3358.825] (-3357.299) -- 0:06:26 248000 -- (-3361.457) [-3365.855] (-3360.730) (-3354.924) * (-3353.957) [-3368.238] (-3366.749) (-3372.847) -- 0:06:25 248500 -- (-3363.219) (-3366.034) (-3362.173) [-3363.716] * (-3356.119) (-3360.806) [-3364.434] (-3354.709) -- 0:06:27 249000 -- (-3359.672) [-3360.898] (-3371.249) (-3357.743) * (-3356.939) (-3359.399) (-3361.543) [-3363.658] -- 0:06:26 249500 -- (-3364.079) (-3360.409) [-3362.777] (-3376.465) * (-3375.449) (-3367.844) (-3356.636) [-3358.620] -- 0:06:25 250000 -- (-3366.304) [-3357.498] (-3356.960) (-3358.089) * (-3376.562) [-3360.185] (-3356.595) (-3367.878) -- 0:06:24 Average standard deviation of split frequencies: 0.008567 250500 -- (-3365.557) (-3360.390) (-3354.957) [-3360.426] * (-3366.911) (-3360.452) (-3376.037) [-3369.127] -- 0:06:25 251000 -- (-3367.672) (-3363.101) (-3362.679) [-3358.499] * (-3361.648) (-3356.761) [-3361.759] (-3372.040) -- 0:06:24 251500 -- (-3354.041) [-3361.358] (-3365.179) (-3359.864) * (-3358.870) [-3359.396] (-3363.893) (-3368.218) -- 0:06:23 252000 -- (-3358.804) [-3361.141] (-3368.329) (-3364.600) * (-3370.117) (-3374.950) (-3355.361) [-3363.554] -- 0:06:22 252500 -- (-3358.805) (-3356.414) [-3368.105] (-3362.102) * (-3364.363) (-3372.581) [-3359.916] (-3368.324) -- 0:06:24 253000 -- (-3370.568) (-3357.802) (-3358.305) [-3357.565] * [-3357.225] (-3365.280) (-3363.546) (-3373.861) -- 0:06:23 253500 -- (-3371.178) [-3354.722] (-3363.974) (-3355.170) * [-3354.628] (-3367.753) (-3363.264) (-3367.912) -- 0:06:22 254000 -- (-3367.849) (-3374.500) (-3366.665) [-3349.356] * (-3354.846) (-3372.206) [-3368.094] (-3364.044) -- 0:06:21 254500 -- (-3361.703) (-3357.131) (-3365.103) [-3358.907] * (-3361.824) [-3360.858] (-3367.948) (-3372.073) -- 0:06:23 255000 -- (-3351.585) (-3354.378) (-3364.497) [-3360.502] * (-3355.315) [-3361.665] (-3363.405) (-3360.287) -- 0:06:22 Average standard deviation of split frequencies: 0.008389 255500 -- (-3367.104) (-3356.704) [-3353.443] (-3361.835) * (-3359.708) [-3358.548] (-3364.796) (-3365.185) -- 0:06:21 256000 -- (-3357.602) (-3353.596) [-3363.060] (-3361.227) * (-3360.166) (-3366.192) [-3353.890] (-3366.063) -- 0:06:20 256500 -- (-3358.171) (-3364.537) (-3366.262) [-3364.588] * (-3357.053) (-3357.145) (-3358.843) [-3360.051] -- 0:06:22 257000 -- (-3364.889) (-3376.644) (-3367.681) [-3354.903] * (-3372.013) (-3360.599) [-3357.851] (-3360.688) -- 0:06:21 257500 -- [-3367.541] (-3372.038) (-3366.133) (-3357.871) * (-3368.775) (-3353.323) [-3354.988] (-3361.201) -- 0:06:20 258000 -- (-3357.809) [-3363.523] (-3362.614) (-3365.331) * (-3371.539) (-3364.017) (-3358.274) [-3356.434] -- 0:06:19 258500 -- (-3366.702) [-3361.371] (-3363.201) (-3369.941) * [-3359.010] (-3364.772) (-3362.014) (-3357.867) -- 0:06:21 259000 -- [-3357.140] (-3371.115) (-3359.165) (-3360.170) * (-3357.334) [-3363.885] (-3357.325) (-3363.982) -- 0:06:20 259500 -- (-3356.858) [-3360.649] (-3368.107) (-3361.862) * (-3363.593) (-3367.553) [-3349.348] (-3363.901) -- 0:06:19 260000 -- [-3356.245] (-3362.006) (-3364.195) (-3365.261) * (-3367.147) (-3371.911) [-3359.062] (-3359.822) -- 0:06:21 Average standard deviation of split frequencies: 0.006229 260500 -- (-3362.359) [-3358.867] (-3351.673) (-3359.126) * (-3357.289) (-3354.102) (-3359.055) [-3357.432] -- 0:06:20 261000 -- (-3357.749) (-3368.117) (-3353.500) [-3355.977] * (-3369.943) [-3356.130] (-3370.778) (-3362.938) -- 0:06:19 261500 -- (-3356.926) [-3361.431] (-3361.847) (-3363.236) * [-3358.729] (-3363.496) (-3360.845) (-3358.101) -- 0:06:18 262000 -- [-3357.838] (-3357.662) (-3353.075) (-3366.789) * [-3362.806] (-3365.021) (-3364.716) (-3362.496) -- 0:06:20 262500 -- [-3356.461] (-3363.791) (-3360.297) (-3355.081) * [-3360.281] (-3365.386) (-3363.616) (-3359.921) -- 0:06:19 263000 -- (-3358.970) [-3354.745] (-3366.005) (-3366.405) * (-3370.852) (-3359.671) [-3362.439] (-3354.785) -- 0:06:18 263500 -- (-3363.601) (-3357.576) [-3361.418] (-3369.234) * [-3355.030] (-3360.299) (-3362.718) (-3356.457) -- 0:06:17 264000 -- (-3370.501) [-3355.266] (-3364.953) (-3357.248) * (-3359.582) (-3359.232) (-3359.794) [-3356.806] -- 0:06:19 264500 -- (-3360.185) [-3360.462] (-3375.540) (-3359.481) * (-3360.256) (-3364.693) [-3360.376] (-3363.791) -- 0:06:18 265000 -- (-3358.609) [-3359.468] (-3358.840) (-3368.792) * (-3361.956) (-3364.559) [-3355.680] (-3368.665) -- 0:06:17 Average standard deviation of split frequencies: 0.008467 265500 -- [-3359.181] (-3363.726) (-3360.559) (-3361.491) * (-3368.768) (-3361.628) [-3359.776] (-3363.684) -- 0:06:16 266000 -- (-3362.703) (-3364.487) [-3359.071] (-3354.915) * [-3365.876] (-3360.083) (-3368.809) (-3364.007) -- 0:06:18 266500 -- (-3358.468) (-3362.321) (-3365.109) [-3356.774] * (-3367.432) (-3362.170) (-3366.527) [-3357.579] -- 0:06:17 267000 -- [-3366.269] (-3372.310) (-3352.818) (-3354.817) * [-3363.590] (-3361.778) (-3356.733) (-3362.055) -- 0:06:16 267500 -- (-3362.096) (-3360.567) (-3363.931) [-3352.989] * (-3366.336) [-3366.101] (-3363.678) (-3363.766) -- 0:06:15 268000 -- (-3363.215) (-3363.916) (-3358.883) [-3352.988] * (-3353.799) [-3363.048] (-3356.077) (-3358.943) -- 0:06:16 268500 -- (-3363.103) (-3360.042) (-3361.175) [-3355.407] * (-3352.850) (-3355.818) [-3356.889] (-3366.339) -- 0:06:15 269000 -- (-3355.408) [-3359.963] (-3365.043) (-3362.223) * [-3352.936] (-3363.910) (-3357.986) (-3359.119) -- 0:06:15 269500 -- (-3361.963) [-3355.692] (-3363.384) (-3358.205) * (-3363.625) [-3358.839] (-3352.838) (-3360.755) -- 0:06:14 270000 -- (-3364.460) (-3367.770) [-3356.056] (-3361.822) * [-3358.132] (-3361.333) (-3358.891) (-3364.535) -- 0:06:15 Average standard deviation of split frequencies: 0.008128 270500 -- (-3357.415) (-3367.291) [-3357.690] (-3364.748) * (-3360.782) (-3353.751) (-3357.140) [-3363.868] -- 0:06:14 271000 -- [-3361.317] (-3359.202) (-3355.093) (-3372.685) * (-3362.796) (-3358.965) (-3359.036) [-3366.799] -- 0:06:13 271500 -- [-3354.105] (-3356.751) (-3365.951) (-3364.592) * (-3358.786) [-3353.743] (-3358.152) (-3373.199) -- 0:06:12 272000 -- (-3355.974) (-3360.225) (-3356.631) [-3360.554] * (-3360.993) (-3357.641) [-3355.861] (-3372.303) -- 0:06:14 272500 -- (-3356.918) (-3369.390) [-3356.919] (-3362.717) * [-3363.959] (-3359.969) (-3370.178) (-3366.375) -- 0:06:13 273000 -- (-3360.603) (-3385.502) [-3361.561] (-3362.660) * (-3360.620) (-3359.605) [-3360.655] (-3355.885) -- 0:06:12 273500 -- [-3361.062] (-3382.100) (-3357.199) (-3359.302) * (-3362.194) (-3354.445) [-3357.439] (-3363.951) -- 0:06:11 274000 -- (-3358.745) [-3373.569] (-3355.856) (-3358.805) * (-3358.322) (-3356.260) [-3359.922] (-3360.933) -- 0:06:13 274500 -- [-3354.265] (-3373.532) (-3366.805) (-3361.430) * (-3362.458) (-3365.621) [-3360.206] (-3363.142) -- 0:06:12 275000 -- [-3354.650] (-3359.684) (-3356.577) (-3356.956) * (-3361.941) [-3359.415] (-3359.079) (-3365.415) -- 0:06:11 Average standard deviation of split frequencies: 0.007781 275500 -- [-3361.609] (-3353.891) (-3361.837) (-3368.705) * (-3358.472) [-3360.924] (-3366.470) (-3357.841) -- 0:06:10 276000 -- [-3364.293] (-3359.731) (-3359.083) (-3368.639) * (-3357.342) (-3367.274) (-3357.127) [-3352.275] -- 0:06:12 276500 -- (-3363.290) (-3364.623) [-3355.201] (-3361.870) * (-3359.460) (-3355.611) [-3359.958] (-3364.772) -- 0:06:11 277000 -- (-3364.030) (-3358.391) [-3355.376] (-3359.376) * (-3361.544) [-3359.208] (-3362.862) (-3371.135) -- 0:06:10 277500 -- (-3357.462) (-3362.659) [-3354.636] (-3356.548) * (-3370.751) (-3360.890) [-3360.951] (-3368.288) -- 0:06:09 278000 -- [-3361.840] (-3371.957) (-3360.544) (-3365.112) * (-3361.417) (-3368.085) [-3356.262] (-3360.556) -- 0:06:11 278500 -- [-3362.782] (-3371.529) (-3361.371) (-3363.406) * (-3361.274) [-3357.167] (-3362.314) (-3373.910) -- 0:06:10 279000 -- (-3358.935) (-3366.218) [-3355.917] (-3361.258) * (-3359.534) (-3369.853) (-3356.421) [-3356.840] -- 0:06:09 279500 -- [-3361.455] (-3361.316) (-3366.632) (-3361.766) * (-3358.473) (-3359.435) [-3356.603] (-3359.817) -- 0:06:08 280000 -- (-3355.418) [-3367.408] (-3363.653) (-3361.773) * (-3367.375) [-3355.354] (-3367.281) (-3359.758) -- 0:06:10 Average standard deviation of split frequencies: 0.006532 280500 -- (-3361.224) (-3353.925) (-3364.961) [-3357.608] * (-3377.097) (-3373.906) (-3369.960) [-3361.680] -- 0:06:09 281000 -- (-3367.237) (-3366.139) [-3361.253] (-3361.215) * (-3360.491) [-3359.448] (-3362.271) (-3363.878) -- 0:06:08 281500 -- [-3359.088] (-3364.311) (-3362.859) (-3354.471) * (-3357.389) (-3370.672) [-3354.366] (-3357.363) -- 0:06:10 282000 -- (-3359.897) [-3362.445] (-3359.702) (-3355.667) * [-3355.692] (-3359.515) (-3360.736) (-3358.835) -- 0:06:09 282500 -- (-3357.049) (-3362.352) (-3361.753) [-3362.827] * [-3359.126] (-3364.561) (-3356.294) (-3367.452) -- 0:06:08 283000 -- [-3356.928] (-3361.175) (-3367.663) (-3364.322) * [-3357.990] (-3362.301) (-3354.488) (-3359.036) -- 0:06:07 283500 -- (-3361.978) (-3364.891) (-3364.797) [-3365.479] * [-3361.044] (-3366.445) (-3353.952) (-3359.894) -- 0:06:08 284000 -- [-3366.415] (-3354.785) (-3358.279) (-3365.232) * (-3361.681) (-3363.594) [-3357.011] (-3362.494) -- 0:06:08 284500 -- [-3355.371] (-3360.968) (-3371.634) (-3366.898) * [-3369.792] (-3365.127) (-3359.409) (-3366.634) -- 0:06:07 285000 -- (-3357.294) (-3363.717) (-3360.923) [-3360.862] * (-3363.868) [-3371.856] (-3358.372) (-3355.810) -- 0:06:06 Average standard deviation of split frequencies: 0.006776 285500 -- (-3360.757) (-3361.509) [-3358.102] (-3360.864) * (-3367.169) (-3360.713) (-3357.875) [-3353.758] -- 0:06:07 286000 -- (-3358.694) (-3364.167) (-3360.891) [-3355.750] * (-3369.314) (-3371.806) (-3363.853) [-3355.808] -- 0:06:06 286500 -- [-3355.512] (-3358.217) (-3360.315) (-3374.259) * (-3366.060) (-3371.588) [-3362.306] (-3357.765) -- 0:06:06 287000 -- (-3362.498) [-3366.398] (-3363.879) (-3356.350) * (-3366.407) (-3372.961) (-3360.679) [-3360.448] -- 0:06:05 287500 -- (-3360.897) (-3361.992) (-3368.239) [-3357.613] * (-3367.690) (-3365.749) (-3360.098) [-3360.710] -- 0:06:06 288000 -- (-3361.555) (-3360.202) (-3359.698) [-3353.741] * (-3362.077) (-3361.179) [-3365.792] (-3360.265) -- 0:06:05 288500 -- [-3358.867] (-3362.138) (-3351.344) (-3360.871) * [-3357.323] (-3362.004) (-3361.592) (-3363.790) -- 0:06:04 289000 -- [-3364.320] (-3364.236) (-3357.657) (-3363.220) * (-3363.029) [-3359.598] (-3360.885) (-3359.538) -- 0:06:04 289500 -- [-3364.590] (-3361.823) (-3361.217) (-3357.174) * (-3354.296) (-3364.041) (-3367.534) [-3352.719] -- 0:06:05 290000 -- (-3353.144) (-3375.954) [-3358.849] (-3358.148) * (-3361.782) [-3354.381] (-3361.334) (-3360.171) -- 0:06:04 Average standard deviation of split frequencies: 0.007388 290500 -- (-3363.838) (-3361.423) [-3355.636] (-3362.927) * [-3367.588] (-3359.915) (-3359.104) (-3373.823) -- 0:06:03 291000 -- (-3359.247) (-3362.935) (-3357.835) [-3353.097] * (-3360.121) (-3375.562) [-3358.924] (-3364.763) -- 0:06:03 291500 -- [-3354.601] (-3355.891) (-3360.448) (-3355.675) * (-3365.972) (-3357.700) [-3356.938] (-3373.126) -- 0:06:04 292000 -- [-3353.552] (-3379.495) (-3369.666) (-3364.057) * (-3374.667) (-3356.182) [-3358.075] (-3361.789) -- 0:06:03 292500 -- (-3362.660) (-3361.285) [-3358.521] (-3357.132) * [-3362.678] (-3359.858) (-3358.955) (-3364.671) -- 0:06:02 293000 -- [-3354.751] (-3359.945) (-3363.472) (-3365.640) * [-3363.825] (-3362.921) (-3364.037) (-3367.649) -- 0:06:01 293500 -- [-3361.119] (-3367.727) (-3365.671) (-3367.638) * (-3354.445) (-3367.715) (-3365.397) [-3362.304] -- 0:06:03 294000 -- (-3362.721) (-3359.322) (-3365.171) [-3358.569] * [-3365.536] (-3355.362) (-3365.631) (-3359.957) -- 0:06:02 294500 -- (-3364.053) (-3358.974) (-3361.450) [-3360.118] * (-3358.416) (-3365.724) (-3369.119) [-3355.274] -- 0:06:01 295000 -- (-3357.183) (-3363.003) [-3356.128] (-3368.782) * (-3360.429) (-3358.634) [-3354.278] (-3371.673) -- 0:06:00 Average standard deviation of split frequencies: 0.007432 295500 -- [-3355.950] (-3358.327) (-3357.803) (-3363.602) * (-3361.344) [-3353.738] (-3362.322) (-3355.176) -- 0:06:02 296000 -- (-3367.248) (-3357.419) (-3360.363) [-3356.594] * (-3355.041) (-3358.607) [-3361.224] (-3366.337) -- 0:06:01 296500 -- (-3363.173) [-3364.841] (-3365.867) (-3362.465) * (-3357.061) (-3358.981) [-3354.319] (-3363.192) -- 0:06:00 297000 -- [-3359.329] (-3365.123) (-3358.940) (-3362.293) * (-3366.595) [-3360.073] (-3359.586) (-3370.331) -- 0:05:59 297500 -- (-3363.701) (-3361.579) (-3364.997) [-3359.705] * [-3356.556] (-3360.517) (-3361.785) (-3362.526) -- 0:06:01 298000 -- (-3363.426) (-3360.573) (-3366.846) [-3357.650] * (-3358.847) (-3365.260) [-3361.105] (-3360.781) -- 0:06:00 298500 -- [-3365.821] (-3353.220) (-3359.632) (-3353.861) * (-3361.545) (-3369.990) [-3365.513] (-3359.228) -- 0:05:59 299000 -- (-3365.441) [-3351.396] (-3362.392) (-3360.438) * (-3353.856) (-3368.751) [-3362.794] (-3362.897) -- 0:05:58 299500 -- (-3370.245) (-3362.105) (-3363.711) [-3362.494] * (-3363.203) (-3364.557) (-3367.940) [-3358.545] -- 0:06:00 300000 -- (-3365.183) [-3354.009] (-3362.175) (-3359.813) * (-3360.493) (-3364.539) [-3366.666] (-3370.611) -- 0:05:59 Average standard deviation of split frequencies: 0.008536 300500 -- (-3363.080) (-3356.870) [-3357.552] (-3357.250) * [-3364.445] (-3362.711) (-3367.331) (-3364.920) -- 0:05:58 301000 -- [-3357.917] (-3359.348) (-3368.304) (-3369.675) * (-3357.864) (-3361.681) [-3361.574] (-3363.853) -- 0:05:57 301500 -- (-3366.641) (-3355.895) (-3359.545) [-3358.453] * [-3359.251] (-3354.685) (-3368.417) (-3359.525) -- 0:05:59 302000 -- (-3369.835) (-3358.727) [-3363.538] (-3358.569) * (-3358.063) (-3356.546) [-3369.505] (-3358.468) -- 0:05:58 302500 -- (-3363.222) (-3359.192) (-3356.824) [-3358.828] * (-3359.293) (-3359.148) (-3362.400) [-3367.662] -- 0:05:57 303000 -- [-3357.451] (-3360.087) (-3362.473) (-3366.001) * (-3360.967) [-3365.781] (-3367.529) (-3354.935) -- 0:05:58 303500 -- (-3363.663) [-3362.931] (-3353.710) (-3357.412) * (-3358.283) (-3367.120) (-3356.551) [-3353.774] -- 0:05:58 304000 -- (-3365.487) (-3372.953) [-3373.685] (-3363.696) * (-3355.719) (-3368.499) [-3358.814] (-3355.086) -- 0:05:57 304500 -- (-3363.167) [-3359.062] (-3365.446) (-3364.748) * [-3356.896] (-3361.249) (-3369.486) (-3364.245) -- 0:05:56 305000 -- (-3353.979) (-3365.525) [-3364.048] (-3368.664) * [-3358.298] (-3371.907) (-3360.271) (-3354.547) -- 0:05:57 Average standard deviation of split frequencies: 0.008216 305500 -- [-3363.010] (-3366.945) (-3361.984) (-3371.005) * [-3359.870] (-3365.742) (-3354.068) (-3367.188) -- 0:05:56 306000 -- (-3360.823) (-3359.168) (-3362.528) [-3358.895] * (-3362.505) (-3358.474) (-3367.011) [-3354.789] -- 0:05:56 306500 -- (-3359.617) (-3367.000) [-3357.737] (-3352.372) * (-3365.656) (-3358.005) (-3369.717) [-3355.433] -- 0:05:55 307000 -- (-3360.926) [-3357.769] (-3361.624) (-3362.665) * [-3357.329] (-3369.236) (-3358.812) (-3355.305) -- 0:05:56 307500 -- (-3359.556) (-3378.068) [-3353.048] (-3366.227) * (-3360.550) [-3357.918] (-3363.879) (-3368.471) -- 0:05:55 308000 -- (-3366.564) (-3356.536) (-3357.319) [-3360.706] * (-3357.531) (-3355.805) [-3362.337] (-3371.252) -- 0:05:54 308500 -- (-3366.968) (-3359.256) [-3351.990] (-3354.091) * (-3364.945) (-3362.122) (-3372.121) [-3359.142] -- 0:05:54 309000 -- (-3364.346) [-3358.515] (-3367.368) (-3359.345) * (-3363.849) (-3365.763) (-3364.984) [-3356.899] -- 0:05:55 309500 -- (-3368.207) (-3365.073) [-3365.127] (-3357.360) * [-3361.214] (-3370.066) (-3373.331) (-3354.538) -- 0:05:54 310000 -- (-3359.851) (-3361.449) (-3367.974) [-3363.868] * (-3371.364) [-3361.343] (-3360.280) (-3358.290) -- 0:05:53 Average standard deviation of split frequencies: 0.008093 310500 -- (-3361.361) [-3359.161] (-3355.238) (-3365.942) * (-3360.323) (-3359.105) [-3359.913] (-3361.102) -- 0:05:53 311000 -- (-3367.383) (-3357.844) (-3357.272) [-3357.421] * (-3361.256) (-3361.651) (-3353.949) [-3364.857] -- 0:05:54 311500 -- (-3365.619) [-3356.771] (-3363.348) (-3359.841) * (-3360.001) (-3360.557) [-3358.998] (-3364.750) -- 0:05:53 312000 -- [-3363.205] (-3366.983) (-3359.724) (-3366.746) * (-3368.574) [-3363.443] (-3364.940) (-3357.709) -- 0:05:52 312500 -- (-3358.740) (-3374.631) (-3358.361) [-3359.416] * (-3365.365) (-3360.262) [-3359.113] (-3359.684) -- 0:05:52 313000 -- (-3361.176) (-3370.362) (-3358.845) [-3361.060] * (-3363.724) [-3354.412] (-3356.402) (-3360.774) -- 0:05:53 313500 -- (-3356.645) (-3360.422) [-3362.507] (-3371.199) * (-3356.129) [-3354.369] (-3361.099) (-3364.939) -- 0:05:52 314000 -- [-3364.346] (-3358.787) (-3378.120) (-3362.202) * (-3362.886) (-3366.417) (-3361.113) [-3359.547] -- 0:05:51 314500 -- [-3361.618] (-3358.329) (-3365.673) (-3355.768) * (-3360.998) (-3368.657) (-3356.529) [-3355.912] -- 0:05:50 315000 -- (-3361.871) [-3357.237] (-3364.016) (-3380.481) * (-3367.237) (-3356.819) [-3356.716] (-3360.754) -- 0:05:52 Average standard deviation of split frequencies: 0.005470 315500 -- (-3363.147) [-3356.156] (-3359.865) (-3360.537) * (-3373.534) [-3359.515] (-3359.418) (-3360.363) -- 0:05:51 316000 -- [-3363.401] (-3364.335) (-3361.522) (-3364.024) * (-3364.139) (-3362.360) [-3354.591] (-3363.636) -- 0:05:50 316500 -- (-3367.243) (-3356.614) [-3359.206] (-3361.170) * (-3360.535) [-3364.546] (-3365.306) (-3355.783) -- 0:05:49 317000 -- (-3356.600) (-3370.063) [-3362.424] (-3359.617) * (-3358.359) (-3362.408) [-3360.361] (-3358.806) -- 0:05:51 317500 -- (-3360.663) (-3365.015) [-3362.126] (-3363.317) * (-3363.571) [-3362.811] (-3365.041) (-3352.051) -- 0:05:50 318000 -- (-3365.783) (-3354.384) [-3358.729] (-3362.041) * (-3363.312) (-3371.270) (-3363.969) [-3352.996] -- 0:05:49 318500 -- [-3359.007] (-3357.905) (-3363.821) (-3361.276) * (-3364.202) (-3362.127) [-3357.295] (-3364.275) -- 0:05:48 319000 -- (-3354.576) (-3359.681) (-3367.132) [-3366.367] * (-3364.524) (-3360.638) (-3361.021) [-3359.643] -- 0:05:50 319500 -- [-3359.255] (-3366.951) (-3365.617) (-3360.028) * (-3367.282) (-3361.356) (-3361.007) [-3358.147] -- 0:05:49 320000 -- [-3362.788] (-3365.203) (-3360.340) (-3369.417) * (-3359.700) (-3361.105) (-3359.982) [-3356.912] -- 0:05:48 Average standard deviation of split frequencies: 0.003920 320500 -- [-3362.636] (-3373.351) (-3372.564) (-3360.485) * (-3361.289) [-3358.085] (-3364.473) (-3365.165) -- 0:05:47 321000 -- [-3357.817] (-3365.537) (-3371.759) (-3363.557) * (-3359.965) [-3361.577] (-3363.768) (-3363.386) -- 0:05:49 321500 -- (-3365.049) (-3361.064) (-3358.106) [-3357.296] * (-3361.791) (-3362.722) [-3353.681] (-3363.669) -- 0:05:48 322000 -- (-3365.053) (-3363.091) [-3361.040] (-3353.175) * (-3356.367) (-3364.777) [-3359.130] (-3355.388) -- 0:05:47 322500 -- (-3367.814) [-3359.646] (-3361.526) (-3357.718) * [-3358.611] (-3356.950) (-3373.254) (-3362.097) -- 0:05:46 323000 -- (-3356.003) [-3360.279] (-3359.581) (-3365.901) * [-3358.965] (-3360.942) (-3369.454) (-3365.198) -- 0:05:47 323500 -- (-3360.473) (-3361.468) [-3355.069] (-3371.792) * [-3361.516] (-3368.638) (-3353.384) (-3357.019) -- 0:05:47 324000 -- (-3369.866) (-3375.105) [-3353.560] (-3358.782) * (-3365.346) (-3360.276) (-3360.012) [-3357.078] -- 0:05:46 324500 -- (-3354.918) (-3358.183) (-3354.850) [-3357.270] * (-3373.833) (-3380.663) (-3354.874) [-3362.765] -- 0:05:47 325000 -- (-3372.325) (-3368.983) [-3353.749] (-3355.927) * [-3362.121] (-3371.607) (-3357.199) (-3365.123) -- 0:05:46 Average standard deviation of split frequencies: 0.004017 325500 -- (-3370.314) [-3362.510] (-3369.361) (-3363.174) * (-3362.116) (-3376.620) (-3366.312) [-3364.045] -- 0:05:46 326000 -- [-3360.607] (-3358.244) (-3365.631) (-3364.296) * (-3355.200) [-3356.501] (-3361.853) (-3361.910) -- 0:05:45 326500 -- (-3364.984) [-3360.686] (-3358.368) (-3356.453) * (-3373.336) [-3364.290] (-3366.789) (-3357.320) -- 0:05:46 327000 -- (-3377.879) [-3358.273] (-3357.562) (-3352.589) * (-3366.989) [-3358.807] (-3375.809) (-3363.594) -- 0:05:45 327500 -- (-3358.754) (-3358.351) [-3359.057] (-3359.823) * (-3361.606) [-3361.861] (-3371.999) (-3363.562) -- 0:05:44 328000 -- (-3366.683) (-3367.295) (-3361.322) [-3366.123] * (-3364.750) [-3358.392] (-3368.966) (-3361.035) -- 0:05:44 328500 -- (-3363.667) (-3349.578) [-3363.607] (-3362.392) * (-3367.864) (-3362.986) [-3353.154] (-3358.121) -- 0:05:45 329000 -- (-3354.490) (-3355.321) [-3361.372] (-3363.729) * (-3373.627) (-3368.134) [-3361.264] (-3361.508) -- 0:05:44 329500 -- (-3353.484) (-3353.215) (-3368.473) [-3357.407] * (-3367.299) [-3364.329] (-3353.789) (-3362.961) -- 0:05:43 330000 -- (-3359.747) (-3353.159) (-3363.085) [-3364.083] * (-3363.435) [-3362.091] (-3361.413) (-3369.463) -- 0:05:43 Average standard deviation of split frequencies: 0.003326 330500 -- (-3368.808) (-3370.446) [-3355.068] (-3358.254) * [-3354.347] (-3357.948) (-3363.695) (-3364.484) -- 0:05:44 331000 -- (-3361.589) [-3362.453] (-3355.081) (-3359.227) * [-3360.704] (-3356.312) (-3366.279) (-3365.965) -- 0:05:43 331500 -- (-3371.859) [-3357.795] (-3357.149) (-3361.525) * (-3360.670) (-3363.371) [-3352.307] (-3360.899) -- 0:05:42 332000 -- (-3359.457) (-3355.504) [-3358.049] (-3364.246) * (-3358.695) (-3355.048) (-3366.893) [-3368.846] -- 0:05:42 332500 -- (-3360.510) [-3360.279] (-3366.653) (-3360.540) * [-3357.979] (-3357.160) (-3358.008) (-3363.070) -- 0:05:43 333000 -- (-3367.725) (-3364.729) (-3353.303) [-3354.006] * (-3360.921) (-3354.359) [-3359.075] (-3359.029) -- 0:05:42 333500 -- (-3371.130) (-3360.738) [-3360.468] (-3355.645) * [-3359.957] (-3357.823) (-3359.601) (-3360.219) -- 0:05:41 334000 -- [-3364.825] (-3370.352) (-3358.317) (-3367.050) * [-3355.246] (-3358.704) (-3369.818) (-3365.330) -- 0:05:42 334500 -- (-3360.276) [-3363.176] (-3365.292) (-3359.653) * (-3356.709) (-3358.253) [-3359.081] (-3356.678) -- 0:05:42 335000 -- (-3364.384) (-3366.332) (-3356.020) [-3361.890] * (-3359.179) (-3361.577) [-3357.888] (-3363.556) -- 0:05:41 Average standard deviation of split frequencies: 0.003897 335500 -- (-3363.072) (-3370.014) (-3363.040) [-3362.801] * (-3365.941) (-3363.561) (-3356.754) [-3356.862] -- 0:05:40 336000 -- [-3356.956] (-3363.641) (-3365.581) (-3365.747) * (-3361.153) [-3364.236] (-3356.832) (-3369.541) -- 0:05:41 336500 -- (-3354.808) (-3365.524) [-3362.749] (-3369.087) * (-3354.692) [-3362.051] (-3363.125) (-3357.368) -- 0:05:41 337000 -- [-3360.644] (-3377.171) (-3362.235) (-3357.749) * [-3363.407] (-3369.293) (-3357.099) (-3362.061) -- 0:05:40 337500 -- (-3352.627) (-3362.945) (-3360.597) [-3354.545] * [-3362.505] (-3356.420) (-3363.341) (-3371.826) -- 0:05:39 338000 -- [-3360.407] (-3361.016) (-3359.015) (-3363.176) * (-3373.540) [-3355.533] (-3362.897) (-3366.595) -- 0:05:40 338500 -- (-3362.145) (-3371.516) [-3363.911] (-3359.913) * (-3367.007) (-3354.460) [-3359.387] (-3359.431) -- 0:05:40 339000 -- (-3359.952) (-3359.661) [-3366.869] (-3359.472) * (-3367.116) [-3356.676] (-3362.433) (-3357.072) -- 0:05:39 339500 -- (-3361.884) [-3355.668] (-3370.404) (-3352.992) * (-3368.157) (-3358.123) [-3354.183] (-3367.494) -- 0:05:38 340000 -- (-3362.865) (-3363.634) [-3360.023] (-3354.392) * [-3360.390] (-3361.014) (-3360.987) (-3360.307) -- 0:05:39 Average standard deviation of split frequencies: 0.003075 340500 -- (-3360.614) (-3352.497) (-3359.907) [-3363.394] * [-3358.237] (-3364.517) (-3364.043) (-3360.953) -- 0:05:38 341000 -- (-3364.155) [-3353.240] (-3368.118) (-3367.795) * (-3361.176) [-3363.324] (-3358.117) (-3365.316) -- 0:05:38 341500 -- (-3358.043) [-3356.136] (-3364.184) (-3360.564) * (-3359.674) [-3357.057] (-3362.970) (-3359.735) -- 0:05:37 342000 -- (-3363.704) (-3362.507) (-3359.808) [-3361.462] * (-3373.800) (-3365.134) (-3358.155) [-3360.219] -- 0:05:38 342500 -- (-3359.669) (-3360.005) (-3358.168) [-3361.071] * (-3372.196) (-3363.535) (-3356.334) [-3360.032] -- 0:05:37 343000 -- (-3355.843) (-3364.419) [-3356.805] (-3373.635) * (-3359.604) (-3369.442) (-3357.004) [-3352.692] -- 0:05:37 343500 -- (-3358.681) (-3358.652) (-3364.518) [-3358.984] * (-3362.245) (-3365.130) (-3359.565) [-3358.363] -- 0:05:36 344000 -- [-3359.525] (-3364.291) (-3363.870) (-3361.195) * (-3376.069) (-3369.562) [-3358.033] (-3365.561) -- 0:05:37 344500 -- (-3371.764) (-3359.345) (-3361.171) [-3361.154] * (-3370.233) (-3371.197) (-3359.708) [-3368.939] -- 0:05:36 345000 -- (-3363.578) [-3360.825] (-3355.409) (-3363.379) * (-3361.131) [-3363.547] (-3365.340) (-3373.438) -- 0:05:36 Average standard deviation of split frequencies: 0.002876 345500 -- (-3364.050) (-3357.911) [-3359.015] (-3364.673) * (-3357.444) [-3363.725] (-3363.470) (-3368.404) -- 0:05:35 346000 -- [-3362.125] (-3364.153) (-3355.567) (-3359.967) * [-3361.016] (-3372.398) (-3367.912) (-3358.366) -- 0:05:36 346500 -- [-3360.545] (-3368.615) (-3366.176) (-3367.861) * (-3366.140) [-3361.267] (-3360.312) (-3355.003) -- 0:05:35 347000 -- (-3354.388) (-3359.698) (-3357.776) [-3358.558] * (-3358.551) [-3359.728] (-3361.312) (-3368.087) -- 0:05:34 347500 -- (-3361.900) (-3362.369) (-3374.430) [-3355.775] * (-3358.550) (-3361.770) [-3353.957] (-3360.828) -- 0:05:34 348000 -- (-3374.677) (-3363.306) (-3359.936) [-3362.707] * (-3365.779) [-3359.099] (-3355.380) (-3362.384) -- 0:05:35 348500 -- (-3360.342) [-3359.676] (-3359.214) (-3359.362) * [-3362.572] (-3355.896) (-3367.475) (-3358.999) -- 0:05:34 349000 -- (-3364.163) (-3355.565) [-3359.620] (-3359.124) * [-3359.771] (-3373.570) (-3365.655) (-3364.715) -- 0:05:33 349500 -- [-3361.215] (-3357.440) (-3365.640) (-3360.324) * (-3361.542) (-3366.993) [-3359.627] (-3355.020) -- 0:05:33 350000 -- [-3362.170] (-3358.853) (-3368.820) (-3363.148) * (-3353.221) [-3360.685] (-3358.283) (-3363.622) -- 0:05:34 Average standard deviation of split frequencies: 0.003286 350500 -- [-3361.634] (-3359.585) (-3360.268) (-3362.665) * [-3356.723] (-3361.704) (-3364.147) (-3358.657) -- 0:05:33 351000 -- (-3362.534) (-3363.939) (-3362.144) [-3354.765] * [-3354.454] (-3352.219) (-3353.389) (-3361.645) -- 0:05:32 351500 -- (-3363.287) [-3352.258] (-3360.490) (-3366.427) * (-3360.400) (-3359.313) (-3358.168) [-3360.881] -- 0:05:32 352000 -- (-3353.225) [-3350.753] (-3354.702) (-3358.839) * (-3356.181) (-3366.599) (-3368.369) [-3354.700] -- 0:05:33 352500 -- (-3369.223) (-3362.898) (-3360.805) [-3356.772] * (-3359.981) (-3358.568) (-3368.551) [-3361.357] -- 0:05:32 353000 -- (-3360.820) (-3362.983) (-3354.016) [-3362.819] * (-3361.169) [-3359.934] (-3363.016) (-3362.421) -- 0:05:31 353500 -- (-3361.700) (-3376.499) (-3358.512) [-3358.657] * (-3356.074) (-3359.061) [-3354.700] (-3369.222) -- 0:05:31 354000 -- (-3359.882) (-3372.276) [-3353.907] (-3361.927) * (-3356.419) [-3359.959] (-3359.276) (-3372.497) -- 0:05:32 354500 -- (-3364.544) (-3358.771) [-3356.808] (-3360.761) * (-3350.171) (-3357.027) (-3359.986) [-3359.612] -- 0:05:31 355000 -- (-3366.453) (-3363.723) [-3357.700] (-3380.355) * (-3362.546) [-3361.470] (-3363.544) (-3366.911) -- 0:05:30 Average standard deviation of split frequencies: 0.003384 355500 -- (-3359.821) (-3355.635) [-3358.387] (-3360.811) * (-3366.399) (-3362.532) (-3359.668) [-3362.543] -- 0:05:29 356000 -- [-3367.799] (-3359.457) (-3358.107) (-3362.699) * [-3358.883] (-3359.324) (-3354.832) (-3378.677) -- 0:05:31 356500 -- (-3355.891) (-3357.328) [-3354.887] (-3364.904) * (-3358.662) (-3372.284) [-3361.616] (-3367.293) -- 0:05:30 357000 -- [-3361.290] (-3362.863) (-3353.841) (-3359.813) * (-3359.976) (-3354.075) [-3362.349] (-3360.364) -- 0:05:29 357500 -- (-3359.064) [-3362.726] (-3363.081) (-3355.869) * [-3360.268] (-3356.731) (-3369.364) (-3354.723) -- 0:05:28 358000 -- (-3362.808) (-3360.141) (-3352.079) [-3358.587] * (-3359.791) (-3363.471) (-3364.357) [-3359.568] -- 0:05:29 358500 -- (-3353.390) (-3358.247) [-3359.905] (-3354.383) * (-3355.601) (-3365.002) [-3357.863] (-3359.864) -- 0:05:29 359000 -- (-3363.652) (-3353.925) [-3356.001] (-3362.892) * (-3363.721) (-3364.028) (-3356.351) [-3357.075] -- 0:05:28 359500 -- (-3371.672) [-3353.101] (-3365.248) (-3370.150) * (-3366.343) (-3361.024) (-3367.058) [-3357.486] -- 0:05:27 360000 -- (-3361.550) [-3358.012] (-3365.598) (-3357.053) * [-3360.482] (-3353.572) (-3366.585) (-3358.615) -- 0:05:28 Average standard deviation of split frequencies: 0.003195 360500 -- (-3377.695) [-3360.325] (-3355.485) (-3353.284) * (-3355.380) (-3362.258) (-3360.063) [-3355.055] -- 0:05:28 361000 -- (-3363.428) [-3355.860] (-3355.614) (-3363.401) * (-3372.360) [-3355.458] (-3362.339) (-3371.206) -- 0:05:27 361500 -- (-3363.375) (-3356.160) (-3358.735) [-3359.000] * (-3357.845) [-3352.662] (-3365.927) (-3359.045) -- 0:05:26 362000 -- (-3361.266) (-3367.808) (-3361.846) [-3358.342] * (-3374.350) (-3355.196) [-3352.164] (-3360.667) -- 0:05:27 362500 -- (-3365.274) (-3365.171) [-3358.247] (-3361.716) * (-3355.009) (-3358.910) [-3359.836] (-3363.991) -- 0:05:27 363000 -- (-3363.069) [-3363.011] (-3359.773) (-3361.633) * [-3364.932] (-3352.298) (-3357.797) (-3364.400) -- 0:05:26 363500 -- [-3361.312] (-3360.815) (-3361.891) (-3368.781) * (-3364.442) (-3353.861) [-3363.115] (-3360.394) -- 0:05:27 364000 -- (-3360.097) [-3356.576] (-3360.122) (-3369.009) * (-3363.492) (-3363.732) (-3372.227) [-3356.600] -- 0:05:26 364500 -- (-3366.762) [-3355.230] (-3357.106) (-3367.204) * (-3361.181) (-3357.057) [-3367.473] (-3371.560) -- 0:05:26 365000 -- (-3370.506) (-3363.384) [-3364.187] (-3358.787) * (-3358.757) (-3360.030) (-3356.282) [-3358.092] -- 0:05:25 Average standard deviation of split frequencies: 0.003292 365500 -- (-3354.271) [-3360.888] (-3367.213) (-3357.123) * [-3359.527] (-3359.126) (-3355.061) (-3355.926) -- 0:05:26 366000 -- [-3356.925] (-3370.826) (-3375.080) (-3365.064) * (-3362.354) (-3375.873) (-3357.595) [-3355.081] -- 0:05:25 366500 -- (-3360.733) (-3360.472) (-3357.536) [-3359.614] * (-3371.741) (-3364.705) [-3360.835] (-3361.781) -- 0:05:24 367000 -- (-3352.131) [-3366.288] (-3364.461) (-3357.330) * (-3369.853) (-3357.140) (-3355.975) [-3358.730] -- 0:05:24 367500 -- (-3362.246) [-3361.983] (-3356.674) (-3359.292) * (-3361.645) (-3358.702) (-3364.278) [-3360.298] -- 0:05:25 368000 -- (-3368.348) [-3360.612] (-3365.447) (-3361.320) * (-3364.089) (-3359.917) [-3355.593] (-3364.159) -- 0:05:24 368500 -- (-3362.750) [-3357.679] (-3357.820) (-3358.351) * (-3358.775) (-3360.565) (-3366.402) [-3355.558] -- 0:05:23 369000 -- (-3366.155) (-3362.645) [-3355.976] (-3362.351) * (-3374.591) (-3369.568) (-3358.171) [-3355.085] -- 0:05:23 369500 -- (-3366.009) [-3359.520] (-3360.869) (-3365.241) * (-3368.498) [-3355.371] (-3361.830) (-3364.683) -- 0:05:24 370000 -- (-3366.465) (-3360.413) (-3364.677) [-3354.355] * (-3366.089) (-3362.231) (-3371.365) [-3362.750] -- 0:05:23 Average standard deviation of split frequencies: 0.002967 370500 -- (-3359.071) (-3363.419) (-3362.384) [-3360.076] * (-3365.371) [-3364.492] (-3367.463) (-3361.540) -- 0:05:22 371000 -- (-3355.921) [-3362.184] (-3363.065) (-3362.037) * (-3359.631) [-3357.623] (-3361.922) (-3357.440) -- 0:05:23 371500 -- (-3362.880) (-3360.230) (-3361.334) [-3361.715] * (-3359.160) (-3367.911) (-3360.793) [-3360.668] -- 0:05:23 372000 -- [-3357.834] (-3361.981) (-3363.892) (-3364.706) * (-3360.582) [-3364.433] (-3357.780) (-3367.621) -- 0:05:22 372500 -- [-3356.144] (-3373.175) (-3364.927) (-3355.663) * (-3363.545) [-3355.244] (-3354.986) (-3360.501) -- 0:05:21 373000 -- (-3357.297) [-3360.308] (-3361.375) (-3357.549) * (-3363.981) (-3354.340) [-3358.769] (-3364.442) -- 0:05:22 373500 -- (-3358.727) (-3361.924) (-3363.102) [-3357.669] * [-3366.452] (-3359.008) (-3365.530) (-3357.934) -- 0:05:22 374000 -- [-3355.846] (-3362.522) (-3366.659) (-3359.004) * (-3368.932) (-3361.602) (-3357.474) [-3361.686] -- 0:05:21 374500 -- (-3378.529) [-3361.059] (-3352.356) (-3354.135) * (-3364.770) (-3366.031) [-3357.646] (-3358.773) -- 0:05:20 375000 -- [-3366.839] (-3358.003) (-3364.291) (-3357.935) * (-3362.927) (-3379.264) [-3362.259] (-3367.109) -- 0:05:21 Average standard deviation of split frequencies: 0.003343 375500 -- (-3367.961) [-3357.375] (-3350.332) (-3351.447) * (-3362.664) (-3381.850) [-3360.353] (-3368.637) -- 0:05:20 376000 -- (-3366.043) (-3369.764) (-3358.783) [-3357.577] * [-3356.474] (-3363.707) (-3355.985) (-3357.925) -- 0:05:20 376500 -- [-3366.813] (-3355.743) (-3369.979) (-3365.195) * (-3358.128) [-3365.674] (-3362.778) (-3362.977) -- 0:05:19 377000 -- (-3374.554) [-3359.611] (-3366.650) (-3371.579) * (-3364.530) (-3373.089) (-3370.430) [-3355.590] -- 0:05:20 377500 -- (-3364.834) [-3358.177] (-3363.283) (-3361.511) * (-3363.576) (-3359.458) (-3365.604) [-3366.392] -- 0:05:19 378000 -- (-3358.520) (-3365.787) [-3360.292] (-3366.228) * (-3364.470) (-3359.385) (-3365.418) [-3358.196] -- 0:05:19 378500 -- (-3360.515) (-3367.752) (-3358.723) [-3354.815] * [-3362.857] (-3365.635) (-3367.343) (-3369.168) -- 0:05:18 379000 -- [-3350.132] (-3367.490) (-3360.308) (-3360.706) * (-3362.051) (-3357.333) (-3370.216) [-3357.555] -- 0:05:19 379500 -- [-3356.509] (-3370.562) (-3357.767) (-3361.415) * (-3368.512) [-3359.027] (-3359.956) (-3359.630) -- 0:05:18 380000 -- (-3369.151) [-3358.869] (-3363.988) (-3360.014) * (-3368.135) [-3356.782] (-3363.567) (-3370.235) -- 0:05:18 Average standard deviation of split frequencies: 0.003578 380500 -- (-3374.429) (-3356.118) (-3368.796) [-3351.934] * (-3366.362) [-3357.488] (-3365.683) (-3368.354) -- 0:05:17 381000 -- (-3363.192) (-3358.807) [-3356.370] (-3355.957) * [-3355.987] (-3367.453) (-3367.303) (-3363.325) -- 0:05:18 381500 -- (-3359.477) (-3377.903) (-3368.827) [-3355.450] * (-3354.114) (-3362.406) (-3355.050) [-3355.979] -- 0:05:17 382000 -- [-3355.297] (-3355.958) (-3358.823) (-3354.779) * (-3363.376) (-3368.382) [-3354.004] (-3358.003) -- 0:05:17 382500 -- [-3359.042] (-3353.854) (-3362.600) (-3362.419) * (-3360.843) (-3373.070) (-3372.190) [-3356.490] -- 0:05:16 383000 -- [-3359.630] (-3353.937) (-3373.478) (-3358.096) * (-3362.028) [-3355.208] (-3359.424) (-3362.948) -- 0:05:17 383500 -- (-3365.160) (-3354.013) [-3362.790] (-3361.572) * (-3353.182) [-3363.648] (-3357.426) (-3371.566) -- 0:05:16 384000 -- (-3356.811) (-3353.221) [-3354.864] (-3365.643) * [-3354.461] (-3362.590) (-3360.458) (-3368.349) -- 0:05:16 384500 -- (-3363.669) (-3362.200) [-3352.695] (-3360.927) * [-3354.908] (-3359.367) (-3362.525) (-3359.229) -- 0:05:15 385000 -- (-3361.040) (-3365.569) [-3357.335] (-3357.645) * (-3361.893) (-3360.229) [-3361.332] (-3353.154) -- 0:05:16 Average standard deviation of split frequencies: 0.003664 385500 -- (-3360.339) [-3357.409] (-3360.424) (-3367.371) * (-3361.497) (-3360.779) (-3359.453) [-3359.417] -- 0:05:15 386000 -- (-3361.056) [-3356.919] (-3361.297) (-3376.223) * [-3358.824] (-3364.015) (-3370.244) (-3360.002) -- 0:05:14 386500 -- (-3362.950) (-3364.816) [-3358.500] (-3358.723) * (-3360.299) (-3370.455) [-3358.759] (-3354.411) -- 0:05:15 387000 -- (-3357.471) (-3353.357) (-3357.434) [-3358.198] * (-3365.001) (-3356.969) [-3358.021] (-3355.911) -- 0:05:15 387500 -- [-3355.828] (-3366.911) (-3361.368) (-3359.687) * [-3354.708] (-3356.419) (-3361.273) (-3359.229) -- 0:05:14 388000 -- (-3363.738) (-3371.641) [-3350.556] (-3358.706) * (-3354.252) (-3368.416) [-3370.446] (-3362.086) -- 0:05:13 388500 -- (-3361.766) (-3377.449) [-3356.499] (-3353.592) * (-3355.296) (-3367.193) [-3360.644] (-3362.888) -- 0:05:14 389000 -- (-3363.321) (-3361.461) [-3352.518] (-3357.561) * (-3354.781) [-3356.752] (-3357.714) (-3373.130) -- 0:05:14 389500 -- [-3355.097] (-3356.789) (-3351.530) (-3358.841) * (-3352.409) [-3351.726] (-3356.463) (-3367.638) -- 0:05:13 390000 -- (-3362.190) (-3355.814) (-3358.947) [-3361.194] * (-3360.661) (-3361.460) (-3362.635) [-3360.567] -- 0:05:12 Average standard deviation of split frequencies: 0.003888 390500 -- (-3361.945) (-3356.367) (-3359.358) [-3353.321] * [-3369.032] (-3358.252) (-3358.423) (-3370.319) -- 0:05:13 391000 -- [-3361.227] (-3360.838) (-3372.049) (-3362.365) * (-3358.942) (-3364.223) [-3350.868] (-3360.150) -- 0:05:13 391500 -- (-3353.361) (-3367.766) [-3363.099] (-3373.009) * (-3365.584) (-3364.782) (-3359.485) [-3358.562] -- 0:05:12 392000 -- (-3360.940) [-3354.369] (-3372.741) (-3361.720) * [-3358.647] (-3370.626) (-3353.982) (-3355.134) -- 0:05:11 392500 -- (-3359.668) (-3357.524) (-3367.542) [-3357.329] * (-3360.666) (-3366.181) [-3357.969] (-3361.819) -- 0:05:12 393000 -- (-3371.442) [-3367.275] (-3354.228) (-3356.773) * (-3368.506) (-3362.206) [-3355.220] (-3369.420) -- 0:05:11 393500 -- (-3362.841) (-3370.414) (-3362.345) [-3353.609] * [-3361.130] (-3358.818) (-3359.874) (-3365.149) -- 0:05:11 394000 -- (-3362.776) (-3361.447) [-3362.795] (-3370.070) * (-3358.710) [-3366.902] (-3364.765) (-3374.233) -- 0:05:10 394500 -- [-3362.558] (-3356.514) (-3367.298) (-3371.421) * [-3359.588] (-3371.054) (-3362.162) (-3360.795) -- 0:05:11 395000 -- (-3361.695) (-3357.070) [-3356.644] (-3359.533) * [-3358.831] (-3366.733) (-3366.326) (-3367.191) -- 0:05:10 Average standard deviation of split frequencies: 0.004100 395500 -- (-3361.346) (-3363.068) [-3359.594] (-3368.677) * [-3364.090] (-3360.462) (-3368.064) (-3360.228) -- 0:05:10 396000 -- (-3366.401) (-3367.408) [-3354.334] (-3361.260) * (-3364.253) (-3354.831) (-3355.624) [-3355.378] -- 0:05:09 396500 -- [-3355.201] (-3365.866) (-3359.099) (-3362.106) * (-3361.992) (-3367.520) (-3360.885) [-3367.552] -- 0:05:10 397000 -- (-3360.333) (-3356.939) [-3354.572] (-3365.333) * (-3365.040) (-3356.245) [-3354.194] (-3360.827) -- 0:05:09 397500 -- (-3369.550) (-3355.922) [-3358.141] (-3368.477) * (-3353.202) (-3365.464) [-3358.101] (-3356.352) -- 0:05:09 398000 -- (-3360.294) [-3355.033] (-3362.181) (-3364.078) * (-3359.168) (-3371.133) (-3363.536) [-3356.725] -- 0:05:08 398500 -- (-3360.775) (-3371.822) [-3360.694] (-3354.563) * (-3360.636) [-3364.416] (-3364.704) (-3359.014) -- 0:05:09 399000 -- (-3363.495) (-3366.281) [-3360.995] (-3350.259) * (-3357.924) [-3356.764] (-3362.901) (-3362.579) -- 0:05:08 399500 -- (-3360.397) [-3361.722] (-3359.772) (-3352.607) * (-3370.072) (-3366.368) (-3358.029) [-3359.013] -- 0:05:08 400000 -- (-3359.697) (-3356.818) [-3356.432] (-3365.753) * (-3357.560) [-3356.035] (-3359.082) (-3354.817) -- 0:05:07 Average standard deviation of split frequencies: 0.004575 400500 -- (-3360.936) (-3360.978) [-3357.625] (-3360.071) * (-3356.644) (-3365.248) [-3358.596] (-3370.433) -- 0:05:08 401000 -- [-3361.532] (-3364.483) (-3369.490) (-3358.311) * (-3360.671) (-3368.355) [-3354.779] (-3368.776) -- 0:05:07 401500 -- (-3356.003) (-3374.729) (-3367.319) [-3358.418] * [-3360.672] (-3363.458) (-3366.441) (-3365.031) -- 0:05:07 402000 -- [-3364.408] (-3370.890) (-3362.593) (-3367.121) * [-3359.856] (-3357.768) (-3359.200) (-3380.872) -- 0:05:06 402500 -- (-3374.478) (-3359.448) (-3360.592) [-3363.397] * (-3363.474) [-3357.675] (-3357.724) (-3369.637) -- 0:05:07 403000 -- (-3357.334) (-3381.385) (-3367.330) [-3359.096] * (-3365.324) (-3359.131) [-3359.591] (-3358.184) -- 0:05:06 403500 -- [-3352.609] (-3370.693) (-3360.937) (-3360.927) * (-3362.029) [-3362.628] (-3356.017) (-3357.576) -- 0:05:06 404000 -- (-3363.334) (-3363.530) [-3362.057] (-3359.388) * (-3359.149) (-3369.120) [-3363.058] (-3357.571) -- 0:05:06 404500 -- [-3360.793] (-3369.143) (-3360.452) (-3359.319) * [-3362.465] (-3369.118) (-3374.839) (-3365.451) -- 0:05:06 405000 -- (-3365.218) (-3370.491) [-3360.206] (-3363.603) * [-3360.087] (-3365.826) (-3367.000) (-3362.662) -- 0:05:05 Average standard deviation of split frequencies: 0.004902 405500 -- [-3356.967] (-3358.784) (-3361.259) (-3361.526) * (-3359.709) (-3357.664) (-3372.250) [-3359.700] -- 0:05:04 406000 -- [-3356.186] (-3364.518) (-3366.090) (-3358.504) * (-3370.221) (-3355.264) (-3373.370) [-3358.472] -- 0:05:05 406500 -- (-3370.335) (-3364.237) (-3356.158) [-3362.244] * (-3360.895) (-3357.546) (-3363.303) [-3360.952] -- 0:05:05 407000 -- (-3363.725) (-3362.618) [-3356.631] (-3364.955) * [-3358.351] (-3359.605) (-3355.545) (-3366.016) -- 0:05:04 407500 -- (-3356.310) (-3356.478) [-3352.820] (-3362.997) * (-3355.947) [-3358.030] (-3366.410) (-3368.374) -- 0:05:03 408000 -- (-3367.071) (-3366.553) (-3362.110) [-3360.232] * (-3353.528) (-3364.290) [-3359.900] (-3359.587) -- 0:05:04 408500 -- (-3360.645) (-3360.595) (-3357.727) [-3359.997] * (-3357.701) (-3362.705) (-3357.865) [-3358.248] -- 0:05:04 409000 -- (-3361.728) [-3352.658] (-3359.557) (-3359.041) * (-3350.164) (-3368.114) [-3354.266] (-3359.015) -- 0:05:03 409500 -- (-3363.553) (-3351.267) (-3367.534) [-3358.150] * [-3357.627] (-3364.529) (-3357.318) (-3357.822) -- 0:05:02 410000 -- [-3358.642] (-3358.783) (-3362.823) (-3359.956) * (-3376.227) (-3362.378) [-3352.984] (-3357.073) -- 0:05:03 Average standard deviation of split frequencies: 0.004974 410500 -- [-3359.710] (-3361.898) (-3357.383) (-3368.825) * [-3359.242] (-3358.468) (-3358.857) (-3356.063) -- 0:05:03 411000 -- [-3361.113] (-3357.953) (-3362.042) (-3358.001) * (-3358.212) (-3363.113) [-3358.118] (-3354.612) -- 0:05:02 411500 -- (-3360.848) (-3360.745) [-3357.663] (-3361.148) * [-3357.836] (-3365.990) (-3362.246) (-3361.697) -- 0:05:01 412000 -- (-3354.841) (-3360.038) [-3361.334] (-3362.912) * (-3358.622) [-3355.342] (-3371.331) (-3366.367) -- 0:05:02 412500 -- [-3363.901] (-3359.265) (-3371.651) (-3362.815) * (-3357.757) [-3360.594] (-3363.211) (-3361.972) -- 0:05:01 413000 -- (-3361.899) [-3360.911] (-3359.545) (-3359.599) * (-3361.797) (-3357.421) (-3355.016) [-3362.373] -- 0:05:01 413500 -- (-3358.410) [-3365.943] (-3358.953) (-3362.518) * (-3370.411) (-3353.827) [-3360.738] (-3354.328) -- 0:05:00 414000 -- (-3356.276) (-3364.820) (-3360.866) [-3357.196] * (-3368.338) [-3361.356] (-3362.922) (-3367.262) -- 0:05:01 414500 -- [-3358.949] (-3360.741) (-3361.633) (-3371.391) * (-3359.806) (-3358.309) [-3357.026] (-3361.529) -- 0:05:00 415000 -- [-3362.531] (-3361.043) (-3355.246) (-3368.953) * (-3358.183) (-3361.561) (-3361.543) [-3358.294] -- 0:05:00 Average standard deviation of split frequencies: 0.005792 415500 -- (-3364.983) (-3370.048) (-3351.056) [-3356.669] * (-3370.338) (-3373.608) [-3356.773] (-3360.441) -- 0:04:59 416000 -- [-3364.047] (-3365.306) (-3363.887) (-3371.152) * (-3361.924) (-3361.523) (-3362.583) [-3356.793] -- 0:05:00 416500 -- (-3362.951) [-3365.041] (-3363.183) (-3361.608) * (-3362.528) (-3365.946) [-3362.451] (-3358.187) -- 0:04:59 417000 -- (-3367.701) (-3361.063) (-3357.987) [-3359.827] * (-3364.252) (-3355.483) (-3360.331) [-3356.201] -- 0:04:59 417500 -- [-3359.444] (-3365.195) (-3360.067) (-3358.345) * [-3357.020] (-3356.074) (-3359.180) (-3364.907) -- 0:04:58 418000 -- (-3367.230) [-3364.788] (-3367.070) (-3364.328) * (-3368.781) (-3361.798) [-3358.613] (-3362.559) -- 0:04:59 418500 -- (-3365.729) [-3356.209] (-3371.799) (-3357.061) * (-3362.385) (-3356.368) (-3362.892) [-3358.088] -- 0:04:58 419000 -- [-3357.268] (-3357.607) (-3367.031) (-3367.577) * (-3361.342) (-3370.548) (-3362.833) [-3360.138] -- 0:04:58 419500 -- (-3355.510) [-3361.234] (-3365.987) (-3368.035) * (-3354.609) [-3363.644] (-3359.921) (-3372.537) -- 0:04:57 420000 -- (-3362.427) (-3363.075) [-3357.135] (-3357.323) * [-3354.507] (-3369.806) (-3358.066) (-3353.725) -- 0:04:58 Average standard deviation of split frequencies: 0.005603 420500 -- [-3360.177] (-3362.451) (-3364.055) (-3365.465) * (-3363.933) (-3362.394) [-3355.236] (-3359.251) -- 0:04:57 421000 -- [-3354.061] (-3367.603) (-3355.252) (-3358.927) * (-3359.350) [-3360.750] (-3353.400) (-3365.515) -- 0:04:57 421500 -- (-3358.726) (-3364.735) [-3360.512] (-3363.358) * (-3363.894) (-3360.665) (-3361.723) [-3355.517] -- 0:04:57 422000 -- (-3360.971) (-3359.334) (-3362.676) [-3361.784] * (-3359.518) [-3363.444] (-3360.134) (-3355.186) -- 0:04:57 422500 -- [-3364.408] (-3365.088) (-3362.416) (-3368.072) * [-3358.969] (-3358.221) (-3365.416) (-3368.579) -- 0:04:56 423000 -- (-3357.141) (-3357.737) (-3356.355) [-3352.653] * (-3358.379) (-3362.567) [-3364.552] (-3357.392) -- 0:04:56 423500 -- (-3363.602) [-3356.799] (-3362.254) (-3360.431) * (-3371.460) (-3373.700) [-3355.591] (-3366.460) -- 0:04:56 424000 -- (-3358.560) [-3360.874] (-3365.902) (-3372.857) * [-3358.243] (-3358.208) (-3368.212) (-3364.515) -- 0:04:56 424500 -- (-3367.012) (-3356.206) (-3365.410) [-3366.033] * (-3356.069) [-3361.161] (-3365.515) (-3357.653) -- 0:04:55 425000 -- [-3357.127] (-3359.593) (-3354.240) (-3351.665) * (-3361.544) (-3360.388) (-3361.519) [-3353.042] -- 0:04:54 Average standard deviation of split frequencies: 0.006025 425500 -- (-3372.061) [-3354.940] (-3356.773) (-3363.954) * (-3360.395) (-3364.418) (-3356.414) [-3360.184] -- 0:04:55 426000 -- (-3366.472) [-3353.421] (-3362.505) (-3359.629) * [-3356.848] (-3366.019) (-3359.857) (-3354.606) -- 0:04:55 426500 -- [-3362.854] (-3365.250) (-3363.457) (-3368.086) * [-3359.381] (-3371.048) (-3357.178) (-3365.690) -- 0:04:54 427000 -- (-3363.758) (-3355.953) (-3358.602) [-3363.702] * (-3370.508) [-3356.135] (-3352.515) (-3363.173) -- 0:04:53 427500 -- (-3360.364) (-3361.717) (-3385.425) [-3357.903] * (-3356.566) (-3367.066) (-3362.077) [-3361.157] -- 0:04:54 428000 -- (-3364.539) (-3367.872) [-3359.543] (-3364.793) * (-3362.852) (-3357.619) (-3367.526) [-3358.085] -- 0:04:54 428500 -- [-3368.455] (-3358.857) (-3356.965) (-3363.267) * (-3362.278) [-3355.623] (-3357.007) (-3354.121) -- 0:04:53 429000 -- (-3354.681) (-3363.197) [-3365.022] (-3362.494) * [-3357.359] (-3361.908) (-3369.978) (-3352.115) -- 0:04:52 429500 -- (-3364.072) (-3358.098) [-3359.505] (-3357.059) * [-3357.370] (-3360.926) (-3356.088) (-3366.503) -- 0:04:53 430000 -- [-3363.929] (-3361.822) (-3364.596) (-3356.405) * [-3357.114] (-3373.136) (-3361.559) (-3353.994) -- 0:04:52 Average standard deviation of split frequencies: 0.005351 430500 -- (-3355.721) (-3356.835) [-3353.261] (-3364.407) * (-3357.986) (-3367.216) (-3366.260) [-3357.048] -- 0:04:52 431000 -- (-3361.395) [-3357.969] (-3366.803) (-3357.753) * [-3358.613] (-3356.912) (-3355.987) (-3372.055) -- 0:04:51 431500 -- (-3376.660) (-3365.815) (-3356.648) [-3360.871] * (-3365.578) (-3366.102) [-3359.673] (-3363.888) -- 0:04:52 432000 -- (-3369.172) (-3360.879) [-3360.358] (-3357.161) * [-3354.939] (-3365.093) (-3363.047) (-3377.186) -- 0:04:51 432500 -- (-3360.378) [-3354.147] (-3361.254) (-3367.713) * [-3358.813] (-3359.721) (-3367.601) (-3372.151) -- 0:04:51 433000 -- [-3356.695] (-3371.268) (-3373.681) (-3357.844) * (-3356.202) (-3366.670) [-3357.365] (-3367.506) -- 0:04:50 433500 -- (-3359.207) (-3360.047) [-3357.086] (-3367.535) * [-3362.004] (-3358.183) (-3362.815) (-3364.216) -- 0:04:51 434000 -- [-3362.697] (-3363.601) (-3363.068) (-3363.227) * [-3354.575] (-3351.631) (-3362.197) (-3362.058) -- 0:04:50 434500 -- (-3359.923) [-3367.266] (-3361.119) (-3360.787) * (-3361.613) (-3361.015) [-3366.832] (-3360.538) -- 0:04:50 435000 -- (-3351.229) (-3364.557) [-3366.122] (-3355.086) * (-3362.150) (-3357.936) [-3353.133] (-3363.693) -- 0:04:49 Average standard deviation of split frequencies: 0.005046 435500 -- (-3358.694) [-3364.559] (-3363.620) (-3361.103) * (-3363.464) [-3354.946] (-3361.612) (-3359.802) -- 0:04:50 436000 -- (-3365.505) [-3358.201] (-3361.050) (-3363.006) * (-3348.312) (-3361.429) [-3362.017] (-3363.245) -- 0:04:49 436500 -- (-3364.205) (-3361.632) [-3364.078] (-3362.280) * (-3358.077) (-3372.860) [-3353.242] (-3363.453) -- 0:04:49 437000 -- [-3360.834] (-3355.265) (-3354.445) (-3360.836) * (-3364.317) (-3368.329) (-3360.350) [-3360.607] -- 0:04:48 437500 -- (-3364.662) (-3367.503) [-3361.103] (-3355.988) * (-3368.684) (-3352.489) (-3377.726) [-3358.211] -- 0:04:49 438000 -- (-3363.844) [-3367.882] (-3357.041) (-3360.492) * (-3365.692) (-3355.928) [-3354.037] (-3353.451) -- 0:04:48 438500 -- (-3362.159) (-3359.852) [-3364.535] (-3360.112) * (-3365.655) (-3359.974) [-3355.656] (-3358.128) -- 0:04:48 439000 -- [-3360.243] (-3356.368) (-3364.750) (-3368.449) * (-3363.211) [-3359.090] (-3360.676) (-3360.044) -- 0:04:48 439500 -- (-3368.998) (-3361.282) (-3361.643) [-3364.130] * (-3373.164) [-3358.347] (-3358.768) (-3361.259) -- 0:04:48 440000 -- (-3362.641) (-3355.294) [-3354.937] (-3360.898) * (-3361.972) [-3359.303] (-3370.818) (-3355.172) -- 0:04:47 Average standard deviation of split frequencies: 0.004754 440500 -- [-3354.870] (-3357.442) (-3359.775) (-3368.405) * (-3368.632) (-3360.291) [-3358.175] (-3356.541) -- 0:04:47 441000 -- (-3362.959) (-3352.749) [-3364.497] (-3361.522) * (-3364.776) [-3363.339] (-3360.001) (-3355.876) -- 0:04:47 441500 -- (-3355.068) [-3353.883] (-3359.765) (-3367.349) * [-3355.419] (-3364.527) (-3363.544) (-3359.333) -- 0:04:47 442000 -- [-3356.251] (-3364.307) (-3356.096) (-3360.751) * (-3367.588) (-3358.421) [-3370.502] (-3362.957) -- 0:04:46 442500 -- (-3360.132) (-3363.619) [-3356.894] (-3357.098) * (-3358.058) (-3357.088) (-3362.727) [-3360.637] -- 0:04:45 443000 -- (-3364.067) (-3358.587) (-3351.293) [-3352.570] * (-3360.924) [-3360.697] (-3369.235) (-3367.987) -- 0:04:46 443500 -- (-3370.065) (-3354.204) (-3358.456) [-3360.632] * [-3361.685] (-3363.889) (-3351.989) (-3361.772) -- 0:04:46 444000 -- [-3361.745] (-3362.556) (-3361.797) (-3356.074) * [-3358.564] (-3364.064) (-3358.522) (-3366.943) -- 0:04:45 444500 -- (-3372.399) (-3364.624) [-3358.024] (-3355.595) * (-3364.422) (-3362.365) [-3355.867] (-3375.707) -- 0:04:44 445000 -- (-3362.425) (-3361.347) [-3359.427] (-3365.876) * (-3364.988) (-3369.529) [-3356.271] (-3361.041) -- 0:04:45 Average standard deviation of split frequencies: 0.004698 445500 -- (-3359.194) (-3361.411) (-3365.435) [-3358.553] * (-3357.768) (-3359.404) (-3361.351) [-3357.915] -- 0:04:45 446000 -- [-3366.810] (-3361.500) (-3356.381) (-3365.534) * (-3352.630) (-3356.908) [-3357.627] (-3354.005) -- 0:04:44 446500 -- (-3364.014) [-3357.706] (-3360.467) (-3361.563) * (-3356.034) (-3360.827) (-3361.434) [-3357.576] -- 0:04:43 447000 -- (-3359.246) (-3368.523) (-3357.779) [-3355.633] * (-3356.363) (-3367.729) (-3367.672) [-3360.587] -- 0:04:44 447500 -- (-3365.515) (-3364.596) (-3357.901) [-3362.788] * [-3362.190] (-3364.948) (-3361.088) (-3362.877) -- 0:04:43 448000 -- (-3367.534) [-3364.132] (-3361.595) (-3353.999) * (-3355.516) (-3363.300) [-3359.935] (-3362.979) -- 0:04:43 448500 -- (-3354.772) (-3364.810) [-3363.895] (-3358.150) * (-3356.829) (-3357.790) [-3352.261] (-3357.184) -- 0:04:42 449000 -- (-3361.359) (-3369.002) (-3354.093) [-3362.306] * (-3354.615) [-3360.869] (-3359.515) (-3356.912) -- 0:04:43 449500 -- (-3356.105) [-3352.385] (-3362.226) (-3358.853) * (-3364.174) (-3364.847) [-3358.506] (-3381.113) -- 0:04:42 450000 -- (-3363.378) (-3360.162) [-3365.781] (-3362.763) * [-3355.169] (-3358.166) (-3355.640) (-3356.335) -- 0:04:42 Average standard deviation of split frequencies: 0.005230 450500 -- (-3370.117) [-3355.991] (-3373.058) (-3355.930) * [-3355.015] (-3364.437) (-3359.988) (-3361.413) -- 0:04:41 451000 -- (-3354.226) (-3361.160) (-3370.759) [-3360.689] * (-3357.471) [-3356.598] (-3356.764) (-3361.875) -- 0:04:42 451500 -- [-3365.229] (-3359.139) (-3361.293) (-3361.629) * [-3358.859] (-3360.692) (-3357.463) (-3368.463) -- 0:04:41 452000 -- [-3367.936] (-3358.359) (-3370.468) (-3352.579) * [-3353.046] (-3365.256) (-3358.287) (-3362.379) -- 0:04:41 452500 -- (-3359.630) (-3360.743) [-3362.585] (-3360.619) * (-3359.261) (-3362.328) (-3362.944) [-3365.168] -- 0:04:40 453000 -- (-3357.705) (-3365.893) (-3364.511) [-3354.183] * (-3360.844) (-3362.532) [-3352.112] (-3356.547) -- 0:04:41 453500 -- (-3356.594) [-3360.258] (-3363.084) (-3366.442) * [-3359.706] (-3360.407) (-3358.524) (-3366.397) -- 0:04:40 454000 -- (-3358.732) (-3364.710) [-3353.960] (-3352.968) * (-3367.660) (-3362.588) (-3360.575) [-3353.325] -- 0:04:40 454500 -- (-3367.702) (-3364.917) (-3356.514) [-3351.280] * [-3364.875] (-3362.039) (-3359.130) (-3359.683) -- 0:04:39 455000 -- (-3360.867) [-3359.337] (-3354.747) (-3357.088) * (-3362.527) (-3366.113) [-3353.468] (-3355.723) -- 0:04:40 Average standard deviation of split frequencies: 0.005628 455500 -- (-3358.911) [-3352.846] (-3359.016) (-3362.514) * [-3357.889] (-3362.422) (-3356.716) (-3364.706) -- 0:04:39 456000 -- (-3365.257) [-3356.595] (-3365.954) (-3361.037) * [-3358.816] (-3366.023) (-3361.400) (-3364.085) -- 0:04:39 456500 -- (-3352.699) (-3371.706) (-3368.496) [-3355.565] * (-3373.125) [-3355.958] (-3357.908) (-3367.256) -- 0:04:39 457000 -- [-3355.443] (-3365.362) (-3358.832) (-3353.146) * (-3357.151) [-3352.840] (-3354.059) (-3364.864) -- 0:04:39 457500 -- [-3356.983] (-3367.732) (-3364.907) (-3358.605) * (-3362.199) [-3360.965] (-3356.368) (-3362.979) -- 0:04:38 458000 -- (-3361.087) [-3361.471] (-3363.446) (-3354.342) * [-3351.285] (-3352.202) (-3360.136) (-3361.252) -- 0:04:38 458500 -- [-3357.203] (-3361.877) (-3357.875) (-3361.797) * (-3357.138) (-3363.368) [-3355.368] (-3381.270) -- 0:04:38 459000 -- [-3359.117] (-3359.217) (-3357.336) (-3359.811) * (-3358.674) (-3357.945) [-3359.919] (-3368.198) -- 0:04:38 459500 -- (-3366.287) (-3369.260) [-3357.156] (-3365.216) * (-3348.156) (-3351.823) [-3365.441] (-3363.287) -- 0:04:37 460000 -- (-3360.163) [-3360.805] (-3361.807) (-3359.312) * (-3357.551) (-3360.504) [-3360.433] (-3357.011) -- 0:04:37 Average standard deviation of split frequencies: 0.005685 460500 -- (-3352.842) (-3361.531) [-3352.806] (-3361.581) * (-3362.665) (-3363.435) [-3356.671] (-3362.919) -- 0:04:37 461000 -- (-3353.124) (-3386.281) [-3352.753] (-3360.957) * (-3359.220) [-3359.936] (-3362.820) (-3368.590) -- 0:04:37 461500 -- (-3362.849) (-3368.862) [-3362.338] (-3358.298) * (-3361.991) [-3365.454] (-3360.907) (-3374.404) -- 0:04:36 462000 -- (-3357.035) [-3358.056] (-3357.330) (-3357.211) * [-3357.681] (-3379.663) (-3364.641) (-3359.038) -- 0:04:35 462500 -- (-3354.553) (-3360.805) [-3359.451] (-3357.710) * (-3358.527) (-3368.841) [-3353.548] (-3357.598) -- 0:04:36 463000 -- (-3362.057) (-3364.508) [-3359.623] (-3365.787) * (-3365.168) (-3361.374) [-3360.661] (-3365.099) -- 0:04:36 463500 -- (-3358.794) (-3353.479) [-3355.048] (-3350.954) * (-3367.386) (-3366.120) (-3374.496) [-3358.550] -- 0:04:35 464000 -- [-3369.390] (-3354.631) (-3355.847) (-3358.119) * [-3363.250] (-3362.052) (-3368.710) (-3365.668) -- 0:04:34 464500 -- (-3362.428) [-3364.274] (-3363.363) (-3361.969) * (-3357.142) (-3360.795) (-3357.737) [-3358.402] -- 0:04:35 465000 -- [-3356.901] (-3374.200) (-3361.539) (-3367.459) * (-3364.772) (-3363.574) (-3360.491) [-3355.057] -- 0:04:34 Average standard deviation of split frequencies: 0.005058 465500 -- [-3357.603] (-3363.360) (-3355.985) (-3369.868) * [-3356.542] (-3361.768) (-3360.754) (-3362.135) -- 0:04:34 466000 -- (-3366.491) [-3354.717] (-3363.079) (-3357.327) * [-3352.726] (-3360.341) (-3355.324) (-3369.148) -- 0:04:33 466500 -- (-3365.641) (-3360.738) (-3368.553) [-3360.000] * (-3363.444) (-3364.856) (-3357.827) [-3360.446] -- 0:04:34 467000 -- (-3361.089) (-3359.435) (-3365.479) [-3357.700] * (-3358.120) (-3361.236) [-3357.220] (-3362.675) -- 0:04:33 467500 -- [-3357.742] (-3356.023) (-3361.635) (-3367.716) * (-3358.144) [-3360.192] (-3355.229) (-3363.442) -- 0:04:33 468000 -- (-3366.491) [-3357.885] (-3357.952) (-3360.750) * (-3355.141) (-3353.723) (-3355.110) [-3356.991] -- 0:04:32 468500 -- (-3358.451) (-3354.810) (-3365.420) [-3371.221] * (-3353.738) [-3363.143] (-3356.600) (-3353.869) -- 0:04:33 469000 -- (-3351.562) (-3357.558) [-3366.127] (-3371.624) * [-3358.131] (-3357.516) (-3365.790) (-3361.215) -- 0:04:32 469500 -- (-3356.321) [-3358.235] (-3367.774) (-3357.430) * (-3365.130) (-3369.990) [-3358.822] (-3361.592) -- 0:04:32 470000 -- (-3362.380) (-3376.521) (-3365.554) [-3353.764] * [-3363.864] (-3361.251) (-3363.590) (-3358.669) -- 0:04:31 Average standard deviation of split frequencies: 0.005898 470500 -- (-3363.255) (-3356.827) (-3361.240) [-3368.517] * (-3361.620) (-3363.188) (-3358.723) [-3361.208] -- 0:04:32 471000 -- [-3355.673] (-3358.678) (-3377.419) (-3364.738) * [-3366.619] (-3372.503) (-3358.628) (-3362.279) -- 0:04:31 471500 -- [-3357.516] (-3366.777) (-3366.654) (-3359.522) * (-3368.812) (-3374.795) (-3354.172) [-3357.056] -- 0:04:31 472000 -- (-3362.848) [-3362.464] (-3369.975) (-3368.433) * (-3361.067) [-3355.956] (-3361.822) (-3377.428) -- 0:04:30 472500 -- [-3365.435] (-3362.173) (-3358.451) (-3362.444) * [-3358.990] (-3368.497) (-3363.341) (-3354.802) -- 0:04:31 473000 -- (-3362.658) [-3356.921] (-3355.760) (-3355.760) * (-3356.591) (-3363.283) [-3360.236] (-3365.515) -- 0:04:30 473500 -- (-3354.408) (-3367.786) (-3360.531) [-3360.544] * (-3365.063) (-3362.492) [-3359.868] (-3357.232) -- 0:04:30 474000 -- [-3353.753] (-3364.660) (-3356.263) (-3368.608) * (-3364.952) [-3355.413] (-3358.175) (-3361.728) -- 0:04:29 474500 -- (-3360.880) [-3359.251] (-3370.061) (-3360.042) * (-3371.949) (-3357.604) [-3354.572] (-3356.202) -- 0:04:30 475000 -- (-3359.523) (-3359.638) [-3355.780] (-3357.795) * (-3368.032) [-3368.116] (-3360.850) (-3375.334) -- 0:04:29 Average standard deviation of split frequencies: 0.005612 475500 -- (-3353.797) (-3359.482) (-3362.245) [-3359.163] * [-3360.084] (-3369.134) (-3363.883) (-3363.947) -- 0:04:29 476000 -- (-3367.185) (-3371.121) [-3360.760] (-3369.812) * (-3360.298) (-3360.096) (-3365.857) [-3358.001] -- 0:04:29 476500 -- (-3366.498) (-3363.827) (-3356.757) [-3360.059] * [-3366.097] (-3368.366) (-3362.859) (-3360.274) -- 0:04:29 477000 -- [-3361.827] (-3356.701) (-3356.867) (-3362.837) * (-3360.164) (-3364.739) [-3361.780] (-3358.158) -- 0:04:28 477500 -- (-3363.859) (-3367.155) [-3367.111] (-3360.639) * (-3361.419) (-3369.532) (-3378.704) [-3363.242] -- 0:04:28 478000 -- [-3357.041] (-3354.437) (-3363.473) (-3358.105) * (-3371.283) [-3360.509] (-3364.794) (-3363.892) -- 0:04:28 478500 -- (-3360.039) (-3359.761) (-3357.313) [-3354.184] * [-3357.090] (-3367.791) (-3365.734) (-3367.489) -- 0:04:28 479000 -- (-3359.097) (-3361.763) (-3358.604) [-3356.941] * (-3358.085) (-3357.603) [-3359.497] (-3361.364) -- 0:04:27 479500 -- (-3369.831) (-3357.696) [-3353.935] (-3354.235) * (-3356.299) (-3364.606) [-3352.379] (-3367.145) -- 0:04:27 480000 -- (-3362.483) [-3357.069] (-3360.235) (-3357.709) * (-3362.652) (-3365.337) [-3353.375] (-3374.407) -- 0:04:27 Average standard deviation of split frequencies: 0.005666 480500 -- (-3362.062) (-3363.306) (-3362.786) [-3362.694] * (-3364.760) [-3358.114] (-3362.138) (-3369.560) -- 0:04:27 481000 -- [-3355.109] (-3366.245) (-3358.987) (-3358.037) * [-3361.183] (-3367.499) (-3358.556) (-3366.003) -- 0:04:26 481500 -- (-3362.578) (-3363.297) [-3359.010] (-3352.573) * (-3359.473) [-3354.050] (-3357.763) (-3367.945) -- 0:04:25 482000 -- [-3364.907] (-3359.625) (-3366.602) (-3370.374) * (-3365.168) (-3354.499) [-3360.835] (-3359.382) -- 0:04:26 482500 -- (-3379.769) [-3354.053] (-3360.174) (-3366.188) * (-3351.186) (-3368.914) [-3361.168] (-3357.083) -- 0:04:25 483000 -- (-3360.393) [-3360.261] (-3355.931) (-3360.036) * (-3358.036) (-3363.772) [-3362.804] (-3359.602) -- 0:04:25 483500 -- (-3358.617) (-3369.429) (-3353.569) [-3356.286] * (-3358.968) (-3360.648) (-3357.353) [-3367.731] -- 0:04:24 484000 -- [-3362.904] (-3356.592) (-3354.918) (-3365.035) * (-3355.051) [-3354.713] (-3357.895) (-3376.429) -- 0:04:25 484500 -- [-3358.676] (-3369.046) (-3363.856) (-3367.492) * (-3354.155) (-3353.392) [-3361.753] (-3376.873) -- 0:04:24 485000 -- [-3367.219] (-3360.925) (-3362.146) (-3361.702) * (-3363.610) (-3362.112) (-3363.578) [-3360.245] -- 0:04:24 Average standard deviation of split frequencies: 0.005065 485500 -- (-3354.955) (-3356.710) [-3358.908] (-3358.284) * (-3354.620) (-3364.509) [-3357.030] (-3368.004) -- 0:04:23 486000 -- (-3351.666) [-3355.863] (-3371.841) (-3357.559) * [-3355.479] (-3360.000) (-3361.038) (-3362.158) -- 0:04:24 486500 -- (-3355.068) (-3362.133) (-3363.722) [-3356.597] * (-3357.964) (-3365.557) [-3359.863] (-3363.819) -- 0:04:23 487000 -- (-3365.264) [-3361.517] (-3364.902) (-3361.042) * (-3357.649) (-3358.548) [-3363.697] (-3364.973) -- 0:04:23 487500 -- [-3373.068] (-3363.626) (-3362.562) (-3363.626) * (-3360.183) [-3359.382] (-3364.381) (-3378.051) -- 0:04:22 488000 -- [-3356.022] (-3358.716) (-3366.806) (-3367.751) * (-3362.137) (-3364.835) (-3368.696) [-3363.955] -- 0:04:23 488500 -- (-3361.556) (-3362.372) [-3358.540] (-3364.376) * (-3371.239) [-3357.805] (-3377.148) (-3376.365) -- 0:04:22 489000 -- (-3362.076) [-3363.075] (-3359.159) (-3358.075) * [-3358.588] (-3357.872) (-3359.419) (-3372.931) -- 0:04:22 489500 -- (-3365.670) [-3356.966] (-3356.634) (-3366.616) * (-3359.039) (-3352.952) [-3354.109] (-3360.916) -- 0:04:21 490000 -- (-3356.472) (-3366.961) [-3361.037] (-3361.844) * [-3361.094] (-3357.585) (-3358.646) (-3360.127) -- 0:04:22 Average standard deviation of split frequencies: 0.005124 490500 -- [-3362.552] (-3356.328) (-3371.121) (-3361.178) * [-3356.603] (-3358.311) (-3361.577) (-3360.233) -- 0:04:21 491000 -- (-3371.118) (-3364.655) [-3360.846] (-3366.643) * (-3356.750) (-3368.213) [-3359.412] (-3355.398) -- 0:04:21 491500 -- (-3362.833) (-3369.156) (-3364.648) [-3361.597] * (-3366.817) [-3362.509] (-3361.289) (-3361.760) -- 0:04:20 492000 -- (-3354.315) (-3368.808) (-3363.263) [-3355.104] * (-3359.266) (-3358.731) [-3357.503] (-3365.484) -- 0:04:21 492500 -- (-3358.888) [-3358.784] (-3365.276) (-3362.322) * (-3365.718) [-3358.135] (-3360.763) (-3361.149) -- 0:04:20 493000 -- (-3365.196) (-3357.517) [-3361.474] (-3358.750) * (-3353.730) [-3351.428] (-3364.609) (-3360.293) -- 0:04:20 493500 -- (-3359.249) [-3356.886] (-3369.322) (-3353.420) * (-3365.407) (-3360.281) (-3374.778) [-3355.158] -- 0:04:19 494000 -- (-3358.002) (-3358.975) (-3355.348) [-3357.467] * (-3357.780) [-3361.127] (-3357.695) (-3363.938) -- 0:04:20 494500 -- (-3352.413) (-3359.589) (-3363.176) [-3357.597] * [-3353.641] (-3361.047) (-3366.448) (-3361.268) -- 0:04:19 495000 -- [-3352.045] (-3365.600) (-3362.440) (-3366.062) * (-3352.931) (-3373.184) [-3353.726] (-3367.591) -- 0:04:19 Average standard deviation of split frequencies: 0.004963 495500 -- [-3359.006] (-3365.204) (-3359.714) (-3361.105) * [-3355.083] (-3368.498) (-3364.642) (-3368.235) -- 0:04:19 496000 -- (-3360.056) (-3366.882) (-3363.821) [-3353.118] * [-3357.422] (-3367.091) (-3363.907) (-3359.587) -- 0:04:19 496500 -- (-3367.956) (-3360.983) (-3360.924) [-3359.983] * [-3352.696] (-3364.463) (-3363.005) (-3378.447) -- 0:04:18 497000 -- (-3354.585) (-3357.663) (-3367.307) [-3358.006] * (-3357.581) [-3355.764] (-3355.168) (-3363.099) -- 0:04:18 497500 -- (-3354.930) (-3367.585) [-3355.245] (-3361.018) * (-3357.195) (-3359.304) [-3358.709] (-3367.082) -- 0:04:18 498000 -- [-3350.877] (-3351.907) (-3357.738) (-3358.850) * [-3357.410] (-3359.699) (-3358.160) (-3362.432) -- 0:04:18 498500 -- (-3351.455) (-3361.955) [-3357.623] (-3361.518) * (-3367.102) [-3358.117] (-3364.135) (-3355.128) -- 0:04:17 499000 -- (-3361.262) (-3359.837) (-3354.777) [-3360.537] * (-3353.281) (-3357.538) [-3352.608] (-3359.532) -- 0:04:17 499500 -- (-3363.537) [-3357.693] (-3355.130) (-3369.628) * [-3356.472] (-3363.426) (-3359.448) (-3362.637) -- 0:04:17 500000 -- (-3360.220) (-3359.208) [-3356.931] (-3367.922) * (-3362.329) (-3362.937) (-3372.385) [-3359.485] -- 0:04:17 Average standard deviation of split frequencies: 0.005649 500500 -- [-3361.078] (-3365.638) (-3355.899) (-3369.006) * (-3357.750) (-3372.214) (-3360.691) [-3367.717] -- 0:04:16 501000 -- (-3365.817) (-3364.293) [-3358.872] (-3366.816) * (-3356.024) (-3358.828) (-3362.949) [-3353.421] -- 0:04:15 501500 -- (-3358.167) (-3355.185) (-3367.844) [-3356.657] * (-3362.675) [-3358.792] (-3371.506) (-3356.228) -- 0:04:16 502000 -- (-3365.885) (-3359.907) (-3367.063) [-3355.367] * (-3369.915) [-3362.225] (-3365.446) (-3364.236) -- 0:04:15 502500 -- [-3354.770] (-3357.007) (-3362.201) (-3361.523) * [-3357.948] (-3357.986) (-3355.531) (-3365.367) -- 0:04:15 503000 -- (-3367.113) [-3358.002] (-3355.718) (-3366.176) * [-3356.252] (-3372.333) (-3353.938) (-3363.650) -- 0:04:14 503500 -- (-3363.587) (-3362.614) [-3357.854] (-3363.322) * (-3362.881) (-3370.571) [-3366.285] (-3368.156) -- 0:04:15 504000 -- [-3363.359] (-3366.047) (-3355.305) (-3368.519) * (-3358.691) (-3371.476) (-3369.703) [-3366.969] -- 0:04:14 504500 -- (-3357.589) (-3362.640) (-3362.911) [-3362.200] * (-3360.805) (-3367.284) (-3370.376) [-3356.077] -- 0:04:14 505000 -- (-3356.486) [-3365.457] (-3361.259) (-3370.294) * (-3375.487) [-3362.118] (-3363.362) (-3360.086) -- 0:04:13 Average standard deviation of split frequencies: 0.005693 505500 -- [-3353.813] (-3357.117) (-3367.850) (-3360.071) * (-3360.079) (-3363.544) [-3357.410] (-3364.243) -- 0:04:14 506000 -- [-3353.323] (-3356.916) (-3368.373) (-3365.350) * (-3368.309) (-3363.544) [-3363.244] (-3361.303) -- 0:04:13 506500 -- (-3359.139) (-3362.141) [-3358.287] (-3353.564) * (-3369.487) (-3356.256) [-3356.605] (-3363.309) -- 0:04:13 507000 -- (-3371.747) (-3359.979) [-3366.208] (-3366.746) * (-3367.154) (-3367.710) (-3359.135) [-3359.575] -- 0:04:12 507500 -- (-3363.597) (-3362.357) (-3377.200) [-3363.171] * (-3365.656) [-3354.073] (-3361.846) (-3367.610) -- 0:04:13 508000 -- (-3363.269) (-3359.012) [-3361.538] (-3364.919) * (-3354.561) (-3366.696) [-3358.074] (-3360.838) -- 0:04:12 508500 -- (-3357.545) [-3353.983] (-3360.920) (-3355.103) * (-3363.476) (-3356.528) (-3358.176) [-3357.658] -- 0:04:12 509000 -- (-3357.104) (-3353.344) (-3369.668) [-3359.730] * [-3357.276] (-3356.247) (-3356.884) (-3362.050) -- 0:04:11 509500 -- (-3365.176) (-3360.260) (-3352.633) [-3360.197] * [-3359.506] (-3361.962) (-3359.922) (-3366.024) -- 0:04:12 510000 -- (-3356.403) [-3362.010] (-3357.576) (-3372.288) * (-3357.463) [-3357.263] (-3356.879) (-3358.312) -- 0:04:11 Average standard deviation of split frequencies: 0.005436 510500 -- (-3359.479) (-3362.481) [-3360.873] (-3367.028) * [-3357.991] (-3371.145) (-3358.871) (-3359.481) -- 0:04:11 511000 -- (-3359.980) (-3363.399) (-3356.964) [-3357.338] * (-3361.839) [-3359.666] (-3364.845) (-3352.550) -- 0:04:10 511500 -- (-3357.571) (-3356.649) (-3365.078) [-3356.153] * (-3366.915) (-3377.622) [-3355.354] (-3368.522) -- 0:04:11 512000 -- (-3366.569) (-3355.036) [-3353.048] (-3366.785) * [-3368.649] (-3367.094) (-3356.709) (-3360.696) -- 0:04:10 512500 -- (-3356.858) [-3353.175] (-3361.842) (-3361.006) * (-3358.225) [-3356.073] (-3358.895) (-3363.210) -- 0:04:10 513000 -- [-3362.421] (-3354.169) (-3368.599) (-3357.123) * [-3360.354] (-3365.398) (-3362.959) (-3360.360) -- 0:04:10 513500 -- (-3361.759) [-3360.278] (-3356.756) (-3363.504) * (-3362.974) [-3360.129] (-3358.302) (-3355.184) -- 0:04:10 514000 -- (-3360.775) [-3360.614] (-3355.705) (-3371.363) * (-3370.207) [-3360.606] (-3361.390) (-3359.260) -- 0:04:09 514500 -- (-3368.940) (-3360.042) [-3354.187] (-3354.582) * [-3359.971] (-3354.756) (-3365.487) (-3355.338) -- 0:04:09 515000 -- [-3358.086] (-3368.981) (-3363.471) (-3364.193) * (-3367.552) (-3356.117) [-3356.169] (-3370.108) -- 0:04:09 Average standard deviation of split frequencies: 0.005380 515500 -- [-3365.619] (-3357.526) (-3353.699) (-3360.648) * (-3373.577) (-3366.146) (-3362.972) [-3366.074] -- 0:04:09 516000 -- (-3360.821) (-3357.351) [-3356.731] (-3366.237) * (-3353.093) (-3366.866) (-3365.907) [-3360.619] -- 0:04:08 516500 -- (-3359.855) (-3369.950) (-3357.004) [-3360.628] * (-3360.024) [-3362.503] (-3370.487) (-3374.427) -- 0:04:08 517000 -- (-3362.909) [-3372.346] (-3356.475) (-3361.483) * (-3360.289) (-3362.627) (-3363.506) [-3357.762] -- 0:04:08 517500 -- (-3360.264) (-3366.888) (-3357.844) [-3355.299] * (-3363.893) (-3369.795) (-3364.500) [-3364.925] -- 0:04:08 518000 -- (-3360.099) (-3361.400) (-3361.331) [-3364.741] * [-3357.147] (-3358.339) (-3377.212) (-3361.570) -- 0:04:07 518500 -- (-3359.541) (-3357.762) [-3356.028] (-3363.502) * [-3356.975] (-3356.970) (-3361.167) (-3369.585) -- 0:04:07 519000 -- (-3363.764) [-3357.402] (-3364.715) (-3354.924) * (-3364.172) [-3357.025] (-3361.408) (-3358.027) -- 0:04:07 519500 -- (-3361.073) [-3354.183] (-3363.741) (-3367.484) * (-3361.653) (-3358.295) (-3367.044) [-3364.247] -- 0:04:06 520000 -- [-3352.978] (-3355.879) (-3355.448) (-3369.881) * (-3360.162) (-3362.178) (-3362.364) [-3361.112] -- 0:04:06 Average standard deviation of split frequencies: 0.005935 520500 -- (-3358.314) (-3366.331) [-3359.408] (-3369.795) * (-3360.516) [-3361.641] (-3365.826) (-3356.010) -- 0:04:05 521000 -- (-3360.758) (-3376.474) [-3355.034] (-3375.154) * (-3360.434) (-3359.437) [-3369.994] (-3365.926) -- 0:04:06 521500 -- [-3363.942] (-3361.920) (-3366.506) (-3364.024) * (-3359.854) [-3357.743] (-3358.506) (-3361.321) -- 0:04:05 522000 -- [-3361.449] (-3359.907) (-3363.912) (-3361.139) * (-3364.309) (-3372.048) [-3356.634] (-3375.281) -- 0:04:05 522500 -- (-3362.394) [-3357.481] (-3357.767) (-3364.265) * (-3367.432) (-3367.745) [-3362.290] (-3361.261) -- 0:04:04 523000 -- (-3354.961) [-3358.608] (-3365.866) (-3365.347) * (-3373.724) (-3361.840) (-3362.632) [-3357.990] -- 0:04:05 523500 -- (-3356.264) (-3356.317) [-3353.164] (-3370.467) * (-3361.693) (-3368.535) [-3360.516] (-3364.362) -- 0:04:04 524000 -- (-3359.584) (-3355.784) [-3350.495] (-3353.860) * (-3362.372) (-3359.547) (-3370.287) [-3357.362] -- 0:04:04 524500 -- (-3366.764) [-3367.068] (-3356.951) (-3353.806) * (-3354.879) (-3361.019) (-3363.921) [-3359.270] -- 0:04:03 525000 -- (-3360.686) (-3374.276) (-3356.716) [-3355.987] * [-3357.040] (-3372.316) (-3359.759) (-3367.438) -- 0:04:04 Average standard deviation of split frequencies: 0.006273 525500 -- (-3374.528) [-3354.854] (-3356.189) (-3360.099) * (-3354.400) (-3362.508) (-3356.229) [-3361.996] -- 0:04:03 526000 -- (-3366.084) (-3359.431) [-3360.667] (-3368.011) * (-3353.481) (-3366.751) [-3362.492] (-3357.235) -- 0:04:03 526500 -- (-3366.003) (-3367.689) (-3356.804) [-3358.304] * [-3358.178] (-3364.646) (-3356.629) (-3365.463) -- 0:04:02 527000 -- (-3365.160) (-3359.975) [-3359.413] (-3369.018) * (-3369.148) [-3363.907] (-3371.739) (-3357.233) -- 0:04:03 527500 -- (-3360.304) (-3366.051) [-3358.865] (-3356.055) * (-3364.396) [-3361.955] (-3357.136) (-3362.013) -- 0:04:02 528000 -- (-3354.928) (-3376.005) [-3361.488] (-3352.890) * (-3366.750) (-3363.494) [-3357.120] (-3357.796) -- 0:04:02 528500 -- (-3356.257) (-3368.248) (-3363.482) [-3357.815] * [-3353.490] (-3364.777) (-3357.915) (-3363.507) -- 0:04:01 529000 -- [-3358.208] (-3361.563) (-3358.994) (-3368.428) * [-3357.635] (-3362.303) (-3359.088) (-3369.745) -- 0:04:02 529500 -- (-3374.782) [-3360.225] (-3356.371) (-3359.631) * (-3360.125) (-3358.923) [-3356.650] (-3364.697) -- 0:04:01 530000 -- (-3359.817) [-3360.011] (-3371.372) (-3357.922) * (-3357.889) (-3356.961) [-3358.862] (-3360.384) -- 0:04:01 Average standard deviation of split frequencies: 0.006120 530500 -- (-3375.355) [-3373.664] (-3358.309) (-3361.414) * (-3355.641) (-3356.466) (-3364.087) [-3361.336] -- 0:04:00 531000 -- [-3358.355] (-3374.661) (-3364.841) (-3377.996) * (-3360.692) [-3373.286] (-3365.869) (-3360.129) -- 0:04:01 531500 -- (-3356.213) [-3357.821] (-3358.798) (-3370.937) * (-3358.234) (-3353.509) (-3358.479) [-3357.678] -- 0:04:00 532000 -- (-3361.865) (-3358.728) [-3357.892] (-3375.573) * (-3357.711) [-3356.576] (-3356.407) (-3372.611) -- 0:04:00 532500 -- (-3354.301) (-3357.746) (-3358.264) [-3365.104] * [-3359.143] (-3370.927) (-3351.514) (-3362.324) -- 0:04:00 533000 -- (-3361.070) [-3357.549] (-3350.345) (-3363.359) * (-3365.941) [-3356.567] (-3367.193) (-3369.160) -- 0:04:00 533500 -- (-3360.365) (-3375.843) [-3355.737] (-3362.229) * (-3359.262) [-3357.838] (-3364.627) (-3364.705) -- 0:03:59 534000 -- (-3368.431) (-3360.057) [-3358.525] (-3355.215) * (-3357.635) (-3357.265) (-3364.436) [-3355.103] -- 0:03:59 534500 -- (-3358.283) (-3358.273) (-3360.075) [-3352.816] * (-3357.822) (-3357.610) [-3357.193] (-3367.046) -- 0:03:59 535000 -- (-3355.268) (-3361.264) (-3361.782) [-3353.035] * (-3358.967) [-3354.735] (-3357.162) (-3362.903) -- 0:03:59 Average standard deviation of split frequencies: 0.006156 535500 -- [-3366.130] (-3361.820) (-3355.156) (-3355.659) * (-3363.173) (-3370.695) (-3360.798) [-3356.557] -- 0:03:58 536000 -- (-3359.279) (-3360.897) [-3358.875] (-3366.545) * (-3361.953) (-3367.380) [-3357.882] (-3359.079) -- 0:03:58 536500 -- (-3353.572) [-3360.475] (-3354.046) (-3354.085) * (-3359.823) (-3356.413) (-3362.660) [-3356.801] -- 0:03:58 537000 -- (-3358.939) [-3355.959] (-3360.588) (-3362.781) * (-3367.564) (-3365.092) (-3364.264) [-3358.444] -- 0:03:57 537500 -- (-3364.217) (-3358.462) (-3360.591) [-3372.640] * [-3356.968] (-3360.826) (-3364.986) (-3365.543) -- 0:03:57 538000 -- (-3359.754) (-3359.201) [-3363.509] (-3371.454) * (-3359.125) (-3355.856) [-3367.754] (-3366.268) -- 0:03:57 538500 -- (-3365.619) (-3368.948) [-3362.603] (-3359.076) * [-3359.395] (-3357.371) (-3365.896) (-3357.492) -- 0:03:57 539000 -- [-3357.199] (-3355.033) (-3355.468) (-3363.518) * [-3359.225] (-3353.889) (-3356.580) (-3366.614) -- 0:03:56 539500 -- [-3351.438] (-3365.249) (-3361.863) (-3369.139) * [-3354.300] (-3365.428) (-3371.041) (-3359.028) -- 0:03:56 540000 -- [-3364.642] (-3366.484) (-3364.055) (-3361.050) * [-3353.501] (-3379.159) (-3366.517) (-3354.029) -- 0:03:55 Average standard deviation of split frequencies: 0.005522 540500 -- (-3373.716) (-3356.923) [-3362.083] (-3361.876) * (-3361.482) (-3361.397) (-3362.801) [-3358.581] -- 0:03:56 541000 -- [-3358.892] (-3353.488) (-3365.178) (-3359.246) * (-3365.005) (-3356.246) [-3360.156] (-3360.912) -- 0:03:55 541500 -- [-3358.139] (-3366.137) (-3364.561) (-3365.712) * (-3369.640) [-3354.133] (-3366.750) (-3352.254) -- 0:03:55 542000 -- (-3355.330) [-3360.133] (-3352.565) (-3356.775) * (-3368.472) [-3354.464] (-3361.089) (-3356.239) -- 0:03:54 542500 -- [-3356.439] (-3363.621) (-3361.300) (-3353.691) * (-3364.232) [-3366.343] (-3357.592) (-3361.890) -- 0:03:55 543000 -- (-3353.531) (-3362.991) (-3363.407) [-3356.580] * (-3363.660) [-3360.505] (-3360.065) (-3367.822) -- 0:03:54 543500 -- (-3359.961) (-3371.061) (-3359.891) [-3357.294] * (-3360.184) (-3360.109) [-3353.615] (-3363.692) -- 0:03:54 544000 -- (-3355.349) (-3359.508) [-3357.390] (-3367.185) * (-3363.552) (-3363.854) [-3355.772] (-3366.656) -- 0:03:53 544500 -- (-3374.299) [-3356.455] (-3366.897) (-3359.492) * (-3355.620) (-3365.740) [-3359.913] (-3358.816) -- 0:03:54 545000 -- (-3384.049) [-3360.635] (-3376.958) (-3365.755) * (-3358.998) (-3360.206) (-3357.145) [-3361.666] -- 0:03:53 Average standard deviation of split frequencies: 0.005948 545500 -- [-3364.813] (-3367.083) (-3373.198) (-3360.690) * (-3354.701) (-3357.959) (-3370.814) [-3358.701] -- 0:03:53 546000 -- (-3361.982) [-3366.072] (-3359.464) (-3371.757) * (-3359.665) (-3363.759) (-3361.959) [-3356.304] -- 0:03:52 546500 -- (-3357.782) (-3360.510) [-3359.339] (-3364.952) * (-3369.948) [-3357.082] (-3361.553) (-3352.109) -- 0:03:53 547000 -- (-3357.645) (-3359.817) [-3357.133] (-3369.010) * (-3365.774) [-3359.756] (-3370.047) (-3353.818) -- 0:03:52 547500 -- (-3359.431) (-3366.073) [-3352.153] (-3366.010) * (-3368.228) (-3352.531) (-3363.379) [-3357.652] -- 0:03:52 548000 -- [-3353.633] (-3362.956) (-3357.201) (-3363.458) * [-3359.187] (-3355.093) (-3361.764) (-3364.567) -- 0:03:51 548500 -- (-3358.397) [-3363.668] (-3363.168) (-3366.991) * (-3360.823) (-3360.626) (-3363.699) [-3355.697] -- 0:03:52 549000 -- (-3365.565) (-3360.622) [-3353.083] (-3358.744) * (-3367.609) (-3361.261) (-3367.942) [-3360.805] -- 0:03:51 549500 -- (-3367.042) [-3367.386] (-3367.000) (-3353.026) * [-3356.584] (-3358.633) (-3367.314) (-3371.101) -- 0:03:51 550000 -- (-3374.965) [-3362.596] (-3353.716) (-3358.216) * [-3360.309] (-3363.368) (-3362.720) (-3357.807) -- 0:03:51 Average standard deviation of split frequencies: 0.006088 550500 -- (-3360.220) (-3359.765) (-3357.747) [-3360.467] * (-3368.864) (-3368.312) [-3357.839] (-3360.005) -- 0:03:51 551000 -- (-3362.187) (-3358.817) (-3367.870) [-3359.227] * (-3353.680) (-3357.903) [-3361.141] (-3359.826) -- 0:03:50 551500 -- (-3366.160) [-3368.092] (-3362.809) (-3364.494) * [-3355.294] (-3374.703) (-3368.543) (-3359.369) -- 0:03:50 552000 -- (-3356.415) (-3366.299) (-3375.534) [-3360.626] * (-3357.823) (-3362.774) (-3360.120) [-3360.591] -- 0:03:50 552500 -- (-3360.365) [-3358.790] (-3375.335) (-3355.776) * (-3370.079) (-3376.521) (-3365.991) [-3357.810] -- 0:03:50 553000 -- (-3362.839) (-3354.624) (-3369.419) [-3356.871] * [-3361.897] (-3357.219) (-3358.430) (-3363.959) -- 0:03:49 553500 -- (-3363.740) (-3361.128) [-3361.613] (-3357.195) * (-3364.058) [-3357.865] (-3367.042) (-3358.335) -- 0:03:49 554000 -- [-3357.167] (-3359.491) (-3363.687) (-3360.713) * (-3352.349) (-3358.084) [-3361.768] (-3357.817) -- 0:03:49 554500 -- [-3358.433] (-3362.943) (-3359.110) (-3354.772) * [-3362.109] (-3357.712) (-3359.030) (-3360.687) -- 0:03:48 555000 -- [-3360.976] (-3365.248) (-3365.673) (-3365.158) * (-3374.967) (-3361.446) [-3363.421] (-3361.931) -- 0:03:48 Average standard deviation of split frequencies: 0.005935 555500 -- (-3368.079) [-3356.298] (-3366.641) (-3370.527) * [-3364.582] (-3351.064) (-3355.175) (-3355.619) -- 0:03:48 556000 -- (-3369.656) [-3359.513] (-3356.867) (-3353.408) * (-3362.508) [-3357.873] (-3362.061) (-3353.829) -- 0:03:48 556500 -- (-3357.264) (-3360.736) (-3360.320) [-3354.955] * (-3361.043) (-3354.685) [-3352.485] (-3369.502) -- 0:03:47 557000 -- (-3355.483) (-3366.655) [-3368.310] (-3364.520) * (-3371.280) (-3358.298) (-3358.864) [-3355.400] -- 0:03:47 557500 -- [-3356.127] (-3362.962) (-3361.805) (-3363.472) * (-3363.037) (-3366.592) (-3361.310) [-3355.776] -- 0:03:47 558000 -- [-3366.824] (-3366.070) (-3356.350) (-3360.553) * (-3364.636) [-3364.715] (-3361.464) (-3361.467) -- 0:03:47 558500 -- [-3359.643] (-3365.762) (-3361.398) (-3359.033) * (-3366.762) (-3359.142) [-3361.582] (-3366.648) -- 0:03:46 559000 -- (-3356.612) [-3367.726] (-3364.228) (-3361.846) * (-3361.457) (-3366.204) [-3356.087] (-3361.475) -- 0:03:46 559500 -- [-3350.591] (-3367.148) (-3360.405) (-3358.688) * (-3366.535) [-3359.705] (-3376.652) (-3360.127) -- 0:03:45 560000 -- (-3360.108) (-3370.104) (-3358.797) [-3363.633] * (-3359.274) [-3355.247] (-3364.212) (-3357.884) -- 0:03:46 Average standard deviation of split frequencies: 0.005886 560500 -- (-3364.225) (-3360.472) (-3358.902) [-3359.026] * (-3359.744) (-3361.298) [-3359.909] (-3359.727) -- 0:03:45 561000 -- (-3374.229) (-3362.201) [-3353.070] (-3362.266) * (-3365.071) (-3353.830) [-3353.914] (-3368.971) -- 0:03:45 561500 -- (-3370.880) (-3358.359) [-3356.415] (-3367.996) * (-3358.628) (-3356.559) (-3376.126) [-3364.186] -- 0:03:44 562000 -- (-3371.271) (-3366.721) [-3355.459] (-3355.354) * [-3362.086] (-3365.534) (-3363.177) (-3354.315) -- 0:03:45 562500 -- (-3364.589) (-3379.337) [-3358.814] (-3355.528) * (-3367.686) (-3354.140) [-3361.396] (-3359.325) -- 0:03:44 563000 -- (-3364.132) (-3361.380) [-3361.957] (-3361.842) * (-3368.437) (-3353.386) [-3358.383] (-3357.272) -- 0:03:44 563500 -- [-3357.495] (-3360.875) (-3361.859) (-3358.337) * (-3360.707) [-3360.945] (-3358.291) (-3359.454) -- 0:03:43 564000 -- (-3364.328) (-3372.781) [-3355.303] (-3360.985) * (-3359.242) (-3361.178) [-3361.803] (-3369.098) -- 0:03:44 564500 -- (-3352.464) [-3362.720] (-3367.505) (-3361.768) * (-3364.849) (-3370.627) (-3354.430) [-3358.746] -- 0:03:43 565000 -- (-3357.357) (-3361.169) [-3365.733] (-3363.388) * (-3362.126) (-3362.526) (-3364.832) [-3356.733] -- 0:03:43 Average standard deviation of split frequencies: 0.005923 565500 -- (-3361.766) [-3355.739] (-3358.482) (-3362.551) * (-3360.000) (-3357.638) (-3354.905) [-3359.644] -- 0:03:42 566000 -- (-3369.118) (-3360.055) [-3358.453] (-3358.856) * (-3361.765) [-3361.679] (-3361.924) (-3363.647) -- 0:03:43 566500 -- (-3370.786) [-3369.391] (-3361.809) (-3362.183) * [-3360.687] (-3370.765) (-3367.186) (-3358.726) -- 0:03:42 567000 -- (-3363.098) (-3371.031) (-3355.608) [-3359.356] * (-3356.293) (-3370.294) [-3366.244] (-3367.800) -- 0:03:42 567500 -- (-3366.318) (-3371.189) [-3358.621] (-3360.367) * (-3375.724) [-3359.709] (-3371.834) (-3359.885) -- 0:03:42 568000 -- (-3362.569) (-3359.235) (-3356.069) [-3353.779] * [-3357.296] (-3361.852) (-3363.230) (-3366.969) -- 0:03:42 568500 -- [-3363.453] (-3370.717) (-3361.481) (-3356.156) * (-3360.215) (-3366.767) [-3355.189] (-3357.025) -- 0:03:41 569000 -- [-3356.718] (-3352.089) (-3362.875) (-3363.368) * (-3357.488) [-3361.760] (-3359.085) (-3364.111) -- 0:03:41 569500 -- (-3359.390) (-3360.402) [-3361.637] (-3361.969) * (-3371.803) [-3365.671] (-3366.817) (-3356.471) -- 0:03:41 570000 -- (-3367.637) (-3363.573) [-3362.546] (-3362.440) * (-3361.698) (-3367.333) [-3357.485] (-3358.473) -- 0:03:41 Average standard deviation of split frequencies: 0.006241 570500 -- [-3353.833] (-3376.328) (-3365.573) (-3360.035) * (-3375.298) (-3361.597) (-3362.181) [-3355.834] -- 0:03:40 571000 -- (-3366.664) (-3368.966) [-3358.604] (-3359.581) * [-3358.675] (-3357.751) (-3361.440) (-3361.668) -- 0:03:40 571500 -- (-3356.821) (-3364.648) [-3359.169] (-3355.891) * [-3359.387] (-3361.303) (-3361.104) (-3360.065) -- 0:03:40 572000 -- [-3355.446] (-3372.041) (-3362.268) (-3356.886) * (-3361.379) (-3357.154) [-3360.951] (-3362.163) -- 0:03:39 572500 -- [-3360.817] (-3363.764) (-3360.272) (-3353.991) * (-3363.478) (-3356.787) [-3353.732] (-3361.464) -- 0:03:39 573000 -- (-3364.603) (-3353.413) (-3372.053) [-3358.500] * (-3356.394) (-3360.191) (-3368.533) [-3354.181] -- 0:03:39 573500 -- (-3367.793) [-3368.921] (-3381.984) (-3358.449) * [-3365.683] (-3363.837) (-3361.408) (-3360.723) -- 0:03:39 574000 -- (-3366.801) [-3357.523] (-3368.479) (-3356.882) * (-3362.065) [-3357.675] (-3357.875) (-3367.592) -- 0:03:38 574500 -- [-3362.262] (-3360.301) (-3368.904) (-3360.256) * (-3360.095) (-3356.426) (-3369.239) [-3355.729] -- 0:03:38 575000 -- (-3359.192) (-3352.804) [-3355.316] (-3359.765) * (-3357.142) [-3354.303] (-3372.186) (-3360.805) -- 0:03:38 Average standard deviation of split frequencies: 0.005911 575500 -- [-3363.406] (-3361.074) (-3363.323) (-3359.214) * (-3357.521) [-3356.059] (-3366.095) (-3364.273) -- 0:03:38 576000 -- (-3358.513) [-3356.235] (-3360.753) (-3362.863) * (-3354.009) (-3361.309) [-3358.321] (-3363.478) -- 0:03:37 576500 -- (-3361.197) [-3371.699] (-3362.297) (-3369.658) * [-3360.905] (-3361.189) (-3359.276) (-3362.061) -- 0:03:37 577000 -- [-3360.684] (-3362.559) (-3369.362) (-3360.564) * (-3365.467) [-3361.630] (-3358.465) (-3370.131) -- 0:03:36 577500 -- (-3359.720) (-3362.708) [-3366.200] (-3364.208) * (-3365.792) [-3357.914] (-3358.256) (-3362.369) -- 0:03:37 578000 -- [-3365.527] (-3365.464) (-3352.665) (-3367.774) * [-3357.428] (-3353.687) (-3362.250) (-3362.107) -- 0:03:36 578500 -- [-3358.396] (-3363.306) (-3363.498) (-3362.049) * [-3364.298] (-3363.495) (-3362.916) (-3363.903) -- 0:03:36 579000 -- [-3358.358] (-3361.187) (-3363.867) (-3363.916) * (-3377.604) [-3360.837] (-3364.702) (-3368.316) -- 0:03:35 579500 -- (-3360.414) (-3369.782) [-3362.838] (-3368.452) * (-3364.318) [-3366.785] (-3358.495) (-3367.154) -- 0:03:36 580000 -- (-3359.072) (-3366.313) [-3355.630] (-3364.709) * (-3366.371) [-3361.159] (-3361.721) (-3364.692) -- 0:03:35 Average standard deviation of split frequencies: 0.006224 580500 -- (-3357.299) (-3358.867) [-3362.017] (-3357.515) * (-3358.807) (-3366.981) [-3359.765] (-3359.688) -- 0:03:35 581000 -- [-3364.170] (-3356.027) (-3361.324) (-3363.016) * [-3357.096] (-3360.551) (-3353.960) (-3355.508) -- 0:03:34 581500 -- (-3354.057) [-3360.376] (-3361.507) (-3363.957) * (-3371.146) [-3355.365] (-3353.162) (-3359.049) -- 0:03:35 582000 -- [-3361.061] (-3364.040) (-3358.570) (-3359.585) * (-3364.159) (-3359.422) [-3359.697] (-3363.596) -- 0:03:34 582500 -- (-3368.568) [-3358.703] (-3361.975) (-3357.084) * (-3362.580) [-3361.413] (-3360.820) (-3361.696) -- 0:03:34 583000 -- (-3356.445) [-3358.642] (-3363.096) (-3370.148) * (-3362.355) [-3355.252] (-3358.399) (-3364.976) -- 0:03:33 583500 -- (-3362.563) (-3371.121) [-3359.812] (-3358.220) * (-3361.314) (-3367.430) [-3356.387] (-3365.102) -- 0:03:34 584000 -- (-3367.503) [-3358.290] (-3361.527) (-3361.558) * [-3355.095] (-3366.086) (-3353.801) (-3366.985) -- 0:03:33 584500 -- [-3356.463] (-3355.506) (-3369.433) (-3364.651) * [-3352.163] (-3364.616) (-3358.277) (-3370.096) -- 0:03:33 585000 -- (-3376.220) [-3353.020] (-3355.379) (-3358.526) * (-3364.108) (-3366.175) (-3358.160) [-3353.106] -- 0:03:32 Average standard deviation of split frequencies: 0.005720 585500 -- (-3361.291) (-3361.210) (-3366.536) [-3354.604] * (-3368.152) (-3364.564) [-3355.794] (-3365.139) -- 0:03:33 586000 -- (-3359.057) [-3361.678] (-3357.243) (-3361.921) * (-3354.413) (-3370.312) [-3354.743] (-3368.548) -- 0:03:32 586500 -- [-3363.272] (-3360.356) (-3359.541) (-3363.950) * [-3357.127] (-3361.564) (-3355.986) (-3356.283) -- 0:03:32 587000 -- (-3368.797) (-3369.086) (-3361.891) [-3357.493] * (-3360.559) (-3363.851) (-3364.182) [-3358.011] -- 0:03:32 587500 -- (-3358.946) (-3359.103) [-3364.726] (-3359.964) * (-3365.666) (-3362.047) (-3364.238) [-3355.083] -- 0:03:32 588000 -- (-3360.427) (-3355.813) [-3365.625] (-3357.655) * (-3360.175) (-3363.497) [-3359.153] (-3364.304) -- 0:03:31 588500 -- (-3362.272) (-3363.195) (-3367.331) [-3358.695] * (-3360.407) (-3358.187) (-3372.609) [-3356.825] -- 0:03:31 589000 -- [-3356.509] (-3361.650) (-3364.166) (-3368.464) * [-3356.204] (-3351.749) (-3368.059) (-3368.515) -- 0:03:31 589500 -- [-3363.762] (-3362.381) (-3365.729) (-3363.818) * [-3360.101] (-3359.467) (-3365.219) (-3353.958) -- 0:03:30 590000 -- (-3367.962) [-3360.466] (-3364.740) (-3377.734) * (-3354.520) (-3352.621) (-3362.227) [-3354.159] -- 0:03:30 Average standard deviation of split frequencies: 0.006562 590500 -- (-3362.128) [-3368.469] (-3359.075) (-3358.541) * (-3361.057) (-3364.527) (-3368.770) [-3363.054] -- 0:03:30 591000 -- (-3361.527) (-3361.149) [-3357.037] (-3351.376) * (-3362.611) (-3357.591) (-3353.137) [-3365.143] -- 0:03:30 591500 -- (-3357.149) (-3363.876) [-3364.487] (-3352.845) * (-3358.908) [-3361.038] (-3364.236) (-3359.947) -- 0:03:29 592000 -- (-3366.826) [-3357.031] (-3366.761) (-3355.065) * (-3359.025) (-3359.344) [-3369.767] (-3363.389) -- 0:03:29 592500 -- [-3354.978] (-3360.524) (-3361.369) (-3359.609) * (-3368.156) [-3358.963] (-3367.967) (-3358.210) -- 0:03:29 593000 -- (-3359.844) (-3360.649) [-3357.624] (-3371.937) * [-3369.156] (-3363.058) (-3369.275) (-3353.927) -- 0:03:29 593500 -- (-3354.239) (-3369.700) (-3366.718) [-3365.812] * [-3363.121] (-3364.512) (-3360.646) (-3356.361) -- 0:03:28 594000 -- (-3356.541) (-3372.464) [-3355.931] (-3357.608) * [-3353.941] (-3357.309) (-3354.474) (-3361.007) -- 0:03:28 594500 -- (-3359.851) (-3367.863) [-3359.656] (-3354.849) * (-3358.782) (-3358.983) [-3363.494] (-3365.106) -- 0:03:28 595000 -- (-3358.074) (-3364.301) [-3353.891] (-3353.458) * (-3381.431) (-3358.650) [-3354.894] (-3360.256) -- 0:03:28 Average standard deviation of split frequencies: 0.005449 595500 -- [-3354.778] (-3361.032) (-3356.655) (-3363.765) * (-3354.723) (-3357.872) (-3362.840) [-3358.351] -- 0:03:27 596000 -- [-3364.532] (-3360.707) (-3356.426) (-3361.277) * [-3360.932] (-3359.768) (-3364.806) (-3356.505) -- 0:03:27 596500 -- [-3367.292] (-3351.542) (-3358.338) (-3368.349) * [-3353.650] (-3358.681) (-3360.870) (-3352.192) -- 0:03:26 597000 -- [-3354.662] (-3360.743) (-3369.312) (-3362.599) * (-3354.981) (-3362.034) (-3371.035) [-3360.634] -- 0:03:27 597500 -- [-3358.205] (-3366.965) (-3361.042) (-3361.018) * [-3353.788] (-3356.805) (-3363.367) (-3364.388) -- 0:03:26 598000 -- (-3358.251) (-3356.899) (-3358.729) [-3356.514] * [-3361.320] (-3360.519) (-3367.015) (-3364.255) -- 0:03:26 598500 -- (-3355.351) (-3367.143) (-3363.733) [-3356.332] * (-3363.632) (-3360.339) [-3357.068] (-3359.044) -- 0:03:25 599000 -- (-3364.614) (-3367.634) [-3354.147] (-3367.168) * (-3363.509) (-3370.046) [-3358.790] (-3356.430) -- 0:03:26 599500 -- (-3368.047) (-3358.635) [-3352.055] (-3364.072) * (-3362.002) [-3359.140] (-3361.317) (-3363.514) -- 0:03:25 600000 -- (-3353.659) (-3361.015) [-3357.620] (-3361.778) * (-3357.818) [-3356.256] (-3367.111) (-3355.222) -- 0:03:25 Average standard deviation of split frequencies: 0.005842 600500 -- [-3360.112] (-3361.055) (-3377.945) (-3363.233) * (-3353.747) [-3356.403] (-3355.761) (-3362.799) -- 0:03:24 601000 -- (-3362.219) (-3361.238) (-3363.925) [-3354.508] * (-3358.762) (-3362.431) [-3356.844] (-3357.811) -- 0:03:25 601500 -- [-3354.182] (-3371.059) (-3359.782) (-3360.510) * (-3360.726) (-3364.468) [-3358.042] (-3367.083) -- 0:03:24 602000 -- (-3373.583) (-3361.112) [-3354.718] (-3362.548) * (-3363.544) (-3365.195) [-3365.100] (-3361.802) -- 0:03:24 602500 -- (-3359.006) (-3362.696) [-3358.682] (-3358.442) * (-3369.559) (-3378.977) [-3360.724] (-3354.777) -- 0:03:23 603000 -- [-3358.430] (-3376.008) (-3359.959) (-3364.833) * (-3369.403) (-3362.234) [-3355.081] (-3360.768) -- 0:03:24 603500 -- [-3359.857] (-3370.292) (-3362.381) (-3361.828) * (-3355.636) (-3363.960) [-3359.240] (-3359.961) -- 0:03:23 604000 -- (-3359.895) (-3382.934) [-3356.682] (-3361.804) * (-3362.856) [-3358.321] (-3364.034) (-3357.252) -- 0:03:23 604500 -- (-3358.100) (-3364.065) [-3362.636] (-3363.839) * (-3365.515) (-3361.474) [-3360.831] (-3364.975) -- 0:03:22 605000 -- (-3357.521) [-3362.936] (-3364.653) (-3365.509) * (-3357.976) [-3363.816] (-3368.301) (-3357.656) -- 0:03:23 Average standard deviation of split frequencies: 0.005359 605500 -- (-3360.580) (-3367.175) (-3365.265) [-3364.154] * (-3369.968) (-3355.921) [-3364.051] (-3365.735) -- 0:03:22 606000 -- (-3357.879) (-3363.818) (-3363.538) [-3361.279] * (-3363.606) (-3363.637) [-3360.107] (-3361.174) -- 0:03:22 606500 -- (-3363.991) (-3360.471) (-3364.840) [-3359.212] * (-3357.428) (-3362.453) [-3350.731] (-3368.423) -- 0:03:22 607000 -- (-3374.958) (-3363.785) (-3369.239) [-3358.660] * (-3363.154) (-3354.740) (-3355.914) [-3359.947] -- 0:03:22 607500 -- (-3353.324) [-3358.952] (-3359.763) (-3357.875) * (-3363.279) (-3364.186) (-3362.713) [-3356.836] -- 0:03:21 608000 -- (-3351.645) (-3358.120) [-3357.553] (-3360.153) * (-3360.121) (-3368.567) [-3361.195] (-3362.965) -- 0:03:21 608500 -- (-3358.911) [-3359.064] (-3368.356) (-3355.285) * (-3362.948) (-3361.964) (-3354.536) [-3352.357] -- 0:03:21 609000 -- (-3358.879) (-3355.428) (-3368.529) [-3361.271] * (-3361.358) (-3362.251) (-3358.212) [-3354.044] -- 0:03:20 609500 -- [-3355.317] (-3370.953) (-3365.060) (-3359.922) * [-3357.569] (-3357.425) (-3373.596) (-3369.339) -- 0:03:20 610000 -- (-3363.356) (-3352.668) [-3359.081] (-3370.197) * (-3361.622) [-3358.532] (-3363.601) (-3360.070) -- 0:03:20 Average standard deviation of split frequencies: 0.005061 610500 -- (-3363.745) [-3351.312] (-3362.554) (-3373.861) * (-3355.445) (-3359.151) (-3360.558) [-3360.722] -- 0:03:20 611000 -- (-3354.985) (-3365.871) [-3356.523] (-3359.240) * [-3359.855] (-3355.751) (-3366.970) (-3363.403) -- 0:03:19 611500 -- [-3362.673] (-3368.160) (-3361.100) (-3359.696) * (-3378.793) (-3354.303) [-3352.057] (-3365.018) -- 0:03:19 612000 -- (-3359.134) (-3357.551) [-3357.833] (-3363.433) * [-3363.304] (-3362.173) (-3364.317) (-3361.025) -- 0:03:19 612500 -- [-3357.877] (-3362.981) (-3360.335) (-3364.962) * (-3359.268) (-3360.839) [-3360.321] (-3361.545) -- 0:03:19 613000 -- [-3353.506] (-3364.284) (-3360.070) (-3361.765) * (-3364.292) [-3359.125] (-3361.705) (-3364.409) -- 0:03:18 613500 -- [-3357.976] (-3364.115) (-3362.394) (-3365.892) * (-3363.465) (-3360.274) [-3356.440] (-3355.073) -- 0:03:18 614000 -- (-3359.385) (-3353.921) (-3366.330) [-3367.701] * (-3356.179) (-3363.789) (-3354.518) [-3356.421] -- 0:03:18 614500 -- (-3359.038) (-3362.479) [-3355.903] (-3355.665) * (-3351.109) (-3362.893) [-3362.243] (-3356.645) -- 0:03:18 615000 -- (-3359.161) (-3362.752) (-3356.397) [-3356.320] * (-3352.679) (-3372.202) (-3359.103) [-3359.248] -- 0:03:17 Average standard deviation of split frequencies: 0.005017 615500 -- (-3365.407) [-3356.897] (-3368.110) (-3358.782) * (-3353.719) (-3362.525) [-3365.284] (-3365.389) -- 0:03:17 616000 -- (-3361.442) (-3359.446) [-3360.278] (-3362.237) * (-3364.876) (-3372.103) (-3353.639) [-3364.025] -- 0:03:16 616500 -- (-3357.133) (-3356.930) [-3355.404] (-3359.148) * (-3368.744) (-3365.725) [-3356.956] (-3365.182) -- 0:03:17 617000 -- (-3355.085) (-3364.804) [-3363.549] (-3359.073) * [-3367.979] (-3363.262) (-3362.652) (-3373.653) -- 0:03:16 617500 -- [-3355.717] (-3362.768) (-3361.721) (-3364.297) * (-3361.558) [-3358.404] (-3358.782) (-3364.658) -- 0:03:16 618000 -- (-3365.079) [-3353.071] (-3363.830) (-3365.208) * (-3357.101) (-3361.568) (-3362.523) [-3354.969] -- 0:03:15 618500 -- [-3359.521] (-3356.693) (-3370.830) (-3363.501) * (-3368.739) (-3356.459) (-3354.457) [-3357.105] -- 0:03:16 619000 -- (-3358.162) (-3358.172) (-3367.547) [-3353.655] * (-3363.890) (-3354.455) (-3353.754) [-3354.791] -- 0:03:15 619500 -- [-3355.063] (-3356.344) (-3373.309) (-3358.924) * (-3354.606) (-3357.699) [-3357.139] (-3355.432) -- 0:03:15 620000 -- (-3365.694) [-3360.695] (-3362.357) (-3362.084) * (-3361.808) [-3363.928] (-3360.754) (-3361.248) -- 0:03:14 Average standard deviation of split frequencies: 0.005401 620500 -- (-3366.343) (-3359.573) (-3357.354) [-3365.575] * (-3360.492) (-3364.351) (-3358.367) [-3356.736] -- 0:03:15 621000 -- (-3361.423) (-3362.463) [-3355.424] (-3363.270) * (-3359.307) [-3359.821] (-3360.354) (-3366.156) -- 0:03:14 621500 -- [-3360.067] (-3359.366) (-3357.140) (-3363.448) * [-3365.486] (-3363.674) (-3375.223) (-3370.451) -- 0:03:14 622000 -- (-3365.840) [-3357.305] (-3361.043) (-3365.876) * (-3364.718) (-3359.511) (-3356.519) [-3360.847] -- 0:03:13 622500 -- [-3361.116] (-3357.888) (-3355.733) (-3366.389) * (-3363.877) (-3362.535) (-3367.284) [-3356.978] -- 0:03:14 623000 -- (-3366.617) [-3358.871] (-3359.564) (-3355.229) * [-3362.655] (-3366.547) (-3369.697) (-3363.667) -- 0:03:13 623500 -- [-3360.976] (-3359.770) (-3367.045) (-3357.030) * (-3361.046) (-3368.296) (-3358.233) [-3358.469] -- 0:03:13 624000 -- (-3357.747) (-3361.901) [-3360.052] (-3365.507) * (-3368.421) (-3368.990) [-3359.122] (-3360.572) -- 0:03:12 624500 -- [-3360.599] (-3355.698) (-3361.390) (-3365.739) * (-3360.973) [-3359.977] (-3360.828) (-3355.067) -- 0:03:13 625000 -- (-3361.378) (-3360.659) (-3356.877) [-3352.517] * [-3358.485] (-3359.615) (-3360.319) (-3356.651) -- 0:03:12 Average standard deviation of split frequencies: 0.006024 625500 -- (-3358.417) [-3353.805] (-3360.937) (-3359.271) * (-3364.183) (-3367.473) (-3354.716) [-3356.487] -- 0:03:12 626000 -- (-3359.767) (-3361.345) (-3368.156) [-3358.796] * (-3358.240) [-3353.980] (-3358.206) (-3361.735) -- 0:03:12 626500 -- (-3368.005) [-3367.029] (-3357.471) (-3367.728) * (-3362.062) (-3358.988) (-3360.323) [-3355.188] -- 0:03:11 627000 -- (-3357.717) [-3359.472] (-3368.016) (-3367.952) * (-3358.518) [-3362.177] (-3357.012) (-3363.873) -- 0:03:11 627500 -- [-3355.358] (-3364.277) (-3368.986) (-3369.319) * (-3361.250) (-3361.400) (-3355.418) [-3357.958] -- 0:03:11 628000 -- [-3359.121] (-3356.201) (-3371.902) (-3360.689) * (-3357.216) [-3360.493] (-3355.406) (-3359.876) -- 0:03:11 628500 -- (-3356.366) [-3357.063] (-3360.966) (-3363.939) * (-3371.972) [-3358.790] (-3367.992) (-3362.959) -- 0:03:10 629000 -- (-3359.494) (-3364.089) [-3359.038] (-3357.430) * (-3367.328) [-3358.948] (-3363.771) (-3366.474) -- 0:03:10 629500 -- [-3358.915] (-3357.418) (-3364.257) (-3367.772) * (-3367.199) [-3360.108] (-3359.614) (-3368.906) -- 0:03:10 630000 -- (-3365.328) (-3363.989) [-3356.625] (-3358.977) * (-3353.652) (-3357.851) [-3354.136] (-3361.688) -- 0:03:10 Average standard deviation of split frequencies: 0.005980 630500 -- (-3360.536) [-3354.882] (-3359.949) (-3366.564) * (-3368.094) [-3354.531] (-3353.864) (-3357.957) -- 0:03:09 631000 -- [-3358.577] (-3356.943) (-3354.889) (-3367.526) * (-3358.710) [-3357.150] (-3356.698) (-3356.384) -- 0:03:09 631500 -- [-3358.698] (-3360.366) (-3362.626) (-3350.512) * [-3362.472] (-3361.371) (-3360.419) (-3362.393) -- 0:03:09 632000 -- [-3362.890] (-3364.950) (-3370.262) (-3372.835) * (-3363.204) [-3356.883] (-3364.919) (-3364.459) -- 0:03:09 632500 -- (-3361.312) [-3357.948] (-3364.252) (-3360.133) * (-3366.749) (-3370.664) [-3356.448] (-3365.834) -- 0:03:08 633000 -- (-3366.279) (-3357.104) [-3361.073] (-3358.337) * [-3358.529] (-3360.012) (-3354.676) (-3366.336) -- 0:03:08 633500 -- (-3367.930) (-3355.889) (-3358.607) [-3358.425] * (-3355.997) (-3364.538) [-3357.639] (-3353.751) -- 0:03:08 634000 -- (-3354.190) (-3357.564) [-3353.364] (-3359.182) * (-3361.901) [-3361.492] (-3360.493) (-3360.709) -- 0:03:08 634500 -- (-3360.234) (-3360.671) [-3355.356] (-3356.649) * [-3357.541] (-3364.472) (-3361.847) (-3357.913) -- 0:03:07 635000 -- (-3359.392) (-3367.302) [-3354.713] (-3361.667) * (-3355.087) (-3364.844) [-3355.079] (-3357.888) -- 0:03:07 Average standard deviation of split frequencies: 0.006836 635500 -- (-3355.120) (-3365.022) [-3354.411] (-3362.547) * (-3362.305) [-3360.091] (-3358.297) (-3357.090) -- 0:03:07 636000 -- (-3358.533) [-3358.583] (-3353.689) (-3354.856) * (-3360.325) [-3352.833] (-3361.713) (-3360.369) -- 0:03:07 636500 -- (-3363.603) (-3359.714) [-3357.369] (-3363.907) * (-3365.102) [-3357.862] (-3361.545) (-3356.011) -- 0:03:06 637000 -- (-3366.837) (-3353.735) (-3358.849) [-3356.208] * (-3374.789) [-3367.352] (-3356.101) (-3357.302) -- 0:03:06 637500 -- [-3360.499] (-3361.850) (-3360.789) (-3362.285) * (-3362.891) (-3361.417) (-3359.319) [-3353.315] -- 0:03:06 638000 -- [-3360.145] (-3360.976) (-3357.410) (-3365.729) * [-3356.752] (-3358.059) (-3364.590) (-3363.648) -- 0:03:06 638500 -- [-3361.483] (-3367.108) (-3361.603) (-3361.909) * (-3362.834) (-3364.847) (-3358.315) [-3354.211] -- 0:03:05 639000 -- (-3351.768) [-3355.874] (-3359.500) (-3358.028) * [-3363.003] (-3375.020) (-3362.798) (-3362.721) -- 0:03:05 639500 -- [-3358.281] (-3361.118) (-3369.531) (-3360.509) * (-3362.867) (-3366.466) (-3355.944) [-3357.413] -- 0:03:05 640000 -- (-3359.995) (-3356.996) (-3372.299) [-3355.344] * (-3360.327) (-3361.199) [-3356.864] (-3358.033) -- 0:03:05 Average standard deviation of split frequencies: 0.007440 640500 -- (-3363.765) (-3358.624) (-3360.523) [-3363.847] * (-3365.783) [-3362.578] (-3363.466) (-3353.998) -- 0:03:04 641000 -- (-3370.128) [-3357.778] (-3371.383) (-3363.097) * (-3354.327) (-3363.863) (-3356.099) [-3353.638] -- 0:03:04 641500 -- (-3359.965) (-3363.034) [-3356.228] (-3365.019) * (-3375.872) (-3355.440) (-3358.017) [-3356.643] -- 0:03:04 642000 -- (-3355.948) (-3373.751) (-3373.306) [-3356.744] * (-3362.126) (-3362.281) (-3355.156) [-3353.176] -- 0:03:04 642500 -- [-3359.580] (-3362.511) (-3362.512) (-3354.935) * (-3362.404) (-3361.616) [-3358.031] (-3367.133) -- 0:03:03 643000 -- (-3366.527) [-3357.312] (-3371.993) (-3361.055) * (-3362.760) [-3369.443] (-3366.920) (-3364.554) -- 0:03:03 643500 -- (-3356.189) [-3359.525] (-3361.174) (-3358.667) * (-3363.992) (-3368.061) [-3357.835] (-3357.934) -- 0:03:03 644000 -- [-3358.172] (-3371.458) (-3365.218) (-3365.848) * (-3353.702) (-3368.647) [-3361.555] (-3370.578) -- 0:03:02 644500 -- [-3359.284] (-3361.324) (-3357.971) (-3354.605) * (-3362.808) [-3355.069] (-3355.612) (-3357.723) -- 0:03:02 645000 -- (-3359.008) (-3362.933) (-3364.722) [-3357.380] * (-3351.478) (-3356.062) (-3355.358) [-3352.000] -- 0:03:02 Average standard deviation of split frequencies: 0.007378 645500 -- (-3360.337) (-3355.345) [-3367.521] (-3362.387) * (-3359.613) (-3359.183) (-3356.255) [-3355.870] -- 0:03:02 646000 -- [-3356.966] (-3358.296) (-3361.913) (-3366.484) * (-3359.450) (-3357.080) (-3357.202) [-3355.131] -- 0:03:01 646500 -- (-3371.863) [-3365.252] (-3362.321) (-3355.643) * (-3363.223) (-3360.773) (-3359.478) [-3357.174] -- 0:03:01 647000 -- (-3363.298) (-3357.637) [-3353.922] (-3360.737) * (-3360.325) (-3355.701) [-3359.868] (-3356.349) -- 0:03:01 647500 -- (-3365.981) (-3354.727) [-3360.047] (-3365.114) * (-3362.977) [-3352.673] (-3365.270) (-3360.892) -- 0:03:01 648000 -- (-3357.827) [-3352.631] (-3359.496) (-3358.400) * [-3355.070] (-3354.581) (-3368.132) (-3359.251) -- 0:03:00 648500 -- (-3358.840) (-3364.117) (-3363.029) [-3364.181] * (-3360.891) (-3357.125) (-3354.241) [-3364.610] -- 0:03:00 649000 -- (-3359.676) (-3356.548) [-3358.329] (-3362.197) * (-3359.027) (-3360.345) [-3360.625] (-3360.851) -- 0:03:00 649500 -- (-3353.971) [-3353.048] (-3359.760) (-3363.567) * [-3360.367] (-3355.030) (-3370.851) (-3357.068) -- 0:03:00 650000 -- (-3364.328) (-3360.524) [-3358.454] (-3362.901) * [-3358.990] (-3354.053) (-3360.687) (-3360.502) -- 0:02:59 Average standard deviation of split frequencies: 0.008050 650500 -- (-3354.570) (-3357.597) [-3357.047] (-3363.164) * (-3362.663) (-3360.038) [-3356.896] (-3363.237) -- 0:02:59 651000 -- (-3357.618) (-3361.201) [-3362.304] (-3365.986) * (-3361.654) (-3353.058) (-3355.141) [-3351.671] -- 0:02:59 651500 -- (-3355.900) (-3368.724) [-3364.635] (-3357.972) * (-3358.770) (-3358.598) [-3357.435] (-3365.160) -- 0:02:59 652000 -- (-3371.072) [-3363.198] (-3361.044) (-3365.327) * [-3355.844] (-3353.002) (-3360.462) (-3361.220) -- 0:02:58 652500 -- (-3359.811) [-3358.080] (-3355.354) (-3359.408) * (-3361.947) (-3350.906) (-3373.804) [-3356.859] -- 0:02:58 653000 -- (-3354.607) [-3358.583] (-3356.333) (-3370.357) * (-3368.319) [-3355.607] (-3359.796) (-3357.045) -- 0:02:58 653500 -- (-3358.481) (-3359.613) [-3353.486] (-3365.950) * [-3360.467] (-3359.001) (-3356.773) (-3368.593) -- 0:02:58 654000 -- (-3368.365) (-3351.456) [-3350.765] (-3358.427) * (-3372.915) (-3360.425) [-3365.988] (-3363.834) -- 0:02:57 654500 -- (-3374.483) (-3369.177) [-3361.520] (-3367.836) * (-3377.330) [-3358.159] (-3357.533) (-3370.856) -- 0:02:57 655000 -- (-3359.682) [-3356.110] (-3358.575) (-3366.636) * (-3358.663) [-3355.180] (-3358.204) (-3355.391) -- 0:02:57 Average standard deviation of split frequencies: 0.008064 655500 -- (-3354.076) (-3368.208) (-3364.350) [-3358.607] * [-3361.244] (-3362.829) (-3372.254) (-3355.137) -- 0:02:57 656000 -- (-3359.059) [-3361.536] (-3369.800) (-3360.944) * [-3356.347] (-3370.980) (-3365.571) (-3361.056) -- 0:02:56 656500 -- [-3357.549] (-3358.504) (-3359.628) (-3361.724) * (-3359.369) (-3364.565) [-3357.390] (-3367.501) -- 0:02:56 657000 -- [-3352.242] (-3363.155) (-3359.981) (-3359.607) * [-3360.151] (-3364.056) (-3362.699) (-3359.944) -- 0:02:56 657500 -- (-3366.376) [-3356.641] (-3368.713) (-3359.452) * [-3358.485] (-3369.874) (-3360.971) (-3364.551) -- 0:02:56 658000 -- (-3364.752) (-3362.095) [-3358.574] (-3359.871) * (-3360.858) (-3370.255) [-3363.177] (-3361.369) -- 0:02:55 658500 -- [-3358.555] (-3361.549) (-3355.740) (-3359.684) * [-3369.004] (-3366.112) (-3358.819) (-3362.884) -- 0:02:55 659000 -- (-3357.271) [-3359.357] (-3362.774) (-3357.134) * (-3358.804) (-3359.671) (-3367.553) [-3362.505] -- 0:02:55 659500 -- (-3361.729) [-3357.686] (-3359.779) (-3362.772) * (-3361.279) (-3356.844) [-3355.260] (-3365.821) -- 0:02:55 660000 -- (-3362.599) [-3357.668] (-3359.801) (-3355.202) * (-3361.530) [-3356.362] (-3358.951) (-3368.700) -- 0:02:54 Average standard deviation of split frequencies: 0.007928 660500 -- (-3365.391) (-3382.159) (-3370.802) [-3361.435] * (-3365.615) [-3364.763] (-3360.251) (-3365.618) -- 0:02:54 661000 -- [-3363.114] (-3365.344) (-3366.217) (-3357.367) * [-3369.621] (-3366.127) (-3364.828) (-3354.886) -- 0:02:54 661500 -- (-3353.142) (-3357.743) (-3363.798) [-3354.027] * (-3369.042) (-3366.555) (-3366.973) [-3361.653] -- 0:02:53 662000 -- (-3363.483) [-3353.615] (-3362.466) (-3354.906) * (-3362.038) (-3372.321) [-3354.419] (-3358.200) -- 0:02:53 662500 -- [-3359.665] (-3361.694) (-3367.104) (-3360.934) * (-3372.599) (-3371.475) (-3363.069) [-3353.360] -- 0:02:53 663000 -- (-3368.740) [-3361.190] (-3364.208) (-3354.907) * [-3366.650] (-3350.370) (-3365.304) (-3359.140) -- 0:02:53 663500 -- (-3363.763) (-3362.797) [-3358.501] (-3367.250) * [-3362.395] (-3352.292) (-3366.483) (-3362.714) -- 0:02:52 664000 -- (-3366.276) (-3360.933) [-3360.299] (-3363.179) * (-3357.109) (-3369.508) [-3356.766] (-3352.507) -- 0:02:52 664500 -- (-3354.657) (-3362.243) (-3365.800) [-3356.932] * (-3365.903) [-3369.282] (-3359.921) (-3366.748) -- 0:02:52 665000 -- [-3356.927] (-3358.507) (-3353.013) (-3359.964) * (-3358.721) (-3374.448) (-3363.815) [-3356.756] -- 0:02:52 Average standard deviation of split frequencies: 0.007550 665500 -- (-3366.534) (-3359.163) (-3364.948) [-3357.433] * (-3357.034) (-3366.490) (-3358.299) [-3360.719] -- 0:02:51 666000 -- (-3365.574) (-3354.523) (-3360.747) [-3353.911] * (-3361.134) (-3372.913) [-3359.982] (-3365.559) -- 0:02:51 666500 -- (-3373.491) [-3358.212] (-3360.249) (-3356.441) * (-3368.226) [-3360.441] (-3358.797) (-3356.964) -- 0:02:51 667000 -- (-3365.117) [-3359.438] (-3361.460) (-3361.354) * (-3355.429) (-3357.589) (-3359.940) [-3358.383] -- 0:02:51 667500 -- (-3362.897) (-3360.213) (-3366.656) [-3364.024] * (-3363.618) (-3358.312) (-3361.964) [-3364.060] -- 0:02:50 668000 -- [-3358.682] (-3364.094) (-3360.333) (-3362.300) * (-3355.749) (-3362.504) (-3362.605) [-3358.185] -- 0:02:50 668500 -- [-3363.893] (-3356.433) (-3372.432) (-3365.759) * (-3366.207) [-3361.528] (-3363.796) (-3360.160) -- 0:02:50 669000 -- [-3359.577] (-3355.832) (-3373.872) (-3362.674) * (-3361.095) [-3356.880] (-3359.821) (-3363.161) -- 0:02:50 669500 -- (-3367.159) (-3367.350) (-3368.076) [-3360.695] * (-3362.601) (-3355.072) [-3353.173] (-3353.494) -- 0:02:49 670000 -- [-3363.041] (-3364.984) (-3377.034) (-3363.922) * (-3359.756) (-3366.415) (-3362.628) [-3362.014] -- 0:02:49 Average standard deviation of split frequencies: 0.007419 670500 -- [-3365.296] (-3361.640) (-3356.397) (-3365.879) * (-3364.630) (-3365.508) (-3366.976) [-3356.855] -- 0:02:49 671000 -- (-3358.464) (-3361.413) [-3355.043] (-3374.907) * (-3367.026) (-3373.441) [-3365.841] (-3363.324) -- 0:02:49 671500 -- (-3357.340) (-3362.555) [-3360.598] (-3356.719) * (-3366.655) (-3377.783) [-3360.573] (-3360.463) -- 0:02:48 672000 -- (-3358.654) (-3357.414) (-3360.885) [-3361.955] * (-3368.005) (-3364.059) (-3363.081) [-3358.104] -- 0:02:48 672500 -- (-3359.235) (-3363.735) [-3354.032] (-3352.397) * [-3368.133] (-3358.947) (-3359.537) (-3371.697) -- 0:02:48 673000 -- [-3355.198] (-3367.645) (-3362.097) (-3361.850) * (-3371.113) [-3354.128] (-3364.207) (-3359.378) -- 0:02:48 673500 -- [-3359.325] (-3361.195) (-3358.982) (-3364.179) * (-3370.399) (-3358.077) [-3367.952] (-3359.311) -- 0:02:47 674000 -- [-3354.946] (-3368.488) (-3363.437) (-3356.171) * (-3364.610) [-3358.982] (-3363.074) (-3366.632) -- 0:02:47 674500 -- (-3353.658) (-3369.973) (-3361.286) [-3351.738] * (-3366.481) [-3353.336] (-3360.189) (-3358.530) -- 0:02:47 675000 -- (-3358.841) [-3362.052] (-3371.130) (-3353.095) * (-3363.859) (-3365.538) (-3353.879) [-3361.575] -- 0:02:47 Average standard deviation of split frequencies: 0.007051 675500 -- (-3366.670) (-3368.892) [-3353.938] (-3354.351) * (-3359.327) (-3362.250) (-3363.645) [-3355.850] -- 0:02:46 676000 -- (-3359.621) (-3368.678) [-3360.385] (-3360.500) * [-3358.124] (-3381.229) (-3360.068) (-3352.423) -- 0:02:46 676500 -- (-3364.278) [-3353.895] (-3355.720) (-3360.974) * [-3362.585] (-3362.558) (-3359.937) (-3356.225) -- 0:02:46 677000 -- (-3362.334) (-3367.050) [-3357.643] (-3371.553) * (-3355.208) (-3361.923) [-3366.813] (-3362.431) -- 0:02:46 677500 -- (-3364.129) (-3361.745) [-3359.013] (-3370.444) * (-3360.098) [-3359.423] (-3356.866) (-3375.527) -- 0:02:45 678000 -- (-3359.611) [-3358.154] (-3366.410) (-3371.148) * (-3353.430) (-3364.682) [-3354.116] (-3365.003) -- 0:02:45 678500 -- [-3355.619] (-3366.349) (-3362.827) (-3365.490) * (-3356.396) (-3370.355) (-3367.338) [-3369.084] -- 0:02:45 679000 -- (-3368.715) [-3354.109] (-3359.097) (-3367.083) * (-3373.410) (-3370.988) (-3368.270) [-3360.493] -- 0:02:44 679500 -- (-3359.756) [-3358.682] (-3354.123) (-3364.776) * (-3370.334) (-3362.476) [-3357.742] (-3370.068) -- 0:02:44 680000 -- [-3361.927] (-3360.842) (-3350.991) (-3364.087) * (-3370.275) (-3358.634) [-3358.894] (-3356.146) -- 0:02:44 Average standard deviation of split frequencies: 0.007310 680500 -- (-3360.572) [-3363.987] (-3369.092) (-3364.508) * (-3363.367) (-3368.714) [-3355.745] (-3374.278) -- 0:02:44 681000 -- (-3358.455) [-3354.944] (-3355.014) (-3360.534) * [-3356.040] (-3362.147) (-3359.725) (-3360.568) -- 0:02:43 681500 -- (-3362.786) [-3357.645] (-3357.448) (-3357.094) * (-3360.062) [-3355.330] (-3364.147) (-3354.120) -- 0:02:43 682000 -- (-3360.831) [-3359.112] (-3366.693) (-3356.053) * (-3355.020) (-3363.091) (-3375.602) [-3356.857] -- 0:02:43 682500 -- (-3363.706) [-3357.103] (-3367.201) (-3357.237) * (-3363.091) (-3351.241) (-3360.659) [-3358.859] -- 0:02:43 683000 -- (-3361.060) [-3359.309] (-3367.632) (-3366.416) * (-3362.981) (-3357.136) (-3369.492) [-3357.955] -- 0:02:42 683500 -- (-3359.352) [-3354.334] (-3368.078) (-3362.858) * (-3368.226) (-3357.876) [-3357.550] (-3357.115) -- 0:02:42 684000 -- (-3362.738) (-3357.266) (-3362.950) [-3360.301] * [-3360.005] (-3360.534) (-3365.868) (-3362.463) -- 0:02:42 684500 -- (-3365.141) (-3359.977) (-3359.219) [-3361.504] * (-3370.967) (-3363.675) [-3361.244] (-3354.923) -- 0:02:42 685000 -- (-3365.141) (-3364.340) (-3356.695) [-3359.120] * (-3369.841) (-3361.714) [-3358.787] (-3357.505) -- 0:02:41 Average standard deviation of split frequencies: 0.007406 685500 -- (-3357.110) (-3366.288) [-3357.785] (-3353.661) * (-3361.356) (-3357.204) [-3356.091] (-3354.707) -- 0:02:41 686000 -- (-3368.827) (-3360.586) [-3362.325] (-3365.051) * [-3359.791] (-3359.662) (-3367.771) (-3355.549) -- 0:02:41 686500 -- (-3360.752) (-3357.934) (-3369.858) [-3356.308] * (-3360.131) [-3362.553] (-3361.883) (-3364.366) -- 0:02:41 687000 -- (-3359.986) (-3355.700) (-3360.652) [-3352.316] * (-3360.985) (-3368.620) (-3355.983) [-3361.981] -- 0:02:40 687500 -- [-3355.353] (-3356.919) (-3364.283) (-3360.335) * (-3357.958) [-3361.029] (-3370.508) (-3372.096) -- 0:02:40 688000 -- (-3359.102) [-3357.267] (-3362.913) (-3356.653) * [-3353.023] (-3374.957) (-3354.160) (-3363.060) -- 0:02:40 688500 -- (-3356.184) (-3362.852) [-3353.842] (-3358.758) * (-3356.397) (-3372.913) [-3355.901] (-3359.095) -- 0:02:40 689000 -- (-3361.204) (-3358.213) [-3351.953] (-3372.144) * (-3362.823) (-3361.597) [-3359.573] (-3365.480) -- 0:02:39 689500 -- (-3363.299) (-3354.169) [-3354.357] (-3358.845) * (-3356.438) (-3368.325) [-3359.192] (-3369.980) -- 0:02:39 690000 -- [-3357.544] (-3361.298) (-3362.979) (-3360.497) * (-3362.410) (-3362.247) [-3362.969] (-3370.731) -- 0:02:39 Average standard deviation of split frequencies: 0.007660 690500 -- [-3362.312] (-3360.544) (-3363.140) (-3354.418) * (-3359.796) (-3355.277) [-3365.575] (-3362.685) -- 0:02:39 691000 -- [-3360.203] (-3368.436) (-3367.674) (-3362.905) * [-3354.008] (-3361.112) (-3363.967) (-3357.794) -- 0:02:38 691500 -- (-3358.546) [-3358.099] (-3374.710) (-3358.903) * (-3359.482) [-3359.408] (-3363.542) (-3358.232) -- 0:02:38 692000 -- (-3356.390) (-3357.370) (-3363.567) [-3362.427] * (-3360.561) [-3362.558] (-3366.437) (-3356.226) -- 0:02:38 692500 -- [-3356.645] (-3357.561) (-3361.284) (-3360.606) * (-3357.717) (-3353.032) (-3359.779) [-3361.661] -- 0:02:38 693000 -- (-3357.975) [-3355.933] (-3370.587) (-3359.818) * (-3362.260) (-3363.341) (-3360.731) [-3360.188] -- 0:02:37 693500 -- [-3370.226] (-3365.275) (-3364.951) (-3356.851) * (-3364.235) (-3359.333) (-3356.182) [-3362.167] -- 0:02:37 694000 -- (-3358.919) (-3364.656) [-3363.659] (-3369.080) * [-3357.634] (-3359.913) (-3368.425) (-3367.485) -- 0:02:37 694500 -- (-3355.911) (-3368.053) (-3362.555) [-3365.450] * (-3364.510) (-3359.634) (-3365.633) [-3363.291] -- 0:02:37 695000 -- (-3355.195) (-3362.491) (-3367.721) [-3369.435] * (-3366.484) [-3361.758] (-3372.157) (-3362.785) -- 0:02:36 Average standard deviation of split frequencies: 0.007149 695500 -- [-3356.206] (-3354.348) (-3363.461) (-3354.450) * (-3360.788) [-3357.068] (-3366.944) (-3369.672) -- 0:02:36 696000 -- (-3359.054) (-3365.700) [-3360.614] (-3358.188) * (-3359.833) (-3362.850) [-3358.985] (-3363.557) -- 0:02:36 696500 -- [-3360.045] (-3362.811) (-3361.964) (-3361.189) * (-3364.897) (-3358.081) [-3363.410] (-3366.014) -- 0:02:35 697000 -- (-3361.152) (-3357.151) (-3361.247) [-3360.463] * [-3358.667] (-3369.737) (-3365.553) (-3364.256) -- 0:02:35 697500 -- [-3353.189] (-3359.808) (-3357.093) (-3358.578) * (-3358.210) [-3356.906] (-3363.007) (-3357.392) -- 0:02:35 698000 -- (-3363.000) (-3364.185) (-3360.168) [-3363.810] * (-3368.609) [-3349.775] (-3374.758) (-3361.404) -- 0:02:35 698500 -- [-3349.450] (-3361.049) (-3367.699) (-3367.170) * (-3365.021) [-3353.286] (-3362.585) (-3358.717) -- 0:02:34 699000 -- (-3360.709) (-3362.051) (-3364.217) [-3362.034] * (-3361.948) [-3362.504] (-3366.935) (-3354.944) -- 0:02:34 699500 -- (-3363.262) (-3357.848) [-3362.796] (-3356.387) * (-3357.831) (-3355.306) (-3359.558) [-3354.663] -- 0:02:34 700000 -- [-3357.549] (-3358.958) (-3355.620) (-3353.400) * [-3367.305] (-3363.295) (-3361.026) (-3363.178) -- 0:02:34 Average standard deviation of split frequencies: 0.006877 700500 -- (-3355.598) (-3363.093) (-3359.043) [-3353.500] * (-3354.660) [-3354.795] (-3361.758) (-3375.371) -- 0:02:33 701000 -- (-3358.202) [-3360.166] (-3356.061) (-3356.666) * (-3368.734) [-3359.346] (-3368.226) (-3366.910) -- 0:02:33 701500 -- (-3372.488) (-3358.457) (-3366.108) [-3356.278] * (-3363.839) (-3357.784) [-3356.727] (-3364.104) -- 0:02:33 702000 -- [-3356.261] (-3373.604) (-3361.067) (-3360.951) * (-3365.541) (-3365.901) (-3360.187) [-3362.879] -- 0:02:33 702500 -- (-3361.488) [-3361.391] (-3364.892) (-3356.216) * (-3363.642) (-3365.018) (-3365.186) [-3364.250] -- 0:02:32 703000 -- (-3359.455) (-3375.034) (-3375.635) [-3353.565] * [-3363.350] (-3362.589) (-3361.258) (-3362.911) -- 0:02:32 703500 -- (-3361.574) (-3363.311) (-3369.458) [-3352.424] * [-3361.161] (-3361.809) (-3361.089) (-3367.053) -- 0:02:32 704000 -- [-3359.492] (-3360.620) (-3365.781) (-3362.578) * (-3368.624) (-3375.069) [-3361.033] (-3357.458) -- 0:02:32 704500 -- (-3357.742) (-3375.485) (-3357.246) [-3355.369] * [-3367.009] (-3361.514) (-3362.381) (-3360.018) -- 0:02:31 705000 -- (-3361.139) [-3368.959] (-3363.005) (-3368.929) * [-3362.138] (-3368.294) (-3365.818) (-3361.362) -- 0:02:31 Average standard deviation of split frequencies: 0.006677 705500 -- [-3361.313] (-3370.763) (-3359.510) (-3356.606) * (-3369.403) (-3367.713) [-3360.844] (-3375.514) -- 0:02:31 706000 -- (-3358.396) [-3365.229] (-3355.752) (-3371.403) * (-3362.194) (-3377.255) (-3361.961) [-3360.447] -- 0:02:31 706500 -- (-3363.135) (-3361.509) (-3370.792) [-3354.558] * (-3361.708) (-3362.506) (-3370.595) [-3357.090] -- 0:02:30 707000 -- (-3365.461) (-3360.904) (-3369.152) [-3356.502] * [-3359.549] (-3363.265) (-3365.049) (-3364.035) -- 0:02:30 707500 -- (-3361.209) [-3357.957] (-3360.512) (-3361.909) * [-3359.165] (-3357.447) (-3360.214) (-3364.145) -- 0:02:30 708000 -- [-3359.651] (-3351.753) (-3364.672) (-3361.345) * (-3361.068) [-3362.289] (-3358.921) (-3366.928) -- 0:02:30 708500 -- [-3356.388] (-3364.314) (-3356.688) (-3365.876) * (-3354.578) (-3366.080) (-3361.286) [-3363.464] -- 0:02:29 709000 -- (-3365.362) (-3352.348) [-3362.135] (-3365.929) * (-3355.743) [-3356.539] (-3363.222) (-3372.155) -- 0:02:29 709500 -- (-3351.921) [-3358.010] (-3375.016) (-3360.177) * (-3368.195) (-3358.107) (-3360.858) [-3354.355] -- 0:02:29 710000 -- (-3352.530) (-3367.887) [-3365.712] (-3366.952) * (-3361.530) (-3364.795) (-3365.035) [-3363.227] -- 0:02:29 Average standard deviation of split frequencies: 0.006928 710500 -- (-3358.149) (-3358.099) [-3362.475] (-3354.739) * (-3357.985) (-3371.330) [-3352.837] (-3362.743) -- 0:02:28 711000 -- (-3357.402) (-3356.628) (-3359.331) [-3363.216] * (-3363.283) (-3362.865) (-3363.867) [-3363.127] -- 0:02:28 711500 -- [-3355.948] (-3369.002) (-3358.289) (-3366.996) * (-3361.801) (-3363.876) (-3359.491) [-3358.223] -- 0:02:28 712000 -- [-3357.383] (-3358.794) (-3360.871) (-3375.731) * (-3363.372) (-3373.692) (-3361.490) [-3354.715] -- 0:02:28 712500 -- (-3361.113) (-3372.627) [-3356.845] (-3360.194) * (-3363.840) (-3354.751) [-3359.712] (-3359.619) -- 0:02:27 713000 -- (-3360.565) [-3355.879] (-3360.637) (-3358.832) * (-3364.173) [-3360.447] (-3366.626) (-3370.186) -- 0:02:27 713500 -- [-3356.342] (-3362.850) (-3358.409) (-3367.054) * (-3363.763) (-3368.516) [-3359.636] (-3358.329) -- 0:02:27 714000 -- (-3357.502) (-3364.145) [-3365.493] (-3364.772) * (-3357.237) (-3358.516) (-3361.144) [-3355.700] -- 0:02:27 714500 -- (-3364.574) [-3355.599] (-3358.629) (-3360.002) * [-3360.736] (-3362.716) (-3368.328) (-3372.897) -- 0:02:26 715000 -- (-3354.736) (-3355.676) [-3364.134] (-3368.578) * (-3367.366) (-3355.663) [-3357.843] (-3355.769) -- 0:02:26 Average standard deviation of split frequencies: 0.006657 715500 -- (-3355.263) (-3373.992) (-3354.532) [-3355.284] * (-3365.094) (-3359.100) [-3360.492] (-3355.924) -- 0:02:26 716000 -- [-3352.927] (-3359.244) (-3368.320) (-3358.755) * (-3363.186) (-3363.421) (-3364.070) [-3355.650] -- 0:02:25 716500 -- [-3360.810] (-3364.578) (-3352.524) (-3357.227) * (-3365.385) [-3358.128] (-3355.287) (-3353.850) -- 0:02:25 717000 -- [-3362.268] (-3364.869) (-3358.579) (-3362.023) * (-3360.729) [-3362.013] (-3359.649) (-3360.194) -- 0:02:25 717500 -- (-3356.683) (-3369.552) (-3367.113) [-3364.583] * (-3364.778) (-3365.308) [-3362.364] (-3357.561) -- 0:02:25 718000 -- [-3362.605] (-3357.932) (-3370.519) (-3361.369) * (-3362.900) [-3362.976] (-3366.726) (-3356.876) -- 0:02:24 718500 -- [-3367.169] (-3361.913) (-3359.612) (-3355.619) * (-3362.599) [-3361.851] (-3367.128) (-3359.575) -- 0:02:24 719000 -- (-3358.405) (-3358.868) (-3375.673) [-3357.481] * [-3367.000] (-3361.437) (-3366.998) (-3356.714) -- 0:02:24 719500 -- [-3362.979] (-3356.811) (-3364.201) (-3352.388) * [-3360.980] (-3356.954) (-3351.901) (-3366.642) -- 0:02:24 720000 -- (-3371.869) [-3359.012] (-3363.441) (-3357.222) * (-3357.454) (-3364.240) (-3361.702) [-3362.223] -- 0:02:23 Average standard deviation of split frequencies: 0.006469 720500 -- [-3357.615] (-3368.185) (-3363.739) (-3373.774) * (-3368.212) (-3366.089) [-3365.483] (-3366.564) -- 0:02:23 721000 -- (-3363.581) (-3363.290) [-3355.791] (-3364.050) * (-3357.651) [-3358.367] (-3359.104) (-3380.500) -- 0:02:23 721500 -- (-3353.041) [-3360.337] (-3357.602) (-3368.547) * (-3360.989) (-3358.510) [-3361.572] (-3368.179) -- 0:02:23 722000 -- (-3361.609) [-3359.401] (-3360.498) (-3357.415) * [-3358.964] (-3354.522) (-3363.304) (-3359.306) -- 0:02:22 722500 -- (-3370.337) (-3361.729) (-3365.889) [-3355.602] * (-3357.225) [-3362.459] (-3359.247) (-3366.634) -- 0:02:22 723000 -- (-3358.893) (-3367.829) [-3359.179] (-3356.614) * [-3361.432] (-3357.937) (-3363.307) (-3362.725) -- 0:02:22 723500 -- (-3366.750) (-3366.710) [-3357.861] (-3369.984) * (-3354.855) [-3356.584] (-3368.645) (-3366.621) -- 0:02:22 724000 -- [-3368.116] (-3381.124) (-3358.531) (-3362.030) * (-3364.698) (-3363.572) (-3363.760) [-3360.957] -- 0:02:21 724500 -- (-3368.798) [-3357.531] (-3365.932) (-3362.841) * (-3362.688) (-3358.688) (-3361.762) [-3356.113] -- 0:02:21 725000 -- (-3369.486) (-3356.153) [-3357.325] (-3358.641) * [-3354.199] (-3356.466) (-3365.078) (-3359.710) -- 0:02:21 Average standard deviation of split frequencies: 0.006132 725500 -- [-3352.850] (-3365.452) (-3356.667) (-3364.684) * (-3370.750) (-3356.230) [-3352.643] (-3359.040) -- 0:02:21 726000 -- [-3365.565] (-3368.105) (-3357.241) (-3353.226) * [-3357.524] (-3354.208) (-3363.593) (-3366.468) -- 0:02:20 726500 -- (-3354.312) [-3361.106] (-3363.531) (-3355.722) * (-3364.748) (-3367.081) [-3357.127] (-3366.356) -- 0:02:20 727000 -- (-3360.839) (-3356.701) (-3363.185) [-3355.577] * (-3365.492) (-3369.225) [-3354.343] (-3360.256) -- 0:02:20 727500 -- (-3365.846) (-3355.771) [-3364.650] (-3367.938) * (-3354.085) (-3359.006) (-3364.106) [-3354.454] -- 0:02:20 728000 -- (-3360.387) (-3360.218) (-3364.942) [-3356.797] * (-3358.502) (-3358.542) (-3357.155) [-3364.487] -- 0:02:19 728500 -- (-3374.062) (-3358.040) [-3363.927] (-3354.490) * (-3359.365) [-3355.320] (-3367.290) (-3365.548) -- 0:02:19 729000 -- (-3367.862) (-3363.812) (-3357.918) [-3365.705] * (-3358.938) [-3355.426] (-3362.208) (-3357.991) -- 0:02:19 729500 -- (-3361.030) [-3362.148] (-3360.664) (-3370.353) * (-3354.953) (-3364.074) [-3364.824] (-3359.387) -- 0:02:19 730000 -- (-3355.423) (-3363.248) [-3357.532] (-3357.157) * [-3365.063] (-3361.018) (-3370.423) (-3366.124) -- 0:02:18 Average standard deviation of split frequencies: 0.006308 730500 -- (-3363.552) (-3362.013) [-3357.653] (-3361.481) * [-3362.368] (-3364.676) (-3352.493) (-3364.584) -- 0:02:18 731000 -- (-3361.697) (-3357.677) (-3367.957) [-3359.106] * (-3357.998) [-3360.987] (-3354.624) (-3366.875) -- 0:02:17 731500 -- (-3361.908) (-3366.757) [-3356.525] (-3365.621) * (-3365.642) [-3354.999] (-3365.980) (-3358.229) -- 0:02:18 732000 -- (-3366.994) (-3364.525) [-3357.493] (-3362.418) * [-3358.098] (-3354.880) (-3361.966) (-3360.702) -- 0:02:17 732500 -- (-3369.839) (-3368.626) [-3358.504] (-3371.650) * [-3354.026] (-3366.270) (-3359.001) (-3360.988) -- 0:02:17 733000 -- [-3370.598] (-3356.150) (-3372.904) (-3357.511) * [-3357.976] (-3363.062) (-3362.781) (-3361.397) -- 0:02:16 733500 -- (-3361.120) [-3353.635] (-3363.259) (-3358.343) * (-3374.299) (-3369.411) [-3365.349] (-3364.631) -- 0:02:16 734000 -- [-3364.071] (-3365.414) (-3360.937) (-3365.279) * (-3363.771) (-3365.806) [-3363.206] (-3367.888) -- 0:02:16 734500 -- (-3361.143) (-3357.563) [-3364.221] (-3352.965) * [-3359.417] (-3358.375) (-3360.965) (-3368.419) -- 0:02:16 735000 -- (-3361.165) (-3361.453) [-3363.088] (-3357.382) * (-3359.108) (-3365.777) [-3359.237] (-3368.921) -- 0:02:15 Average standard deviation of split frequencies: 0.005836 735500 -- (-3354.508) (-3362.085) [-3357.138] (-3363.523) * [-3365.095] (-3362.227) (-3357.267) (-3372.638) -- 0:02:15 736000 -- [-3355.805] (-3361.271) (-3370.277) (-3353.577) * [-3356.103] (-3371.631) (-3371.660) (-3358.982) -- 0:02:15 736500 -- (-3352.648) (-3361.497) (-3361.342) [-3365.219] * (-3365.885) (-3366.951) (-3369.964) [-3358.392] -- 0:02:15 737000 -- (-3353.452) (-3363.386) [-3358.653] (-3363.442) * [-3357.286] (-3361.668) (-3367.133) (-3363.029) -- 0:02:14 737500 -- (-3358.868) [-3363.187] (-3367.979) (-3362.213) * (-3367.597) [-3361.231] (-3358.904) (-3364.680) -- 0:02:14 738000 -- (-3356.662) [-3355.834] (-3366.088) (-3366.333) * [-3357.560] (-3358.902) (-3364.246) (-3365.912) -- 0:02:14 738500 -- [-3355.183] (-3367.458) (-3365.349) (-3366.489) * [-3357.874] (-3366.523) (-3357.114) (-3369.439) -- 0:02:14 739000 -- [-3356.477] (-3362.404) (-3357.523) (-3359.256) * (-3355.234) [-3361.193] (-3369.684) (-3360.820) -- 0:02:13 739500 -- (-3364.151) [-3373.605] (-3367.742) (-3358.554) * (-3365.505) [-3360.340] (-3363.259) (-3371.239) -- 0:02:13 740000 -- (-3362.883) [-3359.551] (-3357.224) (-3359.419) * [-3359.939] (-3376.304) (-3372.996) (-3370.776) -- 0:02:13 Average standard deviation of split frequencies: 0.005870 740500 -- (-3362.118) (-3367.934) [-3361.575] (-3361.129) * (-3359.892) (-3366.581) (-3358.174) [-3367.367] -- 0:02:13 741000 -- (-3367.254) (-3360.325) (-3362.938) [-3359.507] * (-3359.086) (-3363.084) [-3359.584] (-3363.446) -- 0:02:13 741500 -- (-3362.078) (-3369.625) [-3356.476] (-3369.616) * [-3363.971] (-3358.289) (-3362.747) (-3359.300) -- 0:02:12 742000 -- [-3356.116] (-3375.588) (-3362.958) (-3371.091) * (-3357.419) (-3367.321) [-3360.815] (-3355.635) -- 0:02:12 742500 -- [-3353.309] (-3372.041) (-3363.979) (-3366.637) * (-3356.034) [-3361.011] (-3365.290) (-3365.107) -- 0:02:12 743000 -- (-3364.962) (-3361.222) (-3363.642) [-3353.805] * [-3353.834] (-3366.265) (-3364.827) (-3363.655) -- 0:02:12 743500 -- (-3355.730) [-3355.106] (-3357.940) (-3358.754) * (-3364.344) (-3360.122) (-3369.220) [-3371.214] -- 0:02:11 744000 -- (-3357.975) (-3358.161) (-3365.582) [-3357.061] * (-3367.809) (-3355.428) (-3361.722) [-3363.168] -- 0:02:11 744500 -- [-3362.339] (-3361.738) (-3368.644) (-3357.609) * (-3359.196) (-3361.481) [-3358.757] (-3358.837) -- 0:02:11 745000 -- (-3366.045) [-3359.374] (-3354.096) (-3354.829) * [-3359.398] (-3367.051) (-3360.798) (-3364.694) -- 0:02:11 Average standard deviation of split frequencies: 0.005898 745500 -- (-3368.834) [-3360.547] (-3366.316) (-3356.996) * (-3360.243) (-3366.512) (-3359.726) [-3352.889] -- 0:02:10 746000 -- (-3364.153) [-3352.648] (-3373.691) (-3360.992) * (-3355.916) (-3362.589) (-3363.657) [-3370.212] -- 0:02:10 746500 -- (-3358.972) (-3359.531) [-3361.246] (-3363.709) * (-3366.516) [-3363.134] (-3370.006) (-3364.957) -- 0:02:10 747000 -- (-3358.654) (-3360.530) (-3366.586) [-3357.612] * (-3357.175) (-3359.203) [-3360.642] (-3355.438) -- 0:02:10 747500 -- [-3363.049] (-3353.375) (-3365.760) (-3367.446) * (-3356.184) (-3351.562) (-3361.094) [-3358.165] -- 0:02:09 748000 -- (-3358.093) (-3356.154) [-3365.035] (-3359.184) * (-3365.556) (-3359.643) (-3358.162) [-3359.185] -- 0:02:09 748500 -- [-3355.330] (-3364.131) (-3366.494) (-3352.841) * [-3366.396] (-3362.033) (-3355.798) (-3355.021) -- 0:02:09 749000 -- (-3367.725) (-3358.830) [-3359.582] (-3364.105) * (-3364.093) [-3360.888] (-3356.049) (-3371.958) -- 0:02:09 749500 -- (-3357.664) [-3354.944] (-3364.348) (-3361.992) * (-3364.148) (-3360.598) (-3369.909) [-3353.920] -- 0:02:08 750000 -- (-3359.302) (-3363.094) (-3375.004) [-3359.193] * [-3362.590] (-3362.472) (-3360.114) (-3360.272) -- 0:02:08 Average standard deviation of split frequencies: 0.006140 750500 -- (-3359.261) [-3356.889] (-3358.222) (-3369.416) * (-3358.091) (-3364.602) [-3360.495] (-3358.166) -- 0:02:07 751000 -- (-3361.268) [-3357.650] (-3360.967) (-3365.672) * (-3353.572) [-3364.859] (-3361.725) (-3360.835) -- 0:02:07 751500 -- [-3358.430] (-3357.870) (-3363.711) (-3362.935) * [-3358.915] (-3358.947) (-3358.623) (-3356.618) -- 0:02:07 752000 -- (-3356.215) (-3357.122) [-3354.346] (-3359.140) * (-3369.562) [-3353.241] (-3373.691) (-3360.086) -- 0:02:07 752500 -- (-3360.159) (-3361.276) (-3361.055) [-3360.638] * (-3367.127) (-3367.416) (-3363.679) [-3355.399] -- 0:02:06 753000 -- [-3357.022] (-3360.060) (-3366.012) (-3359.801) * (-3364.688) (-3366.789) (-3359.625) [-3358.038] -- 0:02:06 753500 -- (-3360.034) (-3358.911) (-3356.845) [-3365.512] * (-3363.984) [-3360.588] (-3356.194) (-3356.964) -- 0:02:06 754000 -- (-3356.008) [-3353.909] (-3367.257) (-3360.500) * (-3362.201) [-3356.046] (-3365.046) (-3364.329) -- 0:02:06 754500 -- [-3361.224] (-3368.833) (-3359.833) (-3355.149) * (-3360.573) [-3362.513] (-3367.546) (-3363.858) -- 0:02:05 755000 -- (-3357.476) [-3357.600] (-3358.537) (-3353.462) * [-3365.566] (-3359.141) (-3375.664) (-3356.975) -- 0:02:05 Average standard deviation of split frequencies: 0.006166 755500 -- [-3359.736] (-3372.673) (-3361.747) (-3357.135) * (-3358.835) (-3354.672) (-3363.984) [-3357.813] -- 0:02:05 756000 -- (-3359.803) [-3360.435] (-3371.915) (-3363.653) * (-3367.411) (-3368.151) (-3366.551) [-3352.774] -- 0:02:05 756500 -- [-3361.476] (-3358.569) (-3364.873) (-3356.897) * [-3359.806] (-3359.576) (-3363.940) (-3358.053) -- 0:02:05 757000 -- (-3364.290) (-3378.771) [-3362.625] (-3363.502) * (-3363.107) [-3360.385] (-3365.450) (-3353.980) -- 0:02:04 757500 -- (-3357.516) (-3357.792) [-3359.028] (-3365.463) * (-3365.083) [-3359.675] (-3359.260) (-3358.891) -- 0:02:04 758000 -- (-3362.281) (-3357.835) (-3355.261) [-3354.567] * (-3351.926) (-3355.318) (-3362.195) [-3362.400] -- 0:02:04 758500 -- (-3368.785) (-3355.211) [-3352.903] (-3360.113) * (-3358.936) (-3354.329) [-3362.408] (-3363.731) -- 0:02:04 759000 -- (-3357.316) [-3359.195] (-3361.461) (-3359.469) * [-3369.178] (-3361.719) (-3359.053) (-3368.281) -- 0:02:03 759500 -- [-3358.249] (-3357.801) (-3361.291) (-3358.812) * [-3362.656] (-3366.723) (-3360.591) (-3363.104) -- 0:02:03 760000 -- (-3360.425) (-3358.974) [-3356.567] (-3351.903) * (-3362.141) [-3364.209] (-3357.754) (-3361.062) -- 0:02:03 Average standard deviation of split frequencies: 0.005922 760500 -- (-3360.872) [-3359.563] (-3364.778) (-3362.153) * (-3369.575) (-3357.297) (-3361.209) [-3360.031] -- 0:02:03 761000 -- [-3368.900] (-3363.315) (-3364.099) (-3365.247) * [-3360.557] (-3360.913) (-3361.791) (-3358.644) -- 0:02:02 761500 -- (-3366.598) (-3358.519) (-3362.370) [-3364.960] * (-3364.720) (-3359.752) [-3369.153] (-3368.318) -- 0:02:02 762000 -- (-3363.282) [-3355.358] (-3359.943) (-3360.576) * (-3360.606) (-3362.180) [-3359.840] (-3365.316) -- 0:02:02 762500 -- [-3356.479] (-3356.906) (-3362.665) (-3376.911) * [-3364.613] (-3362.882) (-3360.874) (-3357.329) -- 0:02:02 763000 -- [-3362.502] (-3359.106) (-3357.665) (-3371.099) * (-3358.330) (-3364.630) [-3354.077] (-3363.933) -- 0:02:01 763500 -- (-3364.754) (-3369.669) [-3365.632] (-3373.622) * [-3353.155] (-3360.122) (-3358.647) (-3358.384) -- 0:02:01 764000 -- (-3375.177) [-3353.948] (-3367.743) (-3375.432) * (-3354.525) (-3377.609) [-3356.986] (-3360.663) -- 0:02:01 764500 -- [-3356.477] (-3353.924) (-3357.129) (-3371.556) * (-3361.636) (-3373.267) [-3361.197] (-3358.034) -- 0:02:01 765000 -- [-3358.184] (-3361.182) (-3356.699) (-3361.148) * [-3352.464] (-3364.697) (-3358.193) (-3361.177) -- 0:02:00 Average standard deviation of split frequencies: 0.006086 765500 -- [-3360.520] (-3362.999) (-3356.247) (-3365.515) * (-3356.349) (-3354.084) (-3366.394) [-3356.719] -- 0:02:00 766000 -- (-3355.606) (-3358.403) [-3359.621] (-3361.434) * (-3362.388) [-3357.020] (-3361.000) (-3359.665) -- 0:02:00 766500 -- (-3357.557) (-3355.154) (-3365.469) [-3351.236] * [-3360.939] (-3361.479) (-3362.064) (-3356.697) -- 0:02:00 767000 -- (-3367.771) [-3362.981] (-3359.703) (-3357.588) * (-3356.963) [-3352.485] (-3353.498) (-3359.779) -- 0:01:59 767500 -- (-3361.709) (-3362.689) (-3363.992) [-3363.280] * (-3363.571) (-3352.947) [-3357.157] (-3367.061) -- 0:01:59 768000 -- (-3361.703) [-3353.161] (-3355.840) (-3361.604) * (-3362.791) (-3364.064) (-3370.608) [-3365.429] -- 0:01:59 768500 -- (-3369.350) [-3364.511] (-3356.479) (-3362.080) * (-3362.965) [-3357.269] (-3363.962) (-3359.879) -- 0:01:58 769000 -- [-3361.110] (-3363.921) (-3359.663) (-3366.548) * (-3360.703) (-3354.173) [-3360.957] (-3365.265) -- 0:01:58 769500 -- [-3362.037] (-3362.985) (-3357.047) (-3362.706) * (-3355.816) [-3355.173] (-3359.074) (-3361.233) -- 0:01:58 770000 -- (-3361.461) [-3364.016] (-3359.020) (-3356.558) * [-3353.052] (-3356.704) (-3356.793) (-3364.971) -- 0:01:57 Average standard deviation of split frequencies: 0.005777 770500 -- [-3359.409] (-3363.554) (-3367.596) (-3356.294) * (-3373.463) (-3367.612) [-3362.218] (-3369.344) -- 0:01:57 771000 -- (-3358.526) (-3376.304) [-3359.251] (-3363.306) * [-3350.059] (-3355.930) (-3354.423) (-3366.263) -- 0:01:57 771500 -- (-3358.932) (-3374.769) [-3359.162] (-3358.726) * (-3354.863) (-3355.437) (-3363.371) [-3354.318] -- 0:01:57 772000 -- (-3353.316) (-3360.033) [-3358.046] (-3360.020) * [-3353.729] (-3358.387) (-3359.622) (-3363.306) -- 0:01:56 772500 -- (-3355.241) (-3360.015) (-3361.695) [-3361.174] * (-3364.347) (-3368.826) (-3369.065) [-3351.000] -- 0:01:56 773000 -- (-3360.486) (-3361.882) (-3361.382) [-3353.354] * (-3360.962) (-3361.685) [-3359.665] (-3354.530) -- 0:01:56 773500 -- (-3363.727) (-3364.184) (-3357.820) [-3353.323] * (-3357.616) (-3369.237) [-3353.717] (-3359.288) -- 0:01:56 774000 -- [-3353.067] (-3353.000) (-3354.935) (-3357.632) * [-3362.014] (-3364.943) (-3360.699) (-3356.225) -- 0:01:55 774500 -- (-3359.621) [-3362.726] (-3363.549) (-3360.548) * (-3361.983) (-3355.436) (-3356.710) [-3353.113] -- 0:01:55 775000 -- (-3362.117) [-3367.606] (-3359.674) (-3364.326) * (-3360.640) [-3357.543] (-3356.425) (-3361.153) -- 0:01:55 Average standard deviation of split frequencies: 0.005737 775500 -- (-3359.538) (-3361.660) (-3362.948) [-3353.653] * (-3360.240) [-3361.145] (-3365.080) (-3364.889) -- 0:01:55 776000 -- (-3363.113) (-3362.866) [-3362.316] (-3357.177) * (-3367.318) [-3361.254] (-3354.747) (-3358.658) -- 0:01:55 776500 -- [-3358.953] (-3353.712) (-3371.212) (-3351.826) * [-3357.787] (-3367.097) (-3361.949) (-3360.407) -- 0:01:54 777000 -- (-3360.086) [-3357.644] (-3372.098) (-3364.133) * (-3366.044) [-3359.535] (-3371.364) (-3354.296) -- 0:01:54 777500 -- [-3359.944] (-3358.749) (-3363.182) (-3364.096) * (-3363.810) [-3362.949] (-3360.388) (-3365.290) -- 0:01:54 778000 -- (-3354.384) (-3359.405) (-3358.914) [-3359.679] * (-3369.629) (-3368.162) [-3358.696] (-3367.370) -- 0:01:54 778500 -- [-3364.650] (-3357.773) (-3371.420) (-3354.203) * (-3362.278) (-3364.392) (-3360.118) [-3366.562] -- 0:01:53 779000 -- (-3368.462) [-3350.378] (-3370.930) (-3356.350) * (-3359.100) (-3363.987) (-3363.408) [-3357.907] -- 0:01:53 779500 -- (-3362.227) [-3354.975] (-3361.795) (-3362.173) * (-3364.385) (-3366.635) (-3367.070) [-3354.604] -- 0:01:53 780000 -- (-3369.210) [-3357.599] (-3369.510) (-3364.006) * (-3361.191) (-3358.567) (-3357.883) [-3354.777] -- 0:01:53 Average standard deviation of split frequencies: 0.005837 780500 -- (-3356.782) (-3355.630) [-3361.394] (-3365.585) * (-3358.448) (-3365.180) [-3355.653] (-3351.924) -- 0:01:52 781000 -- (-3353.023) (-3358.745) [-3360.182] (-3378.892) * (-3358.610) (-3364.377) (-3361.996) [-3358.932] -- 0:01:52 781500 -- [-3356.580] (-3360.689) (-3362.361) (-3374.861) * (-3356.828) (-3360.726) (-3362.397) [-3363.688] -- 0:01:52 782000 -- (-3352.481) [-3360.806] (-3363.303) (-3362.209) * (-3363.657) (-3375.863) [-3367.237] (-3364.878) -- 0:01:52 782500 -- (-3352.386) (-3361.144) (-3362.622) [-3357.833] * (-3359.726) (-3360.169) [-3356.296] (-3369.521) -- 0:01:51 783000 -- (-3361.809) (-3358.065) [-3355.811] (-3355.753) * [-3358.827] (-3373.718) (-3355.403) (-3358.009) -- 0:01:51 783500 -- (-3360.103) (-3370.558) (-3355.307) [-3355.647] * (-3375.170) (-3366.171) (-3357.707) [-3361.638] -- 0:01:51 784000 -- (-3367.932) (-3362.257) [-3362.703] (-3364.634) * [-3358.442] (-3364.532) (-3366.159) (-3360.079) -- 0:01:51 784500 -- (-3361.194) (-3367.345) [-3356.548] (-3379.966) * [-3363.952] (-3372.739) (-3373.121) (-3360.778) -- 0:01:50 785000 -- (-3362.164) (-3365.317) (-3362.016) [-3358.064] * (-3360.640) [-3365.169] (-3364.733) (-3361.078) -- 0:01:50 Average standard deviation of split frequencies: 0.005998 785500 -- (-3357.611) [-3366.631] (-3363.484) (-3360.469) * [-3351.024] (-3360.484) (-3362.093) (-3356.044) -- 0:01:50 786000 -- [-3356.742] (-3368.554) (-3361.816) (-3354.045) * (-3355.260) [-3364.070] (-3363.568) (-3363.786) -- 0:01:49 786500 -- (-3369.193) [-3360.980] (-3353.878) (-3373.134) * (-3359.744) [-3358.778] (-3365.593) (-3363.010) -- 0:01:49 787000 -- (-3364.625) (-3366.311) (-3361.633) [-3359.526] * (-3363.371) [-3353.618] (-3370.060) (-3366.247) -- 0:01:49 787500 -- (-3360.455) (-3364.384) (-3355.957) [-3361.389] * (-3362.796) (-3361.003) [-3360.681] (-3360.990) -- 0:01:49 788000 -- (-3358.799) (-3370.521) [-3355.087] (-3356.905) * (-3364.850) (-3361.020) (-3356.236) [-3356.790] -- 0:01:48 788500 -- (-3359.786) (-3360.748) (-3359.057) [-3356.303] * [-3357.598] (-3363.779) (-3368.338) (-3364.102) -- 0:01:48 789000 -- [-3358.697] (-3354.527) (-3361.340) (-3357.275) * (-3360.642) (-3355.477) (-3363.627) [-3359.928] -- 0:01:48 789500 -- (-3366.212) [-3350.601] (-3364.321) (-3360.847) * (-3362.234) [-3351.853] (-3364.236) (-3361.956) -- 0:01:47 790000 -- (-3365.030) (-3354.417) [-3367.755] (-3360.783) * (-3365.546) (-3359.754) [-3358.895] (-3367.312) -- 0:01:47 Average standard deviation of split frequencies: 0.006161 790500 -- (-3358.895) (-3351.784) (-3357.349) [-3359.448] * (-3365.935) [-3359.995] (-3358.490) (-3362.881) -- 0:01:47 791000 -- [-3356.869] (-3363.184) (-3361.231) (-3364.017) * (-3374.211) [-3371.517] (-3361.424) (-3356.902) -- 0:01:47 791500 -- [-3357.159] (-3363.350) (-3361.205) (-3362.884) * (-3368.461) (-3375.215) [-3363.516] (-3353.186) -- 0:01:46 792000 -- (-3360.420) (-3374.069) [-3358.030] (-3361.439) * (-3366.349) (-3374.230) (-3362.204) [-3359.261] -- 0:01:46 792500 -- [-3356.660] (-3361.116) (-3370.792) (-3365.137) * (-3364.116) (-3381.041) (-3361.210) [-3355.855] -- 0:01:46 793000 -- (-3370.273) (-3363.608) (-3362.939) [-3363.960] * (-3355.648) (-3367.274) (-3365.442) [-3356.509] -- 0:01:46 793500 -- [-3359.267] (-3361.758) (-3357.637) (-3352.499) * (-3360.803) (-3368.056) (-3363.672) [-3353.278] -- 0:01:45 794000 -- [-3357.310] (-3372.627) (-3352.692) (-3357.000) * (-3357.502) (-3361.103) (-3363.500) [-3358.628] -- 0:01:45 794500 -- [-3357.170] (-3366.890) (-3355.192) (-3359.174) * [-3358.376] (-3356.120) (-3358.120) (-3356.048) -- 0:01:45 795000 -- (-3358.730) [-3354.671] (-3360.163) (-3363.684) * [-3351.765] (-3356.149) (-3363.343) (-3360.086) -- 0:01:45 Average standard deviation of split frequencies: 0.006185 795500 -- (-3351.285) (-3359.191) [-3360.115] (-3358.117) * (-3359.338) (-3369.274) [-3358.283] (-3360.449) -- 0:01:45 796000 -- (-3369.407) (-3356.785) [-3355.424] (-3355.520) * (-3364.150) (-3364.693) [-3353.051] (-3360.377) -- 0:01:44 796500 -- (-3361.656) [-3363.974] (-3360.400) (-3364.891) * [-3357.703] (-3366.730) (-3358.708) (-3361.167) -- 0:01:44 797000 -- (-3365.806) [-3368.788] (-3353.873) (-3364.635) * (-3365.868) (-3369.620) (-3356.717) [-3355.069] -- 0:01:44 797500 -- (-3359.908) [-3361.463] (-3358.797) (-3361.241) * (-3367.576) (-3365.642) (-3359.109) [-3356.144] -- 0:01:44 798000 -- [-3357.227] (-3369.403) (-3358.828) (-3358.310) * (-3362.860) (-3356.451) [-3365.574] (-3361.646) -- 0:01:43 798500 -- (-3358.725) [-3363.005] (-3359.661) (-3367.011) * [-3359.908] (-3363.714) (-3369.064) (-3362.860) -- 0:01:43 799000 -- (-3355.326) [-3352.282] (-3366.925) (-3356.224) * (-3364.150) (-3360.766) [-3358.870] (-3370.279) -- 0:01:43 799500 -- (-3362.311) (-3359.695) (-3365.050) [-3351.252] * (-3357.088) [-3361.553] (-3356.311) (-3363.703) -- 0:01:43 800000 -- [-3358.051] (-3363.714) (-3358.743) (-3352.896) * [-3359.099] (-3359.440) (-3362.563) (-3356.897) -- 0:01:42 Average standard deviation of split frequencies: 0.006411 800500 -- (-3362.079) (-3359.298) (-3367.028) [-3359.387] * (-3357.341) (-3367.400) [-3361.290] (-3373.484) -- 0:01:42 801000 -- (-3364.291) (-3360.824) [-3367.190] (-3364.187) * [-3356.019] (-3362.970) (-3358.720) (-3370.467) -- 0:01:42 801500 -- (-3355.907) (-3361.494) [-3358.401] (-3364.632) * (-3368.172) (-3360.080) (-3357.090) [-3359.877] -- 0:01:42 802000 -- [-3358.332] (-3378.791) (-3353.040) (-3366.449) * (-3360.772) (-3360.116) [-3363.028] (-3358.033) -- 0:01:41 802500 -- [-3356.340] (-3358.040) (-3355.563) (-3361.641) * [-3358.554] (-3367.964) (-3355.267) (-3358.879) -- 0:01:41 803000 -- (-3378.614) (-3361.949) [-3355.609] (-3358.995) * [-3362.049] (-3370.889) (-3365.100) (-3362.977) -- 0:01:41 803500 -- (-3368.797) [-3359.898] (-3357.072) (-3369.436) * (-3363.042) (-3362.249) [-3365.968] (-3352.770) -- 0:01:41 804000 -- (-3363.863) [-3359.184] (-3354.892) (-3358.400) * (-3359.950) (-3363.727) [-3356.698] (-3369.743) -- 0:01:40 804500 -- (-3366.783) [-3361.143] (-3361.482) (-3363.454) * [-3357.074] (-3362.870) (-3374.733) (-3361.104) -- 0:01:40 805000 -- [-3366.330] (-3374.221) (-3371.163) (-3360.462) * (-3358.012) (-3361.630) (-3362.374) [-3364.770] -- 0:01:40 Average standard deviation of split frequencies: 0.006304 805500 -- (-3364.104) (-3352.182) [-3363.729] (-3355.101) * [-3361.872] (-3367.116) (-3366.377) (-3356.849) -- 0:01:39 806000 -- (-3362.207) (-3362.057) [-3368.800] (-3375.533) * [-3355.475] (-3372.917) (-3364.195) (-3360.855) -- 0:01:39 806500 -- (-3359.803) [-3366.046] (-3358.761) (-3364.409) * (-3358.283) (-3374.402) [-3353.639] (-3364.267) -- 0:01:39 807000 -- (-3359.521) (-3354.552) (-3360.381) [-3364.802] * (-3366.463) [-3361.596] (-3358.189) (-3357.998) -- 0:01:39 807500 -- (-3358.705) [-3359.755] (-3358.901) (-3361.160) * (-3358.489) [-3360.323] (-3363.134) (-3365.970) -- 0:01:38 808000 -- (-3359.235) (-3370.223) (-3362.717) [-3360.554] * (-3356.660) [-3354.906] (-3357.336) (-3363.913) -- 0:01:38 808500 -- (-3356.341) (-3369.846) [-3361.264] (-3360.692) * (-3367.379) [-3359.149] (-3364.116) (-3369.357) -- 0:01:38 809000 -- [-3361.684] (-3363.887) (-3353.538) (-3355.601) * (-3360.582) [-3356.347] (-3378.293) (-3360.846) -- 0:01:37 809500 -- (-3368.515) [-3357.595] (-3368.859) (-3363.840) * (-3357.641) (-3367.509) (-3369.335) [-3354.012] -- 0:01:37 810000 -- (-3366.988) (-3354.321) [-3360.158] (-3362.195) * (-3360.216) (-3372.106) [-3364.694] (-3363.387) -- 0:01:37 Average standard deviation of split frequencies: 0.006590 810500 -- (-3374.116) (-3365.894) [-3363.485] (-3365.005) * (-3363.767) (-3359.440) [-3364.325] (-3363.287) -- 0:01:37 811000 -- [-3363.355] (-3368.092) (-3361.100) (-3360.954) * [-3357.925] (-3365.973) (-3361.580) (-3367.504) -- 0:01:36 811500 -- (-3363.750) (-3360.560) [-3362.248] (-3357.462) * [-3355.107] (-3364.607) (-3372.108) (-3358.496) -- 0:01:36 812000 -- [-3356.967] (-3358.375) (-3360.418) (-3356.957) * (-3362.377) (-3357.392) (-3359.748) [-3359.964] -- 0:01:36 812500 -- (-3358.983) [-3360.465] (-3361.825) (-3360.980) * (-3368.533) (-3366.106) (-3359.929) [-3365.218] -- 0:01:36 813000 -- (-3360.375) (-3363.886) (-3359.301) [-3359.626] * (-3370.835) (-3360.847) [-3352.028] (-3356.571) -- 0:01:35 813500 -- (-3357.040) [-3357.382] (-3360.250) (-3359.443) * [-3358.749] (-3362.215) (-3354.599) (-3364.132) -- 0:01:35 814000 -- [-3358.224] (-3369.086) (-3369.665) (-3355.456) * (-3362.877) [-3354.712] (-3358.969) (-3361.538) -- 0:01:35 814500 -- (-3355.337) (-3362.719) [-3368.700] (-3360.193) * (-3362.442) (-3356.820) (-3359.207) [-3362.172] -- 0:01:35 815000 -- (-3365.066) (-3356.995) [-3363.990] (-3357.642) * [-3368.626] (-3364.300) (-3355.590) (-3358.375) -- 0:01:34 Average standard deviation of split frequencies: 0.006355 815500 -- [-3354.924] (-3358.925) (-3362.941) (-3363.017) * (-3365.636) (-3356.680) (-3368.243) [-3356.314] -- 0:01:34 816000 -- (-3360.641) [-3355.029] (-3362.869) (-3362.563) * [-3357.852] (-3358.575) (-3361.451) (-3369.179) -- 0:01:34 816500 -- (-3355.627) (-3368.105) [-3356.446] (-3356.185) * [-3356.743] (-3364.168) (-3366.825) (-3356.102) -- 0:01:34 817000 -- (-3360.243) (-3362.656) (-3360.640) [-3364.139] * (-3367.767) [-3358.497] (-3364.790) (-3361.755) -- 0:01:33 817500 -- (-3359.013) [-3364.512] (-3358.277) (-3360.093) * (-3362.820) (-3352.079) (-3364.569) [-3356.962] -- 0:01:33 818000 -- (-3370.807) (-3360.322) (-3361.517) [-3354.314] * (-3354.268) (-3369.525) [-3358.907] (-3358.992) -- 0:01:33 818500 -- (-3364.356) (-3357.037) (-3372.854) [-3363.896] * (-3354.202) (-3363.600) [-3361.134] (-3363.433) -- 0:01:33 819000 -- (-3360.618) [-3358.353] (-3359.118) (-3357.976) * (-3359.714) (-3361.631) (-3366.831) [-3359.341] -- 0:01:32 819500 -- [-3370.055] (-3357.176) (-3362.473) (-3362.322) * (-3353.832) [-3363.577] (-3369.766) (-3367.361) -- 0:01:32 820000 -- [-3361.637] (-3356.682) (-3363.726) (-3363.204) * (-3354.638) (-3367.105) [-3366.823] (-3364.506) -- 0:01:32 Average standard deviation of split frequencies: 0.006382 820500 -- (-3358.627) (-3367.642) [-3353.171] (-3357.116) * [-3360.399] (-3359.712) (-3361.516) (-3357.414) -- 0:01:32 821000 -- (-3362.497) (-3362.101) (-3358.567) [-3362.626] * (-3370.186) [-3361.582] (-3359.127) (-3360.776) -- 0:01:31 821500 -- (-3359.242) (-3364.276) (-3359.053) [-3361.754] * (-3368.635) (-3356.238) [-3364.575] (-3363.990) -- 0:01:31 822000 -- [-3355.117] (-3357.208) (-3367.017) (-3356.978) * [-3356.661] (-3367.265) (-3355.990) (-3357.077) -- 0:01:31 822500 -- [-3361.093] (-3353.339) (-3356.108) (-3361.898) * (-3357.296) (-3371.783) [-3362.349] (-3357.125) -- 0:01:31 823000 -- [-3355.727] (-3361.044) (-3365.724) (-3359.506) * (-3354.282) (-3367.652) (-3360.924) [-3361.102] -- 0:01:30 823500 -- [-3357.669] (-3357.228) (-3363.305) (-3356.914) * (-3357.874) (-3367.341) [-3362.610] (-3373.178) -- 0:01:30 824000 -- (-3361.660) (-3354.486) [-3361.156] (-3355.513) * (-3363.247) (-3360.213) (-3355.689) [-3361.389] -- 0:01:30 824500 -- (-3356.844) (-3357.232) [-3362.051] (-3361.280) * (-3361.558) [-3361.368] (-3364.313) (-3359.233) -- 0:01:30 825000 -- [-3356.563] (-3357.470) (-3353.212) (-3367.868) * (-3360.465) [-3360.825] (-3363.695) (-3361.873) -- 0:01:29 Average standard deviation of split frequencies: 0.006595 825500 -- (-3357.436) (-3356.412) (-3356.812) [-3359.823] * (-3359.495) [-3358.531] (-3361.210) (-3367.325) -- 0:01:29 826000 -- [-3356.867] (-3372.906) (-3360.308) (-3362.989) * (-3359.268) [-3357.944] (-3367.551) (-3365.576) -- 0:01:29 826500 -- (-3353.782) (-3360.039) (-3365.619) [-3356.965] * [-3352.683] (-3356.896) (-3366.324) (-3359.345) -- 0:01:29 827000 -- [-3355.888] (-3357.598) (-3364.587) (-3367.707) * (-3360.270) (-3362.788) [-3367.641] (-3360.590) -- 0:01:28 827500 -- (-3360.684) [-3359.426] (-3365.213) (-3367.377) * [-3359.418] (-3358.381) (-3360.040) (-3365.028) -- 0:01:28 828000 -- (-3368.395) [-3358.825] (-3361.766) (-3365.833) * (-3359.614) (-3362.057) (-3368.402) [-3368.961] -- 0:01:28 828500 -- (-3362.960) (-3357.533) [-3358.526] (-3363.935) * (-3354.237) [-3353.091] (-3362.451) (-3356.359) -- 0:01:27 829000 -- (-3358.586) (-3361.601) [-3355.560] (-3360.887) * (-3362.316) (-3363.598) [-3359.877] (-3363.342) -- 0:01:27 829500 -- (-3367.360) (-3355.606) [-3353.873] (-3358.580) * [-3359.777] (-3354.650) (-3372.799) (-3357.698) -- 0:01:27 830000 -- (-3355.081) (-3364.749) [-3353.377] (-3375.756) * [-3353.571] (-3359.580) (-3357.981) (-3365.613) -- 0:01:27 Average standard deviation of split frequencies: 0.006810 830500 -- (-3362.899) (-3359.902) [-3357.166] (-3370.986) * (-3367.989) (-3365.219) [-3361.660] (-3366.659) -- 0:01:26 831000 -- (-3362.383) (-3363.823) [-3361.719] (-3362.354) * (-3361.896) [-3355.980] (-3356.221) (-3369.595) -- 0:01:26 831500 -- [-3359.274] (-3365.805) (-3361.879) (-3353.155) * (-3362.525) [-3357.433] (-3358.729) (-3362.061) -- 0:01:26 832000 -- (-3366.327) (-3364.544) (-3355.697) [-3364.541] * (-3362.184) (-3352.692) (-3368.818) [-3358.960] -- 0:01:26 832500 -- (-3359.570) [-3358.227] (-3365.178) (-3358.219) * (-3371.182) (-3359.624) (-3364.965) [-3354.660] -- 0:01:25 833000 -- (-3368.904) [-3360.502] (-3357.712) (-3367.244) * (-3362.269) [-3360.760] (-3358.298) (-3351.316) -- 0:01:25 833500 -- (-3364.036) [-3364.664] (-3354.512) (-3358.925) * (-3374.218) (-3359.934) (-3362.479) [-3359.765] -- 0:01:25 834000 -- (-3364.159) (-3358.843) [-3361.814] (-3361.894) * (-3358.874) [-3354.485] (-3367.900) (-3356.985) -- 0:01:25 834500 -- [-3362.315] (-3364.483) (-3358.483) (-3369.570) * [-3358.275] (-3359.970) (-3363.753) (-3370.833) -- 0:01:24 835000 -- (-3357.032) [-3355.630] (-3357.179) (-3365.666) * (-3356.917) (-3358.912) (-3376.346) [-3363.155] -- 0:01:24 Average standard deviation of split frequencies: 0.006203 835500 -- (-3366.484) [-3354.191] (-3358.652) (-3365.303) * [-3363.652] (-3361.506) (-3365.210) (-3356.847) -- 0:01:24 836000 -- (-3363.016) (-3354.299) [-3361.026] (-3374.270) * (-3359.585) [-3353.921] (-3366.540) (-3355.964) -- 0:01:24 836500 -- (-3360.613) [-3354.116] (-3369.034) (-3361.872) * [-3362.597] (-3353.444) (-3371.388) (-3359.534) -- 0:01:24 837000 -- (-3364.135) [-3360.369] (-3368.543) (-3362.263) * [-3357.521] (-3361.974) (-3374.414) (-3358.225) -- 0:01:23 837500 -- [-3358.874] (-3366.629) (-3365.602) (-3361.806) * [-3356.640] (-3363.329) (-3362.897) (-3365.205) -- 0:01:23 838000 -- (-3356.386) (-3359.196) (-3357.319) [-3370.179] * (-3363.069) (-3354.239) [-3356.274] (-3365.407) -- 0:01:23 838500 -- (-3361.548) [-3354.492] (-3364.903) (-3359.343) * [-3352.645] (-3358.311) (-3356.893) (-3368.298) -- 0:01:23 839000 -- (-3360.795) (-3362.231) (-3357.653) [-3354.016] * [-3363.315] (-3362.159) (-3360.644) (-3360.829) -- 0:01:22 839500 -- (-3367.746) (-3359.025) [-3365.457] (-3362.035) * (-3352.957) (-3361.375) [-3354.600] (-3360.553) -- 0:01:22 840000 -- (-3368.136) [-3361.731] (-3366.086) (-3367.278) * (-3361.381) [-3363.538] (-3355.671) (-3377.793) -- 0:01:22 Average standard deviation of split frequencies: 0.006293 840500 -- (-3357.233) [-3365.127] (-3361.806) (-3365.384) * (-3364.353) (-3364.677) [-3357.025] (-3359.464) -- 0:01:21 841000 -- [-3357.746] (-3358.670) (-3362.684) (-3362.584) * (-3360.563) [-3357.445] (-3361.027) (-3365.051) -- 0:01:21 841500 -- (-3367.525) (-3366.547) [-3356.827] (-3360.152) * (-3362.677) [-3356.634] (-3356.004) (-3364.634) -- 0:01:21 842000 -- (-3373.598) [-3350.938] (-3357.373) (-3370.789) * (-3361.656) [-3361.765] (-3357.904) (-3365.533) -- 0:01:21 842500 -- (-3361.211) (-3350.080) (-3370.479) [-3357.647] * (-3363.776) [-3355.671] (-3357.470) (-3366.420) -- 0:01:20 843000 -- (-3360.266) (-3351.489) (-3354.277) [-3361.454] * (-3364.960) [-3355.832] (-3359.988) (-3363.690) -- 0:01:20 843500 -- (-3370.170) (-3367.469) (-3357.887) [-3361.889] * (-3355.636) (-3367.748) [-3360.384] (-3360.256) -- 0:01:20 844000 -- (-3360.803) [-3354.658] (-3361.850) (-3369.215) * (-3352.275) [-3352.262] (-3362.441) (-3354.398) -- 0:01:20 844500 -- [-3359.008] (-3363.366) (-3363.353) (-3368.894) * (-3357.571) (-3356.875) (-3360.444) [-3359.015] -- 0:01:19 845000 -- (-3360.998) [-3353.803] (-3366.562) (-3374.769) * (-3359.474) (-3362.653) (-3361.421) [-3357.258] -- 0:01:19 Average standard deviation of split frequencies: 0.006129 845500 -- (-3364.678) (-3368.081) (-3360.075) [-3359.622] * [-3355.606] (-3360.988) (-3374.923) (-3357.904) -- 0:01:19 846000 -- (-3363.107) (-3361.061) (-3361.498) [-3356.062] * [-3357.886] (-3365.305) (-3373.037) (-3370.231) -- 0:01:19 846500 -- (-3373.103) (-3358.324) [-3359.827] (-3357.182) * [-3356.626] (-3362.212) (-3367.874) (-3361.017) -- 0:01:18 847000 -- (-3355.565) (-3357.506) (-3358.213) [-3357.846] * (-3367.776) [-3353.985] (-3359.958) (-3363.928) -- 0:01:18 847500 -- [-3362.063] (-3360.850) (-3357.551) (-3363.960) * (-3364.546) (-3357.829) (-3362.212) [-3354.469] -- 0:01:18 848000 -- (-3364.119) (-3365.451) [-3356.652] (-3358.067) * [-3361.760] (-3359.034) (-3367.977) (-3355.575) -- 0:01:17 848500 -- (-3352.888) (-3359.319) (-3354.622) [-3362.323] * (-3354.609) (-3369.172) (-3355.727) [-3352.954] -- 0:01:17 849000 -- (-3353.022) (-3374.540) (-3358.953) [-3359.296] * [-3355.857] (-3361.793) (-3355.350) (-3364.914) -- 0:01:17 849500 -- [-3362.935] (-3371.461) (-3359.502) (-3361.043) * [-3358.371] (-3363.195) (-3361.963) (-3359.353) -- 0:01:17 850000 -- (-3364.116) (-3363.833) [-3361.550] (-3368.020) * (-3365.769) [-3359.886] (-3361.290) (-3363.914) -- 0:01:16 Average standard deviation of split frequencies: 0.005542 850500 -- (-3358.248) (-3360.369) (-3367.219) [-3367.122] * (-3364.315) (-3362.120) (-3355.964) [-3355.880] -- 0:01:16 851000 -- (-3359.776) (-3363.114) [-3356.879] (-3368.903) * (-3361.668) (-3363.627) [-3359.574] (-3355.286) -- 0:01:16 851500 -- (-3362.477) [-3355.608] (-3364.525) (-3360.654) * (-3364.525) (-3356.165) (-3356.450) [-3357.313] -- 0:01:16 852000 -- (-3362.187) (-3360.537) (-3362.851) [-3366.778] * (-3358.706) (-3360.826) (-3367.973) [-3359.081] -- 0:01:15 852500 -- (-3361.086) [-3358.578] (-3360.439) (-3357.101) * [-3362.076] (-3361.903) (-3361.490) (-3357.016) -- 0:01:15 853000 -- [-3363.313] (-3359.670) (-3366.929) (-3361.597) * (-3367.385) [-3366.009] (-3363.712) (-3353.409) -- 0:01:15 853500 -- [-3361.108] (-3362.368) (-3365.706) (-3355.717) * (-3369.012) (-3361.865) (-3364.109) [-3354.418] -- 0:01:15 854000 -- (-3355.828) [-3356.122] (-3362.384) (-3364.074) * (-3368.448) [-3356.150] (-3358.166) (-3355.442) -- 0:01:14 854500 -- (-3359.024) [-3356.698] (-3364.207) (-3364.893) * (-3364.193) [-3352.672] (-3361.689) (-3360.386) -- 0:01:14 855000 -- [-3357.908] (-3368.936) (-3369.910) (-3358.294) * (-3365.416) (-3361.597) (-3360.648) [-3358.445] -- 0:01:14 Average standard deviation of split frequencies: 0.005507 855500 -- (-3364.152) (-3368.563) (-3362.972) [-3373.945] * (-3364.914) (-3361.229) [-3359.057] (-3363.901) -- 0:01:14 856000 -- [-3363.473] (-3374.401) (-3360.319) (-3360.833) * (-3364.265) (-3356.044) (-3353.923) [-3363.308] -- 0:01:13 856500 -- [-3361.796] (-3364.136) (-3360.592) (-3366.763) * (-3366.627) [-3369.549] (-3365.840) (-3364.436) -- 0:01:13 857000 -- (-3372.844) (-3361.037) (-3357.597) [-3363.111] * (-3364.585) (-3359.894) [-3359.868] (-3359.991) -- 0:01:13 857500 -- (-3359.131) [-3357.583] (-3358.687) (-3355.307) * (-3369.918) [-3364.245] (-3361.690) (-3353.697) -- 0:01:13 858000 -- [-3360.228] (-3357.540) (-3364.753) (-3357.052) * (-3364.473) (-3370.024) (-3369.315) [-3354.934] -- 0:01:12 858500 -- [-3356.075] (-3361.217) (-3361.407) (-3358.378) * [-3373.549] (-3360.526) (-3360.142) (-3358.058) -- 0:01:12 859000 -- (-3358.568) (-3360.021) [-3362.099] (-3367.934) * [-3359.687] (-3355.850) (-3359.839) (-3354.838) -- 0:01:12 859500 -- [-3356.854] (-3359.375) (-3358.878) (-3360.923) * (-3360.972) [-3359.013] (-3366.013) (-3355.360) -- 0:01:12 860000 -- (-3369.012) [-3357.826] (-3364.444) (-3367.426) * (-3366.356) (-3365.025) [-3352.573] (-3360.851) -- 0:01:11 Average standard deviation of split frequencies: 0.004808 860500 -- (-3358.849) [-3359.829] (-3354.512) (-3364.928) * (-3370.612) (-3361.869) [-3352.736] (-3366.526) -- 0:01:11 861000 -- (-3363.393) (-3361.046) [-3354.479] (-3363.561) * (-3376.821) [-3363.128] (-3354.557) (-3363.301) -- 0:01:11 861500 -- [-3351.592] (-3359.918) (-3360.700) (-3365.194) * (-3365.280) (-3365.764) (-3352.298) [-3355.703] -- 0:01:11 862000 -- (-3372.902) (-3354.102) (-3356.648) [-3362.621] * (-3361.330) [-3360.543] (-3365.577) (-3367.016) -- 0:01:10 862500 -- (-3358.146) (-3360.220) [-3357.390] (-3361.065) * (-3369.808) (-3361.151) (-3358.132) [-3356.319] -- 0:01:10 863000 -- (-3361.156) [-3354.195] (-3364.698) (-3355.257) * (-3364.433) (-3351.215) (-3369.230) [-3368.659] -- 0:01:10 863500 -- (-3355.732) [-3359.856] (-3358.989) (-3360.777) * [-3363.606] (-3361.153) (-3372.249) (-3361.066) -- 0:01:10 864000 -- [-3360.901] (-3358.255) (-3361.267) (-3368.441) * [-3356.853] (-3357.344) (-3366.831) (-3358.311) -- 0:01:09 864500 -- (-3359.069) [-3361.286] (-3358.589) (-3370.550) * (-3357.836) [-3363.364] (-3364.567) (-3360.696) -- 0:01:09 865000 -- (-3362.471) [-3356.539] (-3360.832) (-3365.997) * (-3360.519) (-3365.683) [-3358.186] (-3370.398) -- 0:01:09 Average standard deviation of split frequencies: 0.004415 865500 -- (-3368.385) [-3360.188] (-3362.817) (-3364.017) * (-3357.454) (-3364.758) [-3352.528] (-3365.123) -- 0:01:08 866000 -- (-3361.612) (-3370.002) (-3365.207) [-3359.040] * (-3367.185) (-3357.496) (-3362.618) [-3364.342] -- 0:01:08 866500 -- (-3379.467) (-3359.923) (-3357.988) [-3359.062] * (-3367.991) (-3360.118) [-3358.480] (-3366.842) -- 0:01:08 867000 -- (-3361.309) (-3360.881) [-3362.791] (-3359.223) * [-3355.543] (-3350.134) (-3354.602) (-3361.016) -- 0:01:08 867500 -- (-3356.833) (-3354.378) [-3362.868] (-3364.638) * (-3358.510) (-3357.115) [-3363.002] (-3358.849) -- 0:01:07 868000 -- (-3356.079) (-3364.738) [-3360.916] (-3363.730) * [-3358.321] (-3369.027) (-3363.706) (-3355.293) -- 0:01:07 868500 -- (-3363.318) (-3363.651) [-3354.426] (-3367.091) * [-3355.711] (-3364.613) (-3360.747) (-3356.569) -- 0:01:07 869000 -- [-3354.377] (-3374.546) (-3360.044) (-3365.467) * (-3355.261) (-3357.484) (-3364.520) [-3357.124] -- 0:01:07 869500 -- (-3355.054) (-3357.978) (-3365.406) [-3362.025] * (-3368.344) [-3350.176] (-3363.166) (-3356.083) -- 0:01:06 870000 -- (-3361.828) (-3358.251) [-3361.770] (-3358.725) * (-3363.413) (-3357.218) (-3359.480) [-3366.017] -- 0:01:06 Average standard deviation of split frequencies: 0.004031 870500 -- (-3364.436) (-3361.008) (-3359.778) [-3357.598] * (-3366.409) [-3356.655] (-3355.371) (-3365.330) -- 0:01:06 871000 -- [-3360.286] (-3360.721) (-3365.949) (-3360.280) * [-3364.257] (-3363.767) (-3362.895) (-3357.396) -- 0:01:06 871500 -- (-3369.577) [-3371.416] (-3362.152) (-3371.077) * (-3367.742) (-3363.394) [-3358.496] (-3364.687) -- 0:01:05 872000 -- (-3362.010) (-3370.758) [-3358.760] (-3364.758) * [-3370.405] (-3357.164) (-3361.877) (-3365.015) -- 0:01:05 872500 -- (-3356.401) (-3362.408) [-3360.482] (-3359.039) * (-3368.815) [-3365.751] (-3367.377) (-3360.599) -- 0:01:05 873000 -- (-3361.557) (-3360.642) (-3360.026) [-3354.395] * (-3359.186) [-3364.196] (-3356.716) (-3365.834) -- 0:01:05 873500 -- (-3363.310) (-3356.018) [-3362.210] (-3360.310) * (-3374.282) (-3357.247) (-3358.497) [-3356.251] -- 0:01:04 874000 -- (-3370.359) (-3360.050) (-3359.921) [-3357.399] * (-3359.807) [-3352.564] (-3363.512) (-3369.023) -- 0:01:04 874500 -- (-3360.260) [-3357.119] (-3362.756) (-3358.719) * (-3365.948) [-3358.139] (-3358.941) (-3357.104) -- 0:01:04 875000 -- (-3355.101) [-3357.573] (-3366.274) (-3355.073) * (-3372.492) (-3369.782) [-3358.086] (-3367.450) -- 0:01:04 Average standard deviation of split frequencies: 0.004185 875500 -- (-3353.610) [-3369.725] (-3363.572) (-3358.276) * (-3364.333) (-3366.364) [-3357.495] (-3364.055) -- 0:01:03 876000 -- (-3364.643) [-3355.568] (-3362.307) (-3358.390) * (-3355.992) [-3366.716] (-3361.806) (-3374.673) -- 0:01:03 876500 -- (-3360.712) (-3362.999) (-3367.709) [-3357.103] * (-3364.179) (-3354.318) [-3352.623] (-3365.046) -- 0:01:03 877000 -- (-3356.210) (-3357.292) (-3363.538) [-3361.822] * (-3353.624) (-3361.399) [-3357.270] (-3366.566) -- 0:01:03 877500 -- (-3363.854) (-3366.643) [-3358.882] (-3363.306) * (-3365.330) (-3362.817) [-3356.841] (-3366.961) -- 0:01:02 878000 -- (-3367.055) (-3360.263) [-3358.185] (-3353.399) * (-3359.202) [-3354.498] (-3366.063) (-3359.542) -- 0:01:02 878500 -- (-3366.795) (-3362.826) (-3363.897) [-3357.024] * (-3356.320) (-3361.663) [-3364.002] (-3360.618) -- 0:01:02 879000 -- (-3369.633) (-3354.061) [-3356.050] (-3359.550) * (-3365.278) (-3367.161) [-3367.555] (-3367.280) -- 0:01:02 879500 -- (-3364.160) [-3364.426] (-3357.257) (-3357.636) * [-3360.761] (-3356.680) (-3364.652) (-3360.223) -- 0:01:01 880000 -- (-3366.255) [-3355.465] (-3364.263) (-3364.072) * (-3365.335) (-3358.413) (-3364.249) [-3363.734] -- 0:01:01 Average standard deviation of split frequencies: 0.004104 880500 -- (-3363.492) (-3355.554) (-3362.954) [-3354.390] * (-3355.360) (-3363.711) [-3356.190] (-3365.169) -- 0:01:01 881000 -- (-3369.458) (-3357.536) (-3369.599) [-3369.833] * [-3358.469] (-3363.815) (-3364.686) (-3371.809) -- 0:01:01 881500 -- [-3347.867] (-3361.318) (-3363.018) (-3360.511) * (-3362.345) [-3358.296] (-3356.511) (-3364.627) -- 0:01:00 882000 -- (-3357.725) (-3364.866) (-3370.694) [-3356.824] * (-3357.275) [-3354.695] (-3360.226) (-3357.623) -- 0:01:00 882500 -- (-3365.421) (-3362.615) (-3361.258) [-3355.764] * (-3365.743) [-3355.583] (-3369.216) (-3353.173) -- 0:01:00 883000 -- (-3369.974) (-3357.489) (-3361.007) [-3357.141] * (-3363.273) (-3354.778) (-3364.522) [-3350.259] -- 0:01:00 883500 -- (-3361.746) (-3359.657) [-3356.756] (-3362.767) * [-3353.268] (-3362.574) (-3366.230) (-3362.116) -- 0:00:59 884000 -- (-3359.922) (-3367.659) (-3359.669) [-3361.541] * (-3357.135) (-3364.566) (-3354.110) [-3351.681] -- 0:00:59 884500 -- (-3351.925) [-3360.783] (-3366.032) (-3356.695) * (-3363.817) (-3358.596) (-3354.240) [-3355.688] -- 0:00:59 885000 -- [-3357.615] (-3359.090) (-3361.008) (-3373.054) * (-3367.257) (-3364.290) (-3350.500) [-3361.297] -- 0:00:58 Average standard deviation of split frequencies: 0.004434 885500 -- (-3362.641) (-3371.416) [-3361.976] (-3362.861) * [-3358.722] (-3355.162) (-3362.006) (-3360.668) -- 0:00:58 886000 -- (-3358.118) [-3355.003] (-3361.642) (-3365.499) * (-3362.990) (-3365.436) [-3356.995] (-3368.619) -- 0:00:58 886500 -- (-3368.434) (-3356.489) [-3356.747] (-3366.023) * (-3362.426) (-3364.224) [-3364.160] (-3358.499) -- 0:00:58 887000 -- (-3369.976) [-3357.601] (-3366.182) (-3358.868) * (-3361.483) [-3355.440] (-3365.918) (-3358.034) -- 0:00:57 887500 -- (-3360.108) (-3362.013) (-3366.691) [-3356.703] * [-3360.294] (-3360.931) (-3360.348) (-3363.049) -- 0:00:57 888000 -- (-3360.577) [-3354.819] (-3365.810) (-3361.467) * (-3364.145) (-3353.753) [-3356.164] (-3358.671) -- 0:00:57 888500 -- (-3363.888) [-3366.742] (-3372.482) (-3356.970) * [-3357.272] (-3356.922) (-3356.060) (-3364.844) -- 0:00:57 889000 -- (-3361.172) (-3368.887) [-3360.326] (-3371.581) * (-3358.082) [-3353.717] (-3366.239) (-3358.748) -- 0:00:56 889500 -- (-3362.208) (-3361.029) (-3357.561) [-3361.356] * (-3374.921) (-3364.291) (-3363.415) [-3350.052] -- 0:00:56 890000 -- [-3360.910] (-3369.704) (-3358.704) (-3365.605) * (-3358.329) (-3357.372) (-3359.852) [-3357.353] -- 0:00:56 Average standard deviation of split frequencies: 0.004058 890500 -- (-3367.477) (-3362.894) (-3354.368) [-3363.588] * (-3358.088) (-3356.208) [-3357.237] (-3358.183) -- 0:00:56 891000 -- [-3363.159] (-3362.618) (-3358.444) (-3357.280) * (-3364.626) (-3357.318) (-3364.527) [-3359.983] -- 0:00:55 891500 -- (-3364.766) (-3357.835) (-3360.487) [-3361.007] * (-3357.707) [-3356.200] (-3362.104) (-3359.178) -- 0:00:55 892000 -- (-3354.075) (-3359.652) (-3359.805) [-3351.004] * (-3359.065) [-3362.707] (-3354.871) (-3365.777) -- 0:00:55 892500 -- (-3362.556) [-3365.673] (-3362.430) (-3355.226) * (-3356.089) [-3357.200] (-3358.614) (-3363.669) -- 0:00:55 893000 -- (-3357.438) (-3366.512) (-3362.898) [-3357.057] * (-3359.119) [-3356.480] (-3361.845) (-3360.339) -- 0:00:54 893500 -- [-3365.630] (-3361.166) (-3359.020) (-3359.518) * (-3364.974) [-3362.506] (-3363.374) (-3363.243) -- 0:00:54 894000 -- (-3363.173) (-3362.944) [-3354.892] (-3355.230) * (-3372.673) (-3361.994) [-3364.922] (-3367.694) -- 0:00:54 894500 -- (-3376.274) (-3363.051) [-3361.179] (-3363.573) * (-3350.091) (-3360.040) [-3365.212] (-3377.918) -- 0:00:54 895000 -- [-3367.564] (-3353.960) (-3363.831) (-3356.842) * (-3371.361) [-3366.333] (-3366.033) (-3363.693) -- 0:00:53 Average standard deviation of split frequencies: 0.003741 895500 -- (-3367.398) (-3367.242) [-3357.197] (-3361.736) * [-3361.234] (-3370.498) (-3362.260) (-3366.237) -- 0:00:53 896000 -- [-3363.945] (-3362.704) (-3363.067) (-3365.473) * (-3355.852) (-3368.396) [-3352.201] (-3365.840) -- 0:00:53 896500 -- (-3358.879) (-3368.649) [-3356.210] (-3357.856) * (-3359.283) (-3369.590) (-3360.920) [-3357.057] -- 0:00:53 897000 -- (-3360.555) [-3358.758] (-3369.594) (-3369.527) * (-3358.238) (-3364.452) [-3356.970] (-3362.587) -- 0:00:52 897500 -- (-3363.672) [-3356.018] (-3363.383) (-3359.068) * [-3357.274] (-3372.219) (-3358.383) (-3358.583) -- 0:00:52 898000 -- (-3358.880) [-3361.077] (-3367.291) (-3369.275) * (-3358.353) (-3361.593) [-3354.036] (-3354.009) -- 0:00:52 898500 -- (-3369.566) (-3355.807) (-3359.540) [-3358.716] * (-3364.845) (-3358.761) [-3355.962] (-3352.791) -- 0:00:52 899000 -- (-3356.984) [-3359.060] (-3362.052) (-3365.638) * (-3360.226) [-3351.826] (-3355.892) (-3356.788) -- 0:00:51 899500 -- (-3361.680) [-3358.747] (-3370.203) (-3363.455) * (-3361.492) (-3360.928) (-3374.393) [-3371.024] -- 0:00:51 900000 -- (-3361.033) [-3351.364] (-3362.567) (-3368.796) * (-3372.493) [-3352.251] (-3373.699) (-3357.445) -- 0:00:51 Average standard deviation of split frequencies: 0.004013 900500 -- [-3356.333] (-3359.546) (-3361.144) (-3364.340) * (-3360.336) [-3358.038] (-3367.240) (-3361.440) -- 0:00:51 901000 -- (-3359.310) (-3358.571) [-3357.520] (-3372.451) * (-3367.424) (-3363.755) (-3364.474) [-3364.759] -- 0:00:50 901500 -- (-3366.565) (-3360.518) (-3360.902) [-3357.108] * (-3364.638) (-3357.599) (-3358.534) [-3357.237] -- 0:00:50 902000 -- (-3366.436) (-3360.710) (-3358.252) [-3354.377] * (-3360.266) [-3361.708] (-3362.690) (-3354.884) -- 0:00:50 902500 -- (-3368.010) (-3367.807) (-3365.939) [-3355.661] * (-3365.187) [-3360.024] (-3354.787) (-3359.360) -- 0:00:50 903000 -- (-3366.765) (-3361.085) (-3371.778) [-3362.405] * (-3366.590) (-3359.562) (-3357.885) [-3359.363] -- 0:00:49 903500 -- (-3369.768) (-3360.128) (-3361.542) [-3355.470] * (-3372.915) (-3361.650) (-3364.681) [-3361.213] -- 0:00:49 904000 -- (-3366.876) (-3366.257) [-3368.256] (-3358.095) * (-3361.076) (-3356.066) [-3362.474] (-3369.307) -- 0:00:49 904500 -- (-3362.926) (-3360.410) [-3359.625] (-3360.774) * (-3357.768) (-3363.146) (-3363.654) [-3356.381] -- 0:00:48 905000 -- (-3364.480) (-3357.282) (-3367.010) [-3353.668] * [-3372.716] (-3363.058) (-3364.773) (-3364.557) -- 0:00:48 Average standard deviation of split frequencies: 0.003931 905500 -- (-3353.727) [-3360.636] (-3367.939) (-3357.837) * (-3354.100) (-3366.760) (-3360.259) [-3353.446] -- 0:00:48 906000 -- (-3361.776) [-3363.905] (-3357.417) (-3365.123) * (-3350.240) (-3367.797) [-3358.508] (-3356.692) -- 0:00:48 906500 -- (-3355.740) (-3357.325) [-3349.186] (-3359.195) * (-3355.988) [-3367.286] (-3359.386) (-3356.785) -- 0:00:47 907000 -- (-3362.454) [-3352.908] (-3365.049) (-3371.204) * [-3355.783] (-3365.581) (-3367.658) (-3367.109) -- 0:00:47 907500 -- (-3361.687) (-3358.480) [-3352.557] (-3366.318) * (-3362.090) (-3362.759) [-3365.823] (-3363.848) -- 0:00:47 908000 -- [-3357.296] (-3359.809) (-3362.686) (-3357.474) * (-3365.618) [-3362.623] (-3366.734) (-3361.866) -- 0:00:47 908500 -- [-3359.786] (-3355.150) (-3376.733) (-3364.735) * (-3366.894) (-3356.651) (-3366.771) [-3354.740] -- 0:00:46 909000 -- (-3368.767) (-3363.384) (-3364.164) [-3352.466] * (-3363.172) (-3362.423) [-3359.367] (-3358.463) -- 0:00:46 909500 -- (-3364.355) (-3367.491) [-3360.959] (-3358.064) * [-3360.045] (-3362.632) (-3357.689) (-3357.762) -- 0:00:46 910000 -- (-3359.319) (-3364.434) (-3358.921) [-3356.776] * (-3351.670) (-3362.477) (-3360.123) [-3361.756] -- 0:00:46 Average standard deviation of split frequencies: 0.003739 910500 -- [-3356.110] (-3358.268) (-3366.918) (-3360.165) * (-3359.540) (-3370.428) [-3362.964] (-3361.191) -- 0:00:45 911000 -- (-3364.773) (-3364.872) (-3357.433) [-3355.535] * (-3363.879) (-3366.233) (-3364.738) [-3367.576] -- 0:00:45 911500 -- (-3365.185) (-3365.311) (-3359.802) [-3359.450] * (-3358.934) [-3362.558] (-3365.689) (-3370.385) -- 0:00:45 912000 -- (-3363.449) (-3361.511) (-3366.382) [-3358.925] * (-3357.505) (-3362.669) [-3355.436] (-3367.668) -- 0:00:45 912500 -- [-3360.214] (-3356.814) (-3360.367) (-3365.084) * (-3363.180) [-3356.821] (-3357.601) (-3361.959) -- 0:00:44 913000 -- (-3362.195) (-3364.920) [-3359.297] (-3364.054) * (-3359.640) [-3369.003] (-3365.986) (-3368.967) -- 0:00:44 913500 -- (-3378.899) (-3362.291) [-3360.478] (-3368.463) * (-3355.887) [-3364.942] (-3374.629) (-3357.884) -- 0:00:44 914000 -- (-3369.131) (-3362.778) (-3356.045) [-3359.873] * (-3364.541) [-3358.960] (-3362.404) (-3364.188) -- 0:00:44 914500 -- (-3358.399) (-3371.553) [-3354.481] (-3356.029) * (-3355.650) (-3369.591) [-3361.539] (-3353.658) -- 0:00:43 915000 -- [-3357.052] (-3357.103) (-3353.338) (-3367.937) * (-3366.935) (-3359.973) [-3353.122] (-3361.703) -- 0:00:43 Average standard deviation of split frequencies: 0.003888 915500 -- [-3356.654] (-3360.649) (-3361.212) (-3362.250) * (-3366.657) (-3353.437) (-3355.968) [-3355.685] -- 0:00:43 916000 -- [-3358.817] (-3356.881) (-3357.822) (-3360.154) * [-3361.235] (-3356.948) (-3361.891) (-3361.566) -- 0:00:43 916500 -- [-3356.439] (-3370.368) (-3354.618) (-3370.602) * (-3364.011) [-3356.395] (-3369.098) (-3360.768) -- 0:00:42 917000 -- (-3357.453) [-3356.289] (-3360.781) (-3359.306) * (-3369.194) (-3358.257) [-3357.722] (-3357.920) -- 0:00:42 917500 -- (-3361.618) (-3365.539) [-3361.868] (-3356.896) * (-3359.938) (-3360.098) [-3358.004] (-3357.872) -- 0:00:42 918000 -- [-3358.298] (-3374.947) (-3359.454) (-3358.057) * (-3356.970) (-3355.300) (-3369.911) [-3369.085] -- 0:00:42 918500 -- [-3362.581] (-3359.125) (-3359.948) (-3366.795) * (-3360.604) [-3360.707] (-3362.407) (-3369.975) -- 0:00:41 919000 -- (-3363.455) (-3359.930) [-3358.188] (-3359.198) * [-3361.079] (-3359.879) (-3358.100) (-3364.452) -- 0:00:41 919500 -- (-3357.889) [-3358.908] (-3358.157) (-3360.251) * (-3358.209) [-3363.054] (-3366.142) (-3371.084) -- 0:00:41 920000 -- (-3360.368) (-3365.213) [-3355.170] (-3354.760) * (-3364.216) (-3359.732) [-3353.210] (-3365.567) -- 0:00:41 Average standard deviation of split frequencies: 0.003812 920500 -- [-3355.797] (-3366.313) (-3360.508) (-3356.546) * (-3357.143) (-3368.090) (-3372.299) [-3358.875] -- 0:00:40 921000 -- (-3362.780) (-3354.381) (-3368.579) [-3361.964] * (-3354.175) (-3363.327) [-3353.262] (-3357.388) -- 0:00:40 921500 -- (-3357.593) [-3357.443] (-3362.332) (-3360.172) * (-3362.175) [-3362.811] (-3364.862) (-3366.235) -- 0:00:40 922000 -- (-3366.013) [-3356.460] (-3380.134) (-3358.921) * (-3372.816) (-3366.233) [-3369.912] (-3357.215) -- 0:00:40 922500 -- [-3359.959] (-3356.952) (-3364.654) (-3355.980) * (-3372.700) (-3369.112) (-3364.741) [-3357.641] -- 0:00:39 923000 -- (-3362.246) (-3360.672) (-3354.985) [-3361.982] * (-3360.725) [-3354.926] (-3364.610) (-3364.966) -- 0:00:39 923500 -- (-3367.846) [-3365.331] (-3361.029) (-3356.600) * (-3362.895) (-3358.881) [-3355.196] (-3365.811) -- 0:00:39 924000 -- (-3374.594) [-3357.229] (-3352.910) (-3357.620) * (-3371.558) (-3357.157) [-3363.335] (-3355.084) -- 0:00:38 924500 -- (-3357.520) [-3355.869] (-3354.758) (-3359.666) * (-3369.750) (-3358.817) [-3356.919] (-3368.222) -- 0:00:38 925000 -- [-3361.249] (-3355.461) (-3366.717) (-3360.981) * (-3365.873) (-3357.214) (-3365.896) [-3365.270] -- 0:00:38 Average standard deviation of split frequencies: 0.003620 925500 -- [-3353.435] (-3358.398) (-3360.807) (-3373.647) * (-3355.706) [-3357.114] (-3353.690) (-3364.384) -- 0:00:38 926000 -- [-3357.429] (-3361.236) (-3366.253) (-3364.166) * (-3365.836) (-3369.787) [-3357.865] (-3362.989) -- 0:00:37 926500 -- (-3361.151) [-3352.165] (-3369.774) (-3361.990) * (-3362.781) (-3363.128) [-3363.885] (-3363.589) -- 0:00:37 927000 -- (-3368.727) (-3362.074) (-3375.129) [-3357.917] * (-3362.653) [-3358.806] (-3360.246) (-3356.525) -- 0:00:37 927500 -- [-3360.220] (-3362.901) (-3370.584) (-3364.162) * (-3365.592) [-3356.848] (-3365.461) (-3361.173) -- 0:00:37 928000 -- (-3353.610) [-3358.927] (-3370.506) (-3362.584) * [-3361.221] (-3365.908) (-3361.275) (-3361.110) -- 0:00:36 928500 -- [-3354.912] (-3364.999) (-3374.858) (-3369.842) * (-3371.579) [-3367.303] (-3355.173) (-3371.110) -- 0:00:36 929000 -- (-3357.001) (-3365.900) (-3363.959) [-3361.771] * (-3361.262) (-3366.129) [-3360.211] (-3357.496) -- 0:00:36 929500 -- (-3356.821) (-3357.126) (-3365.603) [-3361.914] * (-3358.282) (-3366.346) [-3351.472] (-3358.568) -- 0:00:36 930000 -- [-3362.910] (-3358.658) (-3366.019) (-3367.226) * (-3366.966) (-3357.891) (-3355.296) [-3360.565] -- 0:00:35 Average standard deviation of split frequencies: 0.003996 930500 -- [-3358.028] (-3353.852) (-3369.763) (-3372.495) * (-3370.103) (-3370.592) [-3352.857] (-3362.793) -- 0:00:35 931000 -- [-3355.718] (-3368.216) (-3364.076) (-3357.245) * [-3359.974] (-3360.013) (-3361.096) (-3357.493) -- 0:00:35 931500 -- (-3360.535) (-3362.777) (-3363.843) [-3358.799] * [-3363.943] (-3366.248) (-3360.871) (-3356.906) -- 0:00:35 932000 -- [-3355.028] (-3359.127) (-3357.992) (-3357.663) * (-3361.276) (-3357.958) (-3363.680) [-3355.620] -- 0:00:34 932500 -- (-3367.463) (-3360.134) (-3370.177) [-3364.564] * [-3364.920] (-3356.121) (-3354.776) (-3361.311) -- 0:00:34 933000 -- (-3365.756) (-3369.614) (-3364.489) [-3353.125] * (-3367.980) [-3365.160] (-3359.387) (-3369.264) -- 0:00:34 933500 -- (-3363.941) [-3358.012] (-3362.446) (-3362.912) * (-3361.435) [-3358.336] (-3359.534) (-3358.947) -- 0:00:34 934000 -- (-3357.961) [-3352.841] (-3361.359) (-3365.048) * (-3367.086) (-3352.324) (-3358.854) [-3362.255] -- 0:00:33 934500 -- (-3366.471) (-3354.995) [-3351.374] (-3367.338) * (-3359.960) (-3370.034) (-3366.600) [-3362.141] -- 0:00:33 935000 -- (-3360.366) (-3356.729) (-3365.400) [-3358.309] * (-3364.899) (-3359.140) (-3358.322) [-3366.845] -- 0:00:33 Average standard deviation of split frequencies: 0.004253 935500 -- (-3360.572) (-3359.248) (-3361.327) [-3356.471] * (-3362.241) [-3358.641] (-3365.020) (-3353.860) -- 0:00:33 936000 -- (-3370.074) (-3356.240) (-3358.712) [-3358.918] * (-3362.645) (-3371.188) [-3361.296] (-3356.691) -- 0:00:32 936500 -- (-3362.072) (-3360.408) (-3357.419) [-3357.781] * (-3365.142) (-3364.701) [-3356.607] (-3352.827) -- 0:00:32 937000 -- (-3381.531) (-3370.202) (-3360.151) [-3362.898] * (-3358.953) (-3368.715) [-3359.920] (-3363.955) -- 0:00:32 937500 -- (-3365.367) [-3358.540] (-3363.124) (-3360.529) * [-3356.826] (-3368.579) (-3357.896) (-3364.790) -- 0:00:32 938000 -- [-3354.439] (-3368.889) (-3364.881) (-3358.792) * [-3360.567] (-3364.311) (-3356.785) (-3361.618) -- 0:00:31 938500 -- (-3364.899) (-3357.133) (-3362.318) [-3361.166] * (-3367.481) [-3357.198] (-3362.711) (-3355.038) -- 0:00:31 939000 -- [-3361.476] (-3355.110) (-3362.529) (-3368.337) * (-3355.683) (-3361.931) (-3364.276) [-3358.770] -- 0:00:31 939500 -- (-3356.554) (-3356.838) [-3362.414] (-3362.200) * (-3361.197) (-3355.215) (-3370.889) [-3356.753] -- 0:00:30 940000 -- (-3371.028) (-3354.128) (-3362.786) [-3354.551] * (-3367.307) (-3363.536) [-3360.609] (-3362.178) -- 0:00:30 Average standard deviation of split frequencies: 0.004510 940500 -- (-3360.005) [-3356.256] (-3361.031) (-3366.143) * [-3367.301] (-3358.323) (-3367.681) (-3363.415) -- 0:00:30 941000 -- (-3363.655) [-3358.655] (-3376.037) (-3368.179) * [-3358.694] (-3360.368) (-3365.682) (-3369.078) -- 0:00:30 941500 -- (-3355.950) [-3357.054] (-3360.859) (-3361.542) * (-3355.743) (-3360.801) (-3361.144) [-3360.623] -- 0:00:30 942000 -- [-3358.201] (-3372.237) (-3366.497) (-3352.315) * [-3361.767] (-3368.099) (-3358.548) (-3354.529) -- 0:00:29 942500 -- (-3356.884) (-3365.167) [-3362.542] (-3371.853) * (-3362.528) (-3360.120) [-3353.574] (-3359.523) -- 0:00:29 943000 -- [-3362.584] (-3357.758) (-3364.905) (-3368.292) * (-3356.121) (-3373.038) [-3353.632] (-3357.804) -- 0:00:29 943500 -- (-3358.180) (-3356.642) [-3358.803] (-3368.712) * [-3359.716] (-3359.885) (-3363.094) (-3359.619) -- 0:00:28 944000 -- (-3362.489) (-3359.085) [-3359.513] (-3365.570) * (-3358.941) (-3355.506) (-3369.552) [-3355.703] -- 0:00:28 944500 -- [-3364.369] (-3354.217) (-3358.412) (-3365.928) * (-3354.732) (-3365.103) (-3370.312) [-3359.530] -- 0:00:28 945000 -- [-3359.101] (-3357.849) (-3359.880) (-3368.419) * (-3355.796) (-3358.486) [-3364.014] (-3360.062) -- 0:00:28 Average standard deviation of split frequencies: 0.004706 945500 -- (-3365.456) [-3367.374] (-3360.479) (-3359.683) * [-3368.432] (-3364.437) (-3366.002) (-3365.465) -- 0:00:27 946000 -- (-3365.516) (-3367.718) (-3352.617) [-3363.051] * (-3354.457) (-3361.375) (-3360.302) [-3359.806] -- 0:00:27 946500 -- (-3371.861) [-3365.662] (-3368.017) (-3370.592) * (-3366.995) (-3354.657) [-3357.276] (-3360.592) -- 0:00:27 947000 -- (-3369.942) (-3365.834) [-3357.622] (-3371.231) * (-3359.753) (-3358.946) (-3367.042) [-3353.722] -- 0:00:27 947500 -- [-3364.626] (-3365.642) (-3373.577) (-3369.920) * (-3366.341) (-3364.222) (-3359.802) [-3369.706] -- 0:00:26 948000 -- (-3360.309) (-3361.484) (-3362.378) [-3354.567] * (-3367.376) [-3354.978] (-3362.182) (-3363.779) -- 0:00:26 948500 -- (-3358.529) [-3356.507] (-3353.334) (-3368.493) * [-3359.316] (-3365.465) (-3361.868) (-3363.129) -- 0:00:26 949000 -- [-3363.807] (-3356.660) (-3355.722) (-3360.695) * [-3369.423] (-3357.605) (-3353.741) (-3366.611) -- 0:00:26 949500 -- (-3361.551) [-3359.909] (-3364.570) (-3356.738) * (-3368.784) (-3356.666) [-3363.437] (-3364.390) -- 0:00:25 950000 -- [-3355.210] (-3369.295) (-3370.523) (-3359.550) * (-3360.584) [-3354.413] (-3370.381) (-3364.714) -- 0:00:25 Average standard deviation of split frequencies: 0.005124 950500 -- (-3357.789) (-3358.227) (-3365.205) [-3356.636] * (-3354.839) [-3364.742] (-3364.711) (-3367.870) -- 0:00:25 951000 -- (-3359.187) [-3351.790] (-3360.372) (-3357.934) * (-3363.025) [-3354.121] (-3361.130) (-3368.244) -- 0:00:25 951500 -- [-3352.980] (-3367.334) (-3354.544) (-3358.264) * (-3362.798) [-3362.169] (-3359.068) (-3365.553) -- 0:00:24 952000 -- (-3355.516) (-3357.393) [-3360.386] (-3356.769) * [-3361.155] (-3363.200) (-3362.795) (-3358.257) -- 0:00:24 952500 -- (-3355.826) (-3360.573) [-3359.617] (-3362.935) * (-3367.734) (-3379.749) [-3362.650] (-3356.886) -- 0:00:24 953000 -- (-3368.109) (-3362.427) [-3355.689] (-3354.438) * (-3356.177) (-3359.279) (-3369.384) [-3358.830] -- 0:00:24 953500 -- [-3353.764] (-3368.648) (-3372.695) (-3357.413) * [-3354.034] (-3353.396) (-3364.144) (-3362.574) -- 0:00:23 954000 -- (-3365.559) (-3357.604) [-3365.090] (-3358.084) * (-3357.492) [-3350.305] (-3364.813) (-3359.965) -- 0:00:23 954500 -- (-3358.945) (-3361.698) (-3359.619) [-3354.038] * (-3363.404) (-3362.509) (-3365.518) [-3357.181] -- 0:00:23 955000 -- [-3353.599] (-3359.487) (-3352.840) (-3362.031) * (-3363.791) (-3359.215) (-3358.772) [-3361.244] -- 0:00:23 Average standard deviation of split frequencies: 0.004931 955500 -- [-3357.234] (-3362.379) (-3359.945) (-3358.503) * (-3360.141) (-3362.864) (-3359.870) [-3360.481] -- 0:00:22 956000 -- (-3360.669) (-3370.465) [-3359.617] (-3363.687) * [-3357.511] (-3358.778) (-3354.468) (-3360.909) -- 0:00:22 956500 -- (-3362.603) [-3364.293] (-3356.163) (-3364.861) * (-3358.452) [-3364.306] (-3357.225) (-3363.344) -- 0:00:22 957000 -- (-3363.925) (-3358.628) (-3364.768) [-3363.614] * (-3362.979) (-3361.257) (-3358.909) [-3359.219] -- 0:00:22 957500 -- (-3364.487) (-3367.738) (-3366.695) [-3354.273] * (-3367.774) (-3361.194) (-3356.630) [-3363.436] -- 0:00:21 958000 -- [-3354.906] (-3356.796) (-3360.544) (-3372.914) * (-3363.282) [-3362.855] (-3364.789) (-3361.436) -- 0:00:21 958500 -- (-3355.351) (-3358.073) [-3354.530] (-3372.998) * (-3366.155) (-3365.249) [-3366.587] (-3357.113) -- 0:00:21 959000 -- [-3361.330] (-3356.860) (-3361.880) (-3365.182) * (-3370.370) [-3354.555] (-3355.676) (-3360.234) -- 0:00:20 959500 -- (-3355.394) (-3356.066) (-3365.547) [-3362.431] * (-3364.527) (-3364.144) (-3358.970) [-3354.647] -- 0:00:20 960000 -- [-3363.091] (-3357.589) (-3365.490) (-3370.141) * (-3355.901) (-3363.356) (-3365.263) [-3364.429] -- 0:00:20 Average standard deviation of split frequencies: 0.004798 960500 -- (-3360.432) (-3365.831) [-3358.558] (-3360.139) * (-3359.167) (-3358.085) (-3364.605) [-3357.629] -- 0:00:20 961000 -- (-3360.130) [-3361.588] (-3363.089) (-3364.127) * [-3363.860] (-3369.471) (-3366.769) (-3356.164) -- 0:00:19 961500 -- [-3351.414] (-3365.029) (-3365.495) (-3365.752) * (-3362.228) (-3362.753) [-3360.000] (-3365.233) -- 0:00:19 962000 -- [-3359.075] (-3364.121) (-3354.322) (-3360.281) * (-3364.286) [-3357.999] (-3366.647) (-3364.288) -- 0:00:19 962500 -- (-3357.695) (-3359.630) (-3359.226) [-3353.749] * (-3351.203) (-3361.975) [-3361.435] (-3357.985) -- 0:00:19 963000 -- (-3359.832) (-3366.991) [-3361.888] (-3359.505) * [-3355.657] (-3367.876) (-3358.650) (-3355.732) -- 0:00:18 963500 -- (-3370.667) (-3364.266) [-3363.418] (-3356.915) * (-3365.344) (-3365.460) (-3362.142) [-3355.121] -- 0:00:18 964000 -- (-3369.522) (-3356.595) [-3353.683] (-3365.328) * (-3356.353) (-3357.182) (-3360.868) [-3355.660] -- 0:00:18 964500 -- [-3368.667] (-3368.216) (-3362.606) (-3368.754) * [-3356.611] (-3360.174) (-3354.925) (-3353.776) -- 0:00:18 965000 -- (-3363.043) [-3353.246] (-3371.577) (-3367.927) * (-3359.866) (-3361.443) (-3362.880) [-3365.854] -- 0:00:17 Average standard deviation of split frequencies: 0.004880 965500 -- (-3373.255) (-3360.357) [-3359.790] (-3358.582) * [-3362.198] (-3361.162) (-3361.427) (-3371.050) -- 0:00:17 966000 -- [-3360.926] (-3361.398) (-3368.644) (-3364.897) * (-3354.966) (-3361.409) (-3363.896) [-3367.016] -- 0:00:17 966500 -- (-3361.803) (-3365.558) (-3355.826) [-3360.096] * [-3355.325] (-3357.720) (-3364.540) (-3365.070) -- 0:00:17 967000 -- (-3358.272) (-3359.588) [-3365.171] (-3366.219) * (-3369.978) [-3354.639] (-3365.026) (-3366.393) -- 0:00:16 967500 -- [-3357.694] (-3354.235) (-3364.605) (-3362.611) * [-3364.510] (-3367.689) (-3370.887) (-3376.108) -- 0:00:16 968000 -- (-3362.234) (-3350.040) (-3353.661) [-3360.878] * (-3357.498) (-3362.497) (-3364.963) [-3358.681] -- 0:00:16 968500 -- [-3357.807] (-3351.829) (-3361.922) (-3355.832) * (-3364.177) (-3357.963) [-3359.932] (-3362.964) -- 0:00:16 969000 -- (-3361.030) (-3364.471) [-3352.557] (-3360.373) * [-3356.467] (-3362.174) (-3360.202) (-3361.770) -- 0:00:15 969500 -- [-3357.725] (-3366.561) (-3365.200) (-3363.027) * [-3361.149] (-3360.537) (-3358.636) (-3361.742) -- 0:00:15 970000 -- (-3365.613) (-3363.332) (-3358.261) [-3354.032] * (-3363.676) (-3360.189) (-3366.594) [-3359.822] -- 0:00:15 Average standard deviation of split frequencies: 0.004857 970500 -- [-3355.145] (-3354.609) (-3363.494) (-3364.964) * [-3353.977] (-3368.181) (-3353.915) (-3364.005) -- 0:00:15 971000 -- (-3362.693) (-3370.159) [-3355.586] (-3362.884) * (-3359.010) (-3363.858) (-3366.945) [-3356.943] -- 0:00:14 971500 -- [-3359.805] (-3362.447) (-3354.239) (-3374.647) * (-3359.419) (-3361.143) [-3357.638] (-3360.597) -- 0:00:14 972000 -- (-3352.197) (-3356.959) [-3367.156] (-3369.713) * (-3358.741) (-3353.388) (-3353.762) [-3362.468] -- 0:00:14 972500 -- [-3360.239] (-3353.348) (-3373.736) (-3359.194) * (-3354.646) (-3364.017) [-3357.640] (-3362.981) -- 0:00:14 973000 -- (-3363.208) (-3356.374) [-3359.872] (-3357.994) * (-3355.153) (-3358.801) (-3356.364) [-3357.473] -- 0:00:13 973500 -- (-3361.905) (-3364.638) (-3364.151) [-3354.492] * (-3358.034) (-3360.902) (-3376.789) [-3361.027] -- 0:00:13 974000 -- (-3362.218) [-3358.241] (-3362.907) (-3360.472) * [-3357.359] (-3361.667) (-3366.806) (-3368.979) -- 0:00:13 974500 -- (-3357.434) (-3354.456) [-3356.071] (-3370.831) * [-3356.964] (-3369.206) (-3364.256) (-3366.421) -- 0:00:13 975000 -- (-3360.247) (-3361.795) [-3365.593] (-3359.634) * [-3358.204] (-3368.954) (-3358.133) (-3373.674) -- 0:00:12 Average standard deviation of split frequencies: 0.005206 975500 -- [-3354.735] (-3358.158) (-3361.718) (-3360.257) * [-3359.023] (-3358.063) (-3362.508) (-3358.238) -- 0:00:12 976000 -- [-3358.201] (-3361.146) (-3359.673) (-3358.118) * [-3361.634] (-3356.012) (-3367.421) (-3360.103) -- 0:00:12 976500 -- [-3359.094] (-3358.555) (-3367.660) (-3370.094) * [-3361.369] (-3356.773) (-3356.219) (-3359.105) -- 0:00:12 977000 -- [-3362.565] (-3360.795) (-3363.559) (-3371.183) * (-3354.597) [-3355.824] (-3365.596) (-3362.535) -- 0:00:11 977500 -- [-3360.273] (-3361.841) (-3358.897) (-3359.125) * [-3357.644] (-3359.438) (-3356.638) (-3366.703) -- 0:00:11 978000 -- (-3355.871) (-3360.114) [-3356.054] (-3355.903) * [-3357.980] (-3361.250) (-3358.723) (-3371.064) -- 0:00:11 978500 -- (-3361.252) [-3361.123] (-3358.330) (-3363.089) * [-3359.500] (-3358.906) (-3356.512) (-3356.283) -- 0:00:11 979000 -- (-3368.231) [-3356.340] (-3363.826) (-3361.817) * (-3365.146) (-3359.464) (-3359.546) [-3364.069] -- 0:00:10 979500 -- (-3358.649) (-3358.133) (-3361.972) [-3357.423] * (-3366.071) [-3358.524] (-3353.707) (-3356.292) -- 0:00:10 980000 -- (-3365.992) (-3369.526) (-3369.651) [-3360.947] * (-3358.662) (-3372.146) [-3358.699] (-3360.781) -- 0:00:10 Average standard deviation of split frequencies: 0.004967 980500 -- (-3361.900) [-3355.403] (-3366.391) (-3357.421) * (-3362.889) (-3360.703) [-3359.725] (-3368.208) -- 0:00:09 981000 -- [-3375.751] (-3355.534) (-3365.661) (-3362.560) * (-3365.793) [-3357.702] (-3363.165) (-3359.634) -- 0:00:09 981500 -- (-3372.165) [-3362.143] (-3355.657) (-3355.427) * [-3362.742] (-3362.714) (-3359.169) (-3372.377) -- 0:00:09 982000 -- (-3364.142) [-3358.433] (-3362.691) (-3359.588) * (-3368.584) [-3359.634] (-3365.018) (-3362.984) -- 0:00:09 982500 -- (-3366.235) (-3359.774) [-3356.293] (-3362.947) * (-3372.199) (-3354.590) (-3357.664) [-3355.354] -- 0:00:08 983000 -- (-3356.021) [-3364.003] (-3357.649) (-3357.004) * (-3374.156) (-3367.210) (-3368.594) [-3355.299] -- 0:00:08 983500 -- (-3378.437) (-3361.105) (-3358.496) [-3359.157] * (-3358.923) (-3380.493) [-3358.766] (-3360.007) -- 0:00:08 984000 -- [-3357.995] (-3367.148) (-3361.187) (-3355.807) * (-3361.487) (-3359.024) [-3354.423] (-3375.446) -- 0:00:08 984500 -- (-3356.979) [-3363.417] (-3354.903) (-3362.099) * (-3362.332) (-3363.919) [-3362.814] (-3366.547) -- 0:00:07 985000 -- (-3358.332) [-3366.041] (-3352.937) (-3361.011) * (-3370.856) [-3354.435] (-3366.736) (-3361.381) -- 0:00:07 Average standard deviation of split frequencies: 0.004675 985500 -- (-3363.228) (-3367.533) [-3352.646] (-3359.752) * [-3353.216] (-3361.452) (-3360.566) (-3360.300) -- 0:00:07 986000 -- [-3359.501] (-3359.916) (-3354.865) (-3365.504) * [-3357.318] (-3357.630) (-3362.758) (-3375.058) -- 0:00:07 986500 -- (-3361.689) (-3369.375) (-3365.140) [-3364.896] * (-3359.728) (-3368.955) (-3360.993) [-3360.820] -- 0:00:06 987000 -- (-3358.902) [-3359.596] (-3358.632) (-3361.868) * [-3355.237] (-3364.391) (-3367.457) (-3357.151) -- 0:00:06 987500 -- [-3362.422] (-3358.306) (-3361.534) (-3362.486) * [-3359.360] (-3356.577) (-3380.055) (-3370.794) -- 0:00:06 988000 -- [-3357.585] (-3355.077) (-3358.844) (-3360.560) * (-3360.168) (-3353.768) [-3366.230] (-3354.742) -- 0:00:06 988500 -- (-3368.297) (-3363.712) [-3358.793] (-3364.643) * (-3359.968) [-3355.315] (-3366.776) (-3365.008) -- 0:00:05 989000 -- (-3361.487) [-3361.750] (-3365.259) (-3359.364) * (-3363.266) [-3359.444] (-3359.291) (-3364.872) -- 0:00:05 989500 -- (-3367.116) [-3352.508] (-3355.169) (-3363.338) * (-3362.406) (-3365.429) [-3363.467] (-3364.868) -- 0:00:05 990000 -- (-3365.789) (-3360.326) [-3356.887] (-3362.594) * (-3357.668) [-3353.336] (-3378.349) (-3361.883) -- 0:00:05 Average standard deviation of split frequencies: 0.004758 990500 -- (-3365.991) (-3358.967) (-3359.095) [-3359.065] * [-3360.640] (-3357.315) (-3362.739) (-3359.994) -- 0:00:04 991000 -- (-3364.221) (-3362.363) [-3360.886] (-3362.979) * (-3355.769) [-3361.553] (-3365.720) (-3357.000) -- 0:00:04 991500 -- [-3358.936] (-3358.925) (-3359.409) (-3362.749) * (-3360.066) [-3366.742] (-3360.637) (-3356.765) -- 0:00:04 992000 -- [-3358.107] (-3362.603) (-3364.149) (-3353.030) * (-3360.011) (-3361.801) (-3364.123) [-3358.678] -- 0:00:04 992500 -- (-3360.822) (-3363.694) [-3357.124] (-3356.699) * (-3357.290) [-3367.436] (-3369.369) (-3370.536) -- 0:00:03 993000 -- [-3363.037] (-3365.786) (-3361.930) (-3366.637) * [-3353.641] (-3369.973) (-3365.060) (-3362.370) -- 0:00:03 993500 -- (-3359.046) [-3355.107] (-3357.868) (-3365.455) * [-3350.089] (-3366.582) (-3358.999) (-3361.697) -- 0:00:03 994000 -- [-3358.941] (-3369.521) (-3355.895) (-3367.535) * (-3367.418) (-3374.201) [-3352.263] (-3355.702) -- 0:00:03 994500 -- (-3361.067) (-3362.309) [-3356.795] (-3371.748) * (-3363.819) (-3362.333) (-3359.558) [-3361.187] -- 0:00:02 995000 -- (-3366.109) (-3355.107) [-3352.009] (-3366.319) * [-3359.566] (-3358.025) (-3355.423) (-3358.896) -- 0:00:02 Average standard deviation of split frequencies: 0.004470 995500 -- (-3360.322) (-3357.027) (-3357.400) [-3364.042] * (-3360.729) [-3358.962] (-3363.062) (-3355.817) -- 0:00:02 996000 -- (-3362.310) [-3357.594] (-3361.950) (-3365.036) * (-3359.712) (-3354.739) [-3359.839] (-3361.877) -- 0:00:02 996500 -- (-3369.952) (-3357.858) [-3363.871] (-3373.441) * [-3353.336] (-3358.327) (-3364.474) (-3358.303) -- 0:00:01 997000 -- (-3356.381) (-3358.490) [-3362.367] (-3367.211) * (-3361.125) (-3366.032) (-3363.439) [-3352.476] -- 0:00:01 997500 -- (-3363.133) [-3361.881] (-3357.479) (-3356.073) * [-3359.214] (-3358.293) (-3362.002) (-3360.273) -- 0:00:01 998000 -- (-3366.145) (-3369.521) [-3358.564] (-3370.410) * (-3364.331) [-3357.099] (-3364.514) (-3359.440) -- 0:00:01 998500 -- [-3365.140] (-3365.620) (-3359.799) (-3355.054) * (-3364.426) (-3358.306) [-3358.225] (-3370.499) -- 0:00:00 999000 -- (-3359.831) [-3360.920] (-3372.664) (-3358.991) * (-3353.662) (-3365.521) [-3357.166] (-3363.763) -- 0:00:00 999500 -- (-3355.669) (-3369.247) (-3357.510) [-3358.528] * (-3361.036) (-3365.250) [-3361.274] (-3368.382) -- 0:00:00 1000000 -- [-3358.737] (-3360.054) (-3362.252) (-3364.825) * [-3370.295] (-3363.690) (-3362.192) (-3359.823) -- 0:00:00 Average standard deviation of split frequencies: 0.004659 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -3358.737350 -- 21.980267 Chain 1 -- -3358.737345 -- 21.980267 Chain 2 -- -3360.054365 -- 21.516964 Chain 2 -- -3360.054363 -- 21.516964 Chain 3 -- -3362.252069 -- 20.152446 Chain 3 -- -3362.252092 -- 20.152446 Chain 4 -- -3364.825038 -- 19.568052 Chain 4 -- -3364.825072 -- 19.568052 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -3370.294732 -- 20.728579 Chain 1 -- -3370.294718 -- 20.728579 Chain 2 -- -3363.689839 -- 21.799877 Chain 2 -- -3363.689846 -- 21.799877 Chain 3 -- -3362.192361 -- 19.228613 Chain 3 -- -3362.192349 -- 19.228613 Chain 4 -- -3359.822556 -- 20.123616 Chain 4 -- -3359.822556 -- 20.123616 Analysis completed in 8 mins 32 seconds Analysis used 511.77 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -3346.18 Likelihood of best state for "cold" chain of run 2 was -3347.44 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 38.0 % ( 30 %) Dirichlet(Revmat{all}) 55.4 % ( 43 %) Slider(Revmat{all}) 24.0 % ( 22 %) Dirichlet(Pi{all}) 26.3 % ( 23 %) Slider(Pi{all}) 28.8 % ( 31 %) Multiplier(Alpha{1,2}) 40.7 % ( 26 %) Multiplier(Alpha{3}) 43.7 % ( 27 %) Slider(Pinvar{all}) 9.8 % ( 6 %) ExtSPR(Tau{all},V{all}) 2.0 % ( 2 %) ExtTBR(Tau{all},V{all}) 12.5 % ( 12 %) NNI(Tau{all},V{all}) 14.1 % ( 17 %) ParsSPR(Tau{all},V{all}) 26.1 % ( 23 %) Multiplier(V{all}) 31.4 % ( 37 %) Nodeslider(V{all}) 25.4 % ( 28 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 38.0 % ( 18 %) Dirichlet(Revmat{all}) 53.2 % ( 36 %) Slider(Revmat{all}) 23.6 % ( 24 %) Dirichlet(Pi{all}) 26.3 % ( 37 %) Slider(Pi{all}) 29.5 % ( 28 %) Multiplier(Alpha{1,2}) 40.9 % ( 23 %) Multiplier(Alpha{3}) 43.8 % ( 21 %) Slider(Pinvar{all}) 9.7 % ( 12 %) ExtSPR(Tau{all},V{all}) 2.0 % ( 1 %) ExtTBR(Tau{all},V{all}) 12.1 % ( 18 %) NNI(Tau{all},V{all}) 14.2 % ( 13 %) ParsSPR(Tau{all},V{all}) 26.1 % ( 22 %) Multiplier(V{all}) 31.5 % ( 37 %) Nodeslider(V{all}) 25.4 % ( 31 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.78 0.59 0.43 2 | 166784 0.80 0.61 3 | 166250 166592 0.81 4 | 166757 166972 166645 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.78 0.59 0.43 2 | 166390 0.79 0.62 3 | 165956 167153 0.81 4 | 166668 167409 166424 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -3356.74 | 2 | | 2 2 1 | | 1 | | 11 2 2 2 1 1 | | 1 2 2 1 1 2 | | 1 2 2 1 2 21 2 1 12 2 | | 1 2 2 2 11 2 1 1 1 21 1 1 1 | | 2 12 2 1 11 21 111 2 2 2| |* 1 22 1 2 21 2 1 1| | 2 2 2 2 1 2 1 2 21 2 | | 21 1121 2 1 12 1 1 2 2 2 | | 2 1 2 2 1 1 1 1 * 1 | | 1 11 2 2 2 2 | | 2 22 | | 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -3361.21 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3353.89 -3369.07 2 -3354.35 -3367.46 -------------------------------------- TOTAL -3354.09 -3368.56 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.705890 0.004421 0.571323 0.829272 0.701419 1255.72 1344.24 1.001 r(A<->C){all} 0.075168 0.000285 0.045704 0.111124 0.073760 1005.40 1061.69 1.000 r(A<->G){all} 0.205639 0.000875 0.152266 0.269385 0.204229 789.38 819.61 1.000 r(A<->T){all} 0.090334 0.000534 0.045138 0.133426 0.088583 621.92 894.37 1.001 r(C<->G){all} 0.074110 0.000216 0.046232 0.102487 0.073503 972.97 984.69 1.000 r(C<->T){all} 0.461108 0.001585 0.379539 0.534046 0.460163 640.87 785.81 1.001 r(G<->T){all} 0.093641 0.000400 0.056298 0.133442 0.092403 1118.39 1120.00 1.001 pi(A){all} 0.258116 0.000169 0.232439 0.282712 0.257908 1014.91 1038.27 1.000 pi(C){all} 0.274320 0.000164 0.250856 0.300275 0.273987 1188.95 1207.14 1.001 pi(G){all} 0.268123 0.000170 0.242735 0.293978 0.267938 1233.34 1246.40 1.000 pi(T){all} 0.199441 0.000134 0.176593 0.220637 0.199205 1058.98 1136.01 1.000 alpha{1,2} 0.163709 0.000705 0.112804 0.214446 0.161292 912.04 1016.46 1.003 alpha{3} 2.542699 0.608396 1.210670 4.103541 2.422947 1250.00 1375.50 1.000 pinvar{all} 0.439988 0.002523 0.342189 0.538213 0.444141 1078.67 1273.00 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 7 -- C7 8 -- C8 9 -- C9 10 -- C10 Key to taxon bipartitions (saved to file "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ---------------- 1 -- .********* 2 -- .*........ 3 -- ..*....... 4 -- ...*...... 5 -- ....*..... 6 -- .....*.... 7 -- ......*... 8 -- .......*.. 9 -- ........*. 10 -- .........* 11 -- ....****** 12 -- ..******** 13 -- ..**...... 14 -- ....*....* 15 -- ......***. 16 -- .......**. 17 -- ....*.**** 18 -- .....****. 19 -- ....**...* ---------------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 11 3002 1.000000 0.000000 1.000000 1.000000 2 12 3000 0.999334 0.000000 0.999334 0.999334 2 13 2988 0.995336 0.001884 0.994004 0.996669 2 14 2955 0.984344 0.002355 0.982678 0.986009 2 15 2809 0.935710 0.007066 0.930713 0.940706 2 16 2797 0.931712 0.005182 0.928048 0.935376 2 17 1143 0.380746 0.005182 0.377082 0.384410 2 18 1142 0.380413 0.008480 0.374417 0.386409 2 19 591 0.196869 0.011777 0.188541 0.205197 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.018343 0.000034 0.007551 0.029231 0.017649 1.000 2 length{all}[2] 0.015824 0.000029 0.006277 0.026395 0.015088 1.000 2 length{all}[3] 0.038450 0.000088 0.021058 0.056693 0.037469 1.000 2 length{all}[4] 0.014321 0.000032 0.004045 0.024854 0.013502 1.000 2 length{all}[5] 0.053478 0.000143 0.030004 0.076049 0.052652 1.001 2 length{all}[6] 0.114473 0.000372 0.078145 0.151916 0.113247 1.000 2 length{all}[7] 0.107438 0.000364 0.073463 0.147357 0.106104 1.000 2 length{all}[8] 0.042233 0.000112 0.022466 0.062586 0.041255 1.000 2 length{all}[9] 0.074850 0.000215 0.048633 0.104864 0.073890 1.000 2 length{all}[10] 0.052154 0.000143 0.028915 0.074888 0.051187 1.000 2 length{all}[11] 0.082064 0.000279 0.050424 0.114376 0.080241 1.000 2 length{all}[12] 0.015800 0.000050 0.003856 0.029898 0.014893 1.000 2 length{all}[13] 0.016823 0.000050 0.004146 0.030974 0.015837 1.000 2 length{all}[14] 0.021597 0.000070 0.006872 0.038706 0.020634 1.000 2 length{all}[15] 0.016415 0.000060 0.003033 0.031653 0.015344 1.000 2 length{all}[16] 0.016405 0.000066 0.002332 0.031962 0.015391 1.001 2 length{all}[17] 0.006622 0.000028 0.000043 0.016832 0.005188 1.001 2 length{all}[18] 0.007170 0.000037 0.000001 0.019029 0.005548 1.000 2 length{all}[19] 0.004066 0.000013 0.000003 0.011183 0.003231 1.000 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.004659 Maximum standard deviation of split frequencies = 0.011777 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /---------------------------------------------------------------------- C1 (1) | |---------------------------------------------------------------------- C2 (2) | | /-------------- C3 (3) + /-------------------100-------------------+ | | \-------------- C4 (4) | | | | /-------------- C5 (5) \-----100-----+ /-------------98------------+ | | \-------------- C10 (10) | | | |------------------------------------------ C6 (6) \-----100-----+ | /---------------------------- C7 (7) | | \------94-----+ /-------------- C8 (8) \------93-----+ \-------------- C9 (9) Phylogram (based on average branch lengths): /------ C1 (1) | |----- C2 (2) | | /------------- C3 (3) + /----+ | | \----- C4 (4) | | | | /------------------ C5 (5) \----+ /-----+ | | \------------------ C10 (10) | | | |------------------------------------- C6 (6) \--------------------------+ | /----------------------------------- C7 (7) | | \----+ /-------------- C8 (8) \----+ \------------------------ C9 (9) |---------------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (36 trees sampled): 50 % credible set contains 2 trees 90 % credible set contains 5 trees 95 % credible set contains 9 trees 99 % credible set contains 18 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 10 ls = 1071 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Reading seq # 7: C7 Reading seq # 8: C8 Reading seq # 9: C9 Reading seq #10: C10 Sites with gaps or missing data are removed. 6 ambiguity characters in seq. 1 6 ambiguity characters in seq. 2 6 ambiguity characters in seq. 3 12 ambiguity characters in seq. 4 6 ambiguity characters in seq. 5 15 ambiguity characters in seq. 6 6 ambiguity characters in seq. 7 6 ambiguity characters in seq. 8 6 ambiguity characters in seq. 9 3 ambiguity characters in seq. 10 5 sites are removed. 48 354 355 356 357 codon 48: AGC AGC AGC AGC AGC TCT AGT AGT AGT AGT codon 94: TCG TCG TCC TCA TCT TCT TCA TCC AGT TCC Sequences read.. Counting site patterns.. 0:00 230 patterns at 352 / 352 sites (100.0%), 0:00 Counting codons.. 360 bytes for distance 224480 bytes for conP 31280 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, ((3, 4), ((5, 10), 6, (7, (8, 9))))); MP score: 347 785680 bytes for conP, adjusted 0.028217 0.027348 0.029912 0.018847 0.054576 0.029283 0.109053 0.015197 0.084120 0.089452 0.185527 0.020761 0.160459 0.026610 0.070391 0.116852 0.300000 1.300000 ntime & nrate & np: 16 2 18 Bounds (np=18): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 18 lnL0 = -3723.877209 Iterating by ming2 Initial: fx= 3723.877209 x= 0.02822 0.02735 0.02991 0.01885 0.05458 0.02928 0.10905 0.01520 0.08412 0.08945 0.18553 0.02076 0.16046 0.02661 0.07039 0.11685 0.30000 1.30000 1 h-m-p 0.0000 0.0004 782.2191 ++YCYCCC 3671.125761 5 0.0003 33 | 0/18 2 h-m-p 0.0002 0.0013 908.8051 YYCCCC 3629.767287 5 0.0004 62 | 0/18 3 h-m-p 0.0001 0.0003 826.2579 +CYYCCC 3564.590635 5 0.0003 92 | 0/18 4 h-m-p 0.0000 0.0000 3207.2321 ++ 3547.381647 m 0.0000 113 | 0/18 5 h-m-p 0.0000 0.0000 19774.2753 +CYYCCCCC 3462.739873 7 0.0000 147 | 0/18 6 h-m-p 0.0000 0.0000 1345.6665 YCYCCC 3458.913670 5 0.0000 176 | 0/18 7 h-m-p 0.0000 0.0002 491.8435 +CCCC 3449.438790 3 0.0001 204 | 0/18 8 h-m-p 0.0000 0.0002 2083.5382 ++ 3378.807304 m 0.0002 225 | 0/18 9 h-m-p 0.0000 0.0000 37443.4589 h-m-p: 5.77839638e-23 2.88919819e-22 3.74434589e+04 3378.807304 .. | 0/18 10 h-m-p 0.0000 0.0004 5962.3498 YYCCCC 3336.689346 5 0.0000 272 | 0/18 11 h-m-p 0.0001 0.0003 647.4129 +YYCCC 3296.900618 4 0.0002 300 | 0/18 12 h-m-p 0.0000 0.0001 669.4431 +YCYCCC 3271.861051 5 0.0001 330 | 0/18 13 h-m-p 0.0000 0.0000 6837.0696 +YCYCCC 3237.853859 5 0.0000 361 | 0/18 14 h-m-p 0.0000 0.0002 524.0143 CYCCCC 3233.456092 5 0.0001 391 | 0/18 15 h-m-p 0.0004 0.0021 66.9663 CCCC 3232.394647 3 0.0005 418 | 0/18 16 h-m-p 0.0003 0.0039 99.9503 CYC 3231.542022 2 0.0004 442 | 0/18 17 h-m-p 0.0004 0.0027 94.3447 YCCC 3230.350204 3 0.0007 468 | 0/18 18 h-m-p 0.0003 0.0032 198.6950 CCCC 3228.856984 3 0.0005 495 | 0/18 19 h-m-p 0.0002 0.0012 311.5133 YCCC 3225.968461 3 0.0006 521 | 0/18 20 h-m-p 0.0004 0.0030 451.6714 YCCC 3220.668272 3 0.0008 547 | 0/18 21 h-m-p 0.0003 0.0014 262.1356 CCCC 3219.361733 3 0.0003 574 | 0/18 22 h-m-p 0.0006 0.0028 113.4030 YCC 3218.834686 2 0.0004 598 | 0/18 23 h-m-p 0.0006 0.0028 48.4188 CC 3218.730573 1 0.0002 621 | 0/18 24 h-m-p 0.0013 0.0212 8.0320 CC 3218.711692 1 0.0005 644 | 0/18 25 h-m-p 0.0026 0.1655 1.5289 +YC 3218.604305 1 0.0076 667 | 0/18 26 h-m-p 0.0055 0.0768 2.1083 +CYCCC 3211.582522 4 0.0386 696 | 0/18 27 h-m-p 0.0007 0.0036 46.5465 YCCC 3211.060416 3 0.0004 722 | 0/18 28 h-m-p 0.0029 0.0217 6.9876 YC 3211.045997 1 0.0005 744 | 0/18 29 h-m-p 0.0432 1.4469 0.0769 ++YYCCC 3206.992072 4 0.5148 773 | 0/18 30 h-m-p 0.8182 4.0908 0.0282 YYC 3206.139556 2 0.7023 814 | 0/18 31 h-m-p 0.4433 8.0000 0.0447 +CYC 3205.530874 2 1.7494 857 | 0/18 32 h-m-p 1.6000 8.0000 0.0212 CYC 3204.880324 2 1.6560 899 | 0/18 33 h-m-p 1.3496 8.0000 0.0260 CCC 3204.308412 2 2.0576 942 | 0/18 34 h-m-p 1.6000 8.0000 0.0160 YCC 3204.181387 2 1.0969 984 | 0/18 35 h-m-p 1.6000 8.0000 0.0037 CC 3204.077252 1 2.0580 1025 | 0/18 36 h-m-p 1.6000 8.0000 0.0031 CCC 3203.925694 2 2.5332 1068 | 0/18 37 h-m-p 1.3394 8.0000 0.0059 YC 3203.879711 1 0.9617 1108 | 0/18 38 h-m-p 1.5922 8.0000 0.0036 YC 3203.863566 1 1.2265 1148 | 0/18 39 h-m-p 1.6000 8.0000 0.0010 YC 3203.862242 1 1.0103 1188 | 0/18 40 h-m-p 0.6973 8.0000 0.0014 C 3203.862107 0 0.7837 1227 | 0/18 41 h-m-p 1.5231 8.0000 0.0007 Y 3203.862094 0 1.0085 1266 | 0/18 42 h-m-p 1.6000 8.0000 0.0002 Y 3203.862093 0 0.7304 1305 | 0/18 43 h-m-p 1.6000 8.0000 0.0000 Y 3203.862092 0 0.9817 1344 | 0/18 44 h-m-p 1.6000 8.0000 0.0000 Y 3203.862092 0 1.0708 1383 | 0/18 45 h-m-p 1.6000 8.0000 0.0000 ---C 3203.862092 0 0.0082 1425 Out.. lnL = -3203.862092 1426 lfun, 1426 eigenQcodon, 22816 P(t) Time used: 0:10 Model 1: NearlyNeutral TREE # 1 (1, 2, ((3, 4), ((5, 10), 6, (7, (8, 9))))); MP score: 347 0.028217 0.027348 0.029912 0.018847 0.054576 0.029283 0.109053 0.015197 0.084120 0.089452 0.185527 0.020761 0.160459 0.026610 0.070391 0.116852 2.069284 0.816750 0.136540 ntime & nrate & np: 16 2 19 Bounds (np=19): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 9.630834 np = 19 lnL0 = -3233.418188 Iterating by ming2 Initial: fx= 3233.418188 x= 0.02822 0.02735 0.02991 0.01885 0.05458 0.02928 0.10905 0.01520 0.08412 0.08945 0.18553 0.02076 0.16046 0.02661 0.07039 0.11685 2.06928 0.81675 0.13654 1 h-m-p 0.0000 0.0004 646.7420 ++CYYCCC 3190.466795 5 0.0002 35 | 0/19 2 h-m-p 0.0000 0.0002 295.3519 CYCCC 3187.158932 4 0.0001 64 | 0/19 3 h-m-p 0.0002 0.0009 148.4109 YCCCC 3184.446032 4 0.0003 93 | 0/19 4 h-m-p 0.0003 0.0014 84.7669 CCC 3184.203683 2 0.0001 119 | 0/19 5 h-m-p 0.0003 0.0029 31.3856 CCC 3184.092057 2 0.0003 145 | 0/19 6 h-m-p 0.0004 0.0037 21.7561 YC 3184.064396 1 0.0002 168 | 0/19 7 h-m-p 0.0004 0.0150 9.1151 CC 3184.052661 1 0.0003 192 | 0/19 8 h-m-p 0.0002 0.0131 11.9063 CC 3184.041810 1 0.0003 216 | 0/19 9 h-m-p 0.0005 0.0349 6.2811 C 3184.032442 0 0.0005 238 | 0/19 10 h-m-p 0.0002 0.0066 14.5022 CC 3184.021996 1 0.0002 262 | 0/19 11 h-m-p 0.0003 0.0541 13.9241 ++YC 3183.903454 1 0.0028 287 | 0/19 12 h-m-p 0.0005 0.0105 78.5737 +CCC 3183.415424 2 0.0020 314 | 0/19 13 h-m-p 0.0007 0.0057 225.5229 CYC 3182.927842 2 0.0007 339 | 0/19 14 h-m-p 0.0007 0.0034 120.2069 YC 3182.813759 1 0.0003 362 | 0/19 15 h-m-p 0.0033 0.0272 10.7992 YC 3182.791830 1 0.0006 385 | 0/19 16 h-m-p 0.0012 0.0209 5.2370 YC 3182.765450 1 0.0010 408 | 0/19 17 h-m-p 0.0020 0.0703 2.5826 +CC 3182.376312 1 0.0088 433 | 0/19 18 h-m-p 0.0007 0.0077 32.7621 +YYYC 3179.860999 3 0.0027 459 | 0/19 19 h-m-p 0.0004 0.0020 94.2939 YCYCCC 3177.205464 5 0.0009 489 | 0/19 20 h-m-p 0.0026 0.0131 11.8752 YC 3177.177372 1 0.0004 512 | 0/19 21 h-m-p 0.0153 4.4248 0.3152 ++YCCC 3176.110438 3 0.5667 541 | 0/19 22 h-m-p 1.6000 8.0000 0.0561 YC 3176.079371 1 0.6969 583 | 0/19 23 h-m-p 1.6000 8.0000 0.0018 YC 3176.077434 1 0.7409 625 | 0/19 24 h-m-p 0.4941 8.0000 0.0027 C 3176.077348 0 0.7376 666 | 0/19 25 h-m-p 1.6000 8.0000 0.0001 Y 3176.077347 0 0.8589 707 | 0/19 26 h-m-p 1.6000 8.0000 0.0000 Y 3176.077347 0 0.8308 748 | 0/19 27 h-m-p 1.6000 8.0000 0.0000 Y 3176.077347 0 0.8984 789 | 0/19 28 h-m-p 1.6000 8.0000 0.0000 ----Y 3176.077347 0 0.0016 834 Out.. lnL = -3176.077347 835 lfun, 2505 eigenQcodon, 26720 P(t) Time used: 0:23 Model 2: PositiveSelection TREE # 1 (1, 2, ((3, 4), ((5, 10), 6, (7, (8, 9))))); MP score: 347 initial w for M2:NSpselection reset. 0.028217 0.027348 0.029912 0.018847 0.054576 0.029283 0.109053 0.015197 0.084120 0.089452 0.185527 0.020761 0.160459 0.026610 0.070391 0.116852 2.100731 1.098208 0.580294 0.458835 2.948231 ntime & nrate & np: 16 3 21 Bounds (np=21): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 4.277217 np = 21 lnL0 = -3415.512436 Iterating by ming2 Initial: fx= 3415.512436 x= 0.02822 0.02735 0.02991 0.01885 0.05458 0.02928 0.10905 0.01520 0.08412 0.08945 0.18553 0.02076 0.16046 0.02661 0.07039 0.11685 2.10073 1.09821 0.58029 0.45883 2.94823 1 h-m-p 0.0000 0.0019 622.4709 ++CCCY 3397.850674 3 0.0002 34 | 0/21 2 h-m-p 0.0002 0.0009 269.2635 ++ 3359.817117 m 0.0009 58 | 0/21 3 h-m-p 0.0000 0.0000 15655.4628 ++ 3286.234348 m 0.0000 82 | 1/21 4 h-m-p 0.0001 0.0004 894.5821 CCCC 3284.054017 3 0.0001 112 | 1/21 5 h-m-p 0.0006 0.0032 76.4941 +YCCCC 3271.075706 4 0.0017 144 | 0/21 6 h-m-p 0.0001 0.0006 336.8684 YYCCC 3266.835085 4 0.0002 174 | 0/21 7 h-m-p 0.0000 0.0002 289.5050 ++ 3263.102680 m 0.0002 198 | 0/21 8 h-m-p 0.0002 0.0017 267.9938 +YYYCC 3252.235666 4 0.0008 228 | 0/21 9 h-m-p 0.0002 0.0009 546.8742 +YYCCCC 3239.037596 5 0.0006 261 | 0/21 10 h-m-p 0.0001 0.0006 536.7859 YCCCC 3232.763553 4 0.0003 292 | 0/21 11 h-m-p 0.0001 0.0007 512.9359 YCCCC 3226.028838 4 0.0003 323 | 0/21 12 h-m-p 0.0004 0.0021 412.6916 CYCCCC 3217.369400 5 0.0006 356 | 0/21 13 h-m-p 0.0004 0.0018 306.4890 CCCCC 3213.512961 4 0.0004 388 | 0/21 14 h-m-p 0.0005 0.0027 56.1535 YC 3213.295173 1 0.0003 413 | 0/21 15 h-m-p 0.0008 0.0177 18.1331 C 3213.157915 0 0.0008 437 | 0/21 16 h-m-p 0.0007 0.0179 22.8529 +YC 3212.858361 1 0.0018 463 | 0/21 17 h-m-p 0.0004 0.0079 110.2190 +CC 3211.878429 1 0.0013 490 | 0/21 18 h-m-p 0.0005 0.0084 306.2948 +YCCC 3201.809747 3 0.0045 520 | 0/21 19 h-m-p 0.0018 0.0090 115.3135 YCCC 3201.147046 3 0.0009 549 | 0/21 20 h-m-p 0.0055 0.3761 18.1860 +YCCC 3196.355495 3 0.0528 579 | 0/21 21 h-m-p 0.0019 0.0095 277.9828 CYC 3194.128028 2 0.0016 606 | 0/21 22 h-m-p 0.0655 0.7672 6.8847 YCCCC 3190.100063 4 0.1511 637 | 0/21 23 h-m-p 0.2927 1.4634 1.2093 CYCCC 3183.777226 4 0.5485 668 | 0/21 24 h-m-p 0.8354 7.2909 0.7940 CYC 3179.628171 2 0.8680 695 | 0/21 25 h-m-p 0.9915 4.9575 0.4441 CCCC 3177.907655 3 1.1433 746 | 0/21 26 h-m-p 0.6976 5.2150 0.7278 YCCC 3177.005253 3 1.1674 796 | 0/21 27 h-m-p 0.9785 4.8926 0.6768 CCCC 3176.444646 3 1.0089 847 | 0/21 28 h-m-p 1.1946 7.3741 0.5716 CC 3176.071705 1 1.1927 894 | 0/21 29 h-m-p 1.2899 8.0000 0.5286 YCC 3175.918723 2 0.8801 942 | 0/21 30 h-m-p 1.0847 8.0000 0.4289 YCC 3175.859412 2 0.7736 990 | 0/21 31 h-m-p 1.1672 8.0000 0.2843 C 3175.812621 0 1.1641 1035 | 0/21 32 h-m-p 1.6000 8.0000 0.2034 CC 3175.786856 1 1.3648 1082 | 0/21 33 h-m-p 1.6000 8.0000 0.0939 YC 3175.777654 1 1.1579 1128 | 0/21 34 h-m-p 1.6000 8.0000 0.0460 CC 3175.763866 1 2.4020 1175 | 0/21 35 h-m-p 1.4123 8.0000 0.0782 +YC 3175.714793 1 4.1883 1222 | 0/21 36 h-m-p 0.5321 8.0000 0.6159 +YCCC 3175.602807 3 2.1875 1273 | 0/21 37 h-m-p 1.6000 8.0000 0.0904 YC 3175.588471 1 1.1273 1319 | 0/21 38 h-m-p 1.6000 8.0000 0.0415 YC 3175.586559 1 0.9787 1365 | 0/21 39 h-m-p 0.7750 8.0000 0.0524 +YC 3175.584737 1 2.1465 1412 | 0/21 40 h-m-p 1.6000 8.0000 0.0152 ++ 3175.574833 m 8.0000 1457 | 0/21 41 h-m-p 0.3667 8.0000 0.3316 ++YYC 3175.492082 2 5.1647 1506 | 0/21 42 h-m-p 1.1860 5.9301 0.7104 Y 3175.449132 0 0.9423 1551 | 0/21 43 h-m-p 1.2126 8.0000 0.5521 YC 3175.437767 1 0.5506 1597 | 0/21 44 h-m-p 1.6000 8.0000 0.1114 YC 3175.436742 1 0.7541 1643 | 0/21 45 h-m-p 1.6000 8.0000 0.0316 Y 3175.436630 0 0.7962 1688 | 0/21 46 h-m-p 1.6000 8.0000 0.0044 Y 3175.436621 0 1.1378 1733 | 0/21 47 h-m-p 1.6000 8.0000 0.0008 Y 3175.436621 0 0.8934 1778 | 0/21 48 h-m-p 1.6000 8.0000 0.0001 Y 3175.436621 0 0.8859 1823 | 0/21 49 h-m-p 1.6000 8.0000 0.0000 Y 3175.436621 0 0.8612 1868 | 0/21 50 h-m-p 1.6000 8.0000 0.0000 Y 3175.436621 0 0.7975 1913 | 0/21 51 h-m-p 1.6000 8.0000 0.0000 --C 3175.436621 0 0.0250 1960 Out.. lnL = -3175.436621 1961 lfun, 7844 eigenQcodon, 94128 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -3187.424256 S = -3068.668288 -109.589837 Calculating f(w|X), posterior probabilities of site classes. did 10 / 230 patterns 1:06 did 20 / 230 patterns 1:06 did 30 / 230 patterns 1:06 did 40 / 230 patterns 1:06 did 50 / 230 patterns 1:06 did 60 / 230 patterns 1:06 did 70 / 230 patterns 1:06 did 80 / 230 patterns 1:06 did 90 / 230 patterns 1:06 did 100 / 230 patterns 1:06 did 110 / 230 patterns 1:06 did 120 / 230 patterns 1:06 did 130 / 230 patterns 1:06 did 140 / 230 patterns 1:06 did 150 / 230 patterns 1:06 did 160 / 230 patterns 1:07 did 170 / 230 patterns 1:07 did 180 / 230 patterns 1:07 did 190 / 230 patterns 1:07 did 200 / 230 patterns 1:07 did 210 / 230 patterns 1:07 did 220 / 230 patterns 1:07 did 230 / 230 patterns 1:07 Time used: 1:07 Model 3: discrete TREE # 1 (1, 2, ((3, 4), ((5, 10), 6, (7, (8, 9))))); MP score: 347 0.028217 0.027348 0.029912 0.018847 0.054576 0.029283 0.109053 0.015197 0.084120 0.089452 0.185527 0.020761 0.160459 0.026610 0.070391 0.116852 2.125411 0.923969 0.634343 0.041588 0.104077 0.145379 ntime & nrate & np: 16 4 22 Bounds (np=22): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 14.438515 np = 22 lnL0 = -3202.762501 Iterating by ming2 Initial: fx= 3202.762501 x= 0.02822 0.02735 0.02991 0.01885 0.05458 0.02928 0.10905 0.01520 0.08412 0.08945 0.18553 0.02076 0.16046 0.02661 0.07039 0.11685 2.12541 0.92397 0.63434 0.04159 0.10408 0.14538 1 h-m-p 0.0000 0.0003 425.0505 ++CYCCC 3194.465594 4 0.0001 36 | 0/22 2 h-m-p 0.0000 0.0001 224.0879 ++ 3190.375615 m 0.0001 61 | 1/22 3 h-m-p 0.0000 0.0003 615.2944 +YCC 3186.843746 2 0.0001 90 | 1/22 4 h-m-p 0.0003 0.0015 174.6816 CCCC 3184.456703 3 0.0004 121 | 1/22 5 h-m-p 0.0001 0.0005 349.3051 +YCYCCC 3180.261304 5 0.0003 155 | 1/22 6 h-m-p 0.0002 0.0009 110.0450 YYCC 3179.843852 3 0.0002 184 | 1/22 7 h-m-p 0.0002 0.0015 87.0052 CCC 3179.403170 2 0.0003 213 | 0/22 8 h-m-p 0.0004 0.0061 63.3805 CYC 3179.209655 2 0.0001 241 | 0/22 9 h-m-p 0.0004 0.0065 21.6897 YC 3179.175154 1 0.0002 267 | 0/22 10 h-m-p 0.0005 0.0093 7.9010 CC 3179.170018 1 0.0002 294 | 0/22 11 h-m-p 0.0002 0.0152 6.7305 CC 3179.165363 1 0.0003 321 | 0/22 12 h-m-p 0.0004 0.0202 4.2486 CC 3179.160689 1 0.0005 348 | 0/22 13 h-m-p 0.0003 0.0226 8.1611 +YC 3179.147457 1 0.0007 375 | 0/22 14 h-m-p 0.0003 0.0199 20.2779 YC 3179.124660 1 0.0005 401 | 0/22 15 h-m-p 0.0002 0.0158 43.4334 +YC 3178.953153 1 0.0016 428 | 0/22 16 h-m-p 0.0003 0.0141 195.3383 +CCC 3178.008306 2 0.0019 458 | 0/22 17 h-m-p 0.0009 0.0062 411.7882 YCC 3177.311584 2 0.0007 486 | 0/22 18 h-m-p 0.0056 0.0280 15.0252 -CC 3177.294760 1 0.0005 514 | 0/22 19 h-m-p 0.0013 0.0818 5.1901 C 3177.278198 0 0.0013 539 | 0/22 20 h-m-p 0.0010 0.0939 7.1866 +CCC 3177.169681 2 0.0060 569 | 0/22 21 h-m-p 0.0005 0.0176 81.7886 +CCC 3176.684748 2 0.0024 599 | 0/22 22 h-m-p 0.0533 0.2663 1.5353 CCCC 3176.395942 3 0.0990 630 | 0/22 23 h-m-p 0.1125 0.8488 1.3504 CYC 3176.177116 2 0.1485 658 | 0/22 24 h-m-p 0.7732 3.8658 0.0544 CYC 3175.884299 2 0.9197 686 | 0/22 25 h-m-p 0.2658 8.0000 0.1881 +YCCC 3175.465902 3 2.3584 739 | 0/22 26 h-m-p 0.5848 2.9242 0.1686 +CC 3175.157166 1 2.1961 789 | 0/22 27 h-m-p 1.2346 6.1730 0.2710 YCC 3175.055180 2 0.5631 839 | 0/22 28 h-m-p 0.0370 0.1852 0.4509 ++ 3174.968281 m 0.1852 886 | 1/22 29 h-m-p 0.0863 8.0000 0.9664 CC 3174.957329 1 0.0753 935 | 1/22 30 h-m-p 0.2209 8.0000 0.3296 +YC 3174.874307 1 0.5637 983 | 1/22 31 h-m-p 1.6000 8.0000 0.0649 +YCC 3174.779811 2 5.3557 1033 | 1/22 32 h-m-p 1.2664 8.0000 0.2744 CCCCC 3174.661646 4 1.6344 1087 | 0/22 33 h-m-p 0.0008 0.0205 574.5589 CC 3174.653744 1 0.0002 1135 | 0/22 34 h-m-p 0.2321 1.1605 0.1896 ++ 3174.445654 m 1.1605 1160 | 1/22 35 h-m-p 0.9588 8.0000 0.2294 CC 3174.366248 1 0.2278 1209 | 1/22 36 h-m-p 0.0565 8.0000 0.9245 ++CCCCC 3173.984775 4 1.1279 1265 | 0/22 37 h-m-p 0.0001 0.0055 8082.9248 CCCC 3173.721634 3 0.0002 1317 | 0/22 38 h-m-p 1.6000 8.0000 0.4211 YCCC 3173.432232 3 0.9827 1347 | 0/22 39 h-m-p 0.7637 6.6248 0.5418 CCC 3173.122187 2 1.1395 1398 | 0/22 40 h-m-p 1.0593 5.2963 0.3431 YC 3173.062459 1 0.7815 1446 | 0/22 41 h-m-p 1.6000 8.0000 0.1641 CC 3173.028614 1 1.3097 1495 | 0/22 42 h-m-p 1.6000 8.0000 0.0200 YC 3172.979841 1 3.4595 1543 | 0/22 43 h-m-p 1.1429 8.0000 0.0604 +CC 3172.905585 1 4.2141 1593 | 0/22 44 h-m-p 1.1134 8.0000 0.2287 YC 3172.788370 1 2.6966 1641 | 0/22 45 h-m-p 1.6000 8.0000 0.0996 YC 3172.766152 1 1.0295 1689 | 0/22 46 h-m-p 1.4898 8.0000 0.0688 YC 3172.761763 1 1.1521 1737 | 0/22 47 h-m-p 1.6000 8.0000 0.0117 +YC 3172.757269 1 4.1376 1786 | 0/22 48 h-m-p 1.6000 8.0000 0.0134 ++ 3172.722604 m 8.0000 1833 | 0/22 49 h-m-p 0.8005 8.0000 0.1341 +CYC 3172.614435 2 3.0064 1884 | 0/22 50 h-m-p 0.9842 8.0000 0.4095 +YC 3172.436290 1 2.4841 1933 | 0/22 51 h-m-p 1.6000 8.0000 0.1877 YCC 3172.392205 2 1.2947 1983 | 0/22 52 h-m-p 1.6000 8.0000 0.1124 C 3172.386994 0 1.7235 2030 | 0/22 53 h-m-p 1.6000 8.0000 0.0289 C 3172.386590 0 1.3542 2077 | 0/22 54 h-m-p 1.6000 8.0000 0.0081 Y 3172.386566 0 1.0507 2124 | 0/22 55 h-m-p 1.6000 8.0000 0.0009 Y 3172.386565 0 0.9277 2171 | 0/22 56 h-m-p 1.6000 8.0000 0.0000 Y 3172.386565 0 0.8749 2218 | 0/22 57 h-m-p 1.5675 8.0000 0.0000 -------Y 3172.386565 0 0.0000 2272 Out.. lnL = -3172.386565 2273 lfun, 9092 eigenQcodon, 109104 P(t) Time used: 1:57 Model 7: beta TREE # 1 (1, 2, ((3, 4), ((5, 10), 6, (7, (8, 9))))); MP score: 347 0.028217 0.027348 0.029912 0.018847 0.054576 0.029283 0.109053 0.015197 0.084120 0.089452 0.185527 0.020761 0.160459 0.026610 0.070391 0.116852 2.083263 1.091300 1.180709 ntime & nrate & np: 16 1 19 Bounds (np=19): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 7.378518 np = 19 lnL0 = -3306.888643 Iterating by ming2 Initial: fx= 3306.888643 x= 0.02822 0.02735 0.02991 0.01885 0.05458 0.02928 0.10905 0.01520 0.08412 0.08945 0.18553 0.02076 0.16046 0.02661 0.07039 0.11685 2.08326 1.09130 1.18071 1 h-m-p 0.0000 0.0007 490.5457 ++YCCCC 3298.486279 4 0.0001 33 | 0/19 2 h-m-p 0.0001 0.0006 146.9892 +YYCCCC 3293.988698 5 0.0004 64 | 0/19 3 h-m-p 0.0001 0.0011 735.3573 +CYC 3282.083319 2 0.0004 90 | 0/19 4 h-m-p 0.0002 0.0011 733.1020 +CCCCC 3231.726373 4 0.0009 121 | 0/19 5 h-m-p 0.0000 0.0002 2301.4614 CYCCC 3224.369661 4 0.0001 150 | 0/19 6 h-m-p 0.0001 0.0004 386.8174 CYCCC 3221.558659 4 0.0001 179 | 0/19 7 h-m-p 0.0001 0.0004 169.7284 YCCCC 3220.564857 4 0.0001 208 | 0/19 8 h-m-p 0.0003 0.0026 80.1631 +YCCCC 3216.339972 4 0.0020 238 | 0/19 9 h-m-p 0.0002 0.0011 749.5200 CYC 3213.071524 2 0.0002 263 | 0/19 10 h-m-p 0.0001 0.0007 337.3610 YCCCCC 3210.618826 5 0.0003 294 | 0/19 11 h-m-p 0.0001 0.0005 396.9284 CCCC 3209.258021 3 0.0002 322 | 0/19 12 h-m-p 0.0003 0.0036 233.8208 YCCC 3206.606254 3 0.0006 349 | 0/19 13 h-m-p 0.0006 0.0030 160.8267 CCCCC 3203.820977 4 0.0010 379 | 0/19 14 h-m-p 0.0020 0.0102 43.8770 CC 3203.405359 1 0.0008 403 | 0/19 15 h-m-p 0.0047 0.0346 7.4302 CC 3203.339079 1 0.0015 427 | 0/19 16 h-m-p 0.0022 0.1415 5.0176 ++YYCCCC 3201.582728 5 0.0370 459 | 0/19 17 h-m-p 0.0010 0.0128 185.4524 +YYCCC 3195.362303 4 0.0032 488 | 0/19 18 h-m-p 0.0016 0.0082 96.8841 CCC 3194.772311 2 0.0006 514 | 0/19 19 h-m-p 0.0071 0.0428 8.6924 YC 3194.322545 1 0.0031 537 | 0/19 20 h-m-p 0.0015 0.0506 18.3517 ++YYCCC 3182.847334 4 0.0203 567 | 0/19 21 h-m-p 0.0948 0.4740 0.5178 YCYCCC 3179.686932 5 0.2475 597 | 0/19 22 h-m-p 0.5229 4.6465 0.2451 CCC 3178.418263 2 0.7665 642 | 0/19 23 h-m-p 0.8821 4.4103 0.1386 CYC 3178.100972 2 0.8106 686 | 0/19 24 h-m-p 1.3842 8.0000 0.0812 YCC 3177.936121 2 1.0977 730 | 0/19 25 h-m-p 0.5710 8.0000 0.1560 YC 3177.659908 1 1.3672 772 | 0/19 26 h-m-p 0.5388 6.0002 0.3960 +YYYYC 3176.571814 4 2.0270 818 | 0/19 27 h-m-p 0.5395 2.6973 0.5853 CCCCC 3176.032803 4 0.7396 867 | 0/19 28 h-m-p 1.6000 8.0000 0.2396 CYC 3175.850137 2 0.4599 911 | 0/19 29 h-m-p 1.6000 8.0000 0.0198 YC 3175.782292 1 0.6861 953 | 0/19 30 h-m-p 0.2573 8.0000 0.0527 +YC 3175.765959 1 0.8718 996 | 0/19 31 h-m-p 1.6000 8.0000 0.0056 YC 3175.763376 1 0.8976 1038 | 0/19 32 h-m-p 0.9758 8.0000 0.0051 Y 3175.763249 0 0.7611 1079 | 0/19 33 h-m-p 1.6000 8.0000 0.0005 Y 3175.763240 0 1.0195 1120 | 0/19 34 h-m-p 1.6000 8.0000 0.0001 Y 3175.763239 0 0.9414 1161 | 0/19 35 h-m-p 1.6000 8.0000 0.0000 Y 3175.763239 0 0.8312 1202 | 0/19 36 h-m-p 1.6000 8.0000 0.0000 Y 3175.763239 0 1.0540 1243 | 0/19 37 h-m-p 1.6000 8.0000 0.0000 Y 3175.763239 0 1.1366 1284 | 0/19 38 h-m-p 1.6000 8.0000 0.0000 C 3175.763239 0 1.6000 1325 | 0/19 39 h-m-p 1.6000 8.0000 0.0000 ---Y 3175.763239 0 0.0063 1369 Out.. lnL = -3175.763239 1370 lfun, 15070 eigenQcodon, 219200 P(t) Time used: 3:36 Model 8: beta&w>1 TREE # 1 (1, 2, ((3, 4), ((5, 10), 6, (7, (8, 9))))); MP score: 347 initial w for M8:NSbetaw>1 reset. 0.028217 0.027348 0.029912 0.018847 0.054576 0.029283 0.109053 0.015197 0.084120 0.089452 0.185527 0.020761 0.160459 0.026610 0.070391 0.116852 2.068499 0.900000 0.318342 1.765725 2.851152 ntime & nrate & np: 16 2 21 Bounds (np=21): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 8.012897 np = 21 lnL0 = -3242.857823 Iterating by ming2 Initial: fx= 3242.857823 x= 0.02822 0.02735 0.02991 0.01885 0.05458 0.02928 0.10905 0.01520 0.08412 0.08945 0.18553 0.02076 0.16046 0.02661 0.07039 0.11685 2.06850 0.90000 0.31834 1.76572 2.85115 1 h-m-p 0.0000 0.0002 870.3413 ++YYCYCCC 3188.270602 6 0.0001 37 | 0/21 2 h-m-p 0.0000 0.0001 265.9512 +YYYY 3185.733995 3 0.0001 65 | 0/21 3 h-m-p 0.0001 0.0004 196.5649 YCCCC 3183.129155 4 0.0002 96 | 0/21 4 h-m-p 0.0002 0.0008 234.4146 YCCCC 3178.765066 4 0.0003 127 | 0/21 5 h-m-p 0.0003 0.0013 167.9939 YCC 3177.696491 2 0.0002 154 | 0/21 6 h-m-p 0.0005 0.0024 43.0784 CC 3177.555908 1 0.0002 180 | 0/21 7 h-m-p 0.0004 0.0072 18.9360 CC 3177.499032 1 0.0004 206 | 0/21 8 h-m-p 0.0004 0.0050 19.6105 YC 3177.472272 1 0.0002 231 | 0/21 9 h-m-p 0.0004 0.0091 11.2262 YC 3177.459727 1 0.0003 256 | 0/21 10 h-m-p 0.0004 0.0229 9.0245 +YC 3177.433020 1 0.0011 282 | 0/21 11 h-m-p 0.0002 0.0069 60.7835 +YCC 3177.347390 2 0.0005 310 | 0/21 12 h-m-p 0.0004 0.0098 75.2644 +YC 3177.138048 1 0.0010 336 | 0/21 13 h-m-p 0.0004 0.0111 184.2408 +CCCC 3175.713372 3 0.0028 367 | 0/21 14 h-m-p 0.0005 0.0023 495.6682 CCCC 3175.018474 3 0.0005 397 | 0/21 15 h-m-p 0.0013 0.0067 138.0573 CC 3174.893121 1 0.0004 423 | 0/21 16 h-m-p 0.0057 0.0286 7.5672 YC 3174.878898 1 0.0009 448 | 0/21 17 h-m-p 0.0005 0.0907 13.7528 +YC 3174.777717 1 0.0039 474 | 0/21 18 h-m-p 0.0006 0.0128 93.4734 +CCCC 3174.255434 3 0.0029 505 | 0/21 19 h-m-p 0.0010 0.0048 193.1875 YCC 3174.005555 2 0.0007 532 | 0/21 20 h-m-p 0.0054 0.0268 16.6583 -CC 3173.994510 1 0.0004 559 | 0/21 21 h-m-p 0.0151 4.8598 0.4293 ++YC 3173.395801 1 0.5870 586 | 0/21 22 h-m-p 0.3943 8.0000 0.6391 YC 3173.299154 1 0.2677 632 | 0/21 23 h-m-p 0.6294 8.0000 0.2718 YC 3173.063699 1 1.4416 678 | 0/21 24 h-m-p 1.0641 5.3203 0.3492 CYCCC 3172.732550 4 2.0291 730 | 0/21 25 h-m-p 0.3159 1.5796 0.6470 CYCCC 3172.634287 4 0.5041 782 | 0/21 26 h-m-p 0.9084 8.0000 0.3590 CCC 3172.525030 2 0.7894 831 | 0/21 27 h-m-p 1.0223 8.0000 0.2772 YC 3172.484222 1 1.6444 877 | 0/21 28 h-m-p 1.6000 8.0000 0.1519 C 3172.464819 0 1.7336 922 | 0/21 29 h-m-p 1.6000 8.0000 0.0952 YC 3172.461829 1 1.0939 968 | 0/21 30 h-m-p 1.6000 8.0000 0.0244 YC 3172.461631 1 0.9457 1014 | 0/21 31 h-m-p 1.6000 8.0000 0.0040 Y 3172.461621 0 0.8719 1059 | 0/21 32 h-m-p 1.6000 8.0000 0.0009 Y 3172.461620 0 0.8962 1104 | 0/21 33 h-m-p 1.6000 8.0000 0.0000 -Y 3172.461620 0 0.1841 1150 | 0/21 34 h-m-p 0.2169 8.0000 0.0000 -C 3172.461620 0 0.0189 1196 | 0/21 35 h-m-p 0.0160 8.0000 0.0000 C 3172.461620 0 0.0250 1241 | 0/21 36 h-m-p 0.0325 8.0000 0.0000 --------------.. | 0/21 37 h-m-p 0.0160 8.0000 0.0160 ------------- | 0/21 38 h-m-p 0.0160 8.0000 0.0160 ------------- Out.. lnL = -3172.461620 1411 lfun, 16932 eigenQcodon, 248336 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -3190.451168 S = -3069.992708 -111.799142 Calculating f(w|X), posterior probabilities of site classes. did 10 / 230 patterns 5:29 did 20 / 230 patterns 5:29 did 30 / 230 patterns 5:29 did 40 / 230 patterns 5:29 did 50 / 230 patterns 5:30 did 60 / 230 patterns 5:30 did 70 / 230 patterns 5:30 did 80 / 230 patterns 5:30 did 90 / 230 patterns 5:30 did 100 / 230 patterns 5:31 did 110 / 230 patterns 5:31 did 120 / 230 patterns 5:31 did 130 / 230 patterns 5:31 did 140 / 230 patterns 5:31 did 150 / 230 patterns 5:32 did 160 / 230 patterns 5:32 did 170 / 230 patterns 5:32 did 180 / 230 patterns 5:32 did 190 / 230 patterns 5:32 did 200 / 230 patterns 5:33 did 210 / 230 patterns 5:33 did 220 / 230 patterns 5:33 did 230 / 230 patterns 5:33 Time used: 5:33 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=357 D_melanogaster_CG5174-PB MSESEPNSLEFIEDPYLPSIDDLTSTPSLDLETNDAVLDWYGDGQEE-SE D_sechellia_CG5174-PB MSESEPNSLEFIEDPYLPSIDDLTSTPSLDLETNEAVLDWYGDGQEE-SE D_yakuba_CG5174-PB MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETSESVLDWYEDGQEE-SE D_erecta_CG5174-PB MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETTEAVLDWYEDGQEE-SE D_suzukii_CG5174-PB MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLEASEAVLDWYGDGQEE-SE D_eugracilis_CG5174-PB MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETNDAVLDWYGDEQED-SE D_ficusphila_CG5174-PB MSESEPNSLEFIEDPYLPGIDDLTSTPSLDLETPEAALDWYGDEQEE-SE D_rhopaloa_CG5174-PB MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLEANDATLDWYGDGEEE-SE D_elegans_CG5174-PB MSESEPNSLDFIEDSYLPGIDDLTSTPSLDLEAHDATIDWYDDGQED-SE D_takahashii_CG5174-PB MSESEPNSLEFIEDSYLPGIDDLTSTPSLDPEATDAVLDWHGDGQEEESE *********:****.***.*********** *: ::.:**: * :*: ** D_melanogaster_CG5174-PB AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIAAKLANQAPSSSMAK D_sechellia_CG5174-PB AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIAAKLANQAPSSSMAK D_yakuba_CG5174-PB AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIGAKLANQAPSSSMAK D_erecta_CG5174-PB AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIGAKLANQAPSSSMAK D_suzukii_CG5174-PB ADFYLRNLTLDQIFYDVDSDYSNSLELQAVEAEFIGAKLANQAPSSSMAK D_eugracilis_CG5174-PB AELYLRNLTLDQIFYDVDSDYTNNLELQTVETEFIGAKLANQAPSSSIAK D_ficusphila_CG5174-PB AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQTPSSSIAK D_rhopaloa_CG5174-PB AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK D_elegans_CG5174-PB AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK D_takahashii_CG5174-PB AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK *::******************:*.****:**::**.******:****:** D_melanogaster_CG5174-PB RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK D_sechellia_CG5174-PB RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSKGTQ D_yakuba_CG5174-PB RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIAHRSRGTK D_erecta_CG5174-PB RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK D_suzukii_CG5174-PB RFRLKFFTKRSMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK D_eugracilis_CG5174-PB RFRLKFFTKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGNRSRGTK D_ficusphila_CG5174-PB RFRLKFFTKRTMRDVRVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK D_rhopaloa_CG5174-PB RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK D_elegans_CG5174-PB RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK D_takahashii_CG5174-PB RFRLKFFAKRSMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGQRSRGTS *******:**:****:**************************.:**:**. D_melanogaster_CG5174-PB FDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE D_sechellia_CG5174-PB FHNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE D_yakuba_CG5174-PB FDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE D_erecta_CG5174-PB LDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE D_suzukii_CG5174-PB FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRADWTQELARVEE D_eugracilis_CG5174-PB FDNTANLSDPASPAASVASAEIAAEFAALTVEEKEQRRAEWSQELARVEE D_ficusphila_CG5174-PB FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE D_rhopaloa_CG5174-PB FDNTANLSEPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE D_elegans_CG5174-PB FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE D_takahashii_CG5174-PB LDNTANLSEPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE :.******:***** **************:*********:*:******** D_melanogaster_CG5174-PB EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQS D_sechellia_CG5174-PB EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS D_yakuba_CG5174-PB EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS D_erecta_CG5174-PB EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS D_suzukii_CG5174-PB EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKESTVYQS D_eugracilis_CG5174-PB EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKESTVYQS D_ficusphila_CG5174-PB EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIRNLKESTVYQS D_rhopaloa_CG5174-PB EINTLRTVLASKTRHACDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS D_elegans_CG5174-PB EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS D_takahashii_CG5174-PB EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS ****************.*****************:***::****:***** D_melanogaster_CG5174-PB VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM D_sechellia_CG5174-PB VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM D_yakuba_CG5174-PB VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM D_erecta_CG5174-PB VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM D_suzukii_CG5174-PB VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM D_eugracilis_CG5174-PB VEQSLGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKFSQM D_ficusphila_CG5174-PB VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM D_rhopaloa_CG5174-PB VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM D_elegans_CG5174-PB VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM D_takahashii_CG5174-PB VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM ****:*****:*:*********************************:*** D_melanogaster_CG5174-PB KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP D_sechellia_CG5174-PB KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP D_yakuba_CG5174-PB KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP D_erecta_CG5174-PB KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP D_suzukii_CG5174-PB KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP D_eugracilis_CG5174-PB KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFQDALDENNTSSGLNSP D_ficusphila_CG5174-PB KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP D_rhopaloa_CG5174-PB KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP D_elegans_CG5174-PB KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDAMDEHNTSSGLNSP D_takahashii_CG5174-PB KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP ********************************** **:**:********* D_melanogaster_CG5174-PB TDSLPKo D_sechellia_CG5174-PB TDSLPKo D_yakuba_CG5174-PB TDSITKo D_erecta_CG5174-PB TDSLooo D_suzukii_CG5174-PB TDSLTKo D_eugracilis_CG5174-PB TDSoooo D_ficusphila_CG5174-PB TDSLTKo D_rhopaloa_CG5174-PB TDSLTKo D_elegans_CG5174-PB TDSLTKo D_takahashii_CG5174-PB TDSLTK- ***
>D_melanogaster_CG5174-PB ATGAGCGAATCGGAACCGAATAGCCTGGAGTTCATTGAAGACCCCTATCT GCCAAGCATTGATGATCTCACCAGCACACCGTCACTGGATCTGGAAACCA ATGATGCCGTCTTGGACTGGTATGGCGATGGGCAGGAGGAG---AGCGAG GCTGAGCTATATTTGCGTAATCTGACGCTAGACCAGATATTCTACGATGT GGATTCGGACTACACCAACAGCCTGGAATTGCAGGCAGTGGAGGCGGACT TCATTGCCGCCAAGTTGGCCAATCAAGCGCCATCGTCTTCGATGGCCAAA CGCTTCCGCTTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT CACGTTCATAGACTTCTCCAAACCGTATCTGGCCAAAATATCAAACAGTG ATAACTACAAGAGATTCCTCAACATTGGGCATAGAAGTAGAGGTACCAAA TTCGATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCTAATTCTGT GGCATCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTTTCCGTCGAGGAGA AGGAGCAGCGTCGGGCTGAGTGGAGTCAGGAGCTCGCCCGCGTTGAGGAA GAGATCAATACGCTGCGAACTGTCCTAGCCTCCAAGACGCGCCATGCCTC CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG ACGTGAACCAGGGCCTTAAGAACCTCAAGGAGAGCACTGTTTACCAATCG GTGGAGCAGAGCGTGGGCACGTTTACTAAAACGGTGTACGAGGCACCACT ATACCAACGCACTGAGTCGGTGCTAAAGTCCACGGGCGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG AAAAACTCCGAATCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA CGAGAACGTTAAAACCAAGGTGACATCCCGCTCGGGTTCGGTGTCCAGTT TCCCAGATGCCCTGGACGAGAATAACACATCCTCGGGTCTGAATTCACCC ACAGACTCACTCCCGAAA--- >D_sechellia_CG5174-PB ATGAGCGAATCGGAACCGAATAGCCTGGAGTTCATTGAAGATCCCTATCT GCCAAGCATCGATGATCTCACCAGCACACCGTCACTGGATCTGGAAACCA ATGAAGCCGTCTTGGACTGGTATGGCGATGGGCAGGAGGAG---AGCGAG GCTGAGCTATATCTGCGTAATCTGACGCTAGACCAGATATTCTACGATGT GGATTCGGACTACACCAACAGCCTAGAACTGCAGGCAGTGGAGGCGGACT TCATTGCCGCCAAGTTGGCCAATCAAGCGCCATCGTCTTCGATGGCCAAA CGCTTCCGCTTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT CACGTTCATAGACTTCTCCAAACCGTATCTGGCCAAAATATCGAACAGTG ATAACTACAAGAGATTCCTCAACATTGGGCATAGAAGTAAAGGTACCCAA TTCCATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCTAATTCTGT GGCATCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTCTCCGTCGAGGAGA AGGAGCAGCGTCGGGCTGAGTGGAGTCAGGAGCTCGCCCGCGTTGAGGAA GAGATCAACACGCTGCGAACCGTTCTAGCCTCCAAGACGCGCCATGCCTC CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG ACATGAACCAGGGCCTTAAGAACCTCAAGGAGAGCACTGTTTACCAATCG GTGGAGCAGAGCGTGGGCACGTTTACTAAAACGGTGTACGAGGCACCACT ATACCAACGCACTGAGTCGGTGCTAAAGTCCACGGGCGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG AAAAACTCCGAATCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA CGAGAACGTTAAAACCAAGGTGACATCCCGCTCGGGTTCGGTATCCAGTT TCCCAGATGCTCTGGACGAGAACAACACATCCTCGGGTCTGAATTCACCC ACAGACTCGCTCCCTAAA--- >D_yakuba_CG5174-PB ATGAGCGAATCCGAACCTAATAGCCTGGAGTTCATTGAAGACTCCTATCT GCCTGGCATCGATGATCTCACCAGCACACCGTCGCTGGATCTGGAAACTA GCGAATCCGTCTTGGACTGGTACGAAGATGGGCAGGAGGAG---AGCGAA GCTGAGCTATATCTGCGTAATCTGACGCTCGACCAGATATTCTACGATGT GGATTCGGACTACACGAATAGCCTGGAACTGCAGGCCGTGGAGGCGGACT TCATTGGTGCCAAGTTGGCCAATCAAGCACCATCCTCATCGATGGCCAAA CGCTTCCGGTTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT CACGTTCATAGACTTCTCCAAGCCGTATCTGGCGAAAATATCGAACAGTG ATAACTACAAGAGATTCCTCAACATTGCGCATAGAAGTAGAGGTACCAAA TTCGATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCTAATTCTGT GGCGTCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTTTCCGTCGAGGAAA AGGAGCAGCGTCGGGCCGAGTGGAGTCAGGAGCTCGCCCGCGTTGAGGAG GAGATCAACACGCTGCGAACTGTCCTAGCGTCTAAGACGCGCCATGCCTC CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG ACATGAACCAGGGCCTTAAGAACCTCAAGGAGAGCACTGTTTACCAATCG GTGGAGCAGAGCGTGGGCACGTTTACTAAAACGGTGTACGAGGCACCACT ATACCAACGCACTGAGTCGGTGTTAAAGTCCACGGGCGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG AAAAACTCTGAATCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA CGAGAACGTTAAAACCAAGGTGACATCCCGCTCGGGTTCGGTATCCAGTT TCCCAGATGCCCTGGACGAGAACAACACATCCTCGGGTCTGAATTCACCC ACAGACTCAATCACTAAA--- >D_erecta_CG5174-PB ATGAGCGAATCGGAACCGAATAGCCTGGAGTTCATTGAAGACTCCTATCT GCCTGGCATCGATGATCTCACCAGCACACCGTCGCTGGATCTGGAAACTA CCGAAGCCGTCTTGGACTGGTATGAAGATGGGCAGGAGGAG---AGCGAA GCTGAGCTATACCTGCGTAATCTGACGTTAGACCAGATATTCTACGATGT GGATTCAGACTATACCAACAGCCTGGAACTGCAGGCAGTGGAGGCGGACT TCATTGGCGCCAAGTTGGCCAATCAAGCACCATCATCTTCGATGGCCAAA CGCTTCCGGTTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT CACGTTCATAGACTTCTCCAAACCGTATCTGGCCAAAATATCGAACAGTG ATAACTACAAGAGATTCCTCAACATTGGGCATAGAAGTAGAGGTACCAAA TTAGATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCTAATTCTGT GGCATCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTTTCCGTCGAGGAAA AGGAGCAGCGTCGGGCCGAGTGGAGTCAGGAGCTCGCCCGCGTTGAGGAA GAGATCAACACGCTGCGAACCGTCCTAGCCTCTAAGACGCGCCATGCCTC CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG ACATGAACCAGGGCCTTAAGAACCTCAAGGAGAGCACTGTTTACCAATCG GTGGAGCAGAGTGTGGGCACGTTTACTAAAACGGTGTACGAGGCACCACT ATACCAACGCACTGAGTCGGTGCTAAAGTCCACGGGCGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG AAAAACTCCGAATCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA CGAGAACGTTAAAACTAAGGTGACATCCCGCTCGGGTTCGGTATCCAGTT TCCCAGATGCCCTGGACGAGAACAACACATCCTCGGGTCTGAATTCACCC ACAGACTCACTC--------- >D_suzukii_CG5174-PB ATGAGCGAATCGGAACCCAATAGCCTGGAGTTCATTGAAGACTCCTATCT GCCAGGCATCGATGATCTCACCAGCACACCATCCCTGGATCTGGAAGCTA GCGAAGCCGTCTTGGACTGGTATGGAGACGGGCAGGAGGAG---AGCGAA GCTGATTTTTATCTGCGTAACCTGACTCTGGACCAGATCTTCTACGATGT GGATTCAGACTACTCCAACAGCCTGGAACTGCAGGCAGTGGAGGCGGAGT TCATTGGCGCCAAGTTGGCCAACCAGGCACCCTCTTCCTCGATGGCCAAA CGCTTCCGGCTAAAGTTCTTCACCAAGCGAAGCATGCGTGACGTTAAAGT CACGTTCATAGACTTCTCCAAGCCATATCTGGCCAAAATATCGAACAGTG ATAACTACAAGAGATTTCTCAACATTGGGCATAGAAGTAGAGGTACCAAA TTCGATAATACAGCCAATCTGTCGGACCCAGCATCTCCAGCAGCTTCTGT GGCATCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTTTCCGTGGAGGAGA AGGAGCAGCGTCGGGCTGATTGGACTCAGGAACTGGCCCGCGTTGAGGAG GAGATCAACACGCTGCGCACCGTCCTCGCCTCGAAGACGCGCCATGCCTC CGATCTCAAGCGCAAGCTGGGCATTACCGTCTGGAAGGAGGTGACGGACG ACATGAACCAGGGCATCAAGAACCTTAAAGAGAGCACTGTTTACCAATCG GTGGAGCAGAGCGTGGGCACGTTTACTAAAGCCGTGCACGAGGCACCCCT ATACCAACGCACGGAGTCTGTGCTCAAGTCCACGGGCGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA CGAGAACGTTAAAACCAAGGTGACATCCCGCTCGGGTTCGGTATCCAGTT TTCCAGACGCCTTGGACGAGAACAACACATCCTCGGGCCTGAATTCACCC ACAGACTCACTTACTAAA--- >D_eugracilis_CG5174-PB ATGAGCGAATCGGAACCCAATAGCCTGGAGTTCATTGAAGACTCCTACCT GCCAGGCATCGATGATCTCACCAGCACACCTTCCTTGGATCTGGAAACCA ATGATGCCGTCTTGGATTGGTATGGTGATGAGCAGGAGGAC---TCTGAA GCTGAGCTATATCTACGTAATCTGACTTTGGATCAGATCTTCTATGATGT AGATTCAGACTACACTAATAACCTGGAATTGCAGACAGTGGAAACAGAGT TCATTGGCGCCAAGTTGGCTAACCAAGCACCCTCTTCCTCGATAGCCAAA CGTTTCCGCTTAAAGTTCTTTACCAAGCGAACGATGCGCGACGTAAAGGT CACGTTCATAGACTTCTCCAAACCGTATCTGGCTAAAATATCGAACAGTG ATAATTACAAGAGATTTCTCAACATTGGGAATAGAAGTAGAGGTACCAAA TTCGATAATACAGCCAACCTTTCGGATCCAGCATCTCCAGCAGCTTCTGT GGCATCTGCAGAAATTGCCGCCGAGTTTGCCGCGCTTACCGTCGAGGAGA AGGAGCAGCGTCGGGCTGAGTGGAGTCAGGAGCTAGCCCGCGTAGAGGAG GAGATTAACACGCTGCGTACAGTTCTGGCCTCGAAGACGCGCCATGCCTC CGATCTCAAGCGCAAGCTGGGCATTACCGTCTGGAAAGAGGTGACGGACG ACATGAACCAGGGCATTAAGAACCTCAAAGAGAGCACTGTTTACCAATCG GTGGAGCAGAGCTTGGGCACGTTTACTAAAGCCGTGCACGAAGCACCCCT ATACCAACGCACTGAGTCTGTGCTGAAGTCGACGGGTGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAATTTTCGCAAATG AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTAGGCTCTGCCTA CGAGAACGTTAAAACTAAGGTGACATCCCGTTCGGGTTCTGTATCCAGTT TCCAAGACGCCCTGGACGAGAATAACACATCATCGGGCCTGAATTCACCT ACAGACTCA------------ >D_ficusphila_CG5174-PB ATGAGCGAATCGGAGCCCAATAGCCTGGAGTTCATCGAGGACCCCTACCT GCCGGGCATCGATGATCTCACCAGCACACCTTCACTGGATCTGGAAACGC CAGAAGCCGCATTGGATTGGTATGGCGACGAGCAGGAGGAG---AGTGAA GCGGAGCTTTATCTGCGTAATTTGACGCTGGATCAGATCTTCTACGATGT GGATTCGGATTATACCAACAGCCTGGAGCTGCAGGCAGTGGAAGCTGAGT TCATTGGAGCCAAGTTGGCCAACCAGACACCCTCATCGTCCATCGCCAAA CGCTTTCGCTTGAAGTTCTTCACCAAGCGAACCATGCGCGACGTTAGGGT CACGTTCATAGACTTCTCGAAACCGTATCTCGCCAAGATATCGAACAGTG ACAATTACAAGAGATTTCTCAACATCGGGCATAGAAGTAGAGGTACCAAA TTCGATAATACAGCTAACCTTTCGGACCCAGCATCTCCAGCAGCTTCTGT GGCATCCGCAGAAATTGCTGCCGAGTTTGCTGCGCTTTCCGTCGAGGAGA AGGAGCAACGTCGGGCTGAATGGAGTCAGGAGCTTGCCCGCGTGGAGGAG GAGATCAACACGCTGCGCACCGTTCTCGCATCGAAGACGCGTCATGCCTC CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG ACATGAACCAGGGCATTAGGAACCTCAAGGAGAGCACTGTTTACCAATCG GTGGAGCAGAGCGTGGGCACGTTTACTAAAGCCGTGCACGAGGCACCCTT GTACCAACGCACTGAATCCGTGCTGAAGTCCACGGGCGAAAAGACAGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA CGAGAACGTTAAAACCAAGGTGACATCCCGGTCGGGTTCGGTATCCAGTT TCCCAGACGCCCTGGACGAGAACAACACATCCTCGGGCCTGAACTCACCC ACAGACTCACTCACTAAA--- >D_rhopaloa_CG5174-PB ATGAGCGAATCGGAACCCAATAGCCTGGAGTTCATTGAGGACTCGTACCT ACCAGGCATCGATGATCTCACCAGCACACCTTCTCTGGATCTGGAAGCTA ATGATGCCACCTTAGATTGGTATGGAGATGGAGAGGAGGAG---AGTGAA GCGGAGCTGTATCTGCGGAATCTGACTCTGGATCAGATATTCTACGATGT GGATTCGGACTACACCAACAGCCTGGAGCTGCAGGCAGTGGAGGCTGAGT TCATTGGCGCCAAGTTGGCCAATCAGGCGCCCTCCTCCTCCATGGCCAAA CGTTTCCGCCTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT CACGTTCATAGACTTCTCCAAACCATATCTGGCCAAGATATCGAACAGTG ATAACTACAAGAGATTTCTCAACATTGGGCATAGAAGTAGAGGTACCAAA TTCGATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCAGCTTCTGT GGCATCCGCAGAAATTGCCGCCGAGTTTGCTGCGCTTTCCGTGGAGGAGA AGGAACAGCGCCGGGCCGAGTGGAGTCAGGAGCTGGCCCGCGTTGAGGAG GAGATTAACACGCTGCGTACCGTTCTCGCCTCGAAGACGCGCCATGCCTG CGATCTCAAGCGTAAACTGGGCATCACCGTCTGGAAGGAGGTTACGGACG ACATGAACCAGGGCATTAAGAACCTCAAAGAGACCACTGTTTACCAATCG GTGGAGCAGAGCGTGGGCACGTTTACTAAAGCCGTGCACGAGGCACCCCT ATACCAACGCACTGAGTCTGTGCTGAAGTCCACGGGCGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAACTGTCGCAAATG AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA CGAGAACGTTAAAACCAAGGTGACATCCCGTTCGGGATCGGTTTCCAGTT TCCCAGACGCCCTGGACGAGAACAACACATCCTCGGGCCTGAACTCACCC ACAGACTCACTCACTAAA--- >D_elegans_CG5174-PB ATGAGCGAATCGGAACCCAATAGCCTGGATTTTATTGAGGACTCTTACCT GCCAGGCATCGATGATCTCACCAGCACACCTTCGCTGGATCTGGAAGCGC ATGATGCCACCATAGATTGGTACGACGATGGGCAGGAGGAT---AGTGAA GCGGAGCTGTATTTGCGTAATCTGACTCTCGATCAGATCTTCTACGATGT GGATTCCGATTACACCAACAGCCTGGAGCTGCAGGCCGTGGAGGCCGAGT TCATTGGCGCCAAGTTGGCCAACCAGGCACCCAGTTCCTCGATGGCCAAA CGCTTCCGCCTGAAGTTCTTTGCCAAGCGAACCATGCGCGACGTTAAGGT CACGTTCATAGACTTTTCCAAACCGTATCTGGCCAAGATATCGAATAGTG ATAACTACAAGAGATTTCTCAACATTGGGCATAGAAGTAGAGGTACCAAA TTCGATAATACAGCCAACCTTTCGGATCCAGCATCTCCAGCAGCTTCTGT GGCATCCGCAGAAATTGCCGCCGAGTTTGCTGCGCTTTCCGTGGAGGAGA AGGAACAGCGTCGGGCTGAGTGGAGTCAGGAGCTAGCTCGCGTTGAGGAG GAGATCAATACGCTGCGCACCGTTCTCGCCTCAAAGACGCGCCACGCCTC CGATCTCAAGCGCAAACTTGGCATAACCGTCTGGAAGGAGGTGACGGATG ATATGAACCAGGGCATTAAGAACCTCAAAGAGACCACTGTTTACCAATCG GTGGAGCAGAGCGTGGGCACGTTTACTAAAGCCGTGCACGAGGCACCCCT ATACCAACGCACGGAGTCGGTGCTGAAGTCGACGGGCGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGTGGCATTTCGTCGAAATTGTCGCAAATG AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA TGAGAACGTTAAAACCAAGGTGACATCCCGGTCGGGCTCGGTTTCCAGTT TCCCAGACGCCATGGACGAGCACAACACATCCTCGGGCCTGAACTCACCC ACAGACTCACTTACTAAA--- >D_takahashii_CG5174-PB ATGAGCGAATCGGAACCCAATAGCCTGGAGTTCATCGAGGACTCCTACCT GCCAGGCATCGATGATCTCACCAGCACACCTTCCCTGGATCCGGAAGCCA CCGATGCCGTCTTGGATTGGCACGGCGATGGCCAGGAGGAGGAGAGTGAA GCCGAGCTCTATCTGCGTAATTTGACTCTCGATCAGATCTTCTACGATGT GGACTCGGACTACACCAATAGCCTGGAACTGCAGGCCGTGGAGGCGGAGT TCATTGGCGCCAAGTTGGCCAACCAGGCACCCTCCTCCTCGATGGCCAAG CGCTTCCGGCTAAAGTTCTTTGCCAAGCGAAGCATGCGCGACGTTAAGGT CACGTTCATAGACTTCTCCAAGCCGTATCTGGCCAAAATATCGAACAGTG ATAACTACAAGAGATTTCTCAACATTGGGCAAAGAAGTAGAGGTACCAGT TTGGATAATACAGCCAACCTGTCGGAGCCAGCATCTCCAGCAGCTTCTGT GGCATCCGCAGAAATTGCCGCCGAGTTCGCTGCGCTTTCCGTGGAGGAGA AGGAGCAGCGTCGTGCTGAATGGAGTCAGGAGCTCGCCCGCGTTGAGGAG GAGATCAACACGCTGCGCACCGTTCTCGCCTCGAAGACGCGCCATGCCTC CGATCTCAAGCGCAAGCTGGGCATCACCGTCTGGAAGGAGGTGACGGACG ACATGAACCAGGGCATCAAGAACCTCAAGGAAACCACTGTTTACCAATCG GTGGAGCAGAGCGTGGGCACGTTTACTAAAGCCGTGCACGAGGCACCCCT ATACCAACGCACGGAGTCTGTGCTCAAGTCCACGGGCGAGAAGACCGCCT CGGTGTTTGGCAGCATCACCAGCGGCATTTCGTCGAAACTGTCGCAAATG AAAAACTCCGAGTCGATGCGTTCTATCGAGGCTTCGGTGGGCTCTGCCTA CGAGAACGTTAAAACCAAGGTGACATCCCGTTCGGGCTCGGTATCCAGTT TTCCAGACGCCTTGGACGAGAACAACACATCCTCGGGCCTGAACTCACCC ACAGACTCACTTACTAAA---
>D_melanogaster_CG5174-PB MSESEPNSLEFIEDPYLPSIDDLTSTPSLDLETNDAVLDWYGDGQEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIAAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQS VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLPK >D_sechellia_CG5174-PB MSESEPNSLEFIEDPYLPSIDDLTSTPSLDLETNEAVLDWYGDGQEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIAAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSKGTQ FHNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLPK >D_yakuba_CG5174-PB MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETSESVLDWYEDGQEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIGAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIAHRSRGTK FDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSITK >D_erecta_CG5174-PB MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETTEAVLDWYEDGQEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEADFIGAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK LDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGLKNLKESTVYQS VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSL-- >D_suzukii_CG5174-PB MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLEASEAVLDWYGDGQEE-SE ADFYLRNLTLDQIFYDVDSDYSNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFTKRSMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRADWTQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKESTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTK >D_eugracilis_CG5174-PB MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLETNDAVLDWYGDEQED-SE AELYLRNLTLDQIFYDVDSDYTNNLELQTVETEFIGAKLANQAPSSSIAK RFRLKFFTKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGNRSRGTK FDNTANLSDPASPAASVASAEIAAEFAALTVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKESTVYQS VEQSLGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKFSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFQDALDENNTSSGLNSP TDS--- >D_ficusphila_CG5174-PB MSESEPNSLEFIEDPYLPGIDDLTSTPSLDLETPEAALDWYGDEQEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQTPSSSIAK RFRLKFFTKRTMRDVRVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIRNLKESTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTK >D_rhopaloa_CG5174-PB MSESEPNSLEFIEDSYLPGIDDLTSTPSLDLEANDATLDWYGDGEEE-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSEPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHACDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTK >D_elegans_CG5174-PB MSESEPNSLDFIEDSYLPGIDDLTSTPSLDLEAHDATIDWYDDGQED-SE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFAKRTMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGHRSRGTK FDNTANLSDPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDAMDEHNTSSGLNSP TDSLTK >D_takahashii_CG5174-PB MSESEPNSLEFIEDSYLPGIDDLTSTPSLDPEATDAVLDWHGDGQEEESE AELYLRNLTLDQIFYDVDSDYTNSLELQAVEAEFIGAKLANQAPSSSMAK RFRLKFFAKRSMRDVKVTFIDFSKPYLAKISNSDNYKRFLNIGQRSRGTS LDNTANLSEPASPAASVASAEIAAEFAALSVEEKEQRRAEWSQELARVEE EINTLRTVLASKTRHASDLKRKLGITVWKEVTDDMNQGIKNLKETTVYQS VEQSVGTFTKAVHEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQM KNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLNSP TDSLTK
#NEXUS [ID: 2257368510] begin taxa; dimensions ntax=10; taxlabels D_melanogaster_CG5174-PB D_sechellia_CG5174-PB D_yakuba_CG5174-PB D_erecta_CG5174-PB D_suzukii_CG5174-PB D_eugracilis_CG5174-PB D_ficusphila_CG5174-PB D_rhopaloa_CG5174-PB D_elegans_CG5174-PB D_takahashii_CG5174-PB ; end; begin trees; translate 1 D_melanogaster_CG5174-PB, 2 D_sechellia_CG5174-PB, 3 D_yakuba_CG5174-PB, 4 D_erecta_CG5174-PB, 5 D_suzukii_CG5174-PB, 6 D_eugracilis_CG5174-PB, 7 D_ficusphila_CG5174-PB, 8 D_rhopaloa_CG5174-PB, 9 D_elegans_CG5174-PB, 10 D_takahashii_CG5174-PB ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.01764934,2:0.01508812,((3:0.03746879,4:0.01350181)0.995:0.01583749,((5:0.05265223,10:0.05118678)0.984:0.02063418,6:0.1132468,(7:0.1061042,(8:0.04125513,9:0.07388976)0.932:0.01539122)0.936:0.01534355)1.000:0.08024067)0.999:0.01489286); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.01764934,2:0.01508812,((3:0.03746879,4:0.01350181):0.01583749,((5:0.05265223,10:0.05118678):0.02063418,6:0.1132468,(7:0.1061042,(8:0.04125513,9:0.07388976):0.01539122):0.01534355):0.08024067):0.01489286); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3353.89 -3369.07 2 -3354.35 -3367.46 -------------------------------------- TOTAL -3354.09 -3368.56 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/166/CG5174-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.705890 0.004421 0.571323 0.829272 0.701419 1255.72 1344.24 1.001 r(A<->C){all} 0.075168 0.000285 0.045704 0.111124 0.073760 1005.40 1061.69 1.000 r(A<->G){all} 0.205639 0.000875 0.152266 0.269385 0.204229 789.38 819.61 1.000 r(A<->T){all} 0.090334 0.000534 0.045138 0.133426 0.088583 621.92 894.37 1.001 r(C<->G){all} 0.074110 0.000216 0.046232 0.102487 0.073503 972.97 984.69 1.000 r(C<->T){all} 0.461108 0.001585 0.379539 0.534046 0.460163 640.87 785.81 1.001 r(G<->T){all} 0.093641 0.000400 0.056298 0.133442 0.092403 1118.39 1120.00 1.001 pi(A){all} 0.258116 0.000169 0.232439 0.282712 0.257908 1014.91 1038.27 1.000 pi(C){all} 0.274320 0.000164 0.250856 0.300275 0.273987 1188.95 1207.14 1.001 pi(G){all} 0.268123 0.000170 0.242735 0.293978 0.267938 1233.34 1246.40 1.000 pi(T){all} 0.199441 0.000134 0.176593 0.220637 0.199205 1058.98 1136.01 1.000 alpha{1,2} 0.163709 0.000705 0.112804 0.214446 0.161292 912.04 1016.46 1.003 alpha{3} 2.542699 0.608396 1.210670 4.103541 2.422947 1250.00 1375.50 1.000 pinvar{all} 0.439988 0.002523 0.342189 0.538213 0.444141 1078.67 1273.00 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/166/CG5174-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 10 ls = 352 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 3 3 3 3 5 6 | Ser TCT 5 5 6 6 6 9 | Tyr TAT 4 4 3 4 4 4 | Cys TGT 0 0 0 0 0 0 TTC 11 11 11 10 10 9 | TCC 10 10 12 10 13 8 | TAC 7 7 8 7 6 6 | TGC 0 0 0 0 0 0 Leu TTA 0 0 1 2 0 1 | TCA 4 2 3 4 3 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 5 3 3 3 3 6 | TCG 16 18 16 16 15 15 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 2 1 2 2 2 2 | Pro CCT 0 0 2 1 0 2 | His CAT 2 3 2 2 2 1 | Arg CGT 3 3 3 3 4 6 CTC 5 6 6 5 5 4 | CCC 2 2 1 1 4 3 | CAC 0 0 0 0 1 1 | CGC 8 8 7 7 7 6 CTA 5 6 3 4 2 4 | CCA 6 6 5 5 6 3 | Gln CAA 4 5 4 4 3 5 | CGA 2 2 2 2 1 1 CTG 13 14 15 15 16 12 | CCG 3 3 2 3 0 1 | CAG 7 7 7 7 8 7 | CGG 1 1 2 2 2 1 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 6 5 5 5 6 8 | Thr ACT 4 3 5 5 4 6 | Asn AAT 9 7 7 6 4 9 | Ser AGT 5 5 5 6 4 5 ATC 4 5 5 5 6 4 | ACC 9 10 7 9 8 8 | AAC 10 12 11 12 13 11 | AGC 9 9 9 7 10 6 ATA 3 3 3 3 2 3 | ACA 5 5 5 5 5 8 | Lys AAA 8 8 7 8 9 10 | Arg AGA 3 2 3 3 3 3 Met ATG 5 6 6 6 6 5 | ACG 8 8 9 8 7 7 | AAG 15 15 16 15 14 13 | AGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 4 5 4 4 4 3 | Ala GCT 5 6 4 4 6 6 | Asp GAT 11 10 10 10 10 13 | Gly GGT 3 3 4 3 2 4 GTC 5 4 5 5 4 4 | GCC 16 15 14 16 15 14 | GAC 11 10 11 11 13 10 | GGC 8 8 8 9 10 9 GTA 0 1 1 1 1 5 | GCA 5 5 4 6 7 6 | Glu GAA 8 9 11 12 9 9 | GGA 0 0 0 0 1 0 GTG 13 11 11 11 12 8 | GCG 3 3 6 2 2 1 | GAG 24 24 23 22 22 23 | GGG 2 2 1 2 2 1 -------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------ Phe TTT 5 5 7 5 | Ser TCT 4 6 5 5 | Tyr TAT 4 3 3 2 | Cys TGT 0 0 0 0 TTC 9 9 7 8 | TCC 10 11 10 13 | TAC 6 7 7 7 | TGC 0 1 0 0 Leu TTA 0 1 0 0 | TCA 4 2 3 2 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0 TTG 5 1 3 5 | TCG 17 16 17 16 | TAG 0 0 0 0 | Trp TGG 3 3 3 3 ------------------------------------------------------------------------------------------------------ Leu CTT 4 1 3 1 | Pro CCT 1 1 1 1 | His CAT 2 2 2 1 | Arg CGT 4 5 3 5 CTC 6 5 6 9 | CCC 5 4 4 4 | CAC 1 1 3 2 | CGC 7 6 8 7 CTA 0 2 2 2 | CCA 4 5 4 4 | Gln CAA 4 3 3 4 | CGA 1 1 1 1 CTG 14 19 13 12 | CCG 2 0 1 2 | CAG 7 7 8 8 | CGG 2 2 2 1 ------------------------------------------------------------------------------------------------------ Ile ATT 4 7 6 4 | Thr ACT 3 4 3 3 | Asn AAT 4 5 5 4 | Ser AGT 6 6 7 6 ATC 9 4 5 8 | ACC 9 11 11 10 | AAC 13 13 11 13 | AGC 7 6 6 8 ATA 2 3 4 2 | ACA 7 5 5 5 | Lys AAA 7 9 9 5 | Arg AGA 3 3 3 3 Met ATG 5 6 7 6 | ACG 8 6 7 7 | AAG 14 14 14 17 | AGG 2 0 0 0 ------------------------------------------------------------------------------------------------------ Val GTT 4 7 6 5 | Ala GCT 7 5 5 4 | Asp GAT 10 12 18 11 | Gly GGT 2 1 1 1 GTC 3 2 2 3 | GCC 12 17 17 19 | GAC 11 9 7 10 | GGC 10 10 11 13 GTA 1 0 0 1 | GCA 8 6 6 6 | Glu GAA 9 6 6 8 | GGA 1 3 0 0 GTG 12 11 12 12 | GCG 2 3 3 2 | GAG 25 28 24 25 | GGG 1 1 2 1 ------------------------------------------------------------------------------------------------------ Codon position x base (3x4) table for each sequence. #1: D_melanogaster_CG5174-PB position 1: T:0.19318 C:0.17898 A:0.29261 G:0.33523 position 2: T:0.23864 C:0.28693 A:0.34091 G:0.13352 position 3: T:0.18750 C:0.32670 A:0.15057 G:0.33523 Average T:0.20644 C:0.26420 A:0.26136 G:0.26799 #2: D_sechellia_CG5174-PB position 1: T:0.18750 C:0.19034 A:0.29261 G:0.32955 position 2: T:0.23864 C:0.28693 A:0.34375 G:0.13068 position 3: T:0.17898 C:0.33239 A:0.15341 G:0.33523 Average T:0.20170 C:0.26989 A:0.26326 G:0.26515 #3: D_yakuba_CG5174-PB position 1: T:0.19602 C:0.17898 A:0.29261 G:0.33239 position 2: T:0.23864 C:0.28693 A:0.34091 G:0.13352 position 3: T:0.18466 C:0.32670 A:0.14773 G:0.34091 Average T:0.20644 C:0.26420 A:0.26042 G:0.26894 #4: D_erecta_CG5174-PB position 1: T:0.19318 C:0.17898 A:0.29261 G:0.33523 position 2: T:0.23864 C:0.28693 A:0.34091 G:0.13352 position 3: T:0.18182 C:0.32386 A:0.16761 G:0.32670 Average T:0.20455 C:0.26326 A:0.26705 G:0.26515 #5: D_suzukii_CG5174-PB position 1: T:0.19318 C:0.17898 A:0.28693 G:0.34091 position 2: T:0.23864 C:0.28693 A:0.33523 G:0.13920 position 3: T:0.17898 C:0.35511 A:0.14773 G:0.31818 Average T:0.20360 C:0.27367 A:0.25663 G:0.26610 #6: D_eugracilis_CG5174-PB position 1: T:0.20170 C:0.16761 A:0.30114 G:0.32955 position 2: T:0.23864 C:0.28693 A:0.34659 G:0.12784 position 3: T:0.23864 C:0.29261 A:0.17614 G:0.29261 Average T:0.22633 C:0.24905 A:0.27462 G:0.25000 #7: D_ficusphila_CG5174-PB position 1: T:0.19034 C:0.18182 A:0.29261 G:0.33523 position 2: T:0.23580 C:0.29261 A:0.33239 G:0.13920 position 3: T:0.18182 C:0.33523 A:0.14489 G:0.33807 Average T:0.20265 C:0.26989 A:0.25663 G:0.27083 #8: D_rhopaloa_CG5174-PB position 1: T:0.18466 C:0.18182 A:0.28977 G:0.34375 position 2: T:0.23580 C:0.28977 A:0.33807 G:0.13636 position 3: T:0.19886 C:0.32955 A:0.13920 G:0.33239 Average T:0.20644 C:0.26705 A:0.25568 G:0.27083 #9: D_elegans_CG5174-PB position 1: T:0.18466 C:0.18182 A:0.29261 G:0.34091 position 2: T:0.23580 C:0.28977 A:0.34091 G:0.13352 position 3: T:0.21307 C:0.32670 A:0.13068 G:0.32955 Average T:0.21117 C:0.26610 A:0.25473 G:0.26799 #10: D_takahashii_CG5174-PB position 1: T:0.18750 C:0.18182 A:0.28693 G:0.34375 position 2: T:0.23580 C:0.29261 A:0.33239 G:0.13920 position 3: T:0.16477 C:0.38068 A:0.12216 G:0.33239 Average T:0.19602 C:0.28504 A:0.24716 G:0.27178 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 45 | Ser S TCT 57 | Tyr Y TAT 35 | Cys C TGT 0 TTC 95 | TCC 107 | TAC 68 | TGC 1 Leu L TTA 5 | TCA 31 | *** * TAA 0 | *** * TGA 0 TTG 37 | TCG 162 | TAG 0 | Trp W TGG 30 ------------------------------------------------------------------------------ Leu L CTT 20 | Pro P CCT 9 | His H CAT 19 | Arg R CGT 39 CTC 57 | CCC 30 | CAC 9 | CGC 71 CTA 30 | CCA 48 | Gln Q CAA 39 | CGA 14 CTG 143 | CCG 17 | CAG 73 | CGG 16 ------------------------------------------------------------------------------ Ile I ATT 56 | Thr T ACT 40 | Asn N AAT 60 | Ser S AGT 55 ATC 55 | ACC 92 | AAC 119 | AGC 77 ATA 28 | ACA 55 | Lys K AAA 80 | Arg R AGA 29 Met M ATG 58 | ACG 75 | AAG 147 | AGG 2 ------------------------------------------------------------------------------ Val V GTT 46 | Ala A GCT 52 | Asp D GAT 115 | Gly G GGT 24 GTC 37 | GCC 155 | GAC 103 | GGC 96 GTA 11 | GCA 59 | Glu E GAA 87 | GGA 5 GTG 113 | GCG 27 | GAG 240 | GGG 15 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.19119 C:0.18011 A:0.29205 G:0.33665 position 2: T:0.23750 C:0.28864 A:0.33920 G:0.13466 position 3: T:0.19091 C:0.33295 A:0.14801 G:0.32812 Average T:0.20653 C:0.26723 A:0.25975 G:0.26648 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_CG5174-PB D_sechellia_CG5174-PB 0.1103 (0.0063 0.0569) D_yakuba_CG5174-PB 0.0803 (0.0120 0.1489) 0.0888 (0.0132 0.1490) D_erecta_CG5174-PB 0.1003 (0.0107 0.1067) 0.1224 (0.0120 0.0978) 0.0656 (0.0063 0.0956) D_suzukii_CG5174-PB 0.0947 (0.0267 0.2819) 0.1034 (0.0280 0.2708) 0.0890 (0.0241 0.2708) 0.0943 (0.0228 0.2422) D_eugracilis_CG5174-PB 0.0866 (0.0319 0.3680) 0.0955 (0.0358 0.3747) 0.0854 (0.0351 0.4113) 0.0880 (0.0325 0.3699) 0.0872 (0.0286 0.3279) D_ficusphila_CG5174-PB 0.0649 (0.0261 0.4017) 0.0728 (0.0274 0.3757) 0.0604 (0.0263 0.4351) 0.0607 (0.0235 0.3871) 0.0591 (0.0205 0.3465) 0.0592 (0.0247 0.4178) D_rhopaloa_CG5174-PB 0.0632 (0.0203 0.3210) 0.0796 (0.0241 0.3035) 0.0613 (0.0216 0.3519) 0.0635 (0.0203 0.3200) 0.0735 (0.0190 0.2584) 0.0827 (0.0267 0.3230) 0.0696 (0.0209 0.3005) D_elegans_CG5174-PB 0.0895 (0.0318 0.3559) 0.0986 (0.0358 0.3624) 0.0783 (0.0312 0.3985) 0.0840 (0.0315 0.3754) 0.0927 (0.0279 0.3015) 0.0951 (0.0337 0.3549) 0.0834 (0.0270 0.3234) 0.0755 (0.0158 0.2089) D_takahashii_CG5174-PB 0.0786 (0.0254 0.3232) 0.0956 (0.0288 0.3016) 0.0958 (0.0273 0.2852) 0.0709 (0.0222 0.3132) 0.1149 (0.0202 0.1761) 0.1059 (0.0344 0.3252) 0.0861 (0.0260 0.3025) 0.0626 (0.0152 0.2422) 0.1073 (0.0260 0.2422) Model 0: one-ratio TREE # 1: (1, 2, ((3, 4), ((5, 10), 6, (7, (8, 9))))); MP score: 347 lnL(ntime: 16 np: 18): -3203.862092 +0.000000 11..1 11..2 11..12 12..13 13..3 13..4 12..14 14..15 15..5 15..10 14..6 14..16 16..7 16..17 17..8 17..9 0.030012 0.026199 0.020889 0.029262 0.062428 0.024171 0.131213 0.042537 0.090416 0.091979 0.182933 0.025223 0.170209 0.033295 0.072685 0.119805 2.069284 0.083176 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.15326 (1: 0.030012, 2: 0.026199, ((3: 0.062428, 4: 0.024171): 0.029262, ((5: 0.090416, 10: 0.091979): 0.042537, 6: 0.182933, (7: 0.170209, (8: 0.072685, 9: 0.119805): 0.033295): 0.025223): 0.131213): 0.020889); (D_melanogaster_CG5174-PB: 0.030012, D_sechellia_CG5174-PB: 0.026199, ((D_yakuba_CG5174-PB: 0.062428, D_erecta_CG5174-PB: 0.024171): 0.029262, ((D_suzukii_CG5174-PB: 0.090416, D_takahashii_CG5174-PB: 0.091979): 0.042537, D_eugracilis_CG5174-PB: 0.182933, (D_ficusphila_CG5174-PB: 0.170209, (D_rhopaloa_CG5174-PB: 0.072685, D_elegans_CG5174-PB: 0.119805): 0.033295): 0.025223): 0.131213): 0.020889); Detailed output identifying parameters kappa (ts/tv) = 2.06928 omega (dN/dS) = 0.08318 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.030 798.7 257.3 0.0832 0.0027 0.0326 2.2 8.4 11..2 0.026 798.7 257.3 0.0832 0.0024 0.0285 1.9 7.3 11..12 0.021 798.7 257.3 0.0832 0.0019 0.0227 1.5 5.8 12..13 0.029 798.7 257.3 0.0832 0.0026 0.0318 2.1 8.2 13..3 0.062 798.7 257.3 0.0832 0.0056 0.0679 4.5 17.5 13..4 0.024 798.7 257.3 0.0832 0.0022 0.0263 1.7 6.8 12..14 0.131 798.7 257.3 0.0832 0.0119 0.1427 9.5 36.7 14..15 0.043 798.7 257.3 0.0832 0.0038 0.0463 3.1 11.9 15..5 0.090 798.7 257.3 0.0832 0.0082 0.0983 6.5 25.3 15..10 0.092 798.7 257.3 0.0832 0.0083 0.1000 6.6 25.7 14..6 0.183 798.7 257.3 0.0832 0.0165 0.1989 13.2 51.2 14..16 0.025 798.7 257.3 0.0832 0.0023 0.0274 1.8 7.1 16..7 0.170 798.7 257.3 0.0832 0.0154 0.1851 12.3 47.6 16..17 0.033 798.7 257.3 0.0832 0.0030 0.0362 2.4 9.3 17..8 0.073 798.7 257.3 0.0832 0.0066 0.0790 5.3 20.3 17..9 0.120 798.7 257.3 0.0832 0.0108 0.1303 8.7 33.5 tree length for dN: 0.1043 tree length for dS: 1.2539 Time used: 0:10 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, ((3, 4), ((5, 10), 6, (7, (8, 9))))); MP score: 347 lnL(ntime: 16 np: 19): -3176.077347 +0.000000 11..1 11..2 11..12 12..13 13..3 13..4 12..14 14..15 15..5 15..10 14..6 14..16 16..7 16..17 17..8 17..9 0.030043 0.026248 0.021130 0.029066 0.062908 0.024289 0.133010 0.040815 0.091971 0.091920 0.189790 0.025740 0.177397 0.029500 0.072825 0.124562 2.100731 0.937630 0.039910 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.17122 (1: 0.030043, 2: 0.026248, ((3: 0.062908, 4: 0.024289): 0.029066, ((5: 0.091971, 10: 0.091920): 0.040815, 6: 0.189790, (7: 0.177397, (8: 0.072825, 9: 0.124562): 0.029500): 0.025740): 0.133010): 0.021130); (D_melanogaster_CG5174-PB: 0.030043, D_sechellia_CG5174-PB: 0.026248, ((D_yakuba_CG5174-PB: 0.062908, D_erecta_CG5174-PB: 0.024289): 0.029066, ((D_suzukii_CG5174-PB: 0.091971, D_takahashii_CG5174-PB: 0.091920): 0.040815, D_eugracilis_CG5174-PB: 0.189790, (D_ficusphila_CG5174-PB: 0.177397, (D_rhopaloa_CG5174-PB: 0.072825, D_elegans_CG5174-PB: 0.124562): 0.029500): 0.025740): 0.133010): 0.021130); Detailed output identifying parameters kappa (ts/tv) = 2.10073 dN/dS (w) for site classes (K=2) p: 0.93763 0.06237 w: 0.03991 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.030 798.2 257.8 0.0998 0.0031 0.0313 2.5 8.1 11..2 0.026 798.2 257.8 0.0998 0.0027 0.0274 2.2 7.1 11..12 0.021 798.2 257.8 0.0998 0.0022 0.0220 1.8 5.7 12..13 0.029 798.2 257.8 0.0998 0.0030 0.0303 2.4 7.8 13..3 0.063 798.2 257.8 0.0998 0.0065 0.0656 5.2 16.9 13..4 0.024 798.2 257.8 0.0998 0.0025 0.0253 2.0 6.5 12..14 0.133 798.2 257.8 0.0998 0.0138 0.1387 11.0 35.8 14..15 0.041 798.2 257.8 0.0998 0.0042 0.0426 3.4 11.0 15..5 0.092 798.2 257.8 0.0998 0.0096 0.0959 7.6 24.7 15..10 0.092 798.2 257.8 0.0998 0.0096 0.0959 7.6 24.7 14..6 0.190 798.2 257.8 0.0998 0.0198 0.1979 15.8 51.0 14..16 0.026 798.2 257.8 0.0998 0.0027 0.0268 2.1 6.9 16..7 0.177 798.2 257.8 0.0998 0.0185 0.1850 14.7 47.7 16..17 0.030 798.2 257.8 0.0998 0.0031 0.0308 2.5 7.9 17..8 0.073 798.2 257.8 0.0998 0.0076 0.0760 6.0 19.6 17..9 0.125 798.2 257.8 0.0998 0.0130 0.1299 10.3 33.5 Time used: 0:23 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, ((3, 4), ((5, 10), 6, (7, (8, 9))))); MP score: 347 lnL(ntime: 16 np: 21): -3175.436621 +0.000000 11..1 11..2 11..12 12..13 13..3 13..4 12..14 14..15 15..5 15..10 14..6 14..16 16..7 16..17 17..8 17..9 0.030067 0.026273 0.021568 0.029002 0.062829 0.024175 0.134246 0.041027 0.091989 0.092393 0.191698 0.026146 0.178486 0.030026 0.073255 0.125320 2.125411 0.938685 0.059055 0.041009 4.690061 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.17850 (1: 0.030067, 2: 0.026273, ((3: 0.062829, 4: 0.024175): 0.029002, ((5: 0.091989, 10: 0.092393): 0.041027, 6: 0.191698, (7: 0.178486, (8: 0.073255, 9: 0.125320): 0.030026): 0.026146): 0.134246): 0.021568); (D_melanogaster_CG5174-PB: 0.030067, D_sechellia_CG5174-PB: 0.026273, ((D_yakuba_CG5174-PB: 0.062829, D_erecta_CG5174-PB: 0.024175): 0.029002, ((D_suzukii_CG5174-PB: 0.091989, D_takahashii_CG5174-PB: 0.092393): 0.041027, D_eugracilis_CG5174-PB: 0.191698, (D_ficusphila_CG5174-PB: 0.178486, (D_rhopaloa_CG5174-PB: 0.073255, D_elegans_CG5174-PB: 0.125320): 0.030026): 0.026146): 0.134246): 0.021568); Detailed output identifying parameters kappa (ts/tv) = 2.12541 dN/dS (w) for site classes (K=3) p: 0.93869 0.05906 0.00226 w: 0.04101 1.00000 4.69006 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.030 797.7 258.3 0.1081 0.0033 0.0307 2.7 7.9 11..2 0.026 797.7 258.3 0.1081 0.0029 0.0268 2.3 6.9 11..12 0.022 797.7 258.3 0.1081 0.0024 0.0220 1.9 5.7 12..13 0.029 797.7 258.3 0.1081 0.0032 0.0296 2.6 7.7 13..3 0.063 797.7 258.3 0.1081 0.0069 0.0642 5.5 16.6 13..4 0.024 797.7 258.3 0.1081 0.0027 0.0247 2.1 6.4 12..14 0.134 797.7 258.3 0.1081 0.0148 0.1372 11.8 35.4 14..15 0.041 797.7 258.3 0.1081 0.0045 0.0419 3.6 10.8 15..5 0.092 797.7 258.3 0.1081 0.0102 0.0940 8.1 24.3 15..10 0.092 797.7 258.3 0.1081 0.0102 0.0944 8.1 24.4 14..6 0.192 797.7 258.3 0.1081 0.0212 0.1958 16.9 50.6 14..16 0.026 797.7 258.3 0.1081 0.0029 0.0267 2.3 6.9 16..7 0.178 797.7 258.3 0.1081 0.0197 0.1823 15.7 47.1 16..17 0.030 797.7 258.3 0.1081 0.0033 0.0307 2.6 7.9 17..8 0.073 797.7 258.3 0.1081 0.0081 0.0748 6.5 19.3 17..9 0.125 797.7 258.3 0.1081 0.0138 0.1280 11.0 33.1 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG5174-PB) Pr(w>1) post mean +- SE for w 34 N 0.771 3.843 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG5174-PB) Pr(w>1) post mean +- SE for w 34 N 0.875 1.509 +- 0.518 35 D 0.595 1.318 +- 0.312 149 K 0.534 1.272 +- 0.327 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.957 0.033 0.004 0.002 0.001 0.001 0.001 0.001 0.001 0.001 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 sum of density on p0-p1 = 1.000000 Time used: 1:07 Model 3: discrete (3 categories) TREE # 1: (1, 2, ((3, 4), ((5, 10), 6, (7, (8, 9))))); MP score: 347 lnL(ntime: 16 np: 22): -3172.386565 +0.000000 11..1 11..2 11..12 12..13 13..3 13..4 12..14 14..15 15..5 15..10 14..6 14..16 16..7 16..17 17..8 17..9 0.030135 0.026327 0.021289 0.029519 0.062753 0.024094 0.134350 0.041475 0.092114 0.092284 0.190555 0.026099 0.177669 0.031313 0.073275 0.124222 2.083263 0.848210 0.148828 0.020219 0.432574 4.390968 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.17747 (1: 0.030135, 2: 0.026327, ((3: 0.062753, 4: 0.024094): 0.029519, ((5: 0.092114, 10: 0.092284): 0.041475, 6: 0.190555, (7: 0.177669, (8: 0.073275, 9: 0.124222): 0.031313): 0.026099): 0.134350): 0.021289); (D_melanogaster_CG5174-PB: 0.030135, D_sechellia_CG5174-PB: 0.026327, ((D_yakuba_CG5174-PB: 0.062753, D_erecta_CG5174-PB: 0.024094): 0.029519, ((D_suzukii_CG5174-PB: 0.092114, D_takahashii_CG5174-PB: 0.092284): 0.041475, D_eugracilis_CG5174-PB: 0.190555, (D_ficusphila_CG5174-PB: 0.177669, (D_rhopaloa_CG5174-PB: 0.073275, D_elegans_CG5174-PB: 0.124222): 0.031313): 0.026099): 0.134350): 0.021289); Detailed output identifying parameters kappa (ts/tv) = 2.08326 dN/dS (w) for site classes (K=3) p: 0.84821 0.14883 0.00296 w: 0.02022 0.43257 4.39097 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.030 798.5 257.5 0.0945 0.0030 0.0319 2.4 8.2 11..2 0.026 798.5 257.5 0.0945 0.0026 0.0278 2.1 7.2 11..12 0.021 798.5 257.5 0.0945 0.0021 0.0225 1.7 5.8 12..13 0.030 798.5 257.5 0.0945 0.0029 0.0312 2.4 8.0 13..3 0.063 798.5 257.5 0.0945 0.0063 0.0663 5.0 17.1 13..4 0.024 798.5 257.5 0.0945 0.0024 0.0255 1.9 6.6 12..14 0.134 798.5 257.5 0.0945 0.0134 0.1420 10.7 36.6 14..15 0.041 798.5 257.5 0.0945 0.0041 0.0438 3.3 11.3 15..5 0.092 798.5 257.5 0.0945 0.0092 0.0974 7.3 25.1 15..10 0.092 798.5 257.5 0.0945 0.0092 0.0975 7.4 25.1 14..6 0.191 798.5 257.5 0.0945 0.0190 0.2014 15.2 51.9 14..16 0.026 798.5 257.5 0.0945 0.0026 0.0276 2.1 7.1 16..7 0.178 798.5 257.5 0.0945 0.0178 0.1878 14.2 48.4 16..17 0.031 798.5 257.5 0.0945 0.0031 0.0331 2.5 8.5 17..8 0.073 798.5 257.5 0.0945 0.0073 0.0774 5.8 19.9 17..9 0.124 798.5 257.5 0.0945 0.0124 0.1313 9.9 33.8 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG5174-PB) Pr(w>1) post mean +- SE for w 34 N 0.994** 4.368 Time used: 1:57 Model 7: beta (10 categories) TREE # 1: (1, 2, ((3, 4), ((5, 10), 6, (7, (8, 9))))); MP score: 347 lnL(ntime: 16 np: 19): -3175.763239 +0.000000 11..1 11..2 11..12 12..13 13..3 13..4 12..14 14..15 15..5 15..10 14..6 14..16 16..7 16..17 17..8 17..9 0.030258 0.026427 0.020919 0.029645 0.063197 0.024397 0.133370 0.041370 0.092582 0.092065 0.189348 0.025771 0.176884 0.030761 0.072986 0.123860 2.068499 0.128424 1.209131 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.17384 (1: 0.030258, 2: 0.026427, ((3: 0.063197, 4: 0.024397): 0.029645, ((5: 0.092582, 10: 0.092065): 0.041370, 6: 0.189348, (7: 0.176884, (8: 0.072986, 9: 0.123860): 0.030761): 0.025771): 0.133370): 0.020919); (D_melanogaster_CG5174-PB: 0.030258, D_sechellia_CG5174-PB: 0.026427, ((D_yakuba_CG5174-PB: 0.063197, D_erecta_CG5174-PB: 0.024397): 0.029645, ((D_suzukii_CG5174-PB: 0.092582, D_takahashii_CG5174-PB: 0.092065): 0.041370, D_eugracilis_CG5174-PB: 0.189348, (D_ficusphila_CG5174-PB: 0.176884, (D_rhopaloa_CG5174-PB: 0.072986, D_elegans_CG5174-PB: 0.123860): 0.030761): 0.025771): 0.133370): 0.020919); Detailed output identifying parameters kappa (ts/tv) = 2.06850 Parameters in M7 (beta): p = 0.12842 q = 1.20913 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00002 0.00021 0.00151 0.00722 0.02661 0.08196 0.22341 0.57628 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.030 798.7 257.3 0.0917 0.0030 0.0322 2.4 8.3 11..2 0.026 798.7 257.3 0.0917 0.0026 0.0281 2.1 7.2 11..12 0.021 798.7 257.3 0.0917 0.0020 0.0223 1.6 5.7 12..13 0.030 798.7 257.3 0.0917 0.0029 0.0316 2.3 8.1 13..3 0.063 798.7 257.3 0.0917 0.0062 0.0673 4.9 17.3 13..4 0.024 798.7 257.3 0.0917 0.0024 0.0260 1.9 6.7 12..14 0.133 798.7 257.3 0.0917 0.0130 0.1420 10.4 36.5 14..15 0.041 798.7 257.3 0.0917 0.0040 0.0441 3.2 11.3 15..5 0.093 798.7 257.3 0.0917 0.0090 0.0986 7.2 25.4 15..10 0.092 798.7 257.3 0.0917 0.0090 0.0980 7.2 25.2 14..6 0.189 798.7 257.3 0.0917 0.0185 0.2016 14.8 51.9 14..16 0.026 798.7 257.3 0.0917 0.0025 0.0274 2.0 7.1 16..7 0.177 798.7 257.3 0.0917 0.0173 0.1884 13.8 48.5 16..17 0.031 798.7 257.3 0.0917 0.0030 0.0328 2.4 8.4 17..8 0.073 798.7 257.3 0.0917 0.0071 0.0777 5.7 20.0 17..9 0.124 798.7 257.3 0.0917 0.0121 0.1319 9.7 33.9 Time used: 3:36 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, ((3, 4), ((5, 10), 6, (7, (8, 9))))); MP score: 347 check convergence.. lnL(ntime: 16 np: 21): -3172.461620 +0.000000 11..1 11..2 11..12 12..13 13..3 13..4 12..14 14..15 15..5 15..10 14..6 14..16 16..7 16..17 17..8 17..9 0.030135 0.026325 0.021297 0.029507 0.062747 0.024094 0.134210 0.041607 0.092057 0.092265 0.190360 0.026065 0.177445 0.031530 0.073190 0.124104 2.083377 0.997035 0.161780 1.710808 4.376541 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.17694 (1: 0.030135, 2: 0.026325, ((3: 0.062747, 4: 0.024094): 0.029507, ((5: 0.092057, 10: 0.092265): 0.041607, 6: 0.190360, (7: 0.177445, (8: 0.073190, 9: 0.124104): 0.031530): 0.026065): 0.134210): 0.021297); (D_melanogaster_CG5174-PB: 0.030135, D_sechellia_CG5174-PB: 0.026325, ((D_yakuba_CG5174-PB: 0.062747, D_erecta_CG5174-PB: 0.024094): 0.029507, ((D_suzukii_CG5174-PB: 0.092057, D_takahashii_CG5174-PB: 0.092265): 0.041607, D_eugracilis_CG5174-PB: 0.190360, (D_ficusphila_CG5174-PB: 0.177445, (D_rhopaloa_CG5174-PB: 0.073190, D_elegans_CG5174-PB: 0.124104): 0.031530): 0.026065): 0.134210): 0.021297); Detailed output identifying parameters kappa (ts/tv) = 2.08338 Parameters in M8 (beta&w>1): p0 = 0.99703 p = 0.16178 q = 1.71081 (p1 = 0.00297) w = 4.37654 dN/dS (w) for site classes (K=11) p: 0.09970 0.09970 0.09970 0.09970 0.09970 0.09970 0.09970 0.09970 0.09970 0.09970 0.00297 w: 0.00000 0.00000 0.00009 0.00073 0.00346 0.01204 0.03427 0.08568 0.19968 0.47963 4.37654 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.030 798.4 257.6 0.0943 0.0030 0.0319 2.4 8.2 11..2 0.026 798.4 257.6 0.0943 0.0026 0.0278 2.1 7.2 11..12 0.021 798.4 257.6 0.0943 0.0021 0.0225 1.7 5.8 12..13 0.030 798.4 257.6 0.0943 0.0029 0.0312 2.3 8.0 13..3 0.063 798.4 257.6 0.0943 0.0063 0.0664 5.0 17.1 13..4 0.024 798.4 257.6 0.0943 0.0024 0.0255 1.9 6.6 12..14 0.134 798.4 257.6 0.0943 0.0134 0.1419 10.7 36.6 14..15 0.042 798.4 257.6 0.0943 0.0041 0.0440 3.3 11.3 15..5 0.092 798.4 257.6 0.0943 0.0092 0.0974 7.3 25.1 15..10 0.092 798.4 257.6 0.0943 0.0092 0.0976 7.3 25.1 14..6 0.190 798.4 257.6 0.0943 0.0190 0.2013 15.2 51.8 14..16 0.026 798.4 257.6 0.0943 0.0026 0.0276 2.1 7.1 16..7 0.177 798.4 257.6 0.0943 0.0177 0.1877 14.1 48.3 16..17 0.032 798.4 257.6 0.0943 0.0031 0.0333 2.5 8.6 17..8 0.073 798.4 257.6 0.0943 0.0073 0.0774 5.8 19.9 17..9 0.124 798.4 257.6 0.0943 0.0124 0.1312 9.9 33.8 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG5174-PB) Pr(w>1) post mean +- SE for w 34 N 0.993** 4.347 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG5174-PB) Pr(w>1) post mean +- SE for w 34 N 0.987* 1.516 +- 0.252 35 D 0.812 1.347 +- 0.386 42 G 0.504 0.980 +- 0.568 149 K 0.686 1.207 +- 0.484 158 E 0.561 1.078 +- 0.512 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.000 0.000 0.003 0.025 0.104 0.283 0.585 ws: 0.981 0.016 0.001 0.000 0.000 0.000 0.000 0.000 0.000 0.000 Time used: 5:33
Model 1: NearlyNeutral -3176.077347 Model 2: PositiveSelection -3175.436621 Model 0: one-ratio -3203.862092 Model 3: discrete -3172.386565 Model 7: beta -3175.763239 Model 8: beta&w>1 -3172.46162 Model 0 vs 1 55.56948999999986 Model 2 vs 1 1.2814520000001721 Model 8 vs 7 6.603237999999692 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG5174-PB) Pr(w>1) post mean +- SE for w 34 N 0.993** 4.347 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG5174-PB) Pr(w>1) post mean +- SE for w 34 N 0.987* 1.516 +- 0.252 35 D 0.812 1.347 +- 0.386 42 G 0.504 0.980 +- 0.568 149 K 0.686 1.207 +- 0.484 158 E 0.561 1.078 +- 0.512