--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 22 06:29:27 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/3/Acp53C14b-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PB4b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PB4b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PB4b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1052.03 -1060.35
2 -1052.04 -1069.62
--------------------------------------
TOTAL -1052.04 -1068.92
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PB4b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PB4b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PB4b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.307863 0.001516 0.237861 0.387492 0.304719 1410.01 1455.51 1.000
r(A<->C){all} 0.100680 0.001142 0.038355 0.168811 0.098047 639.05 717.98 1.000
r(A<->G){all} 0.304926 0.002725 0.208409 0.407673 0.302280 706.59 833.55 1.000
r(A<->T){all} 0.160653 0.001547 0.084756 0.235129 0.158463 1013.06 1024.57 1.000
r(C<->G){all} 0.171433 0.002079 0.082661 0.255912 0.167821 812.83 814.49 1.000
r(C<->T){all} 0.187351 0.002086 0.101043 0.277245 0.184308 878.88 912.45 1.000
r(G<->T){all} 0.074957 0.001001 0.014956 0.132249 0.072202 849.66 985.82 1.000
pi(A){all} 0.276284 0.000427 0.235328 0.315524 0.276312 1183.86 1271.57 1.000
pi(C){all} 0.226119 0.000382 0.189261 0.264358 0.225750 1007.73 1047.17 1.000
pi(G){all} 0.240699 0.000397 0.199932 0.278203 0.240218 1165.51 1298.65 1.000
pi(T){all} 0.256898 0.000408 0.217296 0.295636 0.256744 976.82 1009.60 1.000
alpha{1,2} 0.890394 0.251277 0.195949 1.915220 0.770264 1314.29 1367.30 1.001
alpha{3} 1.009960 0.315957 0.231232 2.174552 0.871490 1501.00 1501.00 1.000
pinvar{all} 0.137164 0.010167 0.000082 0.325879 0.118108 1251.65 1306.62 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1025.055906
Model 2: PositiveSelection -1025.055906
Model 0: one-ratio -1025.224871
Model 3: discrete -1024.22943
Model 7: beta -1024.586583
Model 8: beta&w>1 -1024.586593
Model 0 vs 1 0.3379299999996874
Model 2 vs 1 0.0
Model 8 vs 7 1.9999999949504854E-5
>C1
MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLA
DKIVPTVYELKQCSGYVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKC
LHGLLNKLAATIKPFAEQISGLGCLDEEDYII
>C2
MSVIKSIFVLSILAVCLISRETEAQATIGESWGRLGKCTQVGIETLTSLA
NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKLVFDEPKC
LHSLLTKLGATIKPFAEQISGLGCSDEEDYII
>C3
MSVIKSIFVLSILAVCLIPRETEAQATIGESWGRLGKCTQVGIETLTSLA
NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKMVFDEPKC
LHSLLTKLGATIKPFAEQISGLGCLDEEDYII
>C4
MSGFKSIFLLSFLAVFLIPRDTEAQATLNESWGKLAKCTQVGIETLTTLA
DGVIPTVYELKQCSGYVSLEPPNGSHRKVTWYLKITYEFFKKLVFDEPRC
LHSLLNKLAVTIKPYAEQISALGCLDEEDYII
>C5
MSGMKSVFLLSFLAVLLIPRETVAQATISETWSKLGKCTHVGIQTLTTLA
NKIVPTVYELSQCSGFVFLEPPNGKQRRVTWYLKISYEFFKKLVFDEPRC
LHSLLNKLAFTIKPFAEQISVLGCLDEEDYII
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=132
C1 MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLA
C2 MSVIKSIFVLSILAVCLISRETEAQATIGESWGRLGKCTQVGIETLTSLA
C3 MSVIKSIFVLSILAVCLIPRETEAQATIGESWGRLGKCTQVGIETLTSLA
C4 MSGFKSIFLLSFLAVFLIPRDTEAQATLNESWGKLAKCTQVGIETLTTLA
C5 MSGMKSVFLLSFLAVLLIPRETVAQATISETWSKLGKCTHVGIQTLTTLA
** :**:*:**:*** **.*:* ****:.*:*.:*.***:*.*:***:**
C1 DKIVPTVYELKQCSGYVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKC
C2 NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKLVFDEPKC
C3 NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKMVFDEPKC
C4 DGVIPTVYELKQCSGYVSLEPPNGSHRKVTWYLKITYEFFKKLVFDEPRC
C5 NKIVPTVYELSQCSGFVFLEPPNGKQRRVTWYLKISYEFFKKLVFDEPRC
: ::******.****:* ***.**..*::*****::******:*****:*
C1 LHGLLNKLAATIKPFAEQISGLGCLDEEDYII
C2 LHSLLTKLGATIKPFAEQISGLGCSDEEDYII
C3 LHSLLTKLGATIKPFAEQISGLGCLDEEDYII
C4 LHSLLNKLAVTIKPYAEQISALGCLDEEDYII
C5 LHSLLNKLAFTIKPFAEQISVLGCLDEEDYII
**.**.**. ****:***** *** *******
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2640]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [2640]--->[2640]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.251 Mb, Max= 30.446 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLA
DKIVPTVYELKQCSGYVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKC
LHGLLNKLAATIKPFAEQISGLGCLDEEDYII
>C2
MSVIKSIFVLSILAVCLISRETEAQATIGESWGRLGKCTQVGIETLTSLA
NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKLVFDEPKC
LHSLLTKLGATIKPFAEQISGLGCSDEEDYII
>C3
MSVIKSIFVLSILAVCLIPRETEAQATIGESWGRLGKCTQVGIETLTSLA
NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKMVFDEPKC
LHSLLTKLGATIKPFAEQISGLGCLDEEDYII
>C4
MSGFKSIFLLSFLAVFLIPRDTEAQATLNESWGKLAKCTQVGIETLTTLA
DGVIPTVYELKQCSGYVSLEPPNGSHRKVTWYLKITYEFFKKLVFDEPRC
LHSLLNKLAVTIKPYAEQISALGCLDEEDYII
>C5
MSGMKSVFLLSFLAVLLIPRETVAQATISETWSKLGKCTHVGIQTLTTLA
NKIVPTVYELSQCSGFVFLEPPNGKQRRVTWYLKISYEFFKKLVFDEPRC
LHSLLNKLAFTIKPFAEQISVLGCLDEEDYII
FORMAT of file /tmp/tmp7223313838063892153aln Not Supported[FATAL:T-COFFEE]
>C1
MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLA
DKIVPTVYELKQCSGYVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKC
LHGLLNKLAATIKPFAEQISGLGCLDEEDYII
>C2
MSVIKSIFVLSILAVCLISRETEAQATIGESWGRLGKCTQVGIETLTSLA
NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKLVFDEPKC
LHSLLTKLGATIKPFAEQISGLGCSDEEDYII
>C3
MSVIKSIFVLSILAVCLIPRETEAQATIGESWGRLGKCTQVGIETLTSLA
NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKMVFDEPKC
LHSLLTKLGATIKPFAEQISGLGCLDEEDYII
>C4
MSGFKSIFLLSFLAVFLIPRDTEAQATLNESWGKLAKCTQVGIETLTTLA
DGVIPTVYELKQCSGYVSLEPPNGSHRKVTWYLKITYEFFKKLVFDEPRC
LHSLLNKLAVTIKPYAEQISALGCLDEEDYII
>C5
MSGMKSVFLLSFLAVLLIPRETVAQATISETWSKLGKCTHVGIQTLTTLA
NKIVPTVYELSQCSGFVFLEPPNGKQRRVTWYLKISYEFFKKLVFDEPRC
LHSLLNKLAFTIKPFAEQISVLGCLDEEDYII
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:132 S:100 BS:132
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 91.67 C1 C2 91.67
TOP 1 0 91.67 C2 C1 91.67
BOT 0 2 92.42 C1 C3 92.42
TOP 2 0 92.42 C3 C1 92.42
BOT 0 3 80.30 C1 C4 80.30
TOP 3 0 80.30 C4 C1 80.30
BOT 0 4 80.30 C1 C5 80.30
TOP 4 0 80.30 C5 C1 80.30
BOT 1 2 97.73 C2 C3 97.73
TOP 2 1 97.73 C3 C2 97.73
BOT 1 3 78.79 C2 C4 78.79
TOP 3 1 78.79 C4 C2 78.79
BOT 1 4 78.79 C2 C5 78.79
TOP 4 1 78.79 C5 C2 78.79
BOT 2 3 79.55 C3 C4 79.55
TOP 3 2 79.55 C4 C3 79.55
BOT 2 4 79.55 C3 C5 79.55
TOP 4 2 79.55 C5 C3 79.55
BOT 3 4 80.30 C4 C5 80.30
TOP 4 3 80.30 C5 C4 80.30
AVG 0 C1 * 86.17
AVG 1 C2 * 86.74
AVG 2 C3 * 87.31
AVG 3 C4 * 79.73
AVG 4 C5 * 79.73
TOT TOT * 83.94
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGCGTGATCAAGTCCATATTTCTGCTCAGTATTTTGGCTGTCTGCCT
C2 ATGAGCGTGATCAAGTCCATATTTGTGCTCAGTATTTTGGCTGTTTGCCT
C3 ATGAGCGTGATCAAGTCCATATTTGTGCTCAGTATTTTGGCTGTCTGCCT
C4 ATGAGCGGGTTCAAGTCCATATTTCTGCTCAGTTTTTTGGCTGTATTCCT
C5 ATGAGCGGGATGAAGTCCGTATTTTTGCTCAGTTTTTTGGCTGTCTTGCT
******* *:* ******.***** ********:********** * **
C1 CATTCCCCGGGAGACGGAGGCCCAGGCCACTATAAGTGAAAGCTGGGGAA
C2 TATATCACGGGAGACGGAGGCCCAGGCCACTATTGGTGAAAGCTGGGGAA
C3 TATTCCCCGGGAGACGGAGGCCCAGGCCACTATTGGTGAAAGCTGGGGAA
C4 TATCCCACGGGACACTGAGGCACAGGCCACTTTAAATGAAAGCTGGGGAA
C5 TATCCCCCGAGAAACTGTGGCGCAGGCCACTATAAGTGAAACCTGGAGTA
** *.**.** ** *:*** *********:*:..***** ****.*:*
C1 GGCTGGGCAAGTGTACTCAGGTGGCCATCGAAACACTGACCAGCCTGGCC
C2 GGCTGGGCAAGTGTACTCAGGTGGGCATCGAAACTCTGACCAGCCTGGCC
C3 GGCTGGGCAAGTGTACTCAGGTGGGCATCGAAACACTGACCAGCCTGGCC
C4 AGCTGGCCAAATGTACTCAGGTGGGCATCGAAACACTGACCACCCTGGCC
C5 AGCTGGGAAAATGTACTCATGTGGGCATCCAAACACTGACCACCCTGGCC
.***** .**.******** **** **** ****:******* *******
C1 GATAAAATCGTCCCGACCGTATATGAGTTGAAACAATGCTCCGGATACGT
C2 AACAAAATCGTCCCGACCGTTTATGAGTTGAAACAATGCTCCGGATACGT
C3 AACAAAATCGTCCCGACCGTTTATGAGTTGAAACAATGCTCCGGATACGT
C4 GACGGAGTTATCCCGACCGTATATGAGTTGAAACAGTGCTCCGGATACGT
C5 AACAAAATTGTCCCGACCGTATATGAGTTGTCACAATGCTCCGGATTCGT
.* ..*.* .**********:*********:.***.**********:***
C1 AACTTTGGAACCGGCAAACGGCAAAGACAGAAAGATTACCTGGTACCTAA
C2 ATCTTTGGAACCGCCAAACGGCAAAGACAGGAAGATTACCTGGTACCTAA
C3 ATCTTTGGAACCGCCAAACGGCAAAGACAGGAAGATTACCTGGTACCTCA
C4 GTCTTTGGAACCGCCAAACGGCTCACATAGAAAGGTCACCTGGTACCTGA
C5 TTTTTTGGAGCCGCCGAACGGCAAACAGAGAAGGGTTACCTGGTACCTAA
: ******.*** *.******:.* * **.*.*.* *********** *
C1 AGGTATCCTATGAATTCTTCAAGAAACTTGTCTTTGACGAACCCAAATGT
C2 AGGTATCCTATGAATTCTTCAAGAAACTGGTCTTTGATGAGCCCAAATGT
C3 AGGTATCCTATGAATTCTTCAAGAAAATGGTCTTTGACGAGCCCAAATGT
C4 AGATAACCTATGAATTCTTCAAGAAACTGGTCTTTGACGAACCCAGATGT
C5 AGATATCCTATGAATTCTTCAAGAAACTGGTCTTTGACGAACCCAGATGT
**.**:********************.* ******** **.****.****
C1 CTGCACGGTCTACTGAACAAGTTGGCTGCCACAATCAAACCATTTGCCGA
C2 CTGCACAGTCTACTGACCAAGTTAGGTGCCACAATCAAACCATTTGCCGA
C3 CTGCACAGTCTACTGACCAAGTTAGGTGCCACAATCAAACCATTTGCCGA
C4 CTGCACAGTCTTCTCAACAAGTTGGCTGTTACCATTAAACCATATGCCGA
C5 CTGCACAGTCTTCTGAACAAGTTAGCTTTTACAATCAAACCTTTTGCCGA
******.****:** *.******.* * **.** *****:*:******
C1 GCAGATATCGGGATTAGGTTGCTTGGACGAAGAAGATTATATCATT
C2 GCAGATATCGGGACTAGGTTGCTCGGACGAGGAAGATTATATCATT
C3 GCAGATATCGGGACTGGGTTGCTTGGACGAAGAAGATTATATCATT
C4 GCAGATATCGGCACTAGGTTGCTTGGACGAAGAAGATTATATCATT
C5 ACAGATATCGGTACTAGGTTGCTTGGACGAAGAAGATTATATCATT
.********** * *.******* ******.***************
>C1
ATGAGCGTGATCAAGTCCATATTTCTGCTCAGTATTTTGGCTGTCTGCCT
CATTCCCCGGGAGACGGAGGCCCAGGCCACTATAAGTGAAAGCTGGGGAA
GGCTGGGCAAGTGTACTCAGGTGGCCATCGAAACACTGACCAGCCTGGCC
GATAAAATCGTCCCGACCGTATATGAGTTGAAACAATGCTCCGGATACGT
AACTTTGGAACCGGCAAACGGCAAAGACAGAAAGATTACCTGGTACCTAA
AGGTATCCTATGAATTCTTCAAGAAACTTGTCTTTGACGAACCCAAATGT
CTGCACGGTCTACTGAACAAGTTGGCTGCCACAATCAAACCATTTGCCGA
GCAGATATCGGGATTAGGTTGCTTGGACGAAGAAGATTATATCATT
>C2
ATGAGCGTGATCAAGTCCATATTTGTGCTCAGTATTTTGGCTGTTTGCCT
TATATCACGGGAGACGGAGGCCCAGGCCACTATTGGTGAAAGCTGGGGAA
GGCTGGGCAAGTGTACTCAGGTGGGCATCGAAACTCTGACCAGCCTGGCC
AACAAAATCGTCCCGACCGTTTATGAGTTGAAACAATGCTCCGGATACGT
ATCTTTGGAACCGCCAAACGGCAAAGACAGGAAGATTACCTGGTACCTAA
AGGTATCCTATGAATTCTTCAAGAAACTGGTCTTTGATGAGCCCAAATGT
CTGCACAGTCTACTGACCAAGTTAGGTGCCACAATCAAACCATTTGCCGA
GCAGATATCGGGACTAGGTTGCTCGGACGAGGAAGATTATATCATT
>C3
ATGAGCGTGATCAAGTCCATATTTGTGCTCAGTATTTTGGCTGTCTGCCT
TATTCCCCGGGAGACGGAGGCCCAGGCCACTATTGGTGAAAGCTGGGGAA
GGCTGGGCAAGTGTACTCAGGTGGGCATCGAAACACTGACCAGCCTGGCC
AACAAAATCGTCCCGACCGTTTATGAGTTGAAACAATGCTCCGGATACGT
ATCTTTGGAACCGCCAAACGGCAAAGACAGGAAGATTACCTGGTACCTCA
AGGTATCCTATGAATTCTTCAAGAAAATGGTCTTTGACGAGCCCAAATGT
CTGCACAGTCTACTGACCAAGTTAGGTGCCACAATCAAACCATTTGCCGA
GCAGATATCGGGACTGGGTTGCTTGGACGAAGAAGATTATATCATT
>C4
ATGAGCGGGTTCAAGTCCATATTTCTGCTCAGTTTTTTGGCTGTATTCCT
TATCCCACGGGACACTGAGGCACAGGCCACTTTAAATGAAAGCTGGGGAA
AGCTGGCCAAATGTACTCAGGTGGGCATCGAAACACTGACCACCCTGGCC
GACGGAGTTATCCCGACCGTATATGAGTTGAAACAGTGCTCCGGATACGT
GTCTTTGGAACCGCCAAACGGCTCACATAGAAAGGTCACCTGGTACCTGA
AGATAACCTATGAATTCTTCAAGAAACTGGTCTTTGACGAACCCAGATGT
CTGCACAGTCTTCTCAACAAGTTGGCTGTTACCATTAAACCATATGCCGA
GCAGATATCGGCACTAGGTTGCTTGGACGAAGAAGATTATATCATT
>C5
ATGAGCGGGATGAAGTCCGTATTTTTGCTCAGTTTTTTGGCTGTCTTGCT
TATCCCCCGAGAAACTGTGGCGCAGGCCACTATAAGTGAAACCTGGAGTA
AGCTGGGAAAATGTACTCATGTGGGCATCCAAACACTGACCACCCTGGCC
AACAAAATTGTCCCGACCGTATATGAGTTGTCACAATGCTCCGGATTCGT
TTTTTTGGAGCCGCCGAACGGCAAACAGAGAAGGGTTACCTGGTACCTAA
AGATATCCTATGAATTCTTCAAGAAACTGGTCTTTGACGAACCCAGATGT
CTGCACAGTCTTCTGAACAAGTTAGCTTTTACAATCAAACCTTTTGCCGA
ACAGATATCGGTACTAGGTTGCTTGGACGAAGAAGATTATATCATT
>C1
MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLA
DKIVPTVYELKQCSGYVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKC
LHGLLNKLAATIKPFAEQISGLGCLDEEDYII
>C2
MSVIKSIFVLSILAVCLISRETEAQATIGESWGRLGKCTQVGIETLTSLA
NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKLVFDEPKC
LHSLLTKLGATIKPFAEQISGLGCSDEEDYII
>C3
MSVIKSIFVLSILAVCLIPRETEAQATIGESWGRLGKCTQVGIETLTSLA
NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKMVFDEPKC
LHSLLTKLGATIKPFAEQISGLGCLDEEDYII
>C4
MSGFKSIFLLSFLAVFLIPRDTEAQATLNESWGKLAKCTQVGIETLTTLA
DGVIPTVYELKQCSGYVSLEPPNGSHRKVTWYLKITYEFFKKLVFDEPRC
LHSLLNKLAVTIKPYAEQISALGCLDEEDYII
>C5
MSGMKSVFLLSFLAVLLIPRETVAQATISETWSKLGKCTHVGIQTLTTLA
NKIVPTVYELSQCSGFVFLEPPNGKQRRVTWYLKISYEFFKKLVFDEPRC
LHSLLNKLAFTIKPFAEQISVLGCLDEEDYII
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 396 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479795965
Setting output file names to "/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1625845819
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4195242839
Seed = 72608787
Swapseed = 1479795965
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 26 unique site patterns
Division 2 has 25 unique site patterns
Division 3 has 37 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1220.215584 -- -25.624409
Chain 2 -- -1210.332956 -- -25.624409
Chain 3 -- -1220.215584 -- -25.624409
Chain 4 -- -1209.302739 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1213.642290 -- -25.624409
Chain 2 -- -1159.811709 -- -25.624409
Chain 3 -- -1185.312220 -- -25.624409
Chain 4 -- -1220.215584 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1220.216] (-1210.333) (-1220.216) (-1209.303) * [-1213.642] (-1159.812) (-1185.312) (-1220.216)
500 -- [-1053.550] (-1060.155) (-1056.100) (-1065.674) * (-1058.634) (-1060.842) [-1057.642] (-1056.890) -- 0:00:00
1000 -- (-1054.126) (-1060.162) (-1057.491) [-1054.417] * (-1057.206) (-1059.704) [-1053.406] (-1061.123) -- 0:00:00
1500 -- (-1053.320) (-1057.179) [-1051.824] (-1054.830) * [-1060.779] (-1055.514) (-1055.258) (-1054.112) -- 0:00:00
2000 -- [-1053.366] (-1055.653) (-1051.872) (-1054.820) * (-1056.199) (-1055.972) (-1053.541) [-1051.582] -- 0:00:00
2500 -- (-1052.526) (-1060.975) [-1052.219] (-1059.499) * (-1067.435) (-1054.896) (-1052.110) [-1053.386] -- 0:00:00
3000 -- (-1056.468) [-1056.131] (-1053.158) (-1054.279) * (-1057.891) [-1051.060] (-1054.009) (-1059.409) -- 0:00:00
3500 -- (-1054.326) (-1053.182) (-1055.446) [-1053.112] * (-1056.766) (-1060.609) (-1059.775) [-1052.802] -- 0:00:00
4000 -- [-1051.548] (-1053.951) (-1056.040) (-1057.311) * [-1056.965] (-1056.086) (-1059.633) (-1052.777) -- 0:00:00
4500 -- (-1053.412) (-1066.126) [-1060.103] (-1053.738) * (-1059.641) (-1053.672) (-1052.252) [-1056.367] -- 0:00:00
5000 -- (-1059.841) (-1051.605) (-1055.585) [-1060.351] * (-1052.401) (-1051.181) [-1057.151] (-1059.422) -- 0:00:00
Average standard deviation of split frequencies: 0.000000
5500 -- [-1056.409] (-1053.544) (-1057.365) (-1054.110) * (-1055.013) (-1052.311) [-1054.121] (-1054.857) -- 0:03:00
6000 -- (-1053.974) (-1063.478) [-1056.985] (-1056.082) * (-1059.198) (-1058.314) [-1056.589] (-1057.899) -- 0:02:45
6500 -- (-1056.506) (-1051.583) (-1054.942) [-1053.393] * (-1050.802) (-1054.227) (-1053.303) [-1054.692] -- 0:02:32
7000 -- (-1050.145) (-1053.561) (-1060.351) [-1053.677] * (-1055.628) [-1058.405] (-1051.858) (-1058.845) -- 0:02:21
7500 -- (-1054.486) (-1058.596) [-1058.013] (-1058.690) * (-1055.818) (-1066.137) [-1057.413] (-1054.956) -- 0:02:12
8000 -- [-1049.737] (-1053.493) (-1061.236) (-1055.308) * (-1062.228) (-1057.435) (-1054.291) [-1054.087] -- 0:02:04
8500 -- [-1049.645] (-1051.342) (-1052.619) (-1056.652) * (-1053.848) (-1058.340) [-1063.288] (-1056.219) -- 0:01:56
9000 -- (-1054.285) (-1055.029) (-1052.514) [-1050.696] * [-1055.926] (-1057.545) (-1065.257) (-1060.726) -- 0:01:50
9500 -- (-1053.255) (-1053.807) (-1055.291) [-1052.230] * (-1054.748) [-1057.904] (-1056.762) (-1053.553) -- 0:01:44
10000 -- (-1058.198) [-1054.419] (-1052.756) (-1052.573) * (-1058.267) (-1053.419) (-1057.376) [-1054.362] -- 0:01:39
Average standard deviation of split frequencies: 0.000000
10500 -- (-1052.641) (-1058.435) [-1053.540] (-1055.684) * (-1055.815) [-1055.930] (-1055.986) (-1058.409) -- 0:01:34
11000 -- [-1057.513] (-1053.248) (-1051.928) (-1051.737) * (-1051.781) [-1050.726] (-1059.246) (-1057.159) -- 0:01:29
11500 -- (-1053.757) (-1057.518) (-1060.339) [-1054.007] * (-1054.009) [-1051.487] (-1057.784) (-1061.744) -- 0:02:51
12000 -- [-1053.421] (-1053.101) (-1053.658) (-1054.704) * (-1054.939) [-1059.617] (-1057.783) (-1054.898) -- 0:02:44
12500 -- (-1050.183) [-1050.412] (-1059.635) (-1056.255) * [-1054.738] (-1057.084) (-1061.102) (-1062.568) -- 0:02:38
13000 -- (-1052.806) (-1055.743) (-1053.332) [-1056.642] * (-1051.255) (-1052.947) (-1061.903) [-1055.570] -- 0:02:31
13500 -- (-1052.943) [-1052.738] (-1055.753) (-1062.100) * (-1049.448) [-1051.766] (-1056.864) (-1053.040) -- 0:02:26
14000 -- (-1056.008) (-1054.901) (-1057.084) [-1054.312] * (-1055.424) (-1058.083) [-1056.952] (-1055.853) -- 0:02:20
14500 -- (-1054.673) [-1051.803] (-1057.409) (-1056.955) * (-1055.498) (-1059.412) (-1053.796) [-1055.849] -- 0:02:15
15000 -- [-1058.000] (-1057.165) (-1059.635) (-1049.269) * [-1050.352] (-1054.678) (-1054.241) (-1060.251) -- 0:02:11
Average standard deviation of split frequencies: 0.000000
15500 -- (-1055.547) [-1051.666] (-1061.461) (-1054.077) * [-1055.712] (-1066.775) (-1052.313) (-1059.512) -- 0:02:07
16000 -- (-1050.979) (-1054.009) (-1055.301) [-1050.536] * (-1047.748) (-1059.421) [-1053.989] (-1056.332) -- 0:02:03
16500 -- [-1050.295] (-1063.048) (-1053.841) (-1056.756) * (-1050.324) [-1058.093] (-1051.465) (-1056.014) -- 0:01:59
17000 -- (-1050.399) (-1055.900) [-1054.408] (-1058.100) * (-1049.607) (-1063.372) [-1052.986] (-1065.523) -- 0:01:55
17500 -- [-1052.612] (-1053.385) (-1052.542) (-1054.711) * (-1053.401) (-1059.248) (-1053.962) [-1058.008] -- 0:01:52
18000 -- (-1054.913) [-1055.239] (-1058.990) (-1061.225) * (-1052.140) (-1053.806) (-1051.916) [-1057.918] -- 0:02:43
18500 -- (-1051.990) (-1053.701) (-1051.253) [-1052.417] * [-1058.815] (-1053.560) (-1056.779) (-1053.722) -- 0:02:39
19000 -- [-1051.702] (-1053.766) (-1058.276) (-1055.978) * [-1053.828] (-1051.763) (-1054.745) (-1057.767) -- 0:02:34
19500 -- (-1054.494) (-1057.887) [-1051.548] (-1051.714) * (-1060.236) (-1056.395) [-1052.278] (-1054.004) -- 0:02:30
20000 -- [-1054.084] (-1058.272) (-1055.382) (-1053.416) * (-1049.351) [-1054.051] (-1060.800) (-1051.100) -- 0:02:27
Average standard deviation of split frequencies: 0.000000
20500 -- (-1054.967) (-1061.622) [-1061.828] (-1054.974) * (-1050.347) [-1053.104] (-1061.267) (-1050.780) -- 0:02:23
21000 -- [-1053.238] (-1063.431) (-1058.078) (-1063.757) * (-1056.642) (-1050.594) [-1055.052] (-1051.465) -- 0:02:19
21500 -- (-1059.443) [-1052.517] (-1067.742) (-1052.105) * (-1060.669) [-1050.989] (-1056.469) (-1054.297) -- 0:02:16
22000 -- (-1059.134) [-1052.691] (-1055.708) (-1056.647) * [-1059.132] (-1056.324) (-1056.433) (-1068.852) -- 0:02:13
22500 -- (-1054.918) (-1052.743) [-1060.438] (-1053.999) * (-1056.579) [-1056.257] (-1057.225) (-1067.393) -- 0:02:10
23000 -- [-1048.855] (-1056.336) (-1055.641) (-1055.950) * (-1057.151) (-1052.592) [-1058.859] (-1061.403) -- 0:02:07
23500 -- [-1051.356] (-1054.931) (-1057.466) (-1053.834) * (-1061.312) (-1053.626) (-1053.178) [-1058.377] -- 0:02:04
24000 -- [-1052.285] (-1056.505) (-1056.593) (-1052.549) * (-1054.623) (-1057.403) (-1052.071) [-1053.818] -- 0:02:42
24500 -- (-1055.104) (-1056.063) (-1057.396) [-1056.244] * [-1055.780] (-1051.341) (-1055.774) (-1056.131) -- 0:02:39
25000 -- (-1051.771) (-1053.522) [-1053.584] (-1057.300) * (-1055.742) (-1056.374) [-1052.027] (-1057.137) -- 0:02:36
Average standard deviation of split frequencies: 0.000000
25500 -- [-1054.148] (-1060.384) (-1055.962) (-1056.865) * [-1054.200] (-1052.309) (-1055.196) (-1057.753) -- 0:02:32
26000 -- [-1056.538] (-1060.116) (-1054.033) (-1053.147) * (-1065.856) [-1053.723] (-1056.459) (-1057.171) -- 0:02:29
26500 -- (-1058.060) (-1054.574) [-1059.349] (-1051.954) * (-1061.389) (-1055.972) (-1054.340) [-1052.045] -- 0:02:26
27000 -- [-1055.098] (-1056.010) (-1054.981) (-1054.121) * (-1052.999) (-1053.304) [-1055.655] (-1060.154) -- 0:02:24
27500 -- (-1054.468) (-1051.490) [-1055.097] (-1055.461) * (-1054.908) [-1055.114] (-1052.575) (-1061.860) -- 0:02:21
28000 -- (-1053.398) (-1056.677) (-1055.038) [-1053.923] * (-1055.153) (-1059.271) [-1050.710] (-1060.585) -- 0:02:18
28500 -- [-1051.146] (-1051.013) (-1055.702) (-1055.215) * [-1056.490] (-1060.851) (-1055.346) (-1057.171) -- 0:02:16
29000 -- (-1054.105) (-1065.439) (-1055.040) [-1055.957] * (-1056.536) (-1063.392) (-1053.249) [-1055.354] -- 0:02:13
29500 -- (-1055.317) (-1061.953) (-1057.118) [-1053.591] * (-1054.815) (-1057.339) (-1055.287) [-1052.656] -- 0:02:11
30000 -- [-1052.315] (-1057.800) (-1053.111) (-1053.630) * (-1058.761) (-1056.059) [-1057.116] (-1052.640) -- 0:02:41
Average standard deviation of split frequencies: 0.000000
30500 -- (-1066.905) (-1053.131) [-1053.894] (-1050.037) * (-1061.063) [-1055.180] (-1056.277) (-1050.680) -- 0:02:38
31000 -- (-1057.646) [-1050.831] (-1055.281) (-1060.282) * (-1062.125) (-1059.263) [-1051.188] (-1057.153) -- 0:02:36
31500 -- (-1060.083) (-1060.773) (-1053.836) [-1053.256] * (-1055.285) (-1055.871) (-1056.932) [-1055.015] -- 0:02:33
32000 -- (-1055.598) (-1057.507) [-1054.739] (-1058.932) * (-1053.286) [-1049.390] (-1059.732) (-1056.251) -- 0:02:31
32500 -- (-1055.547) [-1052.562] (-1061.163) (-1053.631) * [-1055.496] (-1052.758) (-1057.659) (-1062.471) -- 0:02:28
33000 -- (-1055.541) (-1060.330) (-1059.317) [-1053.148] * (-1054.573) (-1052.093) (-1055.402) [-1055.599] -- 0:02:26
33500 -- (-1054.962) (-1052.847) [-1061.113] (-1052.720) * (-1055.332) (-1056.651) [-1054.100] (-1053.899) -- 0:02:24
34000 -- (-1058.046) [-1055.160] (-1056.946) (-1053.756) * (-1054.035) (-1059.570) [-1053.164] (-1054.378) -- 0:02:22
34500 -- [-1054.481] (-1058.559) (-1056.664) (-1055.731) * (-1055.079) [-1055.455] (-1058.428) (-1051.018) -- 0:02:19
35000 -- (-1051.447) [-1052.233] (-1059.498) (-1054.141) * (-1057.753) (-1056.186) (-1056.372) [-1052.615] -- 0:02:17
Average standard deviation of split frequencies: 0.000000
35500 -- (-1054.097) (-1056.824) [-1058.484] (-1064.310) * (-1054.635) (-1056.276) [-1056.883] (-1058.918) -- 0:02:15
36000 -- (-1051.646) (-1052.353) (-1058.618) [-1057.008] * (-1055.031) (-1059.696) (-1053.088) [-1055.588] -- 0:02:40
36500 -- (-1053.556) (-1053.775) (-1059.353) [-1055.815] * [-1054.185] (-1053.644) (-1052.026) (-1050.553) -- 0:02:38
37000 -- (-1056.784) (-1058.131) [-1055.376] (-1053.934) * [-1051.746] (-1053.521) (-1055.125) (-1055.657) -- 0:02:36
37500 -- (-1059.136) (-1057.905) (-1056.682) [-1051.506] * [-1053.167] (-1052.791) (-1062.292) (-1050.356) -- 0:02:34
38000 -- (-1053.959) [-1059.831] (-1052.839) (-1056.601) * (-1057.350) (-1056.837) (-1055.393) [-1052.448] -- 0:02:31
38500 -- (-1055.521) [-1054.262] (-1054.486) (-1052.103) * (-1052.051) [-1058.335] (-1058.979) (-1056.075) -- 0:02:29
39000 -- (-1051.733) (-1056.349) (-1056.868) [-1050.862] * [-1051.736] (-1054.236) (-1053.375) (-1051.237) -- 0:02:27
39500 -- (-1054.806) [-1052.516] (-1054.869) (-1053.978) * (-1052.865) [-1057.612] (-1056.345) (-1054.836) -- 0:02:25
40000 -- [-1056.361] (-1055.208) (-1053.683) (-1051.955) * (-1054.270) [-1055.639] (-1056.833) (-1051.786) -- 0:02:24
Average standard deviation of split frequencies: 0.000000
40500 -- (-1058.477) (-1057.833) [-1051.769] (-1051.696) * (-1060.247) (-1052.655) (-1056.609) [-1056.991] -- 0:02:22
41000 -- (-1054.848) (-1056.213) (-1049.731) [-1053.007] * (-1049.258) (-1051.598) [-1055.907] (-1059.453) -- 0:02:20
41500 -- (-1050.923) (-1054.465) [-1050.924] (-1053.813) * (-1057.191) (-1054.193) (-1052.907) [-1054.141] -- 0:02:18
42000 -- (-1055.929) (-1060.186) [-1049.819] (-1051.793) * (-1051.603) [-1053.965] (-1055.880) (-1054.802) -- 0:02:39
42500 -- [-1050.650] (-1060.158) (-1057.653) (-1056.457) * [-1052.466] (-1051.663) (-1056.076) (-1051.964) -- 0:02:37
43000 -- (-1054.476) (-1062.665) [-1054.722] (-1056.641) * (-1057.921) [-1053.907] (-1057.621) (-1053.835) -- 0:02:35
43500 -- [-1053.900] (-1058.572) (-1053.060) (-1055.176) * (-1055.847) (-1055.166) (-1053.184) [-1057.279] -- 0:02:33
44000 -- (-1053.261) (-1055.132) (-1055.579) [-1050.304] * (-1053.947) [-1055.909] (-1052.497) (-1059.265) -- 0:02:32
44500 -- (-1054.930) (-1055.236) (-1054.409) [-1054.924] * (-1062.460) (-1051.243) [-1048.729] (-1052.111) -- 0:02:30
45000 -- (-1056.529) (-1056.530) (-1052.779) [-1053.019] * (-1054.176) (-1054.774) [-1052.326] (-1056.529) -- 0:02:28
Average standard deviation of split frequencies: 0.000000
45500 -- [-1056.636] (-1057.205) (-1056.210) (-1055.073) * (-1053.848) [-1054.014] (-1050.801) (-1056.328) -- 0:02:26
46000 -- [-1056.857] (-1057.669) (-1057.732) (-1054.964) * (-1051.008) (-1056.354) (-1053.999) [-1056.301] -- 0:02:25
46500 -- (-1052.666) [-1053.630] (-1055.423) (-1056.358) * (-1055.288) (-1057.393) (-1056.944) [-1053.873] -- 0:02:23
47000 -- (-1054.033) (-1056.028) [-1052.766] (-1054.828) * [-1056.203] (-1058.064) (-1057.581) (-1050.447) -- 0:02:21
47500 -- (-1052.660) (-1056.894) [-1056.262] (-1051.148) * (-1052.372) (-1053.360) (-1055.428) [-1051.134] -- 0:02:20
48000 -- (-1049.686) [-1053.090] (-1054.166) (-1051.728) * (-1055.802) [-1050.570] (-1060.348) (-1049.490) -- 0:02:38
48500 -- [-1054.356] (-1053.663) (-1055.885) (-1054.479) * (-1055.305) (-1056.454) [-1057.042] (-1051.399) -- 0:02:36
49000 -- (-1056.559) [-1053.069] (-1059.768) (-1057.690) * (-1053.719) (-1056.418) (-1052.182) [-1055.199] -- 0:02:35
49500 -- [-1059.673] (-1054.936) (-1053.561) (-1064.815) * [-1057.707] (-1057.455) (-1056.260) (-1056.714) -- 0:02:33
50000 -- (-1054.456) (-1056.073) (-1056.610) [-1052.170] * (-1057.232) [-1051.384] (-1051.570) (-1053.255) -- 0:02:32
Average standard deviation of split frequencies: 0.000000
50500 -- (-1059.349) (-1054.585) (-1054.500) [-1059.704] * [-1054.287] (-1058.847) (-1053.589) (-1051.936) -- 0:02:30
51000 -- (-1055.459) (-1053.587) [-1052.368] (-1054.137) * (-1056.618) [-1053.476] (-1054.835) (-1057.203) -- 0:02:28
51500 -- (-1058.877) (-1055.861) (-1054.155) [-1052.981] * (-1053.577) (-1056.609) (-1056.848) [-1055.581] -- 0:02:27
52000 -- (-1057.824) [-1053.856] (-1056.483) (-1055.411) * (-1061.462) (-1059.769) (-1056.692) [-1057.153] -- 0:02:25
52500 -- [-1059.484] (-1063.458) (-1055.649) (-1056.145) * [-1052.492] (-1053.923) (-1059.147) (-1055.706) -- 0:02:24
53000 -- (-1054.026) (-1057.769) [-1055.968] (-1054.743) * (-1052.063) [-1053.352] (-1067.585) (-1054.025) -- 0:02:22
53500 -- (-1053.737) [-1060.954] (-1061.244) (-1052.224) * (-1052.297) (-1053.864) [-1058.257] (-1053.866) -- 0:02:21
54000 -- [-1055.508] (-1054.784) (-1056.009) (-1055.330) * [-1055.697] (-1058.031) (-1055.510) (-1054.668) -- 0:02:37
54500 -- (-1053.007) (-1057.741) (-1063.427) [-1058.541] * (-1056.354) (-1058.424) [-1053.960] (-1055.899) -- 0:02:36
55000 -- (-1056.436) [-1055.266] (-1063.926) (-1074.865) * (-1058.151) [-1059.916] (-1054.123) (-1050.977) -- 0:02:34
Average standard deviation of split frequencies: 0.000000
55500 -- (-1060.280) (-1059.757) [-1057.516] (-1060.418) * [-1053.797] (-1059.054) (-1056.202) (-1051.485) -- 0:02:33
56000 -- (-1057.346) (-1058.263) [-1058.038] (-1059.888) * [-1057.344] (-1064.255) (-1051.574) (-1054.817) -- 0:02:31
56500 -- (-1054.388) (-1054.882) (-1064.221) [-1056.842] * (-1057.815) (-1060.544) (-1049.758) [-1055.695] -- 0:02:30
57000 -- (-1054.539) (-1062.637) [-1052.006] (-1065.916) * (-1054.492) (-1059.246) [-1051.931] (-1064.264) -- 0:02:28
57500 -- [-1052.928] (-1057.141) (-1052.082) (-1059.829) * (-1051.977) [-1054.260] (-1056.737) (-1054.679) -- 0:02:27
58000 -- (-1053.524) (-1054.855) [-1055.900] (-1057.860) * (-1054.938) (-1053.394) [-1056.653] (-1059.849) -- 0:02:26
58500 -- (-1055.168) (-1061.510) [-1051.321] (-1057.968) * (-1055.386) (-1055.558) (-1056.573) [-1061.680] -- 0:02:24
59000 -- [-1058.056] (-1052.519) (-1055.739) (-1060.807) * (-1052.018) [-1053.162] (-1055.959) (-1059.708) -- 0:02:23
59500 -- (-1056.120) (-1051.871) [-1051.166] (-1055.751) * (-1053.033) [-1052.368] (-1058.719) (-1065.658) -- 0:02:22
60000 -- (-1060.912) [-1053.784] (-1055.326) (-1054.857) * [-1056.057] (-1052.919) (-1054.198) (-1054.891) -- 0:02:21
Average standard deviation of split frequencies: 0.000000
60500 -- (-1053.413) [-1053.346] (-1062.464) (-1055.129) * (-1061.880) (-1055.999) [-1057.081] (-1056.969) -- 0:02:35
61000 -- (-1058.403) [-1053.761] (-1058.573) (-1054.316) * (-1054.810) [-1059.971] (-1055.416) (-1058.516) -- 0:02:33
61500 -- [-1051.093] (-1054.473) (-1056.704) (-1055.856) * (-1068.535) [-1051.812] (-1062.716) (-1061.962) -- 0:02:32
62000 -- (-1057.424) (-1057.571) (-1055.445) [-1056.551] * (-1062.702) (-1055.691) [-1055.112] (-1056.670) -- 0:02:31
62500 -- (-1055.833) [-1061.444] (-1054.094) (-1056.287) * (-1057.655) (-1058.212) (-1060.594) [-1061.734] -- 0:02:30
63000 -- [-1053.823] (-1057.539) (-1052.430) (-1056.284) * (-1062.261) (-1060.287) (-1059.747) [-1055.180] -- 0:02:28
63500 -- (-1057.222) (-1052.250) [-1054.484] (-1054.073) * (-1057.384) (-1066.645) [-1060.211] (-1055.388) -- 0:02:27
64000 -- (-1053.400) [-1057.143] (-1051.440) (-1056.923) * [-1060.629] (-1057.474) (-1061.107) (-1054.751) -- 0:02:26
64500 -- (-1052.932) (-1056.433) (-1058.968) [-1057.405] * [-1055.658] (-1068.976) (-1057.276) (-1062.744) -- 0:02:25
65000 -- (-1050.674) (-1053.398) (-1054.528) [-1056.726] * [-1053.306] (-1061.228) (-1060.954) (-1063.141) -- 0:02:23
Average standard deviation of split frequencies: 0.000000
65500 -- [-1055.162] (-1053.556) (-1057.865) (-1058.415) * (-1055.101) (-1059.134) (-1057.746) [-1059.528] -- 0:02:22
66000 -- [-1057.354] (-1056.733) (-1058.682) (-1055.039) * (-1052.564) [-1054.914] (-1057.781) (-1056.584) -- 0:02:21
66500 -- (-1059.997) (-1055.908) (-1066.456) [-1056.420] * (-1053.903) (-1051.917) [-1057.600] (-1062.630) -- 0:02:34
67000 -- [-1059.710] (-1056.962) (-1053.457) (-1052.875) * (-1057.486) (-1055.591) [-1054.058] (-1056.069) -- 0:02:33
67500 -- [-1055.692] (-1057.115) (-1052.744) (-1059.999) * (-1058.461) [-1053.820] (-1061.971) (-1054.698) -- 0:02:31
68000 -- [-1053.783] (-1055.260) (-1054.455) (-1050.858) * (-1056.408) (-1056.858) [-1062.650] (-1049.800) -- 0:02:30
68500 -- (-1055.775) (-1059.410) [-1051.758] (-1063.988) * (-1051.229) (-1054.544) (-1055.459) [-1052.106] -- 0:02:29
69000 -- (-1056.315) (-1054.978) (-1055.282) [-1056.839] * [-1056.553] (-1057.218) (-1055.841) (-1060.348) -- 0:02:28
69500 -- (-1055.881) (-1058.962) [-1053.344] (-1060.587) * [-1053.181] (-1056.344) (-1054.681) (-1054.644) -- 0:02:27
70000 -- [-1051.767] (-1058.060) (-1053.313) (-1056.061) * [-1060.101] (-1052.854) (-1057.147) (-1055.465) -- 0:02:26
Average standard deviation of split frequencies: 0.000000
70500 -- (-1059.506) (-1052.695) (-1052.711) [-1051.404] * [-1052.149] (-1056.686) (-1067.490) (-1056.245) -- 0:02:25
71000 -- [-1054.643] (-1054.935) (-1054.265) (-1054.096) * [-1054.592] (-1054.506) (-1065.582) (-1052.218) -- 0:02:23
71500 -- (-1053.141) (-1056.883) (-1055.711) [-1052.742] * [-1056.273] (-1053.874) (-1064.711) (-1051.744) -- 0:02:22
72000 -- (-1052.232) (-1062.365) [-1054.355] (-1053.995) * [-1056.043] (-1049.943) (-1057.898) (-1053.068) -- 0:02:21
72500 -- (-1051.629) (-1057.236) (-1054.216) [-1057.153] * (-1059.072) [-1053.680] (-1053.997) (-1055.588) -- 0:02:20
73000 -- (-1053.037) [-1057.470] (-1055.653) (-1053.837) * [-1053.195] (-1060.347) (-1053.451) (-1056.587) -- 0:02:32
73500 -- [-1052.512] (-1054.833) (-1055.161) (-1054.834) * (-1057.937) (-1058.929) [-1055.649] (-1054.417) -- 0:02:31
74000 -- (-1053.170) (-1053.831) (-1057.364) [-1053.593] * (-1060.833) [-1052.164] (-1054.620) (-1057.987) -- 0:02:30
74500 -- (-1052.097) [-1051.254] (-1056.189) (-1051.701) * (-1063.127) (-1057.531) (-1056.814) [-1055.968] -- 0:02:29
75000 -- (-1056.449) (-1054.210) (-1054.974) [-1052.306] * (-1057.527) [-1051.211] (-1057.434) (-1060.128) -- 0:02:28
Average standard deviation of split frequencies: 0.000000
75500 -- (-1053.966) (-1057.136) (-1053.416) [-1054.670] * (-1057.753) [-1051.929] (-1058.115) (-1059.393) -- 0:02:26
76000 -- (-1058.970) (-1053.499) [-1054.556] (-1058.555) * (-1054.471) [-1049.705] (-1053.449) (-1059.033) -- 0:02:25
76500 -- (-1055.376) (-1058.250) (-1056.036) [-1057.747] * (-1060.699) [-1055.597] (-1055.644) (-1054.124) -- 0:02:24
77000 -- (-1051.760) [-1050.245] (-1052.372) (-1058.275) * (-1057.288) [-1054.188] (-1060.751) (-1058.284) -- 0:02:23
77500 -- (-1056.284) [-1050.933] (-1055.077) (-1062.718) * (-1053.310) (-1055.447) [-1057.161] (-1063.270) -- 0:02:22
78000 -- (-1055.968) (-1055.964) [-1058.602] (-1066.578) * (-1055.411) (-1052.690) (-1062.804) [-1052.722] -- 0:02:21
78500 -- (-1056.956) [-1060.516] (-1057.379) (-1055.296) * [-1051.508] (-1054.711) (-1058.480) (-1059.182) -- 0:02:20
79000 -- (-1055.495) (-1059.519) [-1058.689] (-1055.549) * (-1054.988) (-1054.205) (-1060.267) [-1052.819] -- 0:02:31
79500 -- (-1053.120) (-1055.224) [-1061.779] (-1055.208) * (-1058.648) (-1049.974) (-1056.657) [-1052.163] -- 0:02:30
80000 -- [-1055.501] (-1051.481) (-1065.591) (-1051.712) * [-1057.987] (-1051.712) (-1059.176) (-1054.773) -- 0:02:29
Average standard deviation of split frequencies: 0.000000
80500 -- (-1058.290) (-1058.382) (-1063.830) [-1055.255] * (-1053.529) (-1052.156) (-1059.975) [-1054.977] -- 0:02:28
81000 -- (-1056.507) [-1052.175] (-1057.013) (-1049.904) * [-1057.595] (-1055.804) (-1056.198) (-1058.003) -- 0:02:27
81500 -- (-1055.638) (-1057.144) (-1058.907) [-1051.784] * (-1062.706) (-1061.190) [-1052.038] (-1066.206) -- 0:02:26
82000 -- (-1055.599) (-1050.866) [-1056.080] (-1057.174) * (-1060.221) (-1052.595) (-1052.896) [-1056.353] -- 0:02:25
82500 -- [-1057.355] (-1052.186) (-1057.096) (-1056.241) * (-1056.488) (-1053.976) (-1052.363) [-1052.484] -- 0:02:24
83000 -- (-1057.623) (-1054.311) (-1055.577) [-1054.482] * (-1061.469) (-1058.139) [-1054.869] (-1053.436) -- 0:02:23
83500 -- (-1059.196) (-1056.249) (-1055.854) [-1057.620] * (-1061.302) [-1058.000] (-1059.130) (-1052.851) -- 0:02:22
84000 -- (-1062.386) (-1055.568) [-1052.834] (-1055.669) * [-1055.783] (-1051.716) (-1057.213) (-1051.835) -- 0:02:21
84500 -- [-1054.817] (-1067.988) (-1054.798) (-1058.345) * (-1061.613) (-1057.376) [-1048.756] (-1056.111) -- 0:02:20
85000 -- (-1057.487) (-1055.950) [-1058.005] (-1057.897) * (-1054.041) (-1051.069) [-1054.979] (-1051.835) -- 0:02:30
Average standard deviation of split frequencies: 0.000000
85500 -- (-1057.977) (-1052.127) (-1053.710) [-1056.090] * (-1049.924) (-1055.628) [-1055.660] (-1051.538) -- 0:02:29
86000 -- (-1057.629) [-1053.063] (-1054.935) (-1057.834) * (-1057.935) (-1055.131) [-1052.659] (-1052.468) -- 0:02:28
86500 -- (-1068.496) [-1055.975] (-1057.592) (-1058.453) * (-1052.025) (-1056.747) (-1055.248) [-1054.104] -- 0:02:27
87000 -- (-1063.390) [-1055.626] (-1052.391) (-1062.856) * (-1057.833) (-1059.186) [-1055.501] (-1059.926) -- 0:02:26
87500 -- [-1060.444] (-1061.306) (-1061.278) (-1066.470) * (-1054.940) [-1059.886] (-1052.925) (-1058.766) -- 0:02:26
88000 -- [-1057.675] (-1057.548) (-1053.420) (-1062.060) * (-1059.569) (-1056.856) [-1053.533] (-1057.008) -- 0:02:25
88500 -- (-1060.876) (-1054.379) [-1052.613] (-1057.482) * (-1055.457) [-1051.508] (-1059.615) (-1053.265) -- 0:02:24
89000 -- [-1052.324] (-1058.159) (-1056.665) (-1054.361) * [-1052.923] (-1054.499) (-1050.436) (-1056.473) -- 0:02:23
89500 -- (-1050.241) [-1058.811] (-1051.546) (-1054.507) * (-1054.110) [-1053.553] (-1054.904) (-1054.907) -- 0:02:22
90000 -- (-1051.707) (-1061.215) [-1051.741] (-1052.604) * (-1054.276) (-1052.498) [-1054.235] (-1058.670) -- 0:02:21
Average standard deviation of split frequencies: 0.000000
90500 -- (-1056.059) [-1054.113] (-1050.024) (-1054.396) * (-1057.175) (-1055.625) [-1052.881] (-1062.610) -- 0:02:20
91000 -- (-1051.882) (-1061.541) (-1051.628) [-1055.037] * [-1054.104] (-1055.151) (-1052.481) (-1053.239) -- 0:02:29
91500 -- [-1050.333] (-1054.453) (-1053.777) (-1059.351) * (-1056.390) [-1052.013] (-1053.523) (-1052.476) -- 0:02:28
92000 -- (-1059.399) (-1058.585) [-1056.036] (-1055.726) * (-1054.758) [-1059.047] (-1050.374) (-1060.429) -- 0:02:28
92500 -- (-1055.306) (-1062.750) [-1052.092] (-1056.041) * (-1061.147) (-1059.007) [-1049.442] (-1054.778) -- 0:02:27
93000 -- (-1060.274) [-1056.824] (-1054.017) (-1051.115) * (-1056.656) (-1052.664) (-1053.801) [-1055.065] -- 0:02:26
93500 -- (-1056.997) (-1057.492) [-1054.812] (-1054.216) * (-1056.004) (-1056.111) [-1050.942] (-1051.102) -- 0:02:25
94000 -- (-1054.434) (-1056.680) [-1052.669] (-1061.852) * (-1049.807) (-1055.029) [-1059.722] (-1050.606) -- 0:02:24
94500 -- (-1063.385) (-1066.554) [-1053.338] (-1058.193) * (-1056.070) (-1051.582) (-1053.855) [-1050.900] -- 0:02:23
95000 -- (-1057.203) (-1054.275) [-1064.650] (-1060.190) * (-1059.091) (-1055.003) [-1053.283] (-1056.433) -- 0:02:22
Average standard deviation of split frequencies: 0.000000
95500 -- (-1062.178) (-1055.033) [-1062.596] (-1057.219) * (-1054.227) [-1058.466] (-1057.167) (-1052.931) -- 0:02:22
96000 -- (-1064.113) (-1054.397) (-1056.204) [-1054.975] * (-1054.797) (-1054.541) [-1050.106] (-1055.315) -- 0:02:21
96500 -- [-1061.640] (-1052.121) (-1058.567) (-1055.528) * [-1051.208] (-1052.917) (-1052.645) (-1059.056) -- 0:02:20
97000 -- (-1055.079) (-1052.761) [-1054.040] (-1063.432) * (-1053.754) (-1055.099) [-1056.062] (-1071.197) -- 0:02:28
97500 -- (-1051.053) (-1054.225) (-1054.688) [-1059.520] * (-1053.311) [-1054.739] (-1054.730) (-1059.533) -- 0:02:28
98000 -- (-1052.947) [-1056.688] (-1057.997) (-1052.728) * (-1060.546) [-1057.576] (-1051.594) (-1060.882) -- 0:02:27
98500 -- (-1055.132) (-1055.331) (-1058.912) [-1055.860] * (-1059.597) [-1057.760] (-1052.140) (-1054.214) -- 0:02:26
99000 -- (-1063.343) (-1056.891) [-1053.992] (-1055.784) * (-1059.106) (-1056.177) [-1053.281] (-1057.464) -- 0:02:25
99500 -- (-1052.350) [-1052.438] (-1056.154) (-1060.195) * [-1053.891] (-1060.070) (-1052.159) (-1057.242) -- 0:02:24
100000 -- (-1054.267) [-1051.169] (-1062.122) (-1055.044) * (-1059.899) [-1054.376] (-1054.655) (-1053.839) -- 0:02:24
Average standard deviation of split frequencies: 0.000000
100500 -- (-1059.223) (-1059.199) (-1059.084) [-1051.468] * [-1055.168] (-1061.018) (-1053.167) (-1058.378) -- 0:02:23
101000 -- (-1051.780) [-1056.721] (-1065.652) (-1053.535) * (-1056.246) (-1059.039) [-1051.791] (-1052.171) -- 0:02:22
101500 -- [-1054.123] (-1053.085) (-1068.561) (-1051.062) * [-1053.324] (-1058.207) (-1054.136) (-1058.301) -- 0:02:21
102000 -- (-1053.817) [-1053.775] (-1070.598) (-1054.029) * (-1058.976) (-1053.792) [-1054.254] (-1055.855) -- 0:02:20
102500 -- (-1053.791) (-1051.667) (-1065.549) [-1056.636] * (-1058.273) (-1053.723) (-1051.289) [-1054.566] -- 0:02:20
103000 -- (-1052.936) [-1050.888] (-1067.306) (-1055.348) * (-1055.179) (-1054.494) [-1054.845] (-1056.642) -- 0:02:28
103500 -- (-1051.539) [-1052.245] (-1068.464) (-1056.245) * (-1058.228) [-1054.760] (-1057.910) (-1055.381) -- 0:02:27
104000 -- (-1056.905) (-1057.035) (-1064.781) [-1054.145] * (-1057.901) (-1063.026) (-1057.755) [-1056.506] -- 0:02:26
104500 -- [-1052.895] (-1051.016) (-1058.950) (-1052.740) * (-1056.408) [-1054.218] (-1067.703) (-1059.479) -- 0:02:25
105000 -- (-1055.675) [-1059.113] (-1054.118) (-1054.839) * (-1055.271) (-1056.304) (-1057.403) [-1065.472] -- 0:02:24
Average standard deviation of split frequencies: 0.000000
105500 -- [-1053.151] (-1054.074) (-1054.876) (-1054.804) * [-1052.560] (-1055.520) (-1054.933) (-1063.209) -- 0:02:24
106000 -- (-1058.144) (-1053.337) [-1057.344] (-1054.112) * [-1054.699] (-1057.231) (-1056.924) (-1061.219) -- 0:02:23
106500 -- (-1068.438) (-1062.646) [-1055.897] (-1055.140) * (-1053.644) (-1057.728) [-1054.814] (-1061.442) -- 0:02:22
107000 -- (-1058.493) (-1056.683) (-1055.934) [-1054.292] * (-1057.397) (-1055.466) (-1058.232) [-1064.311] -- 0:02:21
107500 -- (-1053.330) (-1057.547) (-1062.545) [-1052.057] * (-1053.020) (-1056.269) [-1054.371] (-1052.052) -- 0:02:21
108000 -- [-1055.593] (-1054.356) (-1063.081) (-1051.379) * [-1058.686] (-1058.644) (-1054.153) (-1051.671) -- 0:02:20
108500 -- (-1053.749) [-1054.488] (-1056.308) (-1052.158) * (-1054.920) (-1062.749) (-1054.357) [-1051.718] -- 0:02:19
109000 -- (-1053.135) (-1054.610) [-1052.419] (-1057.217) * (-1058.993) (-1055.465) [-1057.435] (-1059.447) -- 0:02:27
109500 -- (-1058.460) (-1051.364) [-1049.656] (-1053.901) * (-1052.096) [-1054.302] (-1057.327) (-1057.120) -- 0:02:26
110000 -- (-1058.979) (-1054.236) (-1058.701) [-1053.208] * [-1053.770] (-1053.804) (-1056.846) (-1057.263) -- 0:02:25
Average standard deviation of split frequencies: 0.000000
110500 -- (-1057.386) (-1050.788) (-1056.343) [-1053.641] * [-1054.040] (-1053.428) (-1055.652) (-1055.478) -- 0:02:24
111000 -- (-1064.313) [-1052.726] (-1050.686) (-1055.237) * (-1068.006) [-1052.181] (-1057.060) (-1052.944) -- 0:02:24
111500 -- (-1054.823) [-1053.461] (-1058.246) (-1058.784) * [-1052.901] (-1057.397) (-1055.318) (-1060.464) -- 0:02:23
112000 -- (-1057.742) (-1059.727) [-1051.047] (-1058.563) * (-1054.942) [-1057.393] (-1057.123) (-1052.487) -- 0:02:22
112500 -- (-1053.101) (-1056.610) [-1053.228] (-1058.933) * (-1053.163) (-1058.648) [-1057.212] (-1054.534) -- 0:02:22
113000 -- [-1052.687] (-1050.876) (-1053.974) (-1055.764) * (-1056.471) (-1059.639) [-1057.936] (-1052.098) -- 0:02:21
113500 -- (-1054.302) (-1052.003) [-1053.263] (-1053.080) * (-1054.754) [-1052.579] (-1059.744) (-1054.158) -- 0:02:20
114000 -- (-1055.039) (-1051.094) [-1055.121] (-1055.450) * [-1052.807] (-1060.255) (-1056.724) (-1053.893) -- 0:02:19
114500 -- [-1057.462] (-1058.098) (-1051.538) (-1052.243) * (-1052.504) [-1060.874] (-1065.471) (-1056.776) -- 0:02:19
115000 -- (-1058.823) (-1057.735) (-1061.721) [-1055.835] * (-1056.141) [-1054.953] (-1058.135) (-1052.743) -- 0:02:26
Average standard deviation of split frequencies: 0.000000
115500 -- (-1058.390) (-1058.336) [-1050.281] (-1063.276) * (-1061.298) [-1054.373] (-1063.277) (-1055.109) -- 0:02:25
116000 -- (-1053.793) [-1056.819] (-1050.987) (-1070.038) * [-1053.568] (-1055.817) (-1053.470) (-1052.109) -- 0:02:24
116500 -- (-1056.401) (-1053.301) [-1050.251] (-1064.945) * (-1056.217) (-1049.946) [-1054.815] (-1053.079) -- 0:02:24
117000 -- (-1051.468) [-1049.537] (-1050.417) (-1052.557) * (-1055.216) (-1052.323) [-1057.493] (-1051.457) -- 0:02:23
117500 -- [-1054.976] (-1057.311) (-1055.547) (-1056.619) * [-1055.025] (-1053.322) (-1055.157) (-1052.117) -- 0:02:22
118000 -- [-1058.543] (-1060.882) (-1055.090) (-1059.917) * (-1057.262) [-1055.736] (-1056.505) (-1059.231) -- 0:02:22
118500 -- (-1059.415) [-1057.066] (-1054.673) (-1061.750) * (-1052.579) (-1054.526) [-1060.935] (-1055.087) -- 0:02:21
119000 -- (-1053.185) (-1056.593) (-1057.032) [-1059.077] * (-1055.452) [-1049.766] (-1057.294) (-1053.694) -- 0:02:20
119500 -- [-1054.413] (-1051.101) (-1060.169) (-1059.521) * (-1056.510) (-1052.312) (-1058.366) [-1051.951] -- 0:02:19
120000 -- (-1059.466) (-1051.045) [-1052.763] (-1058.408) * (-1059.984) (-1054.036) [-1054.685] (-1052.321) -- 0:02:19
Average standard deviation of split frequencies: 0.000000
120500 -- (-1056.554) [-1055.629] (-1053.614) (-1053.942) * (-1057.552) (-1054.002) [-1057.898] (-1054.194) -- 0:02:18
121000 -- [-1053.363] (-1052.789) (-1059.040) (-1054.781) * (-1051.799) (-1057.482) (-1054.696) [-1056.782] -- 0:02:18
121500 -- [-1052.226] (-1057.250) (-1054.448) (-1054.699) * (-1057.984) (-1065.142) (-1052.728) [-1053.413] -- 0:02:24
122000 -- (-1056.057) (-1051.748) [-1058.326] (-1059.371) * (-1058.099) (-1057.958) (-1053.139) [-1053.943] -- 0:02:23
122500 -- [-1053.238] (-1060.200) (-1052.839) (-1054.324) * (-1059.100) (-1057.116) (-1056.303) [-1053.554] -- 0:02:23
123000 -- (-1057.000) [-1060.821] (-1056.366) (-1059.291) * (-1050.695) [-1061.022] (-1054.047) (-1057.543) -- 0:02:22
123500 -- (-1060.121) [-1055.873] (-1055.370) (-1054.564) * (-1056.471) (-1058.890) [-1051.631] (-1063.263) -- 0:02:21
124000 -- [-1052.564] (-1051.902) (-1050.939) (-1060.856) * [-1055.607] (-1060.759) (-1052.517) (-1065.750) -- 0:02:21
124500 -- (-1052.477) (-1057.291) (-1055.169) [-1056.424] * (-1060.054) (-1056.034) [-1053.677] (-1061.229) -- 0:02:20
125000 -- (-1051.938) [-1053.267] (-1050.720) (-1059.551) * (-1055.952) (-1052.648) [-1063.153] (-1054.730) -- 0:02:20
Average standard deviation of split frequencies: 0.000000
125500 -- [-1051.485] (-1056.053) (-1049.794) (-1058.049) * (-1052.198) (-1060.847) (-1058.489) [-1055.320] -- 0:02:19
126000 -- (-1050.740) (-1053.680) (-1052.462) [-1058.778] * (-1051.799) (-1058.399) (-1060.322) [-1061.571] -- 0:02:18
126500 -- [-1053.993] (-1062.004) (-1050.449) (-1062.922) * (-1052.948) [-1059.070] (-1056.365) (-1055.820) -- 0:02:18
127000 -- (-1055.473) [-1061.192] (-1054.609) (-1063.936) * (-1054.157) [-1056.437] (-1054.433) (-1053.880) -- 0:02:17
127500 -- (-1055.958) (-1054.439) (-1054.013) [-1058.056] * (-1052.981) [-1055.857] (-1056.423) (-1056.991) -- 0:02:23
128000 -- (-1057.272) (-1064.252) (-1053.186) [-1053.317] * (-1054.011) [-1050.927] (-1057.359) (-1051.698) -- 0:02:23
128500 -- (-1052.961) [-1053.990] (-1057.439) (-1055.491) * (-1059.471) (-1054.845) [-1059.249] (-1055.344) -- 0:02:22
129000 -- (-1052.802) (-1058.848) [-1057.393] (-1061.833) * [-1058.889] (-1064.115) (-1060.495) (-1050.450) -- 0:02:21
129500 -- (-1055.389) [-1054.602] (-1061.212) (-1058.570) * (-1058.964) (-1053.458) [-1050.867] (-1057.758) -- 0:02:21
130000 -- (-1060.437) (-1056.236) [-1056.133] (-1052.245) * (-1060.293) (-1057.700) (-1060.539) [-1056.034] -- 0:02:20
Average standard deviation of split frequencies: 0.000000
130500 -- (-1055.369) (-1051.987) [-1056.208] (-1054.247) * (-1061.565) (-1062.546) (-1054.739) [-1056.142] -- 0:02:19
131000 -- (-1059.239) (-1050.924) [-1057.389] (-1055.538) * (-1063.341) (-1060.472) [-1053.536] (-1056.007) -- 0:02:19
131500 -- (-1058.226) (-1051.400) (-1052.102) [-1058.647] * (-1060.830) (-1064.496) [-1050.486] (-1059.680) -- 0:02:18
132000 -- (-1058.583) [-1056.089] (-1048.290) (-1053.107) * (-1063.059) (-1053.246) (-1052.547) [-1056.471] -- 0:02:18
132500 -- (-1059.514) (-1057.229) (-1052.694) [-1054.167] * (-1057.690) (-1054.710) [-1053.247] (-1056.453) -- 0:02:17
133000 -- (-1057.410) [-1051.113] (-1050.847) (-1058.382) * (-1060.281) (-1054.127) [-1051.576] (-1053.997) -- 0:02:16
133500 -- [-1052.545] (-1055.089) (-1053.703) (-1052.923) * (-1054.524) [-1054.953] (-1055.436) (-1056.292) -- 0:02:22
134000 -- (-1049.675) [-1059.055] (-1054.124) (-1054.825) * (-1055.215) (-1056.133) (-1051.105) [-1050.803] -- 0:02:22
134500 -- [-1055.605] (-1060.292) (-1057.684) (-1057.718) * [-1052.637] (-1056.919) (-1051.195) (-1052.361) -- 0:02:21
135000 -- [-1049.970] (-1063.570) (-1053.013) (-1065.769) * (-1056.772) (-1057.785) (-1055.702) [-1049.353] -- 0:02:20
Average standard deviation of split frequencies: 0.000000
135500 -- [-1054.323] (-1060.286) (-1053.657) (-1059.410) * [-1052.982] (-1064.382) (-1059.272) (-1053.988) -- 0:02:20
136000 -- (-1055.422) (-1055.390) (-1053.104) [-1051.496] * (-1062.244) (-1056.754) (-1056.672) [-1055.867] -- 0:02:19
136500 -- (-1052.776) (-1055.822) [-1056.386] (-1054.325) * (-1054.485) (-1058.843) [-1056.459] (-1060.275) -- 0:02:19
137000 -- (-1050.586) (-1057.074) (-1066.825) [-1053.405] * (-1063.373) (-1052.628) [-1054.664] (-1058.117) -- 0:02:18
137500 -- (-1053.257) (-1053.533) [-1054.276] (-1052.206) * [-1056.992] (-1055.604) (-1054.872) (-1059.593) -- 0:02:18
138000 -- (-1057.149) (-1054.657) [-1051.901] (-1054.450) * (-1053.906) (-1056.876) [-1060.817] (-1055.227) -- 0:02:17
138500 -- [-1054.476] (-1051.659) (-1052.647) (-1053.709) * (-1052.033) (-1056.269) [-1056.465] (-1055.935) -- 0:02:16
139000 -- (-1049.506) [-1050.762] (-1052.886) (-1059.808) * (-1057.757) [-1054.802] (-1055.494) (-1055.613) -- 0:02:16
139500 -- (-1057.367) (-1054.785) [-1056.983] (-1050.801) * (-1057.022) (-1058.923) (-1053.562) [-1054.485] -- 0:02:21
140000 -- [-1054.247] (-1060.290) (-1054.265) (-1055.708) * (-1058.205) (-1056.521) (-1054.752) [-1053.728] -- 0:02:21
Average standard deviation of split frequencies: 0.000000
140500 -- (-1055.652) (-1057.010) (-1051.985) [-1052.691] * (-1061.060) (-1056.189) (-1052.074) [-1053.683] -- 0:02:20
141000 -- (-1058.142) (-1058.968) (-1050.524) [-1052.650] * [-1056.290] (-1061.837) (-1056.615) (-1056.469) -- 0:02:20
141500 -- (-1063.276) (-1059.135) (-1054.747) [-1049.725] * (-1054.569) [-1053.952] (-1062.105) (-1054.133) -- 0:02:19
142000 -- (-1060.333) [-1056.758] (-1052.920) (-1055.651) * (-1057.813) [-1053.186] (-1056.190) (-1057.859) -- 0:02:18
142500 -- (-1055.063) (-1052.921) (-1055.180) [-1055.336] * [-1053.164] (-1061.297) (-1056.372) (-1051.857) -- 0:02:18
143000 -- [-1054.906] (-1052.871) (-1051.461) (-1051.554) * [-1052.192] (-1050.895) (-1058.528) (-1054.874) -- 0:02:17
143500 -- (-1055.168) (-1057.435) [-1054.263] (-1057.636) * (-1055.610) (-1055.671) (-1056.635) [-1058.218] -- 0:02:17
144000 -- (-1058.793) (-1052.424) [-1055.705] (-1056.219) * [-1054.045] (-1053.390) (-1060.577) (-1057.473) -- 0:02:16
144500 -- (-1051.095) [-1056.340] (-1054.055) (-1055.510) * (-1053.218) (-1060.092) [-1062.711] (-1057.772) -- 0:02:16
145000 -- (-1054.543) [-1052.694] (-1051.539) (-1059.488) * (-1050.808) (-1061.444) (-1057.775) [-1052.607] -- 0:02:15
Average standard deviation of split frequencies: 0.000000
145500 -- (-1061.342) (-1054.903) [-1051.949] (-1051.909) * (-1054.818) [-1055.293] (-1054.980) (-1062.355) -- 0:02:20
146000 -- (-1061.264) (-1052.677) (-1050.145) [-1057.606] * (-1053.394) (-1059.735) [-1055.947] (-1057.931) -- 0:02:20
146500 -- [-1054.708] (-1055.941) (-1058.681) (-1055.686) * (-1058.044) [-1058.669] (-1056.330) (-1056.737) -- 0:02:19
147000 -- (-1059.405) (-1056.027) (-1054.568) [-1059.387] * (-1056.368) [-1060.740] (-1058.588) (-1060.450) -- 0:02:19
147500 -- (-1059.083) (-1055.774) [-1052.224] (-1058.519) * [-1051.720] (-1054.376) (-1056.389) (-1060.945) -- 0:02:18
148000 -- (-1056.681) [-1054.563] (-1051.993) (-1059.840) * (-1054.022) (-1060.420) [-1054.888] (-1058.894) -- 0:02:18
148500 -- (-1056.534) [-1053.848] (-1063.543) (-1055.614) * (-1050.134) (-1056.530) (-1055.142) [-1052.609] -- 0:02:17
149000 -- [-1051.996] (-1063.770) (-1059.727) (-1054.779) * [-1054.043] (-1057.205) (-1055.008) (-1064.341) -- 0:02:17
149500 -- (-1049.994) [-1054.941] (-1058.650) (-1052.160) * (-1055.645) [-1052.489] (-1061.550) (-1061.416) -- 0:02:16
150000 -- (-1053.101) (-1056.083) (-1059.380) [-1053.960] * (-1054.968) [-1058.477] (-1063.339) (-1056.502) -- 0:02:16
Average standard deviation of split frequencies: 0.000000
150500 -- (-1055.848) [-1056.062] (-1059.356) (-1054.062) * (-1058.798) [-1052.382] (-1052.757) (-1055.537) -- 0:02:15
151000 -- (-1054.714) (-1054.177) [-1064.260] (-1061.750) * [-1057.395] (-1052.056) (-1052.970) (-1052.963) -- 0:02:14
151500 -- (-1052.061) (-1056.724) (-1057.204) [-1057.032] * (-1053.470) (-1053.204) (-1053.312) [-1054.921] -- 0:02:20
152000 -- [-1048.862] (-1053.645) (-1058.188) (-1054.408) * (-1056.137) (-1053.513) [-1053.267] (-1051.294) -- 0:02:19
152500 -- (-1053.233) (-1051.320) (-1054.022) [-1052.276] * (-1056.434) [-1061.421] (-1055.291) (-1056.423) -- 0:02:18
153000 -- (-1058.624) (-1050.945) (-1053.970) [-1053.317] * [-1053.759] (-1056.503) (-1051.052) (-1053.387) -- 0:02:18
153500 -- (-1057.094) (-1049.766) (-1051.680) [-1055.211] * [-1051.795] (-1058.378) (-1053.925) (-1055.512) -- 0:02:17
154000 -- (-1058.641) (-1051.594) (-1054.005) [-1054.905] * (-1056.889) (-1064.835) [-1054.131] (-1054.507) -- 0:02:17
154500 -- (-1063.398) [-1051.986] (-1056.880) (-1051.570) * (-1055.948) (-1058.028) (-1054.567) [-1054.873] -- 0:02:16
155000 -- [-1053.383] (-1055.430) (-1066.538) (-1062.496) * (-1055.443) [-1056.755] (-1055.707) (-1052.690) -- 0:02:16
Average standard deviation of split frequencies: 0.000000
155500 -- (-1056.237) (-1051.191) (-1059.201) [-1052.914] * (-1054.956) (-1054.031) (-1052.347) [-1052.228] -- 0:02:15
156000 -- (-1063.420) [-1050.837] (-1060.227) (-1058.188) * (-1053.254) (-1052.166) [-1056.349] (-1052.831) -- 0:02:15
156500 -- [-1053.033] (-1052.049) (-1058.806) (-1058.276) * [-1051.620] (-1052.287) (-1059.574) (-1055.712) -- 0:02:14
157000 -- [-1050.171] (-1060.287) (-1067.673) (-1060.088) * (-1059.779) [-1050.911] (-1053.035) (-1056.789) -- 0:02:14
157500 -- (-1057.460) [-1056.841] (-1062.991) (-1060.519) * (-1057.791) (-1056.471) [-1052.689] (-1059.616) -- 0:02:19
158000 -- [-1055.304] (-1053.736) (-1062.259) (-1059.893) * (-1051.096) [-1053.864] (-1064.078) (-1058.196) -- 0:02:18
158500 -- (-1053.059) (-1059.793) (-1063.566) [-1055.620] * (-1049.264) (-1050.873) [-1051.089] (-1056.380) -- 0:02:18
159000 -- (-1054.587) (-1056.275) (-1065.037) [-1059.806] * (-1059.268) (-1055.314) [-1050.788] (-1056.257) -- 0:02:17
159500 -- (-1060.755) (-1060.680) (-1058.493) [-1060.795] * [-1055.987] (-1057.801) (-1052.476) (-1057.528) -- 0:02:17
160000 -- (-1060.925) (-1055.184) [-1057.660] (-1054.190) * (-1053.891) (-1053.105) (-1063.138) [-1058.999] -- 0:02:16
Average standard deviation of split frequencies: 0.000000
160500 -- [-1060.480] (-1055.802) (-1057.677) (-1056.319) * (-1063.376) (-1053.710) (-1052.385) [-1053.746] -- 0:02:15
161000 -- (-1062.199) [-1054.863] (-1054.663) (-1055.793) * (-1051.954) [-1057.216] (-1057.552) (-1052.139) -- 0:02:15
161500 -- (-1058.775) (-1050.284) (-1055.916) [-1055.567] * [-1058.042] (-1054.330) (-1061.131) (-1056.752) -- 0:02:14
162000 -- (-1063.650) (-1063.300) (-1057.909) [-1053.868] * [-1053.435] (-1052.557) (-1055.321) (-1064.322) -- 0:02:14
162500 -- [-1060.812] (-1055.054) (-1054.862) (-1059.941) * (-1056.883) (-1059.787) [-1053.423] (-1060.360) -- 0:02:14
163000 -- (-1054.414) [-1055.311] (-1052.443) (-1058.013) * (-1053.279) (-1054.683) [-1054.003] (-1056.076) -- 0:02:13
163500 -- (-1058.066) [-1051.280] (-1060.865) (-1052.988) * (-1057.801) (-1057.768) [-1053.277] (-1056.335) -- 0:02:18
164000 -- [-1055.594] (-1052.858) (-1055.616) (-1055.938) * [-1050.117] (-1057.311) (-1051.103) (-1063.123) -- 0:02:17
164500 -- (-1058.103) [-1055.500] (-1056.258) (-1060.004) * (-1055.973) [-1056.846] (-1052.708) (-1056.254) -- 0:02:17
165000 -- (-1061.605) (-1062.879) [-1059.350] (-1056.176) * [-1055.258] (-1059.237) (-1056.208) (-1057.186) -- 0:02:16
Average standard deviation of split frequencies: 0.000000
165500 -- (-1059.514) (-1054.540) (-1055.564) [-1052.296] * [-1054.958] (-1059.576) (-1053.817) (-1056.989) -- 0:02:16
166000 -- (-1066.299) [-1056.241] (-1056.073) (-1055.806) * [-1055.185] (-1061.985) (-1053.037) (-1059.003) -- 0:02:15
166500 -- (-1057.532) (-1058.012) (-1059.264) [-1052.809] * [-1057.108] (-1053.766) (-1053.614) (-1060.005) -- 0:02:15
167000 -- (-1061.135) [-1049.483] (-1059.668) (-1052.888) * [-1055.054] (-1054.017) (-1053.765) (-1054.590) -- 0:02:14
167500 -- (-1068.336) (-1056.986) [-1056.989] (-1049.179) * (-1053.002) (-1051.742) (-1063.545) [-1054.509] -- 0:02:14
168000 -- (-1065.373) (-1054.572) (-1055.032) [-1053.631] * (-1049.723) [-1053.000] (-1055.398) (-1053.642) -- 0:02:13
168500 -- (-1064.246) (-1065.757) [-1055.371] (-1056.645) * [-1053.286] (-1058.850) (-1055.003) (-1054.179) -- 0:02:13
169000 -- (-1058.491) (-1062.275) [-1052.934] (-1057.882) * (-1052.709) (-1064.804) [-1054.933] (-1057.947) -- 0:02:17
169500 -- (-1061.101) (-1064.721) (-1055.919) [-1055.544] * (-1059.259) (-1058.891) [-1052.739] (-1050.852) -- 0:02:17
170000 -- (-1058.494) (-1060.281) [-1054.676] (-1052.524) * (-1052.659) [-1056.336] (-1058.193) (-1056.610) -- 0:02:16
Average standard deviation of split frequencies: 0.000000
170500 -- (-1054.505) (-1063.183) (-1055.531) [-1052.134] * (-1058.663) (-1056.757) (-1054.786) [-1056.657] -- 0:02:16
171000 -- (-1055.222) [-1053.124] (-1058.111) (-1061.059) * [-1056.353] (-1059.087) (-1057.210) (-1056.445) -- 0:02:15
171500 -- [-1050.854] (-1054.848) (-1054.504) (-1056.601) * (-1056.456) [-1056.504] (-1051.453) (-1058.160) -- 0:02:15
172000 -- (-1054.157) [-1053.985] (-1059.685) (-1052.460) * (-1056.174) (-1061.901) (-1053.466) [-1058.658] -- 0:02:14
172500 -- (-1054.679) (-1053.729) [-1057.357] (-1050.614) * (-1055.362) (-1056.987) [-1052.862] (-1051.581) -- 0:02:14
173000 -- (-1054.302) (-1055.780) [-1056.601] (-1052.593) * (-1052.220) [-1056.402] (-1054.248) (-1054.892) -- 0:02:13
173500 -- (-1054.206) (-1053.597) (-1055.551) [-1054.718] * (-1053.919) (-1054.853) [-1050.146] (-1054.306) -- 0:02:13
174000 -- [-1054.501] (-1062.438) (-1059.516) (-1055.035) * (-1058.354) (-1060.167) [-1052.303] (-1051.671) -- 0:02:12
174500 -- (-1051.790) (-1057.092) (-1053.880) [-1052.541] * (-1054.243) (-1056.350) (-1055.371) [-1052.375] -- 0:02:12
175000 -- (-1051.935) (-1055.279) (-1054.663) [-1051.385] * (-1063.486) (-1055.687) (-1052.321) [-1050.783] -- 0:02:12
Average standard deviation of split frequencies: 0.000000
175500 -- (-1052.838) (-1053.733) (-1061.543) [-1049.792] * (-1058.920) (-1054.722) (-1056.881) [-1055.794] -- 0:02:16
176000 -- (-1052.065) [-1052.866] (-1060.217) (-1055.979) * (-1053.865) (-1060.120) (-1056.311) [-1053.888] -- 0:02:15
176500 -- [-1051.869] (-1053.505) (-1062.579) (-1061.987) * (-1059.886) (-1055.499) (-1053.403) [-1055.552] -- 0:02:15
177000 -- (-1053.389) [-1053.423] (-1072.119) (-1060.014) * [-1056.157] (-1056.028) (-1055.565) (-1059.200) -- 0:02:14
177500 -- (-1060.018) [-1053.520] (-1059.704) (-1056.551) * [-1060.158] (-1052.580) (-1051.707) (-1055.268) -- 0:02:14
178000 -- (-1054.390) (-1054.811) [-1063.691] (-1052.773) * (-1055.255) (-1057.728) (-1062.875) [-1055.242] -- 0:02:13
178500 -- (-1055.963) (-1057.309) [-1054.290] (-1056.794) * (-1053.579) (-1054.602) (-1058.866) [-1059.348] -- 0:02:13
179000 -- (-1054.614) [-1054.476] (-1050.918) (-1058.070) * [-1052.548] (-1054.499) (-1058.171) (-1051.652) -- 0:02:13
179500 -- (-1054.032) [-1052.071] (-1052.448) (-1057.565) * (-1049.685) (-1051.430) [-1055.509] (-1057.559) -- 0:02:12
180000 -- [-1055.512] (-1055.798) (-1053.376) (-1055.500) * (-1060.028) (-1052.167) (-1055.795) [-1057.369] -- 0:02:12
Average standard deviation of split frequencies: 0.000000
180500 -- (-1053.627) (-1055.759) [-1056.382] (-1058.553) * (-1053.818) (-1053.819) (-1057.481) [-1055.626] -- 0:02:11
181000 -- (-1055.527) [-1055.317] (-1057.654) (-1059.029) * (-1060.651) (-1057.842) (-1057.814) [-1051.567] -- 0:02:15
181500 -- (-1056.386) (-1063.138) (-1058.493) [-1051.869] * (-1057.554) (-1057.103) [-1053.137] (-1052.854) -- 0:02:15
182000 -- (-1062.556) (-1061.558) [-1055.228] (-1054.002) * [-1064.486] (-1059.054) (-1055.904) (-1057.594) -- 0:02:14
182500 -- (-1052.769) (-1059.956) (-1059.517) [-1051.654] * [-1053.248] (-1054.967) (-1054.509) (-1060.034) -- 0:02:14
183000 -- (-1059.491) (-1057.217) [-1057.431] (-1059.312) * [-1052.305] (-1053.100) (-1055.250) (-1050.703) -- 0:02:13
183500 -- (-1054.481) (-1060.038) [-1055.497] (-1056.826) * [-1048.043] (-1056.595) (-1053.878) (-1054.544) -- 0:02:13
184000 -- (-1055.021) (-1057.235) [-1055.036] (-1062.262) * [-1052.294] (-1057.213) (-1052.265) (-1055.325) -- 0:02:13
184500 -- (-1056.448) (-1064.153) (-1051.305) [-1056.799] * (-1056.444) (-1052.654) [-1051.582] (-1055.783) -- 0:02:12
185000 -- [-1054.404] (-1054.882) (-1055.876) (-1054.312) * (-1054.959) (-1055.725) (-1053.356) [-1053.903] -- 0:02:12
Average standard deviation of split frequencies: 0.000000
185500 -- (-1056.163) [-1061.151] (-1050.614) (-1058.004) * (-1055.817) [-1057.466] (-1060.814) (-1053.073) -- 0:02:11
186000 -- (-1054.252) [-1061.646] (-1055.737) (-1054.157) * [-1053.261] (-1057.255) (-1053.765) (-1052.046) -- 0:02:11
186500 -- (-1058.888) (-1054.680) [-1052.711] (-1052.099) * (-1053.602) (-1053.659) [-1048.708] (-1051.096) -- 0:02:10
187000 -- (-1056.026) [-1052.322] (-1055.233) (-1052.500) * (-1050.499) (-1058.805) (-1057.821) [-1057.165] -- 0:02:14
187500 -- (-1055.761) (-1059.071) (-1058.829) [-1052.568] * [-1052.698] (-1053.650) (-1054.852) (-1057.181) -- 0:02:14
188000 -- (-1054.959) [-1058.690] (-1054.584) (-1056.332) * (-1059.227) (-1060.927) [-1052.981] (-1053.437) -- 0:02:13
188500 -- (-1057.735) (-1060.331) (-1054.683) [-1059.018] * [-1053.771] (-1053.369) (-1062.356) (-1055.611) -- 0:02:13
189000 -- (-1054.820) (-1055.369) (-1056.232) [-1053.141] * (-1053.823) (-1056.812) (-1068.750) [-1050.253] -- 0:02:13
189500 -- (-1063.664) (-1055.027) (-1058.888) [-1050.333] * (-1054.676) (-1059.868) (-1056.380) [-1051.925] -- 0:02:12
190000 -- [-1054.826] (-1056.119) (-1057.250) (-1061.223) * [-1054.453] (-1055.915) (-1052.225) (-1057.378) -- 0:02:12
Average standard deviation of split frequencies: 0.000000
190500 -- (-1052.211) (-1056.108) [-1062.207] (-1054.126) * [-1052.928] (-1060.650) (-1056.730) (-1057.412) -- 0:02:11
191000 -- (-1053.206) (-1057.273) [-1056.929] (-1051.989) * (-1056.681) [-1053.719] (-1053.894) (-1053.622) -- 0:02:11
191500 -- (-1060.120) (-1055.776) (-1055.246) [-1049.696] * [-1056.004] (-1052.778) (-1056.376) (-1064.540) -- 0:02:10
192000 -- (-1057.635) [-1056.710] (-1052.347) (-1055.971) * [-1056.097] (-1059.238) (-1058.166) (-1052.671) -- 0:02:10
192500 -- [-1053.371] (-1052.729) (-1053.665) (-1053.567) * (-1061.112) (-1052.230) (-1052.780) [-1055.492] -- 0:02:10
193000 -- (-1059.743) (-1052.116) (-1053.739) [-1056.576] * [-1056.739] (-1056.579) (-1054.927) (-1049.813) -- 0:02:13
193500 -- (-1062.056) (-1057.135) [-1051.354] (-1057.879) * (-1068.076) (-1052.250) (-1053.144) [-1053.002] -- 0:02:13
194000 -- (-1056.313) (-1054.457) (-1055.147) [-1054.491] * (-1053.344) (-1054.439) [-1059.157] (-1055.212) -- 0:02:12
194500 -- (-1055.718) (-1058.399) [-1055.718] (-1051.469) * (-1055.389) [-1050.905] (-1060.395) (-1054.785) -- 0:02:12
195000 -- [-1054.237] (-1056.006) (-1061.804) (-1059.324) * (-1062.251) (-1058.060) [-1061.391] (-1061.710) -- 0:02:12
Average standard deviation of split frequencies: 0.000000
195500 -- (-1054.764) (-1052.118) [-1054.100] (-1057.225) * (-1064.611) (-1059.390) (-1064.262) [-1060.568] -- 0:02:11
196000 -- [-1054.374] (-1057.734) (-1058.134) (-1053.190) * (-1064.964) (-1058.912) (-1062.308) [-1054.148] -- 0:02:11
196500 -- (-1054.131) (-1058.477) [-1053.590] (-1054.413) * [-1052.706] (-1058.669) (-1062.402) (-1054.454) -- 0:02:10
197000 -- (-1051.786) (-1057.946) [-1060.093] (-1055.468) * (-1053.978) (-1058.423) [-1056.264] (-1059.953) -- 0:02:10
197500 -- [-1053.745] (-1060.464) (-1050.748) (-1058.521) * (-1058.594) [-1057.104] (-1052.555) (-1057.014) -- 0:02:10
198000 -- (-1050.736) (-1057.349) [-1052.420] (-1064.584) * [-1053.615] (-1052.484) (-1055.904) (-1062.793) -- 0:02:09
198500 -- (-1056.181) (-1060.969) [-1054.449] (-1051.854) * (-1054.282) (-1056.694) (-1058.510) [-1057.445] -- 0:02:09
199000 -- (-1055.768) [-1058.718] (-1051.387) (-1055.622) * (-1053.754) (-1053.766) [-1055.287] (-1062.644) -- 0:02:12
199500 -- (-1055.372) (-1056.473) [-1056.173] (-1052.519) * (-1055.068) (-1057.054) [-1052.187] (-1057.668) -- 0:02:12
200000 -- (-1055.454) (-1056.136) (-1054.627) [-1056.394] * (-1054.652) (-1053.612) (-1058.424) [-1053.981] -- 0:02:12
Average standard deviation of split frequencies: 0.000000
200500 -- (-1061.018) (-1051.739) [-1054.562] (-1059.073) * (-1054.380) (-1051.409) (-1052.842) [-1053.003] -- 0:02:11
201000 -- (-1052.957) (-1052.150) (-1054.893) [-1056.556] * [-1054.631] (-1055.368) (-1057.809) (-1050.592) -- 0:02:11
201500 -- (-1054.355) (-1051.289) (-1056.184) [-1051.705] * (-1051.186) [-1052.869] (-1054.305) (-1057.235) -- 0:02:10
202000 -- (-1051.951) (-1054.216) [-1053.702] (-1059.251) * [-1055.631] (-1055.640) (-1051.923) (-1055.168) -- 0:02:10
202500 -- [-1052.871] (-1058.682) (-1057.478) (-1059.626) * (-1053.867) (-1054.616) (-1056.632) [-1053.175] -- 0:02:09
203000 -- (-1058.371) (-1053.705) [-1053.053] (-1061.007) * (-1054.225) (-1058.549) (-1055.281) [-1048.629] -- 0:02:09
203500 -- [-1051.235] (-1058.910) (-1052.265) (-1057.175) * (-1051.037) (-1051.717) (-1057.407) [-1054.388] -- 0:02:09
204000 -- (-1058.290) (-1056.748) (-1050.653) [-1056.461] * [-1058.952] (-1051.375) (-1058.503) (-1061.383) -- 0:02:08
204500 -- (-1056.624) (-1057.189) (-1052.742) [-1056.992] * (-1048.875) (-1055.326) [-1059.154] (-1053.211) -- 0:02:08
205000 -- (-1061.655) (-1062.519) (-1054.101) [-1054.030] * (-1057.817) (-1053.079) (-1058.022) [-1051.185] -- 0:02:11
Average standard deviation of split frequencies: 0.000000
205500 -- [-1062.901] (-1064.793) (-1052.991) (-1053.687) * (-1055.992) (-1059.713) (-1054.582) [-1054.490] -- 0:02:11
206000 -- (-1055.724) (-1057.440) (-1056.902) [-1051.864] * (-1054.979) (-1055.790) [-1054.755] (-1053.459) -- 0:02:11
206500 -- (-1060.380) (-1055.260) [-1058.553] (-1055.022) * (-1056.432) (-1051.896) (-1054.596) [-1054.071] -- 0:02:10
207000 -- (-1061.322) [-1059.707] (-1056.048) (-1056.928) * (-1057.186) (-1055.995) (-1058.091) [-1053.416] -- 0:02:10
207500 -- (-1056.201) [-1053.893] (-1056.101) (-1066.363) * (-1054.263) (-1058.131) [-1052.992] (-1056.308) -- 0:02:09
208000 -- (-1052.414) (-1054.134) [-1054.717] (-1052.951) * [-1051.769] (-1058.613) (-1057.090) (-1051.873) -- 0:02:09
208500 -- (-1050.246) (-1057.590) (-1056.588) [-1052.291] * [-1054.525] (-1068.565) (-1054.642) (-1063.190) -- 0:02:09
209000 -- (-1059.197) [-1058.410] (-1054.056) (-1056.688) * (-1051.728) (-1068.712) (-1049.559) [-1059.327] -- 0:02:08
209500 -- (-1062.348) (-1057.585) [-1051.220] (-1053.574) * (-1058.343) [-1059.345] (-1058.259) (-1051.821) -- 0:02:08
210000 -- (-1051.587) (-1050.551) (-1053.150) [-1052.312] * (-1058.135) (-1055.894) (-1054.735) [-1051.553] -- 0:02:07
Average standard deviation of split frequencies: 0.000000
210500 -- (-1056.970) (-1051.676) (-1052.783) [-1055.072] * (-1054.952) (-1054.888) (-1053.870) [-1060.314] -- 0:02:07
211000 -- (-1052.619) [-1050.928] (-1052.249) (-1058.068) * (-1057.150) [-1055.920] (-1060.242) (-1059.690) -- 0:02:10
211500 -- (-1052.265) (-1059.828) (-1054.943) [-1051.229] * (-1060.150) (-1059.035) (-1055.264) [-1056.392] -- 0:02:10
212000 -- (-1055.838) [-1053.767] (-1049.397) (-1056.773) * (-1054.321) (-1050.578) [-1053.353] (-1060.019) -- 0:02:10
212500 -- (-1057.172) (-1053.931) [-1054.927] (-1053.230) * (-1064.233) [-1052.074] (-1052.145) (-1058.953) -- 0:02:09
213000 -- [-1053.116] (-1056.217) (-1052.766) (-1052.674) * [-1055.041] (-1054.004) (-1056.677) (-1055.374) -- 0:02:09
213500 -- [-1055.761] (-1051.481) (-1052.820) (-1054.819) * (-1054.585) (-1057.443) [-1061.283] (-1054.409) -- 0:02:08
214000 -- (-1054.607) [-1051.675] (-1054.871) (-1054.795) * (-1051.609) (-1049.840) [-1058.290] (-1053.236) -- 0:02:08
214500 -- (-1055.561) [-1058.232] (-1053.943) (-1058.248) * [-1057.406] (-1052.434) (-1058.088) (-1054.085) -- 0:02:08
215000 -- [-1051.487] (-1062.213) (-1051.445) (-1057.014) * (-1066.664) (-1054.447) (-1056.495) [-1054.157] -- 0:02:07
Average standard deviation of split frequencies: 0.000000
215500 -- (-1054.165) [-1057.503] (-1053.673) (-1052.534) * [-1057.512] (-1056.047) (-1056.035) (-1052.649) -- 0:02:07
216000 -- (-1056.631) (-1058.600) [-1053.633] (-1059.678) * [-1049.616] (-1064.633) (-1055.231) (-1055.142) -- 0:02:07
216500 -- (-1065.226) [-1052.806] (-1052.217) (-1066.003) * (-1053.181) (-1055.583) [-1057.653] (-1048.601) -- 0:02:06
217000 -- (-1063.621) [-1054.086] (-1059.439) (-1057.287) * (-1052.156) [-1051.090] (-1055.401) (-1050.351) -- 0:02:09
217500 -- (-1065.534) (-1055.602) [-1054.391] (-1055.764) * (-1054.881) (-1054.012) (-1066.118) [-1050.044] -- 0:02:09
218000 -- (-1061.936) (-1055.165) [-1052.134] (-1056.834) * [-1058.171] (-1053.912) (-1058.399) (-1055.370) -- 0:02:09
218500 -- (-1068.108) [-1055.667] (-1053.692) (-1062.892) * (-1061.671) [-1054.184] (-1065.319) (-1057.805) -- 0:02:08
219000 -- (-1062.750) (-1059.144) [-1053.581] (-1059.049) * [-1050.227] (-1052.454) (-1057.898) (-1053.246) -- 0:02:08
219500 -- (-1058.643) (-1062.254) (-1059.063) [-1058.492] * (-1053.734) [-1057.182] (-1062.023) (-1052.603) -- 0:02:08
220000 -- [-1057.116] (-1061.012) (-1063.593) (-1059.503) * [-1056.144] (-1054.628) (-1055.156) (-1059.361) -- 0:02:07
Average standard deviation of split frequencies: 0.000000
220500 -- (-1057.446) [-1060.611] (-1055.952) (-1054.649) * (-1055.567) [-1059.823] (-1056.811) (-1061.806) -- 0:02:07
221000 -- (-1059.814) (-1060.634) (-1057.666) [-1052.267] * (-1057.024) (-1052.486) (-1064.404) [-1060.581] -- 0:02:06
221500 -- (-1057.845) [-1055.413] (-1056.795) (-1056.330) * (-1053.450) (-1056.522) [-1051.233] (-1052.720) -- 0:02:06
222000 -- (-1059.911) [-1061.995] (-1055.351) (-1060.263) * (-1058.748) (-1054.783) (-1052.712) [-1055.601] -- 0:02:06
222500 -- (-1066.476) (-1056.797) (-1059.222) [-1054.433] * (-1062.170) [-1053.386] (-1064.303) (-1059.111) -- 0:02:05
223000 -- (-1060.284) (-1055.653) (-1058.167) [-1060.176] * (-1057.233) [-1057.379] (-1055.256) (-1056.984) -- 0:02:08
223500 -- (-1056.797) (-1053.743) [-1054.415] (-1054.838) * (-1061.803) (-1055.381) (-1068.454) [-1053.397] -- 0:02:08
224000 -- (-1053.153) (-1059.019) (-1056.442) [-1058.900] * (-1051.916) (-1061.608) [-1056.599] (-1058.786) -- 0:02:08
224500 -- [-1054.694] (-1058.923) (-1055.811) (-1063.914) * [-1057.256] (-1052.437) (-1053.598) (-1058.383) -- 0:02:07
225000 -- [-1054.483] (-1054.300) (-1057.228) (-1054.938) * (-1055.782) [-1055.178] (-1055.413) (-1060.494) -- 0:02:07
Average standard deviation of split frequencies: 0.000000
225500 -- (-1062.050) (-1055.035) [-1054.695] (-1059.195) * (-1060.624) [-1052.446] (-1054.355) (-1052.756) -- 0:02:07
226000 -- (-1063.956) (-1060.652) (-1061.562) [-1051.628] * (-1055.617) (-1056.505) [-1053.221] (-1056.911) -- 0:02:06
226500 -- (-1063.477) [-1059.347] (-1055.026) (-1051.666) * (-1053.932) [-1057.740] (-1054.156) (-1054.833) -- 0:02:06
227000 -- (-1061.522) (-1057.278) (-1057.848) [-1053.528] * (-1054.501) (-1055.541) (-1053.370) [-1050.675] -- 0:02:05
227500 -- (-1061.970) (-1051.246) [-1055.019] (-1049.799) * [-1053.179] (-1053.828) (-1059.179) (-1052.986) -- 0:02:05
228000 -- (-1063.406) (-1049.922) [-1049.462] (-1053.720) * (-1054.324) (-1059.600) (-1057.859) [-1050.751] -- 0:02:05
228500 -- (-1060.628) (-1057.224) [-1054.009] (-1057.990) * (-1051.930) (-1053.697) (-1057.775) [-1052.375] -- 0:02:04
229000 -- (-1059.000) [-1060.222] (-1051.145) (-1052.389) * (-1057.319) (-1052.187) (-1054.975) [-1052.830] -- 0:02:07
229500 -- [-1054.672] (-1058.774) (-1058.587) (-1055.157) * (-1054.267) (-1053.210) [-1052.424] (-1057.527) -- 0:02:07
230000 -- (-1050.803) (-1060.517) (-1054.650) [-1056.217] * (-1060.418) (-1053.553) [-1053.003] (-1056.190) -- 0:02:07
Average standard deviation of split frequencies: 0.000000
230500 -- (-1054.892) (-1058.043) [-1050.127] (-1057.493) * [-1055.594] (-1056.949) (-1053.920) (-1056.873) -- 0:02:06
231000 -- (-1064.031) (-1055.329) (-1052.511) [-1054.005] * (-1053.377) [-1057.325] (-1060.467) (-1051.710) -- 0:02:06
231500 -- [-1054.861] (-1055.854) (-1055.642) (-1054.925) * [-1051.995] (-1059.710) (-1055.699) (-1058.430) -- 0:02:06
232000 -- [-1055.615] (-1059.020) (-1057.162) (-1061.975) * [-1054.901] (-1052.716) (-1057.083) (-1061.981) -- 0:02:05
232500 -- (-1051.282) (-1054.730) [-1050.310] (-1062.374) * (-1055.284) [-1050.846] (-1061.933) (-1060.167) -- 0:02:05
233000 -- (-1053.341) [-1053.566] (-1054.122) (-1054.980) * (-1053.643) (-1055.530) (-1058.601) [-1051.616] -- 0:02:05
233500 -- (-1055.433) (-1056.757) (-1053.037) [-1054.449] * (-1053.263) [-1058.694] (-1059.555) (-1056.070) -- 0:02:04
234000 -- (-1058.855) (-1053.984) [-1054.004] (-1055.644) * [-1052.749] (-1057.708) (-1060.418) (-1062.421) -- 0:02:04
234500 -- [-1061.212] (-1052.056) (-1054.442) (-1062.350) * (-1059.440) [-1058.076] (-1057.279) (-1051.732) -- 0:02:04
235000 -- (-1065.167) (-1052.503) [-1053.911] (-1056.216) * (-1055.498) (-1050.712) (-1054.144) [-1055.708] -- 0:02:06
Average standard deviation of split frequencies: 0.000000
235500 -- (-1054.369) (-1053.614) (-1061.596) [-1054.985] * (-1056.121) (-1056.544) (-1061.982) [-1051.162] -- 0:02:06
236000 -- (-1056.518) (-1061.019) [-1055.947] (-1057.491) * (-1055.023) (-1053.143) (-1056.105) [-1049.751] -- 0:02:06
236500 -- (-1054.670) (-1058.256) [-1055.826] (-1055.083) * (-1056.236) (-1055.094) [-1050.326] (-1051.680) -- 0:02:05
237000 -- (-1055.505) [-1056.575] (-1055.642) (-1056.264) * (-1057.692) (-1057.161) [-1057.808] (-1053.767) -- 0:02:05
237500 -- (-1059.473) (-1048.520) [-1057.391] (-1059.492) * (-1053.903) [-1059.604] (-1058.909) (-1051.809) -- 0:02:05
238000 -- (-1055.507) (-1059.791) [-1054.935] (-1063.245) * (-1068.303) [-1055.366] (-1053.252) (-1054.047) -- 0:02:04
238500 -- (-1057.744) [-1053.314] (-1052.809) (-1055.601) * (-1055.548) (-1054.501) (-1055.002) [-1056.529] -- 0:02:04
239000 -- [-1056.483] (-1055.483) (-1059.523) (-1055.816) * (-1060.419) (-1058.054) [-1057.080] (-1054.002) -- 0:02:04
239500 -- (-1054.254) (-1052.243) [-1056.919] (-1061.357) * (-1056.334) (-1055.160) (-1059.114) [-1052.314] -- 0:02:03
240000 -- (-1050.205) [-1056.332] (-1055.777) (-1058.105) * (-1060.943) (-1055.133) (-1052.080) [-1059.429] -- 0:02:03
Average standard deviation of split frequencies: 0.000000
240500 -- [-1052.922] (-1056.910) (-1060.143) (-1057.130) * [-1063.024] (-1052.862) (-1060.184) (-1060.441) -- 0:02:03
241000 -- [-1049.565] (-1055.581) (-1057.543) (-1051.298) * (-1061.104) (-1061.435) [-1058.413] (-1050.713) -- 0:02:05
241500 -- (-1057.200) (-1056.614) (-1066.909) [-1051.255] * (-1052.208) (-1062.118) [-1054.826] (-1055.490) -- 0:02:05
242000 -- (-1051.406) (-1054.364) [-1055.541] (-1052.100) * (-1055.499) (-1058.343) (-1057.382) [-1058.058] -- 0:02:05
242500 -- (-1061.722) [-1051.135] (-1064.565) (-1053.892) * (-1052.877) (-1061.660) (-1049.990) [-1061.287] -- 0:02:04
243000 -- (-1054.825) [-1051.741] (-1058.801) (-1054.619) * [-1052.912] (-1055.833) (-1057.433) (-1053.653) -- 0:02:04
243500 -- (-1058.233) (-1056.381) (-1060.830) [-1052.156] * [-1054.074] (-1051.777) (-1051.774) (-1060.862) -- 0:02:04
244000 -- (-1058.339) (-1058.571) [-1053.962] (-1053.206) * (-1049.936) (-1053.389) (-1049.736) [-1056.224] -- 0:02:03
244500 -- [-1053.544] (-1058.083) (-1060.533) (-1054.068) * (-1051.772) [-1055.648] (-1051.903) (-1057.290) -- 0:02:03
245000 -- (-1056.021) (-1053.857) (-1055.775) [-1053.258] * (-1054.336) (-1063.064) (-1053.259) [-1056.226] -- 0:02:03
Average standard deviation of split frequencies: 0.000000
245500 -- (-1059.026) (-1051.867) (-1057.124) [-1056.464] * (-1061.298) (-1051.820) [-1051.990] (-1057.438) -- 0:02:02
246000 -- (-1059.034) (-1058.045) [-1057.530] (-1053.580) * (-1051.823) (-1050.098) (-1055.964) [-1053.937] -- 0:02:02
246500 -- [-1053.026] (-1055.056) (-1050.677) (-1057.868) * (-1052.438) (-1049.899) (-1062.339) [-1052.352] -- 0:02:02
247000 -- (-1052.803) (-1056.206) (-1059.401) [-1054.857] * (-1053.049) (-1049.659) (-1055.645) [-1052.111] -- 0:02:04
247500 -- (-1054.667) (-1057.015) (-1051.870) [-1051.853] * (-1054.883) (-1053.133) (-1053.662) [-1050.946] -- 0:02:04
248000 -- [-1050.272] (-1057.697) (-1055.765) (-1051.424) * [-1056.247] (-1059.004) (-1052.457) (-1060.541) -- 0:02:04
248500 -- (-1053.214) [-1056.425] (-1060.081) (-1055.843) * [-1053.999] (-1055.470) (-1053.698) (-1054.354) -- 0:02:03
249000 -- (-1055.655) (-1054.226) (-1064.766) [-1053.379] * [-1050.665] (-1057.302) (-1052.310) (-1058.169) -- 0:02:03
249500 -- [-1052.179] (-1054.592) (-1058.354) (-1053.658) * [-1052.175] (-1053.415) (-1054.421) (-1057.265) -- 0:02:03
250000 -- (-1057.606) [-1056.943] (-1062.223) (-1056.948) * (-1057.487) (-1054.816) [-1052.311] (-1059.971) -- 0:02:03
Average standard deviation of split frequencies: 0.000000
250500 -- (-1055.777) (-1052.903) (-1059.607) [-1056.714] * [-1055.630] (-1056.690) (-1052.383) (-1053.466) -- 0:02:02
251000 -- (-1054.957) (-1056.597) (-1058.163) [-1053.513] * (-1051.643) (-1056.609) (-1049.717) [-1051.104] -- 0:02:02
251500 -- (-1058.427) [-1050.410] (-1056.581) (-1057.422) * [-1053.540] (-1056.889) (-1054.221) (-1053.376) -- 0:02:02
252000 -- (-1057.829) (-1054.992) (-1061.439) [-1056.512] * (-1060.028) [-1061.302] (-1053.352) (-1059.449) -- 0:02:01
252500 -- (-1059.817) [-1051.352] (-1062.496) (-1063.167) * (-1055.354) (-1058.614) [-1054.437] (-1056.409) -- 0:02:01
253000 -- (-1061.184) [-1055.153] (-1057.920) (-1052.427) * (-1059.113) (-1065.059) [-1051.145] (-1057.107) -- 0:02:04
253500 -- (-1058.628) (-1060.089) [-1055.812] (-1059.826) * (-1054.245) [-1053.035] (-1051.334) (-1052.257) -- 0:02:03
254000 -- (-1057.840) (-1058.000) (-1061.821) [-1056.322] * (-1051.331) [-1055.578] (-1061.186) (-1049.785) -- 0:02:03
254500 -- [-1058.894] (-1052.214) (-1054.381) (-1060.795) * (-1056.337) (-1060.797) (-1059.178) [-1053.150] -- 0:02:03
255000 -- (-1050.308) (-1058.134) (-1058.355) [-1059.705] * [-1055.361] (-1054.883) (-1066.907) (-1057.111) -- 0:02:02
Average standard deviation of split frequencies: 0.000000
255500 -- (-1052.908) (-1053.158) (-1059.773) [-1053.532] * (-1060.361) (-1053.648) [-1065.444] (-1058.858) -- 0:02:02
256000 -- [-1052.377] (-1051.573) (-1055.975) (-1050.670) * (-1054.417) [-1053.386] (-1066.026) (-1053.102) -- 0:02:02
256500 -- (-1058.747) [-1051.376] (-1058.284) (-1060.093) * [-1055.418] (-1057.543) (-1064.220) (-1070.614) -- 0:02:01
257000 -- (-1052.435) [-1053.395] (-1058.287) (-1057.519) * (-1054.917) (-1061.229) (-1061.558) [-1051.778] -- 0:02:01
257500 -- (-1053.331) (-1054.491) [-1050.761] (-1055.632) * (-1052.766) (-1060.049) [-1052.974] (-1055.277) -- 0:02:01
258000 -- (-1059.165) (-1057.962) [-1052.552] (-1056.373) * (-1056.456) [-1060.356] (-1054.058) (-1056.719) -- 0:02:00
258500 -- (-1059.492) (-1052.119) (-1054.911) [-1053.967] * (-1053.653) [-1055.767] (-1056.692) (-1058.071) -- 0:02:00
259000 -- [-1053.481] (-1054.469) (-1052.525) (-1055.972) * (-1054.207) (-1057.268) [-1055.293] (-1062.984) -- 0:02:03
259500 -- (-1052.756) (-1053.078) [-1052.130] (-1062.799) * [-1053.420] (-1053.906) (-1054.855) (-1058.615) -- 0:02:02
260000 -- (-1050.587) (-1052.764) (-1058.902) [-1058.583] * (-1059.126) [-1056.874] (-1055.167) (-1053.433) -- 0:02:02
Average standard deviation of split frequencies: 0.000000
260500 -- (-1053.891) (-1052.547) [-1057.104] (-1059.380) * (-1056.966) (-1052.271) [-1055.252] (-1049.854) -- 0:02:02
261000 -- (-1054.342) (-1055.559) (-1052.245) [-1054.291] * (-1054.929) (-1053.983) (-1055.384) [-1051.411] -- 0:02:01
261500 -- [-1052.745] (-1054.826) (-1057.085) (-1052.661) * (-1056.268) [-1057.456] (-1054.285) (-1057.996) -- 0:02:01
262000 -- (-1051.409) [-1052.408] (-1051.309) (-1056.791) * [-1057.409] (-1058.637) (-1055.714) (-1063.072) -- 0:02:01
262500 -- (-1056.661) [-1054.249] (-1055.675) (-1055.157) * (-1060.992) (-1059.214) [-1051.063] (-1061.563) -- 0:02:00
263000 -- (-1056.465) [-1058.123] (-1062.478) (-1052.686) * (-1058.817) (-1054.657) (-1055.046) [-1057.920] -- 0:02:00
263500 -- (-1051.057) (-1054.161) (-1059.358) [-1053.533] * (-1054.184) [-1056.093] (-1056.291) (-1062.575) -- 0:02:00
264000 -- [-1050.034] (-1051.320) (-1063.616) (-1062.290) * [-1059.627] (-1062.829) (-1052.243) (-1052.858) -- 0:01:59
264500 -- (-1052.320) (-1055.667) (-1059.902) [-1054.287] * (-1056.252) (-1063.335) (-1055.672) [-1056.987] -- 0:01:59
265000 -- (-1061.874) (-1059.124) (-1052.521) [-1053.268] * (-1050.969) (-1062.661) (-1052.387) [-1058.105] -- 0:02:02
Average standard deviation of split frequencies: 0.000000
265500 -- (-1049.918) [-1053.067] (-1056.470) (-1058.168) * (-1056.210) (-1058.972) [-1052.821] (-1062.185) -- 0:02:01
266000 -- (-1055.648) (-1056.827) (-1050.357) [-1063.572] * (-1056.102) [-1053.928] (-1052.914) (-1061.866) -- 0:02:01
266500 -- [-1054.767] (-1057.576) (-1055.887) (-1055.413) * (-1056.340) [-1050.332] (-1052.278) (-1060.536) -- 0:02:01
267000 -- (-1057.657) [-1054.985] (-1052.384) (-1055.107) * [-1055.827] (-1055.429) (-1057.015) (-1055.147) -- 0:02:00
267500 -- [-1057.643] (-1059.754) (-1054.750) (-1054.829) * (-1056.132) (-1052.773) (-1051.739) [-1059.666] -- 0:02:00
268000 -- (-1053.692) (-1051.579) (-1060.431) [-1061.964] * (-1053.592) (-1058.731) [-1051.588] (-1050.386) -- 0:02:00
268500 -- (-1057.937) (-1057.339) (-1060.233) [-1050.569] * [-1050.503] (-1054.134) (-1057.670) (-1057.690) -- 0:01:59
269000 -- (-1054.600) (-1054.089) [-1054.846] (-1053.830) * [-1055.982] (-1053.122) (-1053.907) (-1055.556) -- 0:01:59
269500 -- (-1055.363) [-1055.298] (-1056.207) (-1056.771) * (-1057.295) (-1053.270) [-1057.682] (-1064.192) -- 0:01:59
270000 -- (-1052.679) (-1054.817) (-1056.129) [-1052.490] * (-1053.757) (-1051.938) [-1055.756] (-1057.259) -- 0:01:58
Average standard deviation of split frequencies: 0.000000
270500 -- (-1057.581) [-1051.471] (-1050.800) (-1053.766) * (-1058.398) (-1050.968) [-1050.506] (-1059.153) -- 0:01:58
271000 -- (-1063.011) (-1061.071) (-1051.066) [-1059.015] * (-1066.134) (-1053.546) [-1054.642] (-1060.452) -- 0:02:01
271500 -- [-1055.558] (-1053.161) (-1052.321) (-1053.145) * (-1057.726) (-1054.063) (-1053.861) [-1056.378] -- 0:02:00
272000 -- (-1059.972) (-1060.542) [-1055.552] (-1060.102) * [-1054.796] (-1053.161) (-1063.995) (-1058.350) -- 0:02:00
272500 -- (-1057.812) (-1057.529) (-1060.338) [-1055.701] * (-1056.653) (-1051.759) [-1059.277] (-1052.274) -- 0:02:00
273000 -- [-1055.598] (-1052.348) (-1056.936) (-1052.154) * (-1062.181) (-1051.445) [-1051.658] (-1053.618) -- 0:01:59
273500 -- (-1054.848) [-1054.147] (-1055.591) (-1060.818) * (-1058.854) (-1054.587) [-1053.582] (-1052.330) -- 0:01:59
274000 -- [-1060.186] (-1058.266) (-1053.473) (-1053.126) * (-1059.012) (-1061.262) (-1057.396) [-1054.894] -- 0:01:59
274500 -- (-1056.024) (-1055.031) (-1063.347) [-1054.268] * (-1053.676) (-1059.099) [-1051.874] (-1061.229) -- 0:01:58
275000 -- (-1055.831) (-1054.131) [-1049.896] (-1055.385) * [-1058.639] (-1056.428) (-1056.779) (-1056.826) -- 0:01:58
Average standard deviation of split frequencies: 0.000000
275500 -- (-1053.622) (-1057.921) (-1059.189) [-1053.315] * (-1057.723) (-1053.815) [-1054.140] (-1057.182) -- 0:01:58
276000 -- (-1052.329) (-1054.316) (-1058.716) [-1059.792] * (-1055.840) [-1052.364] (-1055.302) (-1055.055) -- 0:01:58
276500 -- [-1052.970] (-1056.884) (-1060.734) (-1057.702) * (-1058.314) [-1061.796] (-1053.148) (-1062.796) -- 0:01:57
277000 -- (-1055.084) [-1055.735] (-1050.639) (-1056.468) * [-1054.916] (-1055.891) (-1056.685) (-1063.933) -- 0:02:00
277500 -- (-1057.340) [-1052.916] (-1055.532) (-1051.727) * (-1054.385) (-1058.659) (-1059.828) [-1056.287] -- 0:01:59
278000 -- (-1056.458) (-1060.069) [-1054.519] (-1055.906) * (-1053.922) (-1058.606) (-1052.178) [-1052.926] -- 0:01:59
278500 -- (-1060.510) (-1057.986) [-1051.695] (-1057.092) * [-1050.521] (-1061.283) (-1055.186) (-1058.467) -- 0:01:59
279000 -- (-1053.811) [-1052.659] (-1058.764) (-1061.560) * [-1055.206] (-1052.555) (-1060.430) (-1055.735) -- 0:01:58
279500 -- [-1054.315] (-1057.317) (-1055.367) (-1056.768) * [-1057.455] (-1052.374) (-1056.850) (-1058.604) -- 0:01:58
280000 -- (-1053.336) (-1058.829) [-1053.268] (-1052.197) * [-1055.868] (-1055.619) (-1054.639) (-1055.932) -- 0:01:58
Average standard deviation of split frequencies: 0.000000
280500 -- [-1054.471] (-1058.751) (-1054.011) (-1056.046) * (-1057.910) [-1050.157] (-1056.260) (-1058.296) -- 0:01:57
281000 -- (-1053.603) [-1058.463] (-1054.727) (-1055.414) * [-1061.319] (-1055.656) (-1052.483) (-1059.077) -- 0:01:57
281500 -- (-1054.205) [-1054.244] (-1054.585) (-1056.344) * (-1056.659) (-1053.979) [-1053.115] (-1056.500) -- 0:01:57
282000 -- [-1056.030] (-1056.380) (-1061.693) (-1066.723) * (-1059.556) [-1051.476] (-1054.165) (-1055.143) -- 0:01:57
282500 -- [-1054.490] (-1053.969) (-1052.633) (-1057.860) * [-1056.024] (-1053.199) (-1051.179) (-1051.946) -- 0:01:59
283000 -- (-1060.694) (-1057.711) [-1059.864] (-1057.611) * [-1053.620] (-1053.133) (-1052.441) (-1061.434) -- 0:01:59
283500 -- (-1056.079) (-1062.707) [-1057.155] (-1057.109) * (-1056.866) (-1054.272) [-1051.840] (-1055.547) -- 0:01:58
284000 -- (-1057.827) [-1052.749] (-1052.912) (-1059.825) * (-1064.590) (-1051.629) [-1051.057] (-1056.419) -- 0:01:58
284500 -- (-1055.139) [-1051.571] (-1054.085) (-1055.036) * (-1054.095) (-1058.742) (-1059.512) [-1057.180] -- 0:01:58
285000 -- (-1065.678) (-1055.419) [-1058.920] (-1052.626) * (-1056.304) (-1060.724) (-1057.722) [-1056.206] -- 0:01:57
Average standard deviation of split frequencies: 0.000000
285500 -- (-1056.457) (-1058.995) (-1055.955) [-1058.471] * (-1057.528) (-1059.199) (-1060.601) [-1051.181] -- 0:01:57
286000 -- (-1058.131) (-1059.718) (-1056.544) [-1056.679] * (-1053.482) (-1057.582) [-1057.276] (-1052.473) -- 0:01:57
286500 -- [-1052.304] (-1062.584) (-1061.726) (-1057.763) * (-1057.046) (-1053.570) [-1054.500] (-1052.324) -- 0:01:57
287000 -- [-1053.200] (-1053.473) (-1060.407) (-1056.283) * (-1056.757) (-1054.707) [-1052.446] (-1063.451) -- 0:01:56
287500 -- (-1053.873) (-1058.861) [-1052.909] (-1051.785) * (-1060.579) (-1055.242) (-1054.053) [-1057.047] -- 0:01:56
288000 -- (-1052.856) (-1058.399) [-1051.462] (-1055.826) * (-1063.410) [-1054.043] (-1052.387) (-1058.431) -- 0:01:56
288500 -- [-1054.897] (-1054.331) (-1058.795) (-1053.659) * (-1056.077) (-1058.699) [-1055.584] (-1064.793) -- 0:01:58
289000 -- (-1056.545) (-1060.210) (-1058.128) [-1057.980] * (-1058.961) [-1054.279] (-1055.186) (-1057.034) -- 0:01:58
289500 -- (-1056.703) (-1062.775) (-1055.233) [-1050.977] * (-1054.570) (-1065.046) [-1052.236] (-1058.195) -- 0:01:57
290000 -- [-1054.916] (-1055.660) (-1059.036) (-1053.172) * [-1055.129] (-1052.643) (-1056.641) (-1054.254) -- 0:01:57
Average standard deviation of split frequencies: 0.000000
290500 -- (-1053.185) (-1055.573) (-1060.667) [-1056.214] * (-1056.075) (-1056.338) (-1052.783) [-1055.256] -- 0:01:57
291000 -- (-1053.551) [-1050.093] (-1063.275) (-1057.962) * (-1053.950) (-1053.779) [-1056.739] (-1059.401) -- 0:01:56
291500 -- (-1055.757) (-1053.417) (-1054.434) [-1052.209] * (-1055.933) [-1052.821] (-1055.174) (-1063.553) -- 0:01:56
292000 -- (-1052.329) [-1053.682] (-1051.211) (-1054.465) * (-1052.719) (-1055.457) (-1059.525) [-1053.954] -- 0:01:56
292500 -- [-1053.552] (-1057.273) (-1055.329) (-1060.602) * (-1051.389) (-1053.078) (-1055.711) [-1054.493] -- 0:01:56
293000 -- (-1057.019) (-1052.588) (-1057.524) [-1052.494] * (-1052.750) [-1054.617] (-1052.250) (-1057.983) -- 0:01:55
293500 -- (-1054.233) (-1050.413) [-1051.204] (-1050.126) * [-1053.143] (-1053.962) (-1052.784) (-1058.356) -- 0:01:55
294000 -- (-1050.021) (-1054.721) (-1061.105) [-1052.782] * (-1053.922) (-1058.610) [-1053.684] (-1052.193) -- 0:01:55
294500 -- [-1052.377] (-1061.826) (-1051.694) (-1052.711) * (-1050.251) [-1055.881] (-1051.413) (-1064.867) -- 0:01:57
295000 -- [-1052.927] (-1060.857) (-1051.219) (-1056.559) * (-1054.519) [-1050.885] (-1054.223) (-1064.232) -- 0:01:57
Average standard deviation of split frequencies: 0.000000
295500 -- [-1049.219] (-1057.920) (-1054.756) (-1054.165) * [-1053.533] (-1051.704) (-1056.468) (-1053.856) -- 0:01:56
296000 -- (-1050.822) (-1059.171) (-1054.928) [-1051.295] * [-1052.138] (-1060.063) (-1058.520) (-1056.249) -- 0:01:56
296500 -- (-1054.322) (-1062.320) (-1051.642) [-1052.198] * (-1053.577) [-1056.443] (-1056.800) (-1054.143) -- 0:01:56
297000 -- (-1052.613) (-1054.208) (-1052.923) [-1052.590] * [-1051.103] (-1050.390) (-1054.823) (-1052.442) -- 0:01:55
297500 -- (-1053.683) (-1054.729) (-1061.871) [-1050.033] * (-1055.909) (-1052.668) [-1054.427] (-1054.117) -- 0:01:55
298000 -- [-1053.590] (-1053.911) (-1055.346) (-1052.125) * (-1058.492) (-1065.241) (-1052.985) [-1053.777] -- 0:01:55
298500 -- [-1052.904] (-1060.575) (-1059.169) (-1053.713) * [-1051.001] (-1052.844) (-1053.248) (-1054.374) -- 0:01:55
299000 -- (-1055.542) [-1057.093] (-1062.789) (-1051.268) * [-1049.980] (-1054.539) (-1054.021) (-1053.598) -- 0:01:54
299500 -- (-1062.424) (-1053.290) [-1060.453] (-1052.219) * (-1055.670) (-1056.035) [-1057.199] (-1051.277) -- 0:01:54
300000 -- (-1059.782) (-1057.429) (-1056.460) [-1051.907] * (-1057.188) (-1054.190) (-1057.598) [-1058.709] -- 0:01:54
Average standard deviation of split frequencies: 0.000000
300500 -- (-1058.127) [-1055.099] (-1055.674) (-1049.165) * (-1058.951) (-1053.343) [-1064.315] (-1059.867) -- 0:01:56
301000 -- (-1060.192) [-1056.821] (-1063.268) (-1054.519) * (-1055.244) (-1055.344) [-1053.981] (-1054.018) -- 0:01:56
301500 -- (-1056.298) (-1056.579) [-1060.000] (-1053.173) * (-1058.274) (-1057.401) (-1062.692) [-1054.929] -- 0:01:55
302000 -- (-1059.045) (-1055.805) (-1058.664) [-1049.981] * (-1049.602) (-1061.064) (-1054.368) [-1055.738] -- 0:01:55
302500 -- (-1057.751) [-1056.174] (-1063.045) (-1052.451) * (-1054.100) (-1058.502) [-1053.713] (-1059.827) -- 0:01:55
303000 -- (-1058.941) (-1058.223) (-1059.128) [-1052.054] * (-1060.843) [-1051.626] (-1057.414) (-1055.815) -- 0:01:55
303500 -- [-1056.899] (-1060.637) (-1051.853) (-1052.212) * (-1061.607) (-1056.607) [-1050.898] (-1060.903) -- 0:01:54
304000 -- (-1056.493) (-1055.536) (-1055.188) [-1058.867] * (-1058.512) (-1054.929) (-1053.529) [-1055.452] -- 0:01:54
304500 -- (-1062.849) (-1057.098) (-1053.834) [-1057.821] * (-1056.459) (-1055.928) [-1061.036] (-1057.201) -- 0:01:54
305000 -- (-1058.802) [-1059.666] (-1054.351) (-1059.413) * (-1052.207) [-1052.726] (-1058.156) (-1056.730) -- 0:01:53
Average standard deviation of split frequencies: 0.000000
305500 -- (-1056.462) [-1058.863] (-1056.775) (-1054.870) * (-1054.277) (-1056.049) [-1060.942] (-1064.768) -- 0:01:53
306000 -- (-1058.906) (-1055.820) [-1053.312] (-1058.875) * (-1052.680) (-1055.065) (-1055.379) [-1059.718] -- 0:01:53
306500 -- (-1057.913) (-1059.667) [-1054.460] (-1055.626) * (-1055.588) (-1059.046) [-1054.978] (-1054.966) -- 0:01:55
307000 -- (-1054.065) [-1051.641] (-1058.101) (-1055.319) * (-1059.474) (-1059.508) [-1053.538] (-1061.803) -- 0:01:55
307500 -- [-1054.673] (-1054.923) (-1054.459) (-1066.468) * (-1055.851) (-1062.103) [-1053.066] (-1056.680) -- 0:01:54
308000 -- (-1053.853) [-1056.528] (-1052.731) (-1056.553) * (-1055.895) [-1054.642] (-1058.484) (-1052.912) -- 0:01:54
308500 -- (-1054.301) (-1053.480) (-1053.130) [-1056.497] * (-1059.759) (-1054.738) (-1055.993) [-1055.129] -- 0:01:54
309000 -- (-1065.017) (-1056.518) [-1054.301] (-1054.072) * (-1053.976) [-1053.229] (-1059.097) (-1060.788) -- 0:01:54
309500 -- (-1058.615) (-1050.089) [-1055.861] (-1057.176) * [-1053.419] (-1054.202) (-1063.601) (-1057.320) -- 0:01:53
310000 -- [-1058.157] (-1052.371) (-1057.136) (-1060.049) * (-1051.042) (-1050.889) (-1053.830) [-1054.611] -- 0:01:53
Average standard deviation of split frequencies: 0.000000
310500 -- (-1053.122) (-1050.778) [-1052.608] (-1063.016) * (-1057.208) (-1053.213) [-1057.678] (-1057.046) -- 0:01:53
311000 -- (-1050.227) [-1053.120] (-1058.977) (-1059.171) * (-1055.433) (-1052.846) [-1048.641] (-1057.055) -- 0:01:52
311500 -- [-1052.676] (-1052.790) (-1053.220) (-1055.428) * (-1060.087) (-1058.753) (-1060.794) [-1051.827] -- 0:01:52
312000 -- (-1054.109) [-1054.984] (-1052.032) (-1057.985) * [-1053.500] (-1056.262) (-1057.916) (-1056.422) -- 0:01:52
312500 -- (-1060.040) [-1051.223] (-1050.319) (-1054.344) * (-1052.310) [-1052.818] (-1054.818) (-1058.728) -- 0:01:52
313000 -- (-1056.533) (-1054.932) (-1054.013) [-1050.775] * (-1056.511) (-1057.594) (-1056.457) [-1054.343] -- 0:01:54
313500 -- (-1054.397) (-1051.689) [-1053.350] (-1056.132) * [-1055.731] (-1053.145) (-1055.220) (-1056.913) -- 0:01:53
314000 -- (-1054.207) (-1053.145) [-1053.514] (-1055.153) * (-1054.609) (-1054.937) [-1059.694] (-1054.187) -- 0:01:53
314500 -- (-1061.743) (-1053.586) (-1060.730) [-1053.527] * (-1054.565) (-1056.491) [-1059.415] (-1052.751) -- 0:01:53
315000 -- [-1053.722] (-1054.709) (-1052.081) (-1055.754) * [-1050.507] (-1059.794) (-1055.043) (-1060.306) -- 0:01:53
Average standard deviation of split frequencies: 0.000000
315500 -- (-1051.932) (-1052.181) (-1051.443) [-1055.621] * (-1059.270) [-1057.524] (-1053.109) (-1052.537) -- 0:01:52
316000 -- [-1055.093] (-1056.672) (-1054.356) (-1053.440) * (-1053.470) (-1051.567) [-1057.413] (-1054.768) -- 0:01:52
316500 -- (-1057.630) (-1055.845) (-1053.474) [-1054.358] * (-1056.225) (-1056.360) [-1053.505] (-1050.523) -- 0:01:52
317000 -- (-1055.217) [-1056.225] (-1059.310) (-1052.215) * (-1055.884) (-1052.149) [-1052.286] (-1051.412) -- 0:01:52
317500 -- (-1056.463) [-1054.072] (-1055.035) (-1054.488) * (-1053.296) (-1059.048) [-1050.361] (-1053.581) -- 0:01:51
318000 -- (-1054.418) (-1056.068) [-1056.772] (-1057.247) * (-1055.252) [-1051.084] (-1055.734) (-1051.203) -- 0:01:51
318500 -- (-1055.690) (-1055.199) (-1055.667) [-1057.789] * (-1057.483) (-1053.744) (-1056.001) [-1053.562] -- 0:01:51
319000 -- [-1053.622] (-1053.949) (-1053.315) (-1051.362) * [-1056.483] (-1051.212) (-1054.002) (-1060.352) -- 0:01:53
319500 -- (-1064.527) (-1059.056) (-1054.726) [-1056.823] * [-1059.423] (-1049.758) (-1050.113) (-1053.961) -- 0:01:52
320000 -- (-1057.498) [-1051.370] (-1052.262) (-1055.271) * (-1053.208) [-1053.368] (-1058.757) (-1055.476) -- 0:01:52
Average standard deviation of split frequencies: 0.000000
320500 -- (-1055.379) (-1053.968) (-1060.227) [-1050.273] * (-1054.633) [-1054.417] (-1059.201) (-1055.807) -- 0:01:52
321000 -- [-1060.237] (-1051.453) (-1052.023) (-1056.092) * [-1051.084] (-1056.734) (-1058.482) (-1055.901) -- 0:01:52
321500 -- (-1061.025) (-1055.552) [-1054.463] (-1053.815) * [-1053.300] (-1056.963) (-1060.588) (-1052.211) -- 0:01:51
322000 -- (-1055.788) (-1055.531) (-1058.344) [-1060.064] * (-1053.976) (-1056.077) [-1059.334] (-1058.923) -- 0:01:51
322500 -- [-1055.370] (-1058.368) (-1058.373) (-1059.887) * [-1052.993] (-1060.200) (-1055.104) (-1059.727) -- 0:01:51
323000 -- (-1063.261) [-1056.519] (-1057.650) (-1058.325) * [-1054.079] (-1051.136) (-1053.599) (-1058.119) -- 0:01:51
323500 -- (-1059.363) [-1050.627] (-1049.480) (-1060.773) * (-1054.123) [-1059.958] (-1054.624) (-1058.053) -- 0:01:50
324000 -- (-1055.292) (-1050.596) [-1054.278] (-1060.148) * (-1058.308) (-1059.036) (-1052.611) [-1063.097] -- 0:01:50
324500 -- (-1057.510) (-1052.648) [-1055.050] (-1054.483) * (-1052.035) [-1049.705] (-1053.753) (-1055.151) -- 0:01:52
325000 -- (-1061.494) (-1055.804) [-1053.250] (-1053.999) * (-1052.450) (-1055.708) [-1054.560] (-1054.468) -- 0:01:52
Average standard deviation of split frequencies: 0.000000
325500 -- (-1054.304) (-1058.222) [-1053.354] (-1056.166) * (-1064.500) (-1050.282) [-1053.557] (-1064.550) -- 0:01:51
326000 -- (-1053.220) (-1058.668) (-1053.652) [-1055.134] * (-1060.681) (-1052.864) (-1054.831) [-1055.173] -- 0:01:51
326500 -- [-1050.775] (-1058.016) (-1064.738) (-1056.710) * (-1056.884) [-1054.181] (-1056.989) (-1050.610) -- 0:01:51
327000 -- (-1054.914) (-1055.471) (-1051.687) [-1051.280] * (-1056.837) (-1052.832) [-1059.340] (-1057.353) -- 0:01:51
327500 -- (-1058.732) [-1050.677] (-1053.291) (-1059.999) * (-1059.706) [-1050.614] (-1060.470) (-1055.078) -- 0:01:50
328000 -- [-1058.727] (-1054.927) (-1051.949) (-1055.490) * (-1052.977) (-1059.951) [-1059.686] (-1054.605) -- 0:01:50
328500 -- (-1060.399) (-1054.819) (-1059.070) [-1051.751] * [-1054.263] (-1054.788) (-1053.761) (-1056.471) -- 0:01:50
329000 -- (-1056.191) (-1054.387) (-1052.744) [-1054.450] * (-1057.423) (-1056.243) [-1057.437] (-1057.862) -- 0:01:50
329500 -- (-1060.577) [-1056.019] (-1060.895) (-1050.354) * (-1055.353) (-1053.513) [-1058.230] (-1051.658) -- 0:01:49
330000 -- (-1063.722) [-1053.633] (-1060.400) (-1055.964) * (-1052.034) [-1053.245] (-1056.778) (-1052.957) -- 0:01:49
Average standard deviation of split frequencies: 0.000000
330500 -- [-1052.194] (-1056.897) (-1055.466) (-1052.427) * [-1051.479] (-1057.762) (-1057.133) (-1056.554) -- 0:01:51
331000 -- (-1057.216) [-1052.119] (-1064.528) (-1054.443) * (-1052.594) [-1052.605] (-1057.668) (-1050.076) -- 0:01:51
331500 -- (-1051.831) [-1054.439] (-1059.619) (-1056.918) * [-1052.661] (-1052.244) (-1058.829) (-1052.488) -- 0:01:50
332000 -- (-1054.814) (-1057.600) [-1056.965] (-1053.046) * [-1050.517] (-1051.567) (-1053.757) (-1055.786) -- 0:01:50
332500 -- (-1054.918) (-1052.750) (-1058.233) [-1055.261] * (-1053.963) (-1059.564) (-1055.812) [-1051.481] -- 0:01:50
333000 -- (-1053.547) (-1054.416) [-1055.327] (-1052.080) * (-1061.869) (-1051.353) (-1053.841) [-1054.873] -- 0:01:50
333500 -- (-1057.139) (-1052.273) (-1054.095) [-1057.069] * (-1064.922) (-1058.303) [-1053.396] (-1056.903) -- 0:01:49
334000 -- (-1056.525) (-1054.307) (-1058.089) [-1057.345] * [-1060.637] (-1063.083) (-1050.348) (-1055.714) -- 0:01:49
334500 -- [-1053.447] (-1055.746) (-1060.152) (-1059.453) * [-1057.126] (-1051.838) (-1057.825) (-1058.171) -- 0:01:49
335000 -- (-1054.344) [-1051.568] (-1049.134) (-1053.559) * (-1057.581) (-1056.496) (-1050.011) [-1058.162] -- 0:01:49
Average standard deviation of split frequencies: 0.000000
335500 -- (-1057.347) (-1056.075) (-1056.977) [-1058.038] * (-1053.420) [-1052.629] (-1052.761) (-1062.220) -- 0:01:48
336000 -- [-1053.310] (-1066.673) (-1059.219) (-1053.626) * [-1049.482] (-1056.901) (-1052.901) (-1056.089) -- 0:01:48
336500 -- (-1053.956) [-1057.987] (-1052.985) (-1062.487) * (-1056.262) (-1050.792) (-1056.026) [-1057.792] -- 0:01:50
337000 -- (-1054.565) (-1062.213) [-1054.165] (-1063.219) * [-1052.554] (-1059.209) (-1055.143) (-1063.788) -- 0:01:50
337500 -- (-1054.188) (-1054.280) (-1059.134) [-1058.929] * (-1062.614) (-1054.801) [-1057.396] (-1057.956) -- 0:01:49
338000 -- (-1056.722) [-1055.776] (-1056.784) (-1059.202) * (-1051.120) (-1053.345) [-1055.782] (-1053.623) -- 0:01:49
338500 -- (-1057.847) [-1054.207] (-1056.862) (-1053.966) * (-1056.132) [-1052.590] (-1055.171) (-1055.304) -- 0:01:49
339000 -- (-1060.611) (-1060.520) [-1057.678] (-1051.676) * (-1059.491) (-1061.422) [-1057.236] (-1056.194) -- 0:01:49
339500 -- [-1055.453] (-1051.473) (-1058.253) (-1051.770) * [-1051.749] (-1057.296) (-1068.115) (-1053.040) -- 0:01:48
340000 -- (-1056.019) (-1053.391) (-1059.734) [-1051.138] * [-1053.517] (-1057.883) (-1063.470) (-1058.733) -- 0:01:48
Average standard deviation of split frequencies: 0.000000
340500 -- (-1055.002) (-1059.946) (-1054.872) [-1054.616] * (-1057.423) [-1051.104] (-1059.138) (-1057.726) -- 0:01:48
341000 -- [-1051.267] (-1057.294) (-1055.691) (-1050.768) * (-1062.853) (-1054.673) (-1061.217) [-1053.319] -- 0:01:48
341500 -- (-1049.506) (-1060.004) [-1054.002] (-1062.186) * (-1054.903) [-1058.657] (-1050.685) (-1052.645) -- 0:01:47
342000 -- (-1050.918) (-1064.553) (-1055.509) [-1063.573] * (-1055.265) [-1055.272] (-1051.769) (-1054.963) -- 0:01:47
342500 -- (-1051.112) (-1057.592) (-1061.936) [-1053.813] * [-1049.596] (-1054.115) (-1056.845) (-1054.796) -- 0:01:49
343000 -- (-1061.163) (-1052.845) (-1057.891) [-1054.590] * (-1048.943) (-1060.328) (-1056.557) [-1055.866] -- 0:01:49
343500 -- (-1053.228) [-1051.446] (-1055.292) (-1056.527) * [-1054.650] (-1057.798) (-1056.404) (-1063.766) -- 0:01:48
344000 -- (-1056.895) [-1051.407] (-1058.300) (-1051.778) * [-1056.502] (-1051.583) (-1057.956) (-1062.951) -- 0:01:48
344500 -- (-1056.229) [-1054.443] (-1053.552) (-1050.695) * [-1056.366] (-1058.278) (-1054.661) (-1057.138) -- 0:01:48
345000 -- [-1054.547] (-1057.267) (-1058.202) (-1056.212) * [-1055.638] (-1058.833) (-1059.719) (-1056.512) -- 0:01:48
Average standard deviation of split frequencies: 0.000000
345500 -- [-1055.724] (-1055.076) (-1053.136) (-1060.938) * [-1055.845] (-1060.904) (-1061.195) (-1054.208) -- 0:01:47
346000 -- (-1058.740) [-1052.062] (-1057.832) (-1058.501) * (-1062.592) (-1054.233) [-1057.791] (-1056.610) -- 0:01:47
346500 -- (-1067.204) (-1052.706) [-1052.356] (-1059.793) * (-1057.203) [-1050.532] (-1056.714) (-1058.066) -- 0:01:47
347000 -- (-1057.069) (-1061.798) (-1056.086) [-1053.422] * (-1057.703) (-1054.089) [-1059.488] (-1054.427) -- 0:01:47
347500 -- (-1063.562) (-1054.405) [-1048.319] (-1057.702) * (-1059.717) (-1063.042) (-1057.547) [-1062.169] -- 0:01:47
348000 -- (-1054.964) [-1049.716] (-1055.551) (-1056.992) * (-1061.721) (-1056.282) (-1056.708) [-1058.481] -- 0:01:46
348500 -- (-1061.888) [-1053.850] (-1055.055) (-1057.970) * (-1053.319) (-1054.737) (-1053.106) [-1056.224] -- 0:01:48
349000 -- (-1054.619) [-1051.715] (-1060.737) (-1058.373) * (-1056.735) (-1053.280) [-1054.483] (-1055.546) -- 0:01:48
349500 -- (-1055.304) (-1054.746) (-1061.673) [-1052.076] * [-1051.432] (-1053.267) (-1057.628) (-1055.108) -- 0:01:47
350000 -- (-1057.814) [-1052.066] (-1058.885) (-1053.320) * (-1053.677) [-1053.366] (-1056.935) (-1054.625) -- 0:01:47
Average standard deviation of split frequencies: 0.000000
350500 -- (-1055.045) (-1051.895) [-1054.919] (-1057.879) * (-1062.016) (-1057.772) [-1056.411] (-1052.991) -- 0:01:47
351000 -- [-1049.402] (-1062.320) (-1063.980) (-1063.291) * (-1060.867) (-1052.176) (-1055.468) [-1051.859] -- 0:01:47
351500 -- (-1056.103) (-1056.819) [-1057.530] (-1061.937) * (-1059.910) (-1054.089) (-1055.076) [-1055.800] -- 0:01:47
352000 -- [-1054.688] (-1058.178) (-1056.058) (-1066.411) * (-1059.904) (-1053.634) (-1056.178) [-1054.066] -- 0:01:46
352500 -- [-1055.287] (-1061.336) (-1063.014) (-1058.017) * (-1063.446) (-1052.443) (-1058.161) [-1054.968] -- 0:01:46
353000 -- (-1061.494) (-1062.270) (-1053.096) [-1056.002] * (-1065.243) [-1052.690] (-1056.327) (-1054.785) -- 0:01:46
353500 -- (-1056.230) (-1056.861) [-1056.319] (-1063.635) * (-1064.560) [-1055.901] (-1059.645) (-1056.947) -- 0:01:46
354000 -- (-1055.769) (-1056.916) (-1061.097) [-1056.934] * (-1061.564) (-1054.758) (-1054.117) [-1054.089] -- 0:01:45
354500 -- (-1053.296) [-1059.172] (-1057.153) (-1057.126) * (-1064.763) [-1055.376] (-1060.067) (-1056.399) -- 0:01:47
355000 -- (-1053.272) (-1051.139) [-1052.031] (-1056.119) * (-1059.843) [-1054.966] (-1052.664) (-1061.885) -- 0:01:47
Average standard deviation of split frequencies: 0.000000
355500 -- (-1057.653) (-1053.845) [-1055.537] (-1050.009) * [-1052.571] (-1051.838) (-1050.114) (-1057.911) -- 0:01:46
356000 -- (-1056.370) (-1053.452) (-1055.270) [-1050.446] * (-1066.282) (-1058.226) [-1062.207] (-1055.521) -- 0:01:46
356500 -- (-1059.894) [-1053.429] (-1057.688) (-1059.236) * (-1054.992) [-1050.670] (-1063.699) (-1059.133) -- 0:01:46
357000 -- (-1052.206) (-1052.016) (-1058.030) [-1056.452] * (-1055.948) (-1052.882) (-1056.765) [-1052.996] -- 0:01:46
357500 -- [-1050.993] (-1055.523) (-1058.037) (-1053.330) * (-1054.813) (-1059.776) (-1060.516) [-1055.342] -- 0:01:46
358000 -- (-1049.988) (-1055.143) (-1052.287) [-1053.089] * (-1057.465) (-1059.447) (-1055.862) [-1053.055] -- 0:01:45
358500 -- [-1053.837] (-1058.525) (-1052.444) (-1063.595) * [-1057.332] (-1050.696) (-1053.120) (-1053.097) -- 0:01:45
359000 -- [-1049.987] (-1054.489) (-1060.409) (-1056.555) * (-1057.147) [-1055.694] (-1051.105) (-1054.987) -- 0:01:45
359500 -- (-1052.422) (-1056.936) [-1053.104] (-1054.023) * [-1060.471] (-1054.540) (-1058.495) (-1059.914) -- 0:01:45
360000 -- [-1054.992] (-1055.171) (-1053.626) (-1053.077) * [-1054.336] (-1051.725) (-1059.284) (-1056.840) -- 0:01:44
Average standard deviation of split frequencies: 0.000000
360500 -- (-1055.694) [-1055.761] (-1052.310) (-1054.242) * (-1055.000) [-1052.886] (-1054.892) (-1055.381) -- 0:01:46
361000 -- [-1055.256] (-1058.399) (-1059.771) (-1054.766) * (-1055.244) [-1055.313] (-1055.727) (-1061.112) -- 0:01:46
361500 -- (-1053.420) (-1061.268) [-1056.861] (-1055.307) * (-1060.131) (-1052.802) [-1058.056] (-1052.900) -- 0:01:45
362000 -- (-1057.334) [-1055.305] (-1052.320) (-1055.664) * (-1058.148) [-1056.068] (-1058.422) (-1055.516) -- 0:01:45
362500 -- (-1058.370) (-1056.084) [-1052.693] (-1053.689) * (-1061.465) (-1055.680) [-1053.690] (-1057.306) -- 0:01:45
363000 -- (-1058.026) (-1054.214) (-1057.194) [-1059.596] * [-1053.847] (-1055.810) (-1060.912) (-1056.952) -- 0:01:45
363500 -- (-1077.046) (-1061.218) [-1052.620] (-1054.294) * (-1054.865) [-1056.289] (-1054.453) (-1061.638) -- 0:01:45
364000 -- (-1059.435) (-1054.267) (-1057.041) [-1056.257] * [-1051.662] (-1052.600) (-1053.902) (-1065.397) -- 0:01:44
364500 -- (-1053.221) (-1063.414) [-1055.847] (-1058.922) * [-1050.914] (-1058.507) (-1061.860) (-1052.203) -- 0:01:44
365000 -- (-1063.246) (-1053.711) (-1051.513) [-1054.505] * (-1054.078) [-1058.502] (-1055.713) (-1048.855) -- 0:01:44
Average standard deviation of split frequencies: 0.000000
365500 -- (-1063.462) [-1054.119] (-1051.410) (-1051.818) * (-1055.610) (-1051.007) (-1068.241) [-1050.426] -- 0:01:44
366000 -- (-1054.764) [-1054.419] (-1061.931) (-1049.652) * (-1056.257) (-1053.636) [-1059.790] (-1059.487) -- 0:01:43
366500 -- [-1052.985] (-1054.291) (-1056.717) (-1057.214) * [-1055.266] (-1052.619) (-1062.256) (-1061.375) -- 0:01:45
367000 -- (-1057.524) (-1056.106) [-1053.942] (-1052.172) * (-1056.814) (-1059.082) [-1056.105] (-1056.965) -- 0:01:45
367500 -- (-1055.059) (-1051.313) [-1051.307] (-1054.276) * (-1054.065) (-1058.146) [-1054.747] (-1058.476) -- 0:01:44
368000 -- (-1047.964) (-1056.256) (-1062.307) [-1052.577] * (-1058.584) (-1054.821) [-1050.060] (-1060.855) -- 0:01:44
368500 -- (-1059.943) [-1054.877] (-1059.908) (-1056.582) * (-1056.536) (-1051.731) [-1051.147] (-1059.620) -- 0:01:44
369000 -- [-1053.904] (-1057.406) (-1055.362) (-1058.599) * (-1056.352) [-1057.302] (-1054.500) (-1060.286) -- 0:01:44
369500 -- [-1058.364] (-1056.480) (-1055.032) (-1059.474) * (-1057.960) (-1057.758) [-1052.421] (-1059.657) -- 0:01:44
370000 -- (-1053.077) (-1057.657) [-1050.205] (-1055.768) * (-1053.720) [-1055.866] (-1057.023) (-1063.407) -- 0:01:43
Average standard deviation of split frequencies: 0.000000
370500 -- (-1055.627) (-1065.388) [-1056.993] (-1060.970) * (-1056.054) (-1056.608) (-1065.227) [-1054.378] -- 0:01:43
371000 -- (-1056.872) [-1053.616] (-1056.626) (-1057.880) * [-1051.755] (-1064.836) (-1056.999) (-1063.745) -- 0:01:43
371500 -- (-1053.021) (-1054.090) [-1057.353] (-1064.312) * (-1055.020) [-1057.895] (-1053.962) (-1060.257) -- 0:01:43
372000 -- (-1058.453) (-1050.876) (-1059.654) [-1056.842] * (-1053.143) (-1060.159) (-1059.027) [-1061.516] -- 0:01:42
372500 -- [-1055.055] (-1052.337) (-1054.233) (-1057.909) * (-1056.166) (-1054.716) [-1059.758] (-1054.533) -- 0:01:44
373000 -- (-1056.526) (-1056.241) (-1053.618) [-1056.820] * (-1054.155) [-1056.085] (-1057.977) (-1055.811) -- 0:01:44
373500 -- (-1052.735) (-1054.634) (-1061.764) [-1056.554] * (-1051.129) (-1055.163) (-1053.707) [-1052.815] -- 0:01:43
374000 -- (-1058.757) (-1058.916) (-1052.057) [-1053.820] * [-1053.439] (-1057.748) (-1053.277) (-1055.234) -- 0:01:43
374500 -- (-1054.098) (-1051.662) (-1055.381) [-1051.866] * [-1055.038] (-1062.689) (-1053.499) (-1059.805) -- 0:01:43
375000 -- [-1051.440] (-1057.038) (-1055.036) (-1054.344) * [-1051.209] (-1052.065) (-1060.030) (-1060.056) -- 0:01:43
Average standard deviation of split frequencies: 0.000000
375500 -- [-1056.357] (-1056.768) (-1056.846) (-1049.518) * [-1051.637] (-1060.368) (-1053.524) (-1058.421) -- 0:01:43
376000 -- (-1055.459) (-1057.334) (-1056.177) [-1052.501] * (-1056.573) (-1065.565) [-1053.936] (-1053.673) -- 0:01:42
376500 -- (-1057.289) (-1057.663) [-1055.653] (-1051.598) * (-1059.292) (-1058.989) (-1056.114) [-1056.295] -- 0:01:42
377000 -- (-1055.704) [-1058.698] (-1057.620) (-1051.475) * (-1062.158) (-1058.456) [-1052.838] (-1054.981) -- 0:01:42
377500 -- (-1052.828) (-1054.872) (-1056.810) [-1052.365] * [-1055.071] (-1052.494) (-1053.014) (-1058.071) -- 0:01:42
378000 -- (-1053.886) (-1053.181) [-1055.436] (-1053.451) * (-1050.306) [-1056.339] (-1057.413) (-1054.061) -- 0:01:42
378500 -- [-1056.538] (-1062.240) (-1054.523) (-1053.157) * (-1051.544) [-1050.926] (-1055.249) (-1060.125) -- 0:01:43
379000 -- [-1052.067] (-1055.390) (-1057.156) (-1054.684) * [-1050.165] (-1049.241) (-1049.365) (-1067.815) -- 0:01:43
379500 -- (-1052.403) (-1056.752) (-1056.081) [-1060.238] * (-1051.061) (-1052.512) [-1050.700] (-1062.668) -- 0:01:43
380000 -- (-1055.084) (-1066.613) [-1058.135] (-1054.462) * [-1052.636] (-1062.885) (-1054.016) (-1062.947) -- 0:01:42
Average standard deviation of split frequencies: 0.000000
380500 -- [-1052.993] (-1058.931) (-1054.763) (-1056.227) * [-1049.819] (-1051.823) (-1052.846) (-1051.601) -- 0:01:42
381000 -- [-1057.129] (-1058.397) (-1054.716) (-1059.560) * (-1051.990) (-1058.968) (-1055.143) [-1052.947] -- 0:01:42
381500 -- (-1057.938) [-1055.936] (-1059.133) (-1054.897) * [-1054.575] (-1056.803) (-1057.431) (-1050.168) -- 0:01:42
382000 -- (-1055.819) [-1056.409] (-1061.995) (-1062.046) * [-1051.985] (-1056.482) (-1057.929) (-1054.020) -- 0:01:41
382500 -- (-1054.451) (-1058.526) [-1053.598] (-1056.771) * [-1054.400] (-1057.202) (-1059.405) (-1053.179) -- 0:01:41
383000 -- (-1054.295) [-1054.671] (-1052.604) (-1057.352) * (-1055.658) [-1053.460] (-1057.483) (-1053.647) -- 0:01:41
383500 -- [-1051.700] (-1059.089) (-1051.855) (-1059.611) * (-1053.183) (-1057.273) [-1054.754] (-1051.940) -- 0:01:41
384000 -- [-1056.435] (-1059.906) (-1051.836) (-1056.358) * (-1059.231) (-1052.813) [-1053.467] (-1052.855) -- 0:01:41
384500 -- (-1055.483) (-1055.874) (-1056.240) [-1054.627] * (-1055.085) [-1056.416] (-1051.289) (-1051.677) -- 0:01:42
385000 -- (-1048.878) (-1053.893) (-1059.653) [-1060.767] * (-1053.228) (-1062.432) (-1056.182) [-1062.649] -- 0:01:42
Average standard deviation of split frequencies: 0.000000
385500 -- [-1059.111] (-1059.235) (-1056.483) (-1057.630) * (-1050.350) (-1059.689) [-1054.147] (-1059.424) -- 0:01:42
386000 -- [-1060.060] (-1060.519) (-1057.742) (-1054.094) * [-1052.781] (-1057.394) (-1053.379) (-1057.121) -- 0:01:41
386500 -- (-1058.350) (-1058.059) (-1054.583) [-1056.884] * [-1050.226] (-1053.785) (-1049.781) (-1056.397) -- 0:01:41
387000 -- (-1052.089) (-1051.261) [-1055.085] (-1055.905) * (-1055.458) [-1052.376] (-1057.743) (-1056.545) -- 0:01:41
387500 -- (-1057.275) (-1054.254) [-1052.586] (-1056.564) * [-1053.182] (-1055.444) (-1053.390) (-1065.629) -- 0:01:41
388000 -- (-1055.310) [-1059.697] (-1051.865) (-1058.743) * (-1057.986) (-1051.471) [-1055.478] (-1056.463) -- 0:01:40
388500 -- (-1058.056) (-1056.525) (-1052.123) [-1053.716] * (-1064.272) [-1054.647] (-1057.679) (-1053.560) -- 0:01:40
389000 -- (-1055.832) [-1051.827] (-1058.530) (-1054.277) * (-1062.500) [-1051.756] (-1064.211) (-1054.045) -- 0:01:40
389500 -- (-1057.073) (-1057.113) [-1056.751] (-1055.141) * [-1056.769] (-1054.526) (-1058.424) (-1058.355) -- 0:01:40
390000 -- (-1057.013) [-1051.800] (-1055.207) (-1058.340) * [-1061.444] (-1051.467) (-1059.479) (-1053.492) -- 0:01:40
Average standard deviation of split frequencies: 0.000000
390500 -- (-1058.922) (-1062.380) [-1057.166] (-1060.591) * (-1062.361) [-1057.019] (-1057.032) (-1054.027) -- 0:01:41
391000 -- (-1060.804) (-1053.092) (-1060.780) [-1053.823] * (-1056.123) (-1055.452) (-1055.783) [-1057.630] -- 0:01:41
391500 -- (-1058.215) (-1053.361) [-1052.929] (-1054.835) * [-1053.353] (-1057.213) (-1065.083) (-1054.009) -- 0:01:41
392000 -- (-1056.989) (-1056.938) (-1052.837) [-1053.852] * [-1054.421] (-1057.916) (-1058.340) (-1053.936) -- 0:01:40
392500 -- [-1054.009] (-1054.991) (-1053.661) (-1058.138) * (-1056.919) (-1055.164) [-1061.773] (-1050.357) -- 0:01:40
393000 -- [-1053.550] (-1056.525) (-1057.867) (-1053.425) * [-1054.872] (-1053.315) (-1057.965) (-1057.142) -- 0:01:40
393500 -- (-1055.721) (-1062.532) [-1056.780] (-1051.610) * (-1055.610) (-1058.212) (-1054.763) [-1057.487] -- 0:01:40
394000 -- [-1056.883] (-1061.068) (-1052.474) (-1054.823) * (-1059.441) [-1052.313] (-1050.478) (-1058.846) -- 0:01:39
394500 -- (-1054.398) (-1053.400) [-1056.153] (-1056.843) * (-1059.824) [-1058.995] (-1058.496) (-1050.043) -- 0:01:39
395000 -- (-1052.981) (-1057.646) [-1052.144] (-1058.401) * [-1053.066] (-1053.714) (-1050.494) (-1053.989) -- 0:01:39
Average standard deviation of split frequencies: 0.000000
395500 -- (-1055.511) [-1059.256] (-1053.239) (-1055.338) * [-1053.965] (-1056.897) (-1053.287) (-1051.212) -- 0:01:39
396000 -- (-1057.305) (-1053.241) [-1053.953] (-1060.277) * (-1060.960) (-1066.031) [-1060.292] (-1055.379) -- 0:01:39
396500 -- (-1056.727) (-1052.578) [-1052.350] (-1060.762) * (-1055.658) (-1053.348) [-1053.821] (-1058.693) -- 0:01:40
397000 -- (-1057.227) (-1058.729) [-1055.000] (-1056.897) * (-1053.315) (-1059.134) (-1055.991) [-1060.173] -- 0:01:40
397500 -- (-1052.104) [-1060.323] (-1067.494) (-1056.142) * (-1049.127) (-1054.896) (-1056.550) [-1060.002] -- 0:01:40
398000 -- (-1055.930) (-1059.471) (-1063.244) [-1052.202] * (-1059.720) [-1053.727] (-1051.253) (-1057.963) -- 0:01:39
398500 -- (-1056.872) (-1051.704) [-1056.826] (-1055.702) * (-1052.187) (-1059.715) [-1055.620] (-1052.469) -- 0:01:39
399000 -- (-1052.799) (-1058.404) (-1059.988) [-1055.663] * (-1056.258) (-1062.004) [-1055.422] (-1056.880) -- 0:01:39
399500 -- (-1059.607) (-1056.483) [-1054.711] (-1053.896) * [-1052.347] (-1054.425) (-1053.762) (-1055.942) -- 0:01:39
400000 -- (-1058.714) [-1052.633] (-1051.715) (-1052.043) * [-1053.205] (-1057.254) (-1053.636) (-1053.523) -- 0:01:39
Average standard deviation of split frequencies: 0.000000
400500 -- (-1055.498) [-1054.822] (-1050.961) (-1052.043) * (-1055.041) [-1052.572] (-1055.926) (-1052.067) -- 0:01:38
401000 -- [-1052.624] (-1054.459) (-1055.176) (-1057.624) * [-1058.050] (-1050.736) (-1057.273) (-1058.515) -- 0:01:38
401500 -- [-1052.868] (-1051.136) (-1051.971) (-1056.912) * (-1050.281) [-1051.673] (-1058.129) (-1058.725) -- 0:01:38
402000 -- (-1067.141) [-1052.702] (-1060.375) (-1054.857) * [-1055.934] (-1054.903) (-1057.779) (-1056.066) -- 0:01:38
402500 -- [-1056.200] (-1056.338) (-1063.822) (-1054.477) * (-1060.619) (-1054.507) (-1053.969) [-1052.461] -- 0:01:39
403000 -- (-1063.467) (-1061.485) (-1061.456) [-1055.275] * (-1056.370) (-1056.067) (-1054.697) [-1053.805] -- 0:01:39
403500 -- (-1058.402) (-1063.850) (-1056.279) [-1053.800] * [-1050.663] (-1051.639) (-1054.516) (-1058.063) -- 0:01:39
404000 -- (-1058.754) [-1059.886] (-1058.975) (-1063.927) * (-1051.714) (-1054.866) [-1055.285] (-1061.341) -- 0:01:38
404500 -- (-1052.977) [-1056.432] (-1056.776) (-1055.891) * (-1056.812) (-1063.749) (-1059.859) [-1056.994] -- 0:01:38
405000 -- (-1054.279) [-1050.641] (-1057.980) (-1060.116) * (-1058.021) (-1060.374) (-1064.598) [-1053.946] -- 0:01:38
Average standard deviation of split frequencies: 0.000000
405500 -- (-1064.721) (-1052.516) [-1054.180] (-1053.233) * (-1057.398) [-1056.482] (-1052.627) (-1052.043) -- 0:01:38
406000 -- (-1058.783) (-1055.021) (-1053.609) [-1053.256] * [-1054.168] (-1053.982) (-1053.144) (-1058.343) -- 0:01:38
406500 -- (-1054.550) (-1051.961) [-1052.071] (-1053.128) * (-1058.159) [-1059.325] (-1053.249) (-1057.760) -- 0:01:37
407000 -- (-1053.430) (-1055.549) [-1057.300] (-1053.217) * [-1057.651] (-1053.978) (-1059.672) (-1057.852) -- 0:01:37
407500 -- (-1051.296) (-1056.523) [-1052.565] (-1055.340) * (-1060.810) (-1052.400) [-1053.195] (-1057.732) -- 0:01:37
408000 -- (-1062.738) (-1053.376) (-1054.481) [-1049.565] * (-1062.699) [-1052.071] (-1054.239) (-1055.771) -- 0:01:38
408500 -- (-1058.468) (-1055.585) [-1055.237] (-1055.447) * (-1054.350) [-1050.446] (-1053.841) (-1054.989) -- 0:01:38
409000 -- [-1053.447] (-1060.322) (-1053.796) (-1050.964) * [-1054.653] (-1056.294) (-1058.734) (-1051.965) -- 0:01:38
409500 -- (-1052.975) (-1062.462) (-1053.109) [-1052.297] * [-1057.270] (-1057.630) (-1058.943) (-1050.938) -- 0:01:38
410000 -- (-1054.477) (-1066.505) [-1051.007] (-1061.688) * (-1052.663) [-1053.778] (-1054.030) (-1054.326) -- 0:01:37
Average standard deviation of split frequencies: 0.000000
410500 -- (-1056.888) [-1055.289] (-1049.833) (-1058.823) * (-1057.065) [-1052.590] (-1060.081) (-1052.357) -- 0:01:37
411000 -- (-1059.356) (-1052.463) (-1055.199) [-1058.601] * [-1054.413] (-1053.435) (-1053.084) (-1055.982) -- 0:01:37
411500 -- [-1055.805] (-1055.110) (-1052.112) (-1051.374) * (-1057.085) (-1051.940) (-1056.008) [-1056.523] -- 0:01:37
412000 -- (-1054.390) [-1058.517] (-1055.977) (-1056.466) * [-1054.193] (-1051.064) (-1053.080) (-1055.828) -- 0:01:37
412500 -- (-1057.203) (-1052.886) (-1054.800) [-1054.534] * (-1053.595) [-1054.788] (-1051.570) (-1060.127) -- 0:01:36
413000 -- (-1055.333) [-1057.758] (-1054.419) (-1058.952) * [-1054.323] (-1057.466) (-1059.507) (-1052.060) -- 0:01:36
413500 -- (-1055.050) [-1056.725] (-1054.007) (-1051.673) * (-1057.129) (-1055.898) (-1057.225) [-1056.199] -- 0:01:36
414000 -- (-1062.269) (-1068.376) (-1056.344) [-1058.321] * (-1055.194) (-1052.724) (-1055.176) [-1055.947] -- 0:01:37
414500 -- (-1052.679) (-1058.183) [-1051.426] (-1055.884) * [-1059.273] (-1059.158) (-1060.756) (-1055.967) -- 0:01:37
415000 -- (-1053.002) [-1051.112] (-1052.023) (-1053.754) * (-1063.322) [-1056.764] (-1055.735) (-1056.522) -- 0:01:37
Average standard deviation of split frequencies: 0.000000
415500 -- (-1059.783) [-1052.692] (-1059.340) (-1056.185) * [-1055.636] (-1062.966) (-1057.328) (-1050.917) -- 0:01:37
416000 -- (-1051.080) (-1057.151) (-1058.893) [-1056.456] * [-1052.596] (-1058.250) (-1056.358) (-1052.971) -- 0:01:36
416500 -- (-1055.370) (-1055.033) [-1049.423] (-1053.604) * (-1050.566) [-1051.529] (-1054.685) (-1055.602) -- 0:01:36
417000 -- (-1057.306) (-1054.773) (-1053.724) [-1059.469] * (-1057.876) [-1053.526] (-1050.372) (-1051.109) -- 0:01:36
417500 -- (-1060.175) (-1049.035) (-1058.121) [-1050.397] * (-1055.477) (-1055.472) (-1056.474) [-1054.404] -- 0:01:36
418000 -- [-1051.201] (-1058.698) (-1060.533) (-1060.199) * (-1051.287) (-1056.932) (-1058.153) [-1050.707] -- 0:01:36
418500 -- [-1051.774] (-1059.629) (-1063.033) (-1054.601) * (-1055.529) [-1054.443] (-1059.166) (-1054.074) -- 0:01:35
419000 -- (-1052.582) (-1056.872) (-1059.989) [-1049.469] * [-1050.696] (-1053.048) (-1056.096) (-1058.069) -- 0:01:35
419500 -- (-1061.416) (-1054.062) (-1053.122) [-1052.540] * (-1055.037) (-1053.765) [-1051.760] (-1055.416) -- 0:01:35
420000 -- [-1055.028] (-1054.003) (-1055.990) (-1051.601) * (-1053.169) (-1056.645) [-1055.465] (-1055.377) -- 0:01:36
Average standard deviation of split frequencies: 0.000000
420500 -- [-1052.650] (-1054.764) (-1057.151) (-1055.839) * (-1052.555) [-1055.356] (-1052.298) (-1062.419) -- 0:01:36
421000 -- (-1057.337) (-1058.082) (-1055.641) [-1052.665] * (-1054.686) [-1053.724] (-1054.100) (-1055.394) -- 0:01:36
421500 -- (-1054.669) [-1054.715] (-1050.936) (-1062.831) * (-1052.280) (-1050.634) (-1054.640) [-1054.436] -- 0:01:36
422000 -- (-1053.650) (-1049.598) (-1055.959) [-1053.786] * [-1053.914] (-1056.924) (-1051.574) (-1052.044) -- 0:01:35
422500 -- (-1054.547) (-1058.652) [-1053.173] (-1053.141) * [-1057.764] (-1053.959) (-1062.874) (-1056.924) -- 0:01:35
423000 -- (-1068.377) (-1063.711) [-1050.820] (-1056.875) * (-1056.674) (-1056.390) [-1056.071] (-1060.942) -- 0:01:35
423500 -- (-1059.315) (-1059.717) (-1052.921) [-1051.257] * [-1052.026] (-1061.203) (-1052.774) (-1059.514) -- 0:01:35
424000 -- (-1061.359) (-1061.228) (-1051.399) [-1053.819] * (-1051.709) (-1054.647) (-1053.041) [-1055.684] -- 0:01:35
424500 -- (-1058.563) [-1055.444] (-1055.708) (-1050.939) * (-1059.885) (-1054.924) (-1059.960) [-1049.512] -- 0:01:34
425000 -- (-1055.237) (-1062.591) (-1054.105) [-1052.213] * [-1051.271] (-1065.207) (-1063.489) (-1052.326) -- 0:01:34
Average standard deviation of split frequencies: 0.000000
425500 -- (-1057.160) [-1052.624] (-1061.074) (-1055.771) * (-1056.648) [-1053.669] (-1057.538) (-1058.297) -- 0:01:34
426000 -- [-1049.133] (-1060.649) (-1056.173) (-1049.620) * (-1050.210) (-1053.880) (-1052.682) [-1056.156] -- 0:01:35
426500 -- (-1055.007) (-1055.893) [-1050.956] (-1058.048) * (-1050.933) [-1051.879] (-1052.716) (-1054.673) -- 0:01:35
427000 -- (-1053.032) (-1057.246) (-1059.341) [-1055.200] * [-1059.528] (-1054.422) (-1060.476) (-1062.792) -- 0:01:35
427500 -- [-1050.703] (-1054.432) (-1060.304) (-1056.201) * (-1060.732) [-1052.197] (-1064.323) (-1053.367) -- 0:01:35
428000 -- (-1055.994) (-1055.759) [-1053.511] (-1055.090) * (-1056.507) (-1055.202) (-1061.252) [-1055.562] -- 0:01:34
428500 -- [-1051.303] (-1052.516) (-1059.536) (-1056.230) * [-1055.341] (-1057.295) (-1060.611) (-1052.526) -- 0:01:34
429000 -- (-1052.581) (-1054.208) (-1059.384) [-1054.619] * (-1056.063) [-1052.604] (-1055.815) (-1056.463) -- 0:01:34
429500 -- [-1053.498] (-1063.859) (-1051.807) (-1053.448) * [-1051.743] (-1055.176) (-1060.170) (-1056.825) -- 0:01:34
430000 -- (-1054.963) (-1060.384) (-1055.134) [-1054.863] * (-1056.710) [-1055.505] (-1054.329) (-1060.631) -- 0:01:34
Average standard deviation of split frequencies: 0.000000
430500 -- [-1054.987] (-1065.092) (-1053.728) (-1060.349) * (-1054.355) [-1052.809] (-1058.525) (-1056.868) -- 0:01:33
431000 -- (-1056.982) [-1055.555] (-1054.518) (-1054.499) * (-1055.397) (-1052.038) (-1055.494) [-1051.971] -- 0:01:33
431500 -- (-1062.756) (-1055.910) (-1056.329) [-1054.235] * (-1059.055) (-1052.899) (-1059.358) [-1054.817] -- 0:01:33
432000 -- (-1062.708) (-1057.604) (-1053.175) [-1056.329] * [-1052.440] (-1053.567) (-1067.242) (-1051.964) -- 0:01:34
432500 -- (-1059.247) (-1056.968) (-1056.937) [-1058.217] * (-1055.897) [-1052.517] (-1062.798) (-1050.161) -- 0:01:34
433000 -- (-1055.416) (-1058.965) (-1055.227) [-1055.615] * (-1058.575) [-1053.614] (-1059.197) (-1055.911) -- 0:01:34
433500 -- (-1057.237) (-1059.892) [-1051.036] (-1059.785) * [-1054.337] (-1055.567) (-1062.945) (-1049.022) -- 0:01:34
434000 -- (-1054.566) [-1055.279] (-1051.118) (-1054.334) * (-1055.509) [-1055.967] (-1055.542) (-1054.023) -- 0:01:33
434500 -- (-1058.015) (-1065.417) (-1054.450) [-1055.928] * (-1056.194) [-1056.694] (-1067.743) (-1056.515) -- 0:01:33
435000 -- (-1054.744) (-1063.419) [-1057.995] (-1054.735) * (-1062.481) [-1053.197] (-1055.913) (-1053.960) -- 0:01:33
Average standard deviation of split frequencies: 0.000000
435500 -- [-1052.046] (-1058.864) (-1054.348) (-1058.762) * (-1053.269) [-1055.407] (-1055.115) (-1057.876) -- 0:01:33
436000 -- (-1054.279) (-1058.169) [-1057.588] (-1055.320) * [-1054.628] (-1058.505) (-1058.391) (-1058.624) -- 0:01:33
436500 -- [-1056.796] (-1059.589) (-1055.880) (-1057.746) * [-1055.168] (-1057.083) (-1059.484) (-1053.232) -- 0:01:32
437000 -- [-1062.336] (-1057.719) (-1052.173) (-1052.014) * (-1054.321) [-1062.921] (-1055.246) (-1062.521) -- 0:01:32
437500 -- (-1056.465) (-1060.631) [-1053.076] (-1053.475) * (-1059.655) [-1060.627] (-1062.466) (-1054.482) -- 0:01:32
438000 -- [-1054.238] (-1054.781) (-1051.898) (-1053.534) * (-1056.130) (-1063.653) (-1052.669) [-1054.297] -- 0:01:33
438500 -- (-1053.060) (-1059.135) [-1055.326] (-1049.452) * (-1056.313) (-1056.462) (-1052.136) [-1052.775] -- 0:01:33
439000 -- (-1050.238) (-1051.888) [-1055.187] (-1052.614) * (-1057.486) [-1054.007] (-1051.553) (-1058.553) -- 0:01:33
439500 -- [-1050.179] (-1054.717) (-1052.245) (-1058.810) * (-1054.319) (-1052.217) (-1052.729) [-1063.311] -- 0:01:33
440000 -- (-1055.934) (-1061.465) [-1056.109] (-1056.560) * [-1055.293] (-1053.562) (-1055.333) (-1057.789) -- 0:01:32
Average standard deviation of split frequencies: 0.000000
440500 -- (-1049.945) (-1063.197) [-1058.048] (-1052.244) * (-1053.091) [-1052.390] (-1055.567) (-1063.178) -- 0:01:32
441000 -- (-1053.294) (-1049.983) [-1054.155] (-1053.867) * (-1055.197) [-1054.120] (-1052.905) (-1055.856) -- 0:01:32
441500 -- (-1057.106) (-1055.810) [-1051.798] (-1052.575) * (-1060.182) [-1052.653] (-1059.806) (-1057.109) -- 0:01:32
442000 -- (-1054.935) (-1058.655) [-1053.382] (-1054.871) * (-1060.508) [-1055.047] (-1065.672) (-1067.461) -- 0:01:32
442500 -- [-1054.601] (-1058.720) (-1056.133) (-1052.767) * (-1053.663) [-1060.279] (-1054.576) (-1053.482) -- 0:01:31
443000 -- [-1058.592] (-1063.134) (-1054.254) (-1052.319) * [-1059.390] (-1058.203) (-1059.296) (-1054.817) -- 0:01:31
443500 -- (-1056.234) (-1057.548) (-1054.658) [-1053.388] * (-1056.673) (-1050.770) (-1058.279) [-1054.546] -- 0:01:31
444000 -- (-1055.353) (-1054.881) [-1056.521] (-1049.987) * (-1054.871) (-1051.039) [-1058.489] (-1060.565) -- 0:01:32
444500 -- (-1055.771) [-1056.658] (-1060.386) (-1053.988) * (-1051.613) (-1050.359) (-1054.610) [-1054.320] -- 0:01:32
445000 -- (-1055.284) [-1059.174] (-1056.947) (-1053.682) * (-1053.817) (-1053.267) [-1053.402] (-1052.866) -- 0:01:32
Average standard deviation of split frequencies: 0.000000
445500 -- [-1050.026] (-1052.279) (-1057.676) (-1056.494) * (-1054.002) (-1052.341) [-1052.816] (-1056.277) -- 0:01:32
446000 -- (-1056.002) (-1056.653) [-1051.680] (-1061.997) * (-1053.947) [-1056.456] (-1048.954) (-1054.033) -- 0:01:31
446500 -- (-1058.581) (-1052.834) [-1056.153] (-1064.259) * (-1057.078) [-1053.412] (-1050.298) (-1053.331) -- 0:01:31
447000 -- (-1054.948) (-1057.374) (-1055.043) [-1055.902] * (-1054.364) [-1055.053] (-1051.909) (-1062.619) -- 0:01:31
447500 -- [-1051.276] (-1054.040) (-1058.892) (-1054.475) * (-1056.211) [-1058.338] (-1055.807) (-1056.604) -- 0:01:31
448000 -- (-1054.372) [-1052.389] (-1056.429) (-1049.970) * (-1054.070) (-1058.268) [-1054.681] (-1058.839) -- 0:01:31
448500 -- (-1054.649) (-1052.861) [-1052.339] (-1056.191) * (-1054.430) [-1056.621] (-1051.939) (-1062.250) -- 0:01:30
449000 -- [-1053.254] (-1053.669) (-1052.403) (-1055.111) * (-1054.571) [-1057.740] (-1059.653) (-1054.994) -- 0:01:30
449500 -- (-1060.363) (-1059.627) (-1050.884) [-1052.351] * (-1053.017) [-1057.975] (-1056.916) (-1055.397) -- 0:01:30
450000 -- (-1054.276) [-1054.751] (-1056.170) (-1058.118) * [-1051.580] (-1059.925) (-1052.500) (-1052.746) -- 0:01:31
Average standard deviation of split frequencies: 0.000000
450500 -- (-1058.875) [-1061.614] (-1055.182) (-1051.625) * (-1053.590) (-1055.645) [-1052.805] (-1060.062) -- 0:01:31
451000 -- (-1051.965) [-1054.254] (-1056.452) (-1051.530) * (-1052.748) [-1053.422] (-1058.399) (-1054.977) -- 0:01:31
451500 -- (-1059.163) (-1050.261) (-1059.600) [-1056.704] * [-1054.461] (-1052.808) (-1054.612) (-1063.020) -- 0:01:31
452000 -- [-1056.390] (-1054.960) (-1053.509) (-1060.344) * (-1055.437) (-1056.674) [-1050.113] (-1060.843) -- 0:01:30
452500 -- [-1056.250] (-1053.329) (-1058.062) (-1060.994) * (-1049.141) (-1057.176) (-1056.240) [-1057.832] -- 0:01:30
453000 -- (-1064.546) (-1050.962) [-1058.347] (-1057.943) * (-1059.303) (-1054.925) [-1052.024] (-1060.924) -- 0:01:30
453500 -- (-1057.632) [-1052.360] (-1054.936) (-1066.736) * (-1057.252) (-1055.694) [-1051.559] (-1054.416) -- 0:01:30
454000 -- (-1057.602) [-1052.177] (-1057.090) (-1058.588) * [-1056.771] (-1059.412) (-1054.270) (-1054.634) -- 0:01:30
454500 -- [-1055.447] (-1051.871) (-1055.598) (-1055.356) * (-1058.010) [-1051.467] (-1056.681) (-1056.167) -- 0:01:30
455000 -- (-1054.632) (-1053.002) [-1055.928] (-1054.906) * (-1056.518) (-1054.737) [-1058.696] (-1053.420) -- 0:01:29
Average standard deviation of split frequencies: 0.000000
455500 -- (-1054.182) [-1053.989] (-1054.970) (-1055.697) * (-1057.738) (-1052.685) (-1057.268) [-1055.446] -- 0:01:29
456000 -- (-1054.363) [-1054.341] (-1055.756) (-1054.662) * [-1050.957] (-1057.908) (-1063.812) (-1058.677) -- 0:01:30
456500 -- (-1060.764) [-1056.088] (-1055.298) (-1053.833) * (-1055.217) [-1057.970] (-1055.597) (-1053.146) -- 0:01:30
457000 -- (-1060.265) (-1053.823) (-1059.984) [-1052.183] * (-1055.514) (-1051.911) (-1050.786) [-1053.637] -- 0:01:30
457500 -- (-1056.597) [-1058.060] (-1057.608) (-1050.166) * [-1056.220] (-1056.904) (-1056.535) (-1053.883) -- 0:01:30
458000 -- [-1053.102] (-1055.110) (-1056.125) (-1053.676) * [-1058.859] (-1056.973) (-1056.807) (-1061.352) -- 0:01:29
458500 -- (-1053.070) [-1052.248] (-1053.175) (-1054.977) * (-1051.827) [-1052.960] (-1055.581) (-1051.941) -- 0:01:29
459000 -- (-1055.243) (-1056.118) [-1053.817] (-1059.691) * (-1053.186) (-1055.754) (-1058.180) [-1053.241] -- 0:01:29
459500 -- (-1054.952) (-1054.767) [-1055.755] (-1051.338) * (-1052.510) (-1061.199) [-1054.530] (-1058.167) -- 0:01:29
460000 -- (-1060.520) (-1055.571) (-1055.175) [-1053.873] * (-1052.102) (-1054.947) (-1052.406) [-1050.354] -- 0:01:29
Average standard deviation of split frequencies: 0.000000
460500 -- [-1057.875] (-1052.908) (-1057.000) (-1052.681) * (-1054.109) (-1059.965) (-1052.320) [-1054.813] -- 0:01:29
461000 -- (-1055.395) (-1058.688) [-1060.207] (-1053.986) * (-1051.614) [-1061.498] (-1057.318) (-1052.778) -- 0:01:28
461500 -- (-1055.117) [-1055.764] (-1055.231) (-1059.871) * (-1058.338) (-1059.093) (-1057.582) [-1052.750] -- 0:01:28
462000 -- (-1055.646) (-1056.933) [-1056.662] (-1059.319) * (-1058.666) (-1057.628) [-1051.845] (-1054.379) -- 0:01:29
462500 -- [-1052.563] (-1062.186) (-1054.392) (-1051.580) * [-1052.711] (-1056.785) (-1054.633) (-1054.900) -- 0:01:29
463000 -- (-1056.501) (-1056.555) [-1053.434] (-1060.070) * (-1055.463) (-1054.825) [-1053.943] (-1059.831) -- 0:01:29
463500 -- (-1055.272) (-1055.551) [-1051.180] (-1052.795) * (-1054.457) [-1052.649] (-1057.036) (-1053.222) -- 0:01:29
464000 -- (-1058.431) [-1050.519] (-1052.394) (-1051.079) * [-1052.948] (-1060.221) (-1058.091) (-1050.802) -- 0:01:28
464500 -- (-1055.243) (-1054.286) (-1054.605) [-1053.249] * (-1057.463) (-1053.165) (-1056.598) [-1053.308] -- 0:01:28
465000 -- [-1059.630] (-1051.277) (-1057.878) (-1056.858) * (-1053.303) (-1059.688) [-1058.030] (-1055.269) -- 0:01:28
Average standard deviation of split frequencies: 0.000000
465500 -- (-1057.721) (-1049.515) [-1054.048] (-1062.981) * [-1054.836] (-1058.453) (-1055.588) (-1057.217) -- 0:01:28
466000 -- (-1057.989) [-1053.655] (-1055.172) (-1062.098) * (-1055.273) (-1056.518) (-1059.989) [-1053.820] -- 0:01:28
466500 -- (-1065.529) (-1055.974) [-1057.105] (-1052.505) * [-1055.838] (-1056.718) (-1061.588) (-1057.976) -- 0:01:28
467000 -- (-1062.408) (-1057.308) [-1059.321] (-1054.542) * (-1056.567) [-1058.479] (-1061.288) (-1058.927) -- 0:01:27
467500 -- [-1053.177] (-1058.231) (-1057.649) (-1057.977) * [-1052.412] (-1059.605) (-1052.783) (-1051.557) -- 0:01:27
468000 -- [-1060.041] (-1061.568) (-1051.791) (-1054.719) * (-1055.312) (-1051.700) (-1054.083) [-1051.924] -- 0:01:28
468500 -- [-1052.939] (-1052.615) (-1053.406) (-1055.521) * (-1055.916) [-1057.841] (-1052.037) (-1057.824) -- 0:01:28
469000 -- (-1051.108) (-1053.127) (-1054.203) [-1056.450] * (-1053.044) (-1057.819) [-1052.663] (-1048.566) -- 0:01:28
469500 -- (-1051.957) [-1054.832] (-1052.725) (-1062.689) * (-1056.909) (-1049.886) (-1053.585) [-1053.316] -- 0:01:28
470000 -- (-1052.796) (-1057.451) (-1059.267) [-1059.561] * (-1057.561) (-1052.410) [-1050.757] (-1054.101) -- 0:01:27
Average standard deviation of split frequencies: 0.000000
470500 -- (-1051.793) [-1054.216] (-1051.380) (-1060.116) * (-1053.948) (-1053.903) [-1053.306] (-1056.298) -- 0:01:27
471000 -- (-1060.048) (-1054.994) (-1056.333) [-1056.209] * [-1059.272] (-1052.768) (-1057.122) (-1060.307) -- 0:01:27
471500 -- (-1056.894) [-1053.064] (-1057.280) (-1054.521) * (-1054.885) (-1057.234) [-1054.309] (-1053.967) -- 0:01:27
472000 -- (-1056.395) [-1059.305] (-1059.527) (-1055.413) * [-1058.938] (-1053.131) (-1057.342) (-1055.160) -- 0:01:27
472500 -- (-1056.999) (-1063.167) (-1051.407) [-1051.613] * (-1053.852) (-1050.088) (-1054.983) [-1052.295] -- 0:01:27
473000 -- (-1051.964) (-1058.909) [-1052.145] (-1055.079) * [-1063.106] (-1052.126) (-1052.817) (-1054.035) -- 0:01:26
473500 -- (-1058.956) (-1057.251) [-1055.771] (-1053.255) * (-1057.204) [-1051.513] (-1055.686) (-1052.937) -- 0:01:26
474000 -- [-1057.245] (-1061.988) (-1051.726) (-1054.865) * (-1055.552) [-1052.691] (-1057.038) (-1057.091) -- 0:01:27
474500 -- (-1051.801) [-1055.176] (-1055.157) (-1057.754) * [-1055.185] (-1059.064) (-1062.278) (-1054.612) -- 0:01:27
475000 -- (-1054.830) (-1054.415) (-1056.820) [-1051.911] * (-1053.841) [-1054.164] (-1060.799) (-1056.768) -- 0:01:27
Average standard deviation of split frequencies: 0.000000
475500 -- (-1050.581) (-1053.213) [-1051.994] (-1054.307) * (-1057.128) (-1055.519) [-1058.674] (-1059.478) -- 0:01:27
476000 -- (-1050.838) (-1055.200) [-1051.600] (-1053.283) * (-1054.900) (-1054.909) [-1059.708] (-1056.083) -- 0:01:26
476500 -- [-1054.536] (-1054.643) (-1054.380) (-1055.362) * (-1057.773) [-1053.540] (-1055.508) (-1055.174) -- 0:01:26
477000 -- (-1050.889) [-1051.570] (-1063.000) (-1055.172) * [-1054.531] (-1054.747) (-1057.806) (-1056.784) -- 0:01:26
477500 -- (-1063.877) (-1058.207) (-1057.429) [-1052.400] * (-1052.164) (-1054.245) (-1054.859) [-1052.036] -- 0:01:26
478000 -- [-1053.743] (-1056.090) (-1055.531) (-1049.744) * (-1060.898) (-1055.673) (-1051.748) [-1049.745] -- 0:01:26
478500 -- (-1056.196) (-1059.774) (-1056.115) [-1055.435] * (-1054.640) (-1056.688) [-1054.323] (-1051.885) -- 0:01:26
479000 -- (-1052.253) (-1052.845) (-1052.976) [-1058.017] * (-1054.304) [-1056.928] (-1055.893) (-1054.231) -- 0:01:25
479500 -- [-1053.995] (-1058.545) (-1063.102) (-1054.280) * [-1053.686] (-1059.839) (-1060.967) (-1060.825) -- 0:01:25
480000 -- [-1061.234] (-1056.054) (-1056.758) (-1051.002) * (-1054.341) (-1059.302) (-1054.448) [-1055.241] -- 0:01:26
Average standard deviation of split frequencies: 0.000000
480500 -- (-1055.504) (-1061.781) [-1052.828] (-1054.159) * (-1052.649) [-1052.579] (-1053.145) (-1050.198) -- 0:01:26
481000 -- (-1065.227) (-1057.367) (-1052.253) [-1055.282] * [-1053.244] (-1053.993) (-1059.607) (-1052.140) -- 0:01:26
481500 -- (-1059.001) (-1054.249) [-1052.174] (-1055.108) * (-1058.376) [-1054.975] (-1055.140) (-1051.103) -- 0:01:26
482000 -- [-1058.958] (-1049.994) (-1061.435) (-1053.138) * (-1057.092) (-1056.788) (-1055.820) [-1054.756] -- 0:01:25
482500 -- (-1061.768) (-1053.634) [-1052.141] (-1058.776) * (-1059.355) [-1051.654] (-1057.476) (-1052.166) -- 0:01:25
483000 -- [-1055.225] (-1057.275) (-1056.772) (-1051.638) * (-1052.148) [-1053.662] (-1056.362) (-1053.873) -- 0:01:25
483500 -- (-1057.741) [-1058.162] (-1056.347) (-1050.118) * (-1058.706) [-1051.314] (-1052.506) (-1065.720) -- 0:01:25
484000 -- (-1055.206) (-1054.331) [-1051.860] (-1065.918) * [-1056.767] (-1057.286) (-1058.510) (-1056.109) -- 0:01:25
484500 -- (-1052.878) [-1056.490] (-1052.942) (-1050.915) * (-1054.259) (-1051.049) (-1059.459) [-1059.873] -- 0:01:25
485000 -- (-1051.940) [-1050.483] (-1058.234) (-1055.522) * (-1053.697) [-1052.921] (-1055.086) (-1059.818) -- 0:01:24
Average standard deviation of split frequencies: 0.000000
485500 -- (-1052.836) (-1055.163) [-1051.631] (-1060.032) * (-1055.905) [-1052.553] (-1050.995) (-1055.866) -- 0:01:25
486000 -- (-1050.524) [-1054.285] (-1051.127) (-1057.574) * (-1060.519) (-1057.004) [-1053.190] (-1051.034) -- 0:01:25
486500 -- [-1057.203] (-1056.941) (-1053.394) (-1056.473) * (-1059.293) (-1058.753) (-1058.490) [-1063.134] -- 0:01:25
487000 -- (-1059.132) (-1054.494) (-1054.788) [-1053.924] * [-1053.604] (-1056.735) (-1059.683) (-1057.549) -- 0:01:25
487500 -- (-1055.294) (-1054.459) (-1056.437) [-1054.790] * (-1056.879) (-1053.005) [-1053.448] (-1063.743) -- 0:01:25
488000 -- (-1052.629) [-1049.697] (-1057.449) (-1060.699) * [-1056.699] (-1050.294) (-1052.890) (-1070.206) -- 0:01:24
488500 -- [-1050.169] (-1054.152) (-1057.351) (-1056.859) * (-1050.664) (-1053.001) [-1051.944] (-1062.608) -- 0:01:24
489000 -- (-1056.163) (-1056.356) [-1056.235] (-1061.140) * (-1055.136) (-1051.191) [-1052.282] (-1057.761) -- 0:01:24
489500 -- (-1063.771) [-1059.218] (-1051.102) (-1061.372) * (-1058.247) [-1051.865] (-1051.880) (-1059.285) -- 0:01:24
490000 -- (-1057.994) (-1059.502) [-1052.762] (-1058.104) * (-1055.216) (-1052.192) (-1052.537) [-1058.067] -- 0:01:24
Average standard deviation of split frequencies: 0.000000
490500 -- [-1058.987] (-1054.781) (-1056.745) (-1061.075) * (-1053.673) [-1052.372] (-1054.980) (-1057.261) -- 0:01:24
491000 -- (-1052.542) [-1054.050] (-1060.178) (-1058.452) * (-1055.107) (-1053.596) [-1051.002] (-1053.836) -- 0:01:23
491500 -- [-1052.211] (-1059.555) (-1059.444) (-1056.925) * (-1055.148) (-1055.584) [-1056.833] (-1062.557) -- 0:01:24
492000 -- (-1054.722) (-1054.949) [-1053.575] (-1051.188) * (-1056.493) (-1057.054) [-1054.662] (-1062.514) -- 0:01:24
492500 -- (-1050.336) (-1057.077) (-1057.605) [-1048.196] * [-1056.706] (-1061.812) (-1051.151) (-1054.506) -- 0:01:24
493000 -- (-1054.595) (-1054.252) (-1061.531) [-1051.423] * (-1061.642) (-1062.805) (-1056.998) [-1056.487] -- 0:01:24
493500 -- (-1059.882) [-1055.856] (-1052.391) (-1056.895) * (-1051.922) (-1061.130) (-1054.237) [-1051.581] -- 0:01:24
494000 -- (-1050.798) [-1050.861] (-1058.815) (-1057.698) * (-1052.709) (-1056.481) [-1051.389] (-1052.286) -- 0:01:23
494500 -- (-1056.046) (-1060.048) [-1051.284] (-1052.348) * (-1058.355) (-1053.323) (-1052.797) [-1049.236] -- 0:01:23
495000 -- (-1066.838) (-1054.031) (-1056.654) [-1052.394] * (-1058.842) (-1057.567) [-1054.981] (-1059.634) -- 0:01:23
Average standard deviation of split frequencies: 0.000000
495500 -- (-1062.705) (-1053.893) (-1053.135) [-1055.911] * [-1053.247] (-1052.680) (-1054.862) (-1058.525) -- 0:01:23
496000 -- (-1059.522) (-1052.563) (-1056.146) [-1056.315] * [-1050.510] (-1054.271) (-1053.023) (-1058.260) -- 0:01:23
496500 -- (-1056.439) (-1054.352) (-1055.395) [-1054.979] * [-1054.251] (-1051.179) (-1054.737) (-1058.260) -- 0:01:23
497000 -- (-1054.862) (-1056.837) (-1053.686) [-1057.996] * (-1055.920) [-1054.407] (-1055.342) (-1056.473) -- 0:01:22
497500 -- (-1059.436) [-1055.793] (-1053.174) (-1054.449) * (-1062.544) [-1060.251] (-1058.047) (-1058.515) -- 0:01:23
498000 -- (-1059.060) (-1050.456) [-1054.637] (-1051.193) * (-1054.662) (-1056.375) [-1053.850] (-1058.135) -- 0:01:23
498500 -- (-1050.737) [-1051.658] (-1054.664) (-1055.089) * (-1055.812) (-1055.208) (-1059.038) [-1054.325] -- 0:01:23
499000 -- (-1053.483) (-1051.809) (-1053.972) [-1055.920] * (-1053.443) (-1058.279) (-1057.443) [-1053.986] -- 0:01:23
499500 -- (-1056.342) [-1050.646] (-1054.935) (-1058.524) * (-1054.795) (-1051.787) [-1056.579] (-1060.407) -- 0:01:23
500000 -- (-1062.211) (-1056.424) [-1056.477] (-1054.418) * (-1055.063) (-1052.441) (-1052.218) [-1051.773] -- 0:01:23
Average standard deviation of split frequencies: 0.000000
500500 -- (-1064.338) [-1050.645] (-1055.363) (-1057.915) * (-1052.259) (-1055.259) (-1054.626) [-1054.358] -- 0:01:22
501000 -- (-1065.003) [-1055.572] (-1055.617) (-1053.690) * (-1057.563) (-1055.279) (-1052.111) [-1053.505] -- 0:01:22
501500 -- (-1061.032) (-1053.420) (-1057.850) [-1053.026] * (-1052.837) (-1052.718) [-1053.753] (-1057.068) -- 0:01:22
502000 -- (-1055.821) (-1056.756) [-1054.893] (-1055.459) * (-1051.143) (-1053.190) [-1055.471] (-1059.827) -- 0:01:22
502500 -- (-1057.041) [-1056.949] (-1057.978) (-1059.745) * (-1056.667) (-1053.798) (-1053.762) [-1055.270] -- 0:01:22
503000 -- (-1057.769) (-1058.627) [-1052.911] (-1055.200) * (-1054.994) [-1052.684] (-1059.844) (-1059.145) -- 0:01:22
503500 -- [-1052.781] (-1065.589) (-1054.604) (-1057.356) * (-1055.195) (-1054.821) (-1061.757) [-1059.378] -- 0:01:21
504000 -- (-1054.909) (-1056.510) [-1057.267] (-1059.418) * (-1057.801) [-1054.191] (-1056.635) (-1059.861) -- 0:01:22
504500 -- (-1054.696) (-1058.189) [-1056.365] (-1053.892) * (-1057.188) (-1060.771) [-1056.548] (-1055.675) -- 0:01:22
505000 -- [-1050.570] (-1062.672) (-1052.335) (-1054.674) * (-1052.471) [-1058.035] (-1054.544) (-1055.843) -- 0:01:22
Average standard deviation of split frequencies: 0.000000
505500 -- [-1050.757] (-1056.667) (-1057.413) (-1057.239) * (-1053.210) (-1060.423) [-1053.381] (-1062.230) -- 0:01:22
506000 -- (-1056.670) [-1056.297] (-1050.977) (-1054.802) * [-1052.771] (-1055.924) (-1057.626) (-1062.883) -- 0:01:22
506500 -- (-1059.092) [-1051.580] (-1058.846) (-1062.327) * (-1052.568) (-1052.382) [-1056.026] (-1065.655) -- 0:01:21
507000 -- (-1063.693) (-1056.172) [-1053.190] (-1061.961) * (-1050.010) [-1054.314] (-1053.600) (-1059.805) -- 0:01:21
507500 -- (-1059.156) (-1058.360) [-1048.811] (-1054.427) * [-1054.094] (-1054.415) (-1052.019) (-1057.036) -- 0:01:21
508000 -- (-1055.717) (-1058.918) (-1054.840) [-1056.940] * (-1053.520) [-1056.060] (-1062.640) (-1057.327) -- 0:01:21
508500 -- [-1055.376] (-1058.250) (-1063.173) (-1060.882) * (-1052.266) (-1056.620) (-1054.666) [-1056.953] -- 0:01:21
509000 -- (-1054.358) (-1054.887) [-1055.078] (-1053.219) * (-1054.726) (-1056.615) (-1059.017) [-1058.559] -- 0:01:21
509500 -- (-1056.986) (-1056.161) (-1052.699) [-1054.103] * [-1059.065] (-1057.074) (-1057.799) (-1059.985) -- 0:01:20
510000 -- (-1059.203) (-1051.744) [-1055.882] (-1053.672) * (-1057.131) [-1054.181] (-1053.693) (-1054.520) -- 0:01:21
Average standard deviation of split frequencies: 0.000000
510500 -- (-1053.456) (-1050.692) (-1054.271) [-1055.520] * (-1057.296) [-1054.276] (-1060.131) (-1060.927) -- 0:01:21
511000 -- (-1058.335) (-1051.006) [-1054.984] (-1062.152) * [-1053.079] (-1058.229) (-1058.016) (-1066.940) -- 0:01:21
511500 -- [-1053.658] (-1053.661) (-1051.699) (-1058.227) * (-1054.528) (-1055.230) (-1060.017) [-1058.150] -- 0:01:21
512000 -- (-1055.439) [-1062.427] (-1055.989) (-1050.913) * (-1054.905) (-1050.565) (-1057.426) [-1058.501] -- 0:01:21
512500 -- [-1053.694] (-1063.307) (-1060.967) (-1055.973) * [-1053.561] (-1054.681) (-1062.042) (-1055.935) -- 0:01:20
513000 -- (-1055.832) (-1053.453) [-1057.361] (-1056.852) * (-1055.466) (-1058.136) (-1053.554) [-1051.325] -- 0:01:20
513500 -- [-1056.008] (-1056.909) (-1052.685) (-1055.145) * (-1056.625) (-1057.048) (-1053.803) [-1051.566] -- 0:01:20
514000 -- (-1057.502) (-1061.220) [-1053.060] (-1051.976) * (-1058.366) (-1055.113) [-1054.785] (-1052.896) -- 0:01:20
514500 -- (-1056.422) (-1053.993) [-1053.894] (-1062.044) * (-1052.646) (-1059.242) (-1057.391) [-1055.845] -- 0:01:20
515000 -- (-1058.664) (-1052.657) [-1051.309] (-1063.079) * (-1056.636) (-1058.883) [-1051.356] (-1059.476) -- 0:01:20
Average standard deviation of split frequencies: 0.000000
515500 -- (-1056.124) [-1053.703] (-1053.898) (-1056.347) * (-1052.415) [-1058.760] (-1055.761) (-1056.796) -- 0:01:19
516000 -- (-1059.449) (-1059.648) [-1055.736] (-1053.099) * (-1055.810) (-1057.223) [-1054.878] (-1057.619) -- 0:01:20
516500 -- (-1054.018) (-1057.820) [-1055.006] (-1054.322) * (-1049.816) (-1056.144) (-1055.294) [-1053.916] -- 0:01:20
517000 -- (-1055.777) (-1059.038) [-1056.864] (-1055.144) * [-1053.353] (-1057.355) (-1052.150) (-1058.304) -- 0:01:20
517500 -- (-1056.050) (-1050.562) [-1056.986] (-1057.298) * (-1054.218) [-1057.082] (-1057.886) (-1062.222) -- 0:01:20
518000 -- (-1055.651) (-1056.310) (-1059.639) [-1059.330] * (-1053.504) (-1054.342) [-1050.676] (-1061.453) -- 0:01:20
518500 -- (-1053.257) (-1052.424) (-1062.315) [-1060.922] * [-1051.471] (-1055.579) (-1056.237) (-1064.860) -- 0:01:19
519000 -- (-1062.043) (-1053.600) (-1066.740) [-1055.702] * (-1061.641) (-1057.763) (-1059.851) [-1060.378] -- 0:01:19
519500 -- (-1054.379) [-1050.850] (-1066.167) (-1062.098) * (-1058.225) [-1055.831] (-1059.382) (-1058.904) -- 0:01:19
520000 -- (-1054.498) (-1052.223) (-1059.689) [-1058.956] * (-1056.874) (-1058.256) (-1055.634) [-1054.826] -- 0:01:19
Average standard deviation of split frequencies: 0.000000
520500 -- (-1055.798) [-1049.884] (-1059.944) (-1056.921) * (-1050.948) (-1060.476) [-1051.918] (-1063.108) -- 0:01:19
521000 -- (-1053.739) (-1054.592) [-1055.379] (-1054.378) * (-1054.825) [-1054.705] (-1054.196) (-1061.019) -- 0:01:19
521500 -- (-1058.630) (-1058.877) (-1055.292) [-1051.276] * [-1052.245] (-1058.370) (-1058.684) (-1060.028) -- 0:01:18
522000 -- (-1056.376) [-1058.868] (-1055.690) (-1060.448) * (-1058.274) [-1055.236] (-1056.370) (-1071.240) -- 0:01:19
522500 -- (-1052.422) (-1058.067) [-1052.797] (-1055.584) * (-1059.581) (-1052.096) [-1054.867] (-1060.235) -- 0:01:19
523000 -- [-1049.579] (-1053.303) (-1054.205) (-1057.749) * (-1050.795) [-1053.115] (-1051.400) (-1057.971) -- 0:01:19
523500 -- [-1052.517] (-1054.716) (-1055.302) (-1056.616) * (-1054.104) [-1054.858] (-1051.313) (-1055.848) -- 0:01:19
524000 -- (-1055.622) [-1050.898] (-1054.099) (-1057.229) * (-1056.650) (-1056.488) (-1053.540) [-1054.494] -- 0:01:19
524500 -- (-1054.642) (-1058.203) [-1050.871] (-1058.995) * (-1059.409) (-1056.842) (-1054.120) [-1056.309] -- 0:01:18
525000 -- (-1053.793) (-1058.458) [-1050.525] (-1056.227) * (-1054.834) (-1052.848) [-1054.221] (-1055.466) -- 0:01:18
Average standard deviation of split frequencies: 0.000000
525500 -- (-1054.612) (-1053.424) [-1055.663] (-1056.424) * [-1058.227] (-1055.743) (-1052.642) (-1054.465) -- 0:01:18
526000 -- (-1055.166) (-1059.900) [-1054.908] (-1058.908) * (-1052.285) (-1052.853) [-1055.859] (-1054.122) -- 0:01:18
526500 -- (-1061.261) (-1053.652) [-1051.022] (-1063.952) * [-1056.850] (-1055.110) (-1054.008) (-1054.096) -- 0:01:18
527000 -- [-1054.345] (-1054.805) (-1052.389) (-1061.931) * (-1062.110) (-1055.736) [-1052.631] (-1059.289) -- 0:01:18
527500 -- (-1052.563) (-1056.145) [-1054.240] (-1058.802) * (-1060.627) (-1058.451) (-1054.769) [-1056.921] -- 0:01:17
528000 -- (-1056.155) (-1051.534) [-1053.777] (-1051.485) * (-1055.833) [-1056.608] (-1060.029) (-1060.728) -- 0:01:18
528500 -- (-1055.565) [-1052.938] (-1056.054) (-1055.393) * [-1052.393] (-1051.381) (-1067.119) (-1061.263) -- 0:01:18
529000 -- (-1054.819) (-1053.439) (-1059.460) [-1053.330] * [-1055.534] (-1054.634) (-1062.726) (-1061.249) -- 0:01:18
529500 -- (-1063.069) [-1051.129] (-1052.506) (-1053.438) * (-1057.006) [-1057.483] (-1054.785) (-1059.120) -- 0:01:18
530000 -- (-1051.740) [-1052.865] (-1052.050) (-1056.556) * (-1056.316) (-1056.501) [-1054.262] (-1053.830) -- 0:01:18
Average standard deviation of split frequencies: 0.000000
530500 -- (-1056.548) (-1052.504) (-1051.387) [-1051.580] * (-1058.757) (-1056.413) [-1054.360] (-1057.900) -- 0:01:17
531000 -- (-1056.412) (-1060.901) [-1056.259] (-1052.461) * [-1056.315] (-1064.744) (-1053.686) (-1053.923) -- 0:01:17
531500 -- (-1055.562) (-1054.170) [-1051.785] (-1054.674) * (-1055.935) (-1066.765) (-1054.903) [-1051.279] -- 0:01:17
532000 -- (-1055.062) (-1059.450) (-1053.355) [-1052.560] * (-1051.652) (-1055.517) (-1052.392) [-1063.346] -- 0:01:17
532500 -- (-1052.324) (-1051.589) [-1056.248] (-1052.427) * (-1056.180) (-1061.034) (-1053.237) [-1056.886] -- 0:01:17
533000 -- (-1054.225) (-1056.153) (-1059.244) [-1049.097] * (-1053.696) (-1062.474) [-1059.067] (-1059.568) -- 0:01:17
533500 -- (-1050.030) (-1056.071) [-1052.730] (-1054.093) * [-1051.843] (-1058.382) (-1051.112) (-1061.263) -- 0:01:16
534000 -- [-1053.593] (-1052.596) (-1055.382) (-1054.894) * (-1057.727) [-1060.236] (-1052.613) (-1064.946) -- 0:01:17
534500 -- [-1051.023] (-1051.980) (-1056.794) (-1049.626) * [-1053.718] (-1057.565) (-1056.232) (-1055.600) -- 0:01:17
535000 -- (-1059.147) (-1052.409) [-1054.630] (-1056.162) * [-1059.864] (-1053.785) (-1057.426) (-1056.508) -- 0:01:17
Average standard deviation of split frequencies: 0.000000
535500 -- (-1056.373) (-1053.674) [-1052.793] (-1058.529) * (-1058.172) [-1064.401] (-1054.023) (-1056.576) -- 0:01:17
536000 -- [-1051.746] (-1053.739) (-1061.047) (-1064.919) * (-1057.117) (-1056.335) (-1055.247) [-1050.948] -- 0:01:17
536500 -- (-1052.485) [-1056.146] (-1051.851) (-1056.283) * (-1057.415) (-1058.538) (-1053.421) [-1057.164] -- 0:01:16
537000 -- (-1051.427) (-1055.704) (-1056.747) [-1058.265] * (-1056.177) (-1057.994) [-1055.317] (-1051.033) -- 0:01:16
537500 -- (-1056.130) [-1056.516] (-1054.891) (-1056.777) * (-1058.669) (-1054.981) [-1058.001] (-1060.969) -- 0:01:16
538000 -- (-1055.942) (-1061.908) (-1052.649) [-1058.497] * [-1053.252] (-1061.118) (-1052.934) (-1055.473) -- 0:01:16
538500 -- [-1053.333] (-1051.186) (-1058.895) (-1054.213) * (-1050.037) (-1058.177) (-1059.291) [-1052.879] -- 0:01:16
539000 -- (-1050.236) [-1054.896] (-1064.591) (-1054.225) * (-1056.743) (-1051.871) [-1057.112] (-1055.436) -- 0:01:16
539500 -- (-1059.503) [-1055.301] (-1058.412) (-1060.054) * (-1051.563) (-1056.066) [-1054.441] (-1058.923) -- 0:01:15
540000 -- (-1056.432) (-1057.612) [-1056.771] (-1059.504) * (-1053.660) [-1053.161] (-1054.251) (-1050.500) -- 0:01:16
Average standard deviation of split frequencies: 0.000000
540500 -- (-1061.674) (-1062.453) (-1054.542) [-1055.374] * (-1058.188) (-1052.481) (-1058.305) [-1052.466] -- 0:01:16
541000 -- (-1056.347) (-1053.840) (-1052.264) [-1049.670] * [-1053.099] (-1058.948) (-1058.466) (-1053.107) -- 0:01:16
541500 -- [-1051.170] (-1057.675) (-1055.828) (-1053.326) * [-1051.162] (-1066.715) (-1063.509) (-1065.759) -- 0:01:16
542000 -- (-1056.366) (-1057.168) [-1053.602] (-1060.344) * [-1052.830] (-1062.102) (-1059.504) (-1055.670) -- 0:01:16
542500 -- (-1061.990) (-1058.150) (-1052.077) [-1056.938] * (-1050.735) (-1057.300) [-1056.265] (-1054.361) -- 0:01:15
543000 -- (-1058.282) [-1056.852] (-1054.860) (-1053.767) * (-1058.866) (-1057.031) (-1055.252) [-1057.337] -- 0:01:15
543500 -- (-1053.910) [-1058.851] (-1054.449) (-1053.831) * (-1061.282) (-1057.960) (-1063.488) [-1054.493] -- 0:01:15
544000 -- [-1055.822] (-1056.202) (-1059.379) (-1053.600) * (-1060.032) [-1056.654] (-1056.049) (-1056.411) -- 0:01:15
544500 -- (-1064.252) (-1056.415) (-1057.241) [-1053.136] * (-1055.273) (-1054.066) (-1058.212) [-1056.338] -- 0:01:15
545000 -- [-1054.598] (-1056.085) (-1062.493) (-1054.930) * (-1057.388) (-1050.560) [-1060.306] (-1055.929) -- 0:01:15
Average standard deviation of split frequencies: 0.000000
545500 -- [-1054.977] (-1056.014) (-1054.959) (-1055.280) * (-1050.065) (-1052.132) (-1052.370) [-1054.887] -- 0:01:14
546000 -- (-1059.855) (-1063.256) (-1055.584) [-1060.599] * (-1054.877) [-1053.878] (-1057.561) (-1056.374) -- 0:01:15
546500 -- (-1052.903) (-1058.832) (-1052.592) [-1054.381] * [-1057.152] (-1052.047) (-1055.249) (-1055.810) -- 0:01:15
547000 -- [-1057.226] (-1054.742) (-1053.494) (-1052.715) * [-1058.567] (-1061.696) (-1053.935) (-1060.972) -- 0:01:15
547500 -- [-1056.563] (-1055.062) (-1058.815) (-1053.016) * (-1066.538) (-1054.473) [-1052.834] (-1053.356) -- 0:01:15
548000 -- (-1053.045) (-1052.391) [-1054.524] (-1055.758) * (-1060.793) (-1061.615) (-1055.131) [-1051.758] -- 0:01:15
548500 -- (-1061.595) (-1052.326) [-1056.463] (-1054.872) * (-1064.793) (-1059.168) (-1061.105) [-1050.335] -- 0:01:14
549000 -- [-1057.646] (-1059.934) (-1054.160) (-1057.484) * (-1072.895) [-1050.008] (-1062.342) (-1055.058) -- 0:01:14
549500 -- (-1054.700) (-1053.324) (-1057.505) [-1053.901] * [-1061.010] (-1056.642) (-1053.238) (-1050.854) -- 0:01:14
550000 -- (-1060.677) [-1056.138] (-1056.707) (-1055.500) * (-1062.242) [-1051.359] (-1058.365) (-1053.789) -- 0:01:14
Average standard deviation of split frequencies: 0.000000
550500 -- [-1052.786] (-1057.735) (-1055.140) (-1062.518) * (-1061.001) [-1054.741] (-1051.780) (-1053.192) -- 0:01:14
551000 -- (-1056.738) [-1054.007] (-1058.784) (-1053.771) * (-1061.603) (-1056.223) [-1050.449] (-1059.242) -- 0:01:14
551500 -- (-1067.100) (-1056.586) [-1049.789] (-1055.146) * (-1053.570) (-1055.173) (-1053.487) [-1059.383] -- 0:01:14
552000 -- (-1063.012) [-1052.574] (-1051.515) (-1054.002) * (-1055.333) (-1053.508) [-1055.297] (-1061.134) -- 0:01:14
552500 -- (-1059.383) [-1058.121] (-1059.871) (-1059.477) * (-1056.706) (-1055.270) (-1052.605) [-1055.330] -- 0:01:14
553000 -- (-1059.053) [-1055.888] (-1058.090) (-1053.486) * (-1050.187) (-1051.615) [-1053.585] (-1058.503) -- 0:01:14
553500 -- (-1056.372) (-1052.011) (-1061.320) [-1054.782] * (-1055.248) (-1059.256) (-1050.741) [-1055.496] -- 0:01:14
554000 -- (-1055.297) (-1053.386) [-1059.178] (-1055.585) * (-1055.068) (-1048.739) [-1054.483] (-1055.064) -- 0:01:14
554500 -- (-1057.693) (-1051.587) (-1062.343) [-1053.939] * (-1053.924) [-1052.845] (-1054.533) (-1056.181) -- 0:01:13
555000 -- (-1057.044) (-1049.882) (-1068.646) [-1053.786] * (-1053.908) (-1054.338) [-1058.774] (-1059.808) -- 0:01:13
Average standard deviation of split frequencies: 0.000000
555500 -- (-1055.254) [-1054.703] (-1065.343) (-1052.596) * (-1056.219) (-1049.486) [-1051.055] (-1052.663) -- 0:01:13
556000 -- [-1050.353] (-1058.578) (-1057.001) (-1054.009) * (-1066.772) [-1053.405] (-1059.231) (-1054.395) -- 0:01:13
556500 -- (-1058.307) (-1052.553) (-1057.492) [-1053.282] * [-1054.662] (-1055.880) (-1050.890) (-1054.051) -- 0:01:13
557000 -- [-1050.289] (-1057.004) (-1057.091) (-1056.214) * [-1051.925] (-1050.707) (-1062.514) (-1052.189) -- 0:01:13
557500 -- (-1056.676) (-1050.682) (-1056.810) [-1053.463] * (-1051.683) (-1054.685) [-1052.262] (-1059.592) -- 0:01:13
558000 -- (-1054.894) (-1054.954) [-1055.527] (-1052.560) * (-1050.553) (-1051.327) (-1054.407) [-1055.082] -- 0:01:13
558500 -- (-1049.095) [-1056.956] (-1053.384) (-1052.155) * [-1053.295] (-1060.432) (-1055.199) (-1056.658) -- 0:01:13
559000 -- (-1052.772) (-1052.902) [-1056.406] (-1055.205) * [-1054.490] (-1058.770) (-1053.552) (-1058.012) -- 0:01:13
559500 -- (-1053.608) (-1057.768) [-1059.072] (-1059.625) * (-1057.351) (-1051.388) (-1053.292) [-1057.178] -- 0:01:13
560000 -- [-1054.395] (-1050.195) (-1053.747) (-1057.342) * (-1054.603) (-1056.274) (-1057.394) [-1050.903] -- 0:01:13
Average standard deviation of split frequencies: 0.000000
560500 -- (-1055.221) (-1055.129) (-1052.261) [-1055.373] * (-1053.980) (-1053.961) [-1054.567] (-1055.053) -- 0:01:12
561000 -- (-1054.591) (-1059.302) (-1063.316) [-1052.661] * (-1054.610) (-1060.125) (-1051.910) [-1053.609] -- 0:01:12
561500 -- (-1053.677) (-1053.135) (-1061.977) [-1052.302] * [-1052.949] (-1065.226) (-1060.537) (-1062.056) -- 0:01:12
562000 -- (-1055.514) (-1054.785) (-1053.123) [-1054.438] * (-1063.363) (-1053.958) (-1057.103) [-1056.757] -- 0:01:12
562500 -- (-1055.680) [-1051.665] (-1051.860) (-1053.625) * (-1054.885) [-1059.595] (-1056.601) (-1051.098) -- 0:01:12
563000 -- (-1065.523) (-1054.462) [-1053.886] (-1051.571) * (-1056.296) [-1052.307] (-1054.930) (-1064.000) -- 0:01:12
563500 -- (-1062.665) (-1052.424) [-1055.086] (-1049.481) * [-1055.312] (-1054.116) (-1060.001) (-1058.236) -- 0:01:12
564000 -- [-1055.684] (-1058.584) (-1054.240) (-1052.605) * (-1055.675) (-1056.215) (-1053.672) [-1058.399] -- 0:01:12
564500 -- (-1054.319) [-1055.015] (-1062.058) (-1056.172) * [-1053.543] (-1065.169) (-1051.508) (-1053.458) -- 0:01:12
565000 -- (-1054.906) (-1053.069) (-1062.325) [-1061.790] * (-1056.478) (-1060.521) (-1055.384) [-1052.609] -- 0:01:12
Average standard deviation of split frequencies: 0.000000
565500 -- (-1065.950) [-1055.125] (-1054.319) (-1052.135) * [-1058.065] (-1055.620) (-1053.663) (-1057.647) -- 0:01:12
566000 -- [-1050.184] (-1052.814) (-1057.625) (-1050.739) * (-1059.257) [-1051.185] (-1054.280) (-1056.608) -- 0:01:12
566500 -- (-1063.055) (-1054.824) [-1056.825] (-1054.006) * (-1055.336) (-1054.001) [-1051.888] (-1054.658) -- 0:01:11
567000 -- (-1052.717) (-1053.306) [-1053.668] (-1055.058) * (-1054.712) (-1058.174) (-1055.654) [-1052.133] -- 0:01:11
567500 -- (-1053.794) (-1051.488) [-1054.161] (-1056.605) * [-1055.434] (-1056.417) (-1053.788) (-1050.024) -- 0:01:11
568000 -- (-1054.553) [-1054.725] (-1056.902) (-1055.942) * [-1051.186] (-1055.730) (-1055.126) (-1054.548) -- 0:01:11
568500 -- (-1055.464) [-1051.387] (-1060.471) (-1057.884) * (-1061.643) (-1055.392) (-1055.881) [-1056.637] -- 0:01:11
569000 -- (-1055.271) [-1052.762] (-1050.777) (-1055.083) * (-1056.471) [-1050.054] (-1056.671) (-1056.600) -- 0:01:11
569500 -- [-1057.454] (-1055.247) (-1054.703) (-1051.628) * (-1062.598) [-1054.023] (-1051.402) (-1053.417) -- 0:01:11
570000 -- (-1051.648) (-1054.229) (-1053.134) [-1054.597] * (-1057.010) [-1059.128] (-1051.133) (-1054.453) -- 0:01:11
Average standard deviation of split frequencies: 0.000000
570500 -- (-1051.968) [-1051.778] (-1057.587) (-1059.098) * (-1055.899) (-1054.769) [-1055.460] (-1056.550) -- 0:01:11
571000 -- (-1055.383) [-1056.403] (-1059.600) (-1053.785) * (-1052.928) (-1054.261) (-1055.914) [-1052.166] -- 0:01:11
571500 -- (-1050.991) [-1050.010] (-1058.608) (-1055.707) * (-1057.621) (-1051.961) (-1055.935) [-1050.979] -- 0:01:11
572000 -- (-1052.862) (-1060.766) (-1055.966) [-1054.180] * (-1056.742) (-1059.249) (-1058.189) [-1050.198] -- 0:01:11
572500 -- (-1063.821) (-1058.322) (-1053.891) [-1058.389] * (-1056.679) (-1056.139) (-1054.581) [-1050.161] -- 0:01:10
573000 -- [-1059.571] (-1055.774) (-1053.978) (-1056.927) * (-1054.198) [-1054.941] (-1055.612) (-1051.955) -- 0:01:10
573500 -- [-1055.750] (-1058.237) (-1057.124) (-1058.553) * (-1053.062) (-1058.221) [-1055.572] (-1055.501) -- 0:01:10
574000 -- (-1056.760) (-1055.124) (-1057.256) [-1051.611] * [-1052.537] (-1055.739) (-1061.038) (-1056.574) -- 0:01:10
574500 -- (-1053.969) (-1055.172) [-1057.970] (-1057.265) * [-1050.439] (-1057.203) (-1050.422) (-1058.234) -- 0:01:10
575000 -- (-1055.379) (-1055.794) [-1060.298] (-1054.496) * [-1056.274] (-1061.953) (-1051.943) (-1059.253) -- 0:01:10
Average standard deviation of split frequencies: 0.000000
575500 -- (-1060.871) (-1057.257) [-1054.472] (-1054.166) * (-1058.422) (-1055.210) (-1055.554) [-1058.311] -- 0:01:10
576000 -- (-1056.907) (-1055.942) (-1053.083) [-1053.056] * (-1067.185) (-1055.457) (-1051.967) [-1064.481] -- 0:01:10
576500 -- (-1066.379) (-1058.170) (-1050.600) [-1052.036] * (-1051.132) (-1050.981) [-1055.219] (-1059.053) -- 0:01:10
577000 -- (-1052.806) [-1056.042] (-1058.140) (-1050.679) * (-1058.075) [-1052.387] (-1052.179) (-1057.333) -- 0:01:10
577500 -- (-1054.574) [-1050.257] (-1059.619) (-1051.376) * [-1051.461] (-1058.118) (-1059.510) (-1057.553) -- 0:01:10
578000 -- (-1053.213) [-1049.463] (-1052.025) (-1057.301) * [-1054.315] (-1052.962) (-1060.447) (-1051.988) -- 0:01:10
578500 -- [-1051.822] (-1053.712) (-1053.348) (-1052.757) * (-1050.761) [-1058.336] (-1054.690) (-1056.623) -- 0:01:09
579000 -- (-1055.766) (-1056.289) [-1054.157] (-1053.128) * (-1058.076) (-1054.915) [-1061.722] (-1056.468) -- 0:01:09
579500 -- (-1055.855) (-1066.028) (-1060.971) [-1051.856] * (-1056.569) (-1060.461) [-1059.373] (-1055.606) -- 0:01:09
580000 -- (-1054.348) [-1055.984] (-1064.753) (-1052.639) * (-1057.793) (-1055.984) [-1053.001] (-1055.334) -- 0:01:09
Average standard deviation of split frequencies: 0.000000
580500 -- (-1057.524) [-1055.263] (-1053.910) (-1049.606) * (-1061.224) (-1056.435) (-1052.793) [-1052.289] -- 0:01:09
581000 -- (-1057.244) (-1058.913) [-1052.120] (-1052.376) * (-1059.047) (-1059.475) (-1055.894) [-1050.801] -- 0:01:09
581500 -- (-1063.072) (-1061.395) (-1055.129) [-1051.384] * (-1056.004) [-1053.737] (-1055.118) (-1059.411) -- 0:01:09
582000 -- (-1057.981) (-1050.792) (-1051.006) [-1055.049] * (-1053.506) (-1058.285) (-1056.798) [-1055.254] -- 0:01:08
582500 -- (-1060.725) (-1055.487) (-1052.875) [-1055.745] * (-1058.204) (-1053.421) (-1066.899) [-1057.122] -- 0:01:09
583000 -- (-1058.022) (-1051.860) [-1058.825] (-1056.464) * (-1058.625) [-1052.272] (-1062.163) (-1052.789) -- 0:01:09
583500 -- (-1053.038) (-1055.946) (-1059.073) [-1056.031] * (-1053.599) (-1059.876) [-1055.774] (-1056.043) -- 0:01:09
584000 -- (-1056.804) (-1056.083) (-1055.475) [-1050.290] * (-1058.762) (-1051.479) (-1052.061) [-1054.910] -- 0:01:09
584500 -- (-1054.341) (-1055.074) (-1056.052) [-1054.325] * (-1053.772) (-1057.799) [-1055.135] (-1060.726) -- 0:01:08
585000 -- (-1058.511) (-1056.902) [-1066.680] (-1054.684) * (-1059.907) (-1062.380) [-1052.739] (-1057.139) -- 0:01:08
Average standard deviation of split frequencies: 0.000000
585500 -- (-1059.406) (-1055.251) [-1057.278] (-1059.951) * (-1057.117) (-1062.532) [-1059.441] (-1054.226) -- 0:01:08
586000 -- (-1057.400) (-1060.266) [-1056.140] (-1063.602) * [-1055.277] (-1068.404) (-1055.318) (-1055.764) -- 0:01:08
586500 -- [-1055.491] (-1060.935) (-1060.743) (-1053.165) * (-1055.173) (-1055.527) [-1055.208] (-1055.957) -- 0:01:08
587000 -- [-1056.528] (-1053.298) (-1063.413) (-1060.920) * (-1056.049) [-1049.917] (-1056.439) (-1055.832) -- 0:01:08
587500 -- (-1054.731) (-1051.807) [-1052.285] (-1059.370) * [-1056.169] (-1049.337) (-1061.897) (-1052.062) -- 0:01:08
588000 -- (-1052.111) [-1051.628] (-1055.934) (-1053.457) * (-1059.681) (-1051.621) (-1056.927) [-1052.858] -- 0:01:07
588500 -- (-1055.570) [-1057.757] (-1059.076) (-1059.144) * (-1055.875) [-1052.824] (-1062.080) (-1051.206) -- 0:01:08
589000 -- (-1055.495) (-1051.387) (-1054.749) [-1054.314] * [-1053.640] (-1057.101) (-1054.545) (-1056.075) -- 0:01:08
589500 -- [-1061.223] (-1054.960) (-1050.729) (-1055.268) * (-1050.648) (-1056.908) (-1054.353) [-1059.899] -- 0:01:08
590000 -- [-1062.327] (-1053.388) (-1050.638) (-1053.099) * [-1056.042] (-1053.835) (-1056.746) (-1054.340) -- 0:01:08
Average standard deviation of split frequencies: 0.000000
590500 -- (-1058.548) (-1059.924) (-1051.940) [-1050.647] * [-1051.007] (-1054.230) (-1057.314) (-1060.854) -- 0:01:07
591000 -- (-1061.072) (-1055.959) (-1057.060) [-1054.178] * (-1055.957) (-1054.634) (-1060.661) [-1060.890] -- 0:01:07
591500 -- (-1056.532) (-1056.161) (-1056.291) [-1053.247] * (-1049.912) (-1053.268) [-1057.994] (-1054.209) -- 0:01:07
592000 -- (-1057.247) (-1060.266) [-1056.456] (-1051.895) * [-1052.186] (-1055.864) (-1055.556) (-1056.604) -- 0:01:07
592500 -- (-1056.729) (-1053.436) [-1055.397] (-1055.961) * (-1056.783) (-1060.273) [-1055.288] (-1058.859) -- 0:01:07
593000 -- (-1056.812) (-1058.747) (-1055.819) [-1054.760] * [-1053.145] (-1058.240) (-1054.251) (-1062.487) -- 0:01:07
593500 -- (-1058.508) [-1051.513] (-1053.692) (-1053.482) * (-1060.251) [-1053.083] (-1053.608) (-1065.299) -- 0:01:07
594000 -- [-1052.428] (-1057.486) (-1055.014) (-1051.748) * (-1053.923) (-1050.203) [-1050.841] (-1064.917) -- 0:01:06
594500 -- (-1051.059) (-1054.095) (-1050.776) [-1050.471] * (-1056.727) (-1053.801) (-1053.862) [-1056.914] -- 0:01:07
595000 -- (-1052.352) [-1056.720] (-1053.427) (-1063.095) * (-1058.113) [-1050.169] (-1051.956) (-1055.193) -- 0:01:07
Average standard deviation of split frequencies: 0.000000
595500 -- [-1050.795] (-1054.788) (-1052.906) (-1056.649) * (-1064.700) [-1053.615] (-1053.602) (-1054.398) -- 0:01:07
596000 -- (-1048.694) (-1054.421) [-1056.612] (-1052.837) * (-1055.189) (-1056.864) [-1052.257] (-1054.800) -- 0:01:07
596500 -- (-1055.159) (-1065.446) (-1055.277) [-1058.777] * (-1053.436) (-1061.958) [-1054.153] (-1055.831) -- 0:01:06
597000 -- (-1054.216) (-1054.175) (-1057.225) [-1053.403] * (-1052.230) (-1051.694) [-1055.759] (-1054.236) -- 0:01:06
597500 -- (-1057.008) [-1058.999] (-1053.827) (-1056.247) * (-1055.729) (-1054.391) (-1057.853) [-1051.159] -- 0:01:06
598000 -- (-1058.144) (-1054.086) (-1053.844) [-1054.869] * (-1060.622) [-1056.512] (-1054.717) (-1051.012) -- 0:01:06
598500 -- [-1057.111] (-1059.692) (-1063.821) (-1052.462) * (-1063.202) [-1050.458] (-1064.135) (-1053.417) -- 0:01:06
599000 -- [-1057.157] (-1055.550) (-1056.927) (-1059.377) * (-1060.262) (-1049.393) [-1053.806] (-1053.428) -- 0:01:06
599500 -- (-1054.741) (-1053.496) (-1060.584) [-1051.186] * (-1055.965) [-1051.901] (-1050.601) (-1055.064) -- 0:01:06
600000 -- (-1064.137) [-1050.732] (-1060.157) (-1055.783) * (-1056.346) [-1048.547] (-1056.812) (-1052.318) -- 0:01:06
Average standard deviation of split frequencies: 0.000000
600500 -- (-1052.813) [-1055.124] (-1054.253) (-1051.660) * (-1053.112) (-1057.852) (-1052.711) [-1054.064] -- 0:01:06
601000 -- (-1051.371) (-1054.673) (-1050.151) [-1052.042] * (-1054.726) [-1056.878] (-1055.382) (-1054.390) -- 0:01:06
601500 -- (-1052.388) (-1061.674) (-1056.089) [-1053.045] * (-1055.565) (-1067.418) [-1054.550] (-1053.126) -- 0:01:06
602000 -- (-1055.900) (-1053.414) [-1050.849] (-1058.189) * (-1059.950) (-1063.063) [-1054.773] (-1055.269) -- 0:01:06
602500 -- [-1056.718] (-1051.775) (-1061.906) (-1056.416) * [-1057.040] (-1063.954) (-1059.999) (-1054.830) -- 0:01:05
603000 -- [-1050.925] (-1060.959) (-1055.062) (-1055.042) * (-1056.631) (-1060.721) (-1060.410) [-1061.941] -- 0:01:05
603500 -- [-1055.577] (-1056.348) (-1054.909) (-1055.980) * [-1055.200] (-1056.034) (-1063.398) (-1057.841) -- 0:01:05
604000 -- (-1051.840) (-1062.341) (-1062.410) [-1050.272] * [-1057.001] (-1056.910) (-1057.403) (-1052.870) -- 0:01:05
604500 -- (-1052.819) [-1059.865] (-1056.213) (-1055.820) * (-1056.856) (-1057.165) [-1053.357] (-1049.541) -- 0:01:05
605000 -- (-1052.812) [-1052.636] (-1056.832) (-1056.424) * (-1054.545) (-1050.309) [-1060.656] (-1056.611) -- 0:01:05
Average standard deviation of split frequencies: 0.000000
605500 -- (-1057.876) (-1059.777) (-1056.600) [-1059.996] * (-1053.426) [-1051.042] (-1056.054) (-1055.609) -- 0:01:05
606000 -- (-1059.582) (-1057.608) [-1054.838] (-1053.684) * [-1056.151] (-1054.219) (-1062.035) (-1057.112) -- 0:01:05
606500 -- (-1061.777) [-1056.114] (-1049.959) (-1058.286) * (-1058.537) [-1057.072] (-1053.165) (-1050.929) -- 0:01:05
607000 -- (-1069.065) (-1057.290) [-1056.959] (-1060.280) * (-1063.876) (-1055.529) (-1051.282) [-1055.862] -- 0:01:05
607500 -- (-1055.756) (-1050.845) [-1055.828] (-1058.207) * (-1061.175) [-1058.133] (-1060.144) (-1057.931) -- 0:01:05
608000 -- (-1054.353) [-1052.242] (-1055.958) (-1058.714) * (-1056.924) (-1052.507) (-1060.982) [-1053.070] -- 0:01:05
608500 -- (-1056.593) [-1052.107] (-1053.208) (-1064.381) * (-1052.932) [-1056.748] (-1053.112) (-1059.623) -- 0:01:04
609000 -- (-1056.816) (-1057.573) [-1054.180] (-1060.209) * (-1056.323) [-1056.034] (-1052.396) (-1057.046) -- 0:01:04
609500 -- (-1059.998) [-1057.635] (-1052.767) (-1053.812) * (-1063.362) (-1052.736) (-1057.643) [-1054.537] -- 0:01:04
610000 -- (-1061.296) (-1056.928) [-1060.496] (-1050.273) * (-1052.563) (-1052.879) (-1059.271) [-1050.993] -- 0:01:04
Average standard deviation of split frequencies: 0.000000
610500 -- (-1057.613) (-1058.020) [-1050.134] (-1050.415) * (-1052.920) (-1056.107) (-1060.303) [-1055.314] -- 0:01:04
611000 -- [-1054.744] (-1054.409) (-1056.818) (-1053.492) * [-1055.066] (-1051.241) (-1051.435) (-1051.767) -- 0:01:04
611500 -- (-1056.477) (-1050.941) [-1051.661] (-1052.929) * [-1051.414] (-1056.562) (-1048.920) (-1061.145) -- 0:01:04
612000 -- (-1066.916) [-1051.602] (-1054.319) (-1053.900) * (-1059.725) (-1056.959) (-1056.497) [-1058.904] -- 0:01:04
612500 -- (-1057.660) (-1053.492) (-1056.282) [-1053.025] * (-1062.246) (-1056.897) (-1051.741) [-1052.819] -- 0:01:04
613000 -- (-1055.619) [-1053.274] (-1057.344) (-1052.484) * (-1060.310) (-1058.561) [-1053.361] (-1055.942) -- 0:01:04
613500 -- (-1057.432) (-1055.218) [-1058.120] (-1052.349) * (-1054.544) [-1052.835] (-1050.784) (-1056.503) -- 0:01:04
614000 -- (-1057.039) (-1060.288) [-1054.444] (-1059.264) * (-1054.660) (-1063.821) [-1052.214] (-1057.376) -- 0:01:04
614500 -- (-1058.874) [-1052.863] (-1054.844) (-1055.203) * [-1050.969] (-1058.419) (-1051.940) (-1058.354) -- 0:01:03
615000 -- (-1060.548) (-1053.130) (-1049.107) [-1063.535] * (-1053.143) [-1053.628] (-1054.161) (-1056.557) -- 0:01:03
Average standard deviation of split frequencies: 0.000000
615500 -- [-1057.407] (-1056.345) (-1053.007) (-1054.500) * [-1053.292] (-1056.834) (-1053.272) (-1058.636) -- 0:01:03
616000 -- [-1050.437] (-1055.102) (-1053.089) (-1059.232) * [-1053.602] (-1056.232) (-1051.666) (-1051.297) -- 0:01:03
616500 -- (-1053.051) [-1055.284] (-1060.152) (-1065.028) * (-1059.476) [-1054.655] (-1055.025) (-1053.641) -- 0:01:03
617000 -- [-1054.642] (-1057.525) (-1053.095) (-1059.309) * [-1052.963] (-1056.395) (-1050.152) (-1061.301) -- 0:01:03
617500 -- (-1057.437) (-1067.051) [-1055.255] (-1058.119) * (-1051.600) (-1058.899) (-1062.037) [-1055.214] -- 0:01:03
618000 -- (-1053.062) (-1053.473) [-1056.455] (-1050.879) * (-1051.683) (-1062.835) [-1053.637] (-1052.127) -- 0:01:03
618500 -- (-1055.040) (-1052.432) (-1060.318) [-1052.990] * (-1058.864) (-1060.288) (-1054.212) [-1054.789] -- 0:01:03
619000 -- (-1055.795) [-1059.068] (-1058.942) (-1054.113) * (-1053.484) [-1062.621] (-1055.164) (-1052.372) -- 0:01:03
619500 -- [-1055.442] (-1054.732) (-1053.421) (-1064.060) * [-1052.989] (-1066.668) (-1064.095) (-1058.605) -- 0:01:03
620000 -- (-1053.588) [-1052.216] (-1053.770) (-1053.364) * [-1052.108] (-1061.684) (-1054.603) (-1060.482) -- 0:01:03
Average standard deviation of split frequencies: 0.000000
620500 -- [-1056.298] (-1052.352) (-1054.502) (-1053.799) * (-1057.772) (-1066.799) [-1054.297] (-1054.519) -- 0:01:02
621000 -- [-1052.307] (-1057.224) (-1056.787) (-1056.163) * (-1059.126) (-1063.417) [-1051.475] (-1056.855) -- 0:01:02
621500 -- (-1053.935) [-1048.015] (-1060.748) (-1059.506) * (-1051.602) (-1062.340) (-1055.733) [-1053.752] -- 0:01:02
622000 -- (-1064.071) (-1056.326) (-1065.980) [-1058.855] * (-1052.659) (-1058.042) [-1054.636] (-1052.045) -- 0:01:02
622500 -- (-1055.235) [-1054.443] (-1059.844) (-1053.530) * (-1053.753) (-1059.293) [-1049.681] (-1052.538) -- 0:01:02
623000 -- (-1054.618) (-1050.995) (-1060.765) [-1055.015] * (-1060.037) [-1061.803] (-1053.786) (-1061.442) -- 0:01:02
623500 -- (-1051.210) (-1054.911) (-1059.939) [-1051.681] * (-1060.264) (-1052.931) (-1056.080) [-1058.227] -- 0:01:02
624000 -- (-1057.081) [-1057.995] (-1054.327) (-1054.444) * (-1055.880) [-1059.498] (-1058.665) (-1053.851) -- 0:01:02
624500 -- (-1051.087) [-1059.980] (-1061.535) (-1056.636) * (-1055.512) [-1058.612] (-1063.653) (-1055.945) -- 0:01:02
625000 -- [-1054.575] (-1059.597) (-1054.677) (-1052.963) * (-1057.627) (-1055.536) (-1058.484) [-1054.644] -- 0:01:02
Average standard deviation of split frequencies: 0.000000
625500 -- (-1053.984) (-1053.221) (-1052.330) [-1053.159] * [-1058.282] (-1063.254) (-1058.322) (-1052.794) -- 0:01:02
626000 -- (-1051.676) (-1053.100) [-1053.291] (-1053.510) * (-1054.153) (-1055.785) [-1054.991] (-1056.080) -- 0:01:02
626500 -- [-1052.929] (-1053.824) (-1056.704) (-1056.350) * (-1060.340) [-1054.206] (-1055.637) (-1056.479) -- 0:01:02
627000 -- (-1053.873) [-1053.649] (-1055.990) (-1061.672) * [-1056.786] (-1051.102) (-1056.661) (-1055.301) -- 0:01:01
627500 -- [-1057.668] (-1052.069) (-1056.557) (-1058.736) * (-1053.163) (-1054.992) (-1053.536) [-1049.998] -- 0:01:01
628000 -- (-1056.241) [-1053.004] (-1053.801) (-1060.885) * (-1054.937) (-1055.049) [-1052.996] (-1058.497) -- 0:01:01
628500 -- (-1050.022) (-1055.634) [-1055.982] (-1065.873) * (-1057.850) (-1051.807) (-1056.599) [-1052.650] -- 0:01:01
629000 -- (-1053.064) (-1052.748) (-1051.780) [-1054.486] * (-1057.312) (-1058.975) [-1054.196] (-1054.749) -- 0:01:01
629500 -- (-1057.583) (-1055.487) [-1053.175] (-1057.839) * [-1052.250] (-1058.019) (-1051.136) (-1058.886) -- 0:01:01
630000 -- (-1052.825) (-1056.556) [-1058.287] (-1059.692) * (-1060.029) (-1055.888) [-1055.359] (-1062.553) -- 0:01:01
Average standard deviation of split frequencies: 0.000000
630500 -- (-1049.144) (-1057.435) [-1053.356] (-1060.740) * (-1054.279) [-1050.416] (-1052.928) (-1056.141) -- 0:01:01
631000 -- [-1052.028] (-1059.683) (-1055.858) (-1062.293) * (-1051.976) (-1052.620) (-1057.886) [-1052.541] -- 0:01:01
631500 -- [-1052.377] (-1059.943) (-1057.223) (-1058.632) * [-1054.001] (-1051.204) (-1057.210) (-1054.008) -- 0:01:01
632000 -- [-1055.305] (-1056.626) (-1058.125) (-1059.585) * [-1056.681] (-1053.776) (-1058.403) (-1062.193) -- 0:01:01
632500 -- (-1062.370) [-1050.856] (-1059.178) (-1060.385) * (-1052.426) [-1052.538] (-1061.532) (-1059.829) -- 0:01:01
633000 -- (-1058.363) (-1054.666) [-1055.888] (-1058.864) * [-1058.473] (-1053.639) (-1059.099) (-1054.968) -- 0:01:00
633500 -- (-1054.584) (-1060.037) (-1060.908) [-1053.903] * [-1053.608] (-1054.298) (-1055.977) (-1053.534) -- 0:01:00
634000 -- (-1061.213) (-1056.223) [-1051.374] (-1058.426) * [-1053.618] (-1051.246) (-1055.060) (-1060.700) -- 0:01:00
634500 -- (-1058.618) (-1057.511) [-1054.989] (-1058.567) * [-1048.872] (-1053.856) (-1055.833) (-1050.634) -- 0:01:00
635000 -- (-1062.796) [-1052.609] (-1057.133) (-1057.469) * [-1050.110] (-1057.348) (-1060.106) (-1059.502) -- 0:01:00
Average standard deviation of split frequencies: 0.000000
635500 -- (-1063.884) [-1058.399] (-1060.263) (-1053.837) * (-1055.889) [-1053.519] (-1057.542) (-1053.149) -- 0:01:00
636000 -- (-1056.944) (-1056.166) (-1057.239) [-1053.079] * (-1056.096) (-1058.260) [-1050.789] (-1053.000) -- 0:01:00
636500 -- (-1054.728) (-1053.071) [-1058.900] (-1055.210) * (-1056.286) (-1056.808) [-1054.873] (-1052.702) -- 0:01:00
637000 -- (-1053.047) (-1058.994) [-1057.216] (-1055.916) * [-1054.424] (-1057.123) (-1056.573) (-1055.397) -- 0:01:00
637500 -- (-1052.165) (-1055.743) (-1054.589) [-1054.862] * (-1059.843) (-1058.955) [-1049.678] (-1055.721) -- 0:01:00
638000 -- (-1049.826) (-1055.913) (-1052.536) [-1051.260] * [-1052.690] (-1059.515) (-1057.743) (-1053.256) -- 0:01:00
638500 -- [-1052.670] (-1056.989) (-1055.564) (-1050.911) * [-1056.513] (-1057.671) (-1058.648) (-1054.235) -- 0:01:00
639000 -- [-1055.639] (-1057.782) (-1060.671) (-1054.520) * (-1052.024) (-1050.754) (-1059.571) [-1052.745] -- 0:00:59
639500 -- (-1053.051) (-1058.647) (-1056.227) [-1052.295] * [-1055.797] (-1055.971) (-1057.876) (-1057.008) -- 0:00:59
640000 -- (-1063.686) [-1055.286] (-1054.172) (-1058.753) * (-1057.960) (-1065.889) [-1061.723] (-1054.886) -- 0:00:59
Average standard deviation of split frequencies: 0.000000
640500 -- (-1055.042) (-1056.253) (-1056.374) [-1050.866] * (-1050.858) (-1052.629) (-1055.899) [-1054.264] -- 0:00:59
641000 -- (-1053.499) (-1055.605) (-1055.544) [-1053.004] * (-1051.669) (-1056.247) (-1053.245) [-1052.796] -- 0:00:59
641500 -- (-1053.879) (-1053.738) (-1062.443) [-1058.259] * (-1054.395) (-1053.724) [-1052.242] (-1058.297) -- 0:00:59
642000 -- (-1056.118) (-1051.445) [-1052.493] (-1056.430) * [-1056.917] (-1063.290) (-1054.457) (-1051.561) -- 0:00:59
642500 -- [-1054.559] (-1053.670) (-1056.042) (-1056.459) * (-1058.511) (-1053.686) (-1054.153) [-1050.930] -- 0:00:59
643000 -- [-1052.637] (-1055.417) (-1053.460) (-1053.866) * (-1062.360) (-1050.405) [-1053.684] (-1049.539) -- 0:00:59
643500 -- (-1052.506) (-1061.606) [-1060.457] (-1058.084) * (-1055.446) (-1057.914) (-1061.618) [-1053.431] -- 0:00:59
644000 -- (-1054.401) [-1059.223] (-1057.318) (-1053.551) * [-1054.617] (-1053.247) (-1057.145) (-1055.013) -- 0:00:59
644500 -- (-1060.359) (-1061.301) (-1054.280) [-1056.551] * [-1054.385] (-1058.100) (-1054.750) (-1057.015) -- 0:00:59
645000 -- (-1051.535) (-1058.528) (-1057.361) [-1052.433] * [-1060.587] (-1053.115) (-1056.744) (-1055.413) -- 0:00:58
Average standard deviation of split frequencies: 0.000000
645500 -- (-1059.807) (-1053.008) (-1052.998) [-1059.151] * [-1051.018] (-1052.110) (-1055.537) (-1051.064) -- 0:00:58
646000 -- (-1054.969) (-1052.062) [-1054.871] (-1054.926) * [-1055.461] (-1055.856) (-1048.443) (-1056.674) -- 0:00:58
646500 -- (-1054.815) (-1068.839) [-1053.080] (-1053.583) * [-1054.641] (-1051.913) (-1059.152) (-1055.368) -- 0:00:58
647000 -- [-1059.269] (-1055.224) (-1057.076) (-1054.052) * [-1055.209] (-1055.071) (-1055.194) (-1054.988) -- 0:00:58
647500 -- [-1056.411] (-1056.329) (-1056.174) (-1056.970) * (-1059.685) [-1055.026] (-1056.301) (-1058.714) -- 0:00:58
648000 -- [-1056.672] (-1061.648) (-1056.644) (-1059.408) * (-1054.255) (-1058.671) [-1053.250] (-1054.353) -- 0:00:58
648500 -- (-1053.611) (-1055.806) (-1055.412) [-1054.139] * (-1055.773) [-1058.223] (-1055.841) (-1053.047) -- 0:00:58
649000 -- [-1053.783] (-1054.619) (-1057.592) (-1054.441) * (-1054.061) (-1055.784) (-1061.669) [-1052.543] -- 0:00:58
649500 -- (-1059.177) [-1051.148] (-1053.541) (-1053.353) * (-1057.930) (-1062.952) [-1054.819] (-1053.750) -- 0:00:58
650000 -- (-1055.934) [-1049.839] (-1049.656) (-1053.756) * (-1058.025) [-1057.254] (-1063.447) (-1056.881) -- 0:00:58
Average standard deviation of split frequencies: 0.000000
650500 -- (-1056.879) (-1050.019) [-1051.569] (-1057.248) * (-1058.147) [-1056.819] (-1060.222) (-1051.404) -- 0:00:58
651000 -- (-1053.774) [-1057.606] (-1061.132) (-1060.370) * (-1069.111) (-1053.507) (-1058.391) [-1060.459] -- 0:00:57
651500 -- (-1062.262) (-1061.329) [-1053.673] (-1056.686) * [-1062.044] (-1056.446) (-1055.021) (-1056.670) -- 0:00:57
652000 -- (-1051.597) (-1054.982) (-1053.057) [-1056.355] * (-1057.889) (-1056.047) (-1057.152) [-1053.168] -- 0:00:57
652500 -- (-1053.487) (-1056.053) (-1052.211) [-1054.304] * (-1061.135) (-1057.623) (-1061.970) [-1056.068] -- 0:00:57
653000 -- (-1050.854) [-1060.504] (-1055.625) (-1052.269) * [-1051.326] (-1056.266) (-1057.052) (-1059.111) -- 0:00:57
653500 -- (-1054.827) (-1052.343) (-1052.475) [-1059.268] * (-1055.392) (-1055.075) (-1051.699) [-1055.029] -- 0:00:57
654000 -- [-1050.635] (-1055.285) (-1051.068) (-1055.632) * (-1057.724) (-1054.953) (-1058.104) [-1053.342] -- 0:00:57
654500 -- (-1050.138) (-1053.092) [-1053.157] (-1060.212) * (-1053.990) [-1052.667] (-1059.014) (-1054.226) -- 0:00:57
655000 -- (-1052.345) (-1056.843) (-1053.699) [-1063.584] * (-1054.383) [-1050.539] (-1063.362) (-1056.440) -- 0:00:57
Average standard deviation of split frequencies: 0.000000
655500 -- (-1051.644) (-1060.736) [-1055.337] (-1054.936) * [-1055.663] (-1056.549) (-1058.102) (-1052.391) -- 0:00:57
656000 -- (-1055.717) (-1056.746) [-1053.721] (-1057.880) * (-1059.442) [-1054.238] (-1054.098) (-1052.681) -- 0:00:57
656500 -- [-1052.448] (-1054.288) (-1056.814) (-1057.403) * (-1052.732) (-1059.063) (-1059.379) [-1054.629] -- 0:00:57
657000 -- (-1059.446) (-1055.512) (-1052.146) [-1054.937] * [-1054.962] (-1052.369) (-1052.096) (-1052.339) -- 0:00:56
657500 -- [-1054.795] (-1051.112) (-1056.669) (-1054.547) * (-1055.258) (-1056.389) [-1054.053] (-1057.906) -- 0:00:56
658000 -- (-1054.640) [-1050.277] (-1056.660) (-1058.341) * (-1058.404) [-1051.476] (-1058.078) (-1056.887) -- 0:00:56
658500 -- (-1053.562) (-1050.397) [-1056.920] (-1055.340) * (-1055.194) [-1058.252] (-1053.543) (-1051.773) -- 0:00:56
659000 -- (-1055.959) [-1054.335] (-1050.718) (-1055.544) * (-1056.031) (-1056.444) (-1060.354) [-1050.862] -- 0:00:56
659500 -- [-1055.070] (-1052.716) (-1054.983) (-1057.854) * (-1060.923) (-1058.793) [-1049.291] (-1055.605) -- 0:00:56
660000 -- [-1052.447] (-1056.066) (-1052.699) (-1059.168) * (-1068.477) (-1053.348) (-1058.449) [-1051.469] -- 0:00:56
Average standard deviation of split frequencies: 0.000000
660500 -- (-1057.898) (-1054.981) [-1052.690] (-1052.261) * (-1068.295) (-1054.474) (-1054.110) [-1054.338] -- 0:00:56
661000 -- (-1054.484) (-1058.309) (-1052.210) [-1052.913] * (-1062.616) [-1056.154] (-1050.654) (-1056.444) -- 0:00:56
661500 -- (-1052.642) (-1061.992) [-1054.515] (-1057.631) * (-1060.900) (-1055.104) [-1054.609] (-1060.366) -- 0:00:56
662000 -- [-1050.930] (-1055.390) (-1053.030) (-1060.888) * (-1060.082) [-1057.649] (-1051.576) (-1053.003) -- 0:00:56
662500 -- (-1056.869) [-1055.039] (-1056.384) (-1054.221) * (-1057.481) (-1058.445) [-1051.685] (-1055.640) -- 0:00:56
663000 -- (-1056.286) (-1052.748) (-1050.563) [-1050.189] * [-1052.409] (-1059.146) (-1054.797) (-1059.502) -- 0:00:55
663500 -- (-1062.309) [-1051.904] (-1052.173) (-1052.391) * (-1055.539) [-1057.841] (-1055.215) (-1055.979) -- 0:00:55
664000 -- (-1054.710) (-1062.419) [-1054.329] (-1050.565) * (-1056.089) (-1054.044) (-1051.190) [-1049.778] -- 0:00:55
664500 -- (-1057.500) (-1056.751) [-1057.422] (-1056.338) * (-1052.207) (-1054.332) [-1054.239] (-1049.245) -- 0:00:55
665000 -- (-1053.598) (-1053.900) [-1053.719] (-1063.854) * (-1058.035) (-1057.747) (-1054.497) [-1053.867] -- 0:00:55
Average standard deviation of split frequencies: 0.000000
665500 -- (-1054.233) [-1053.749] (-1051.871) (-1058.128) * (-1057.928) [-1056.155] (-1064.525) (-1052.638) -- 0:00:55
666000 -- (-1054.156) (-1058.601) (-1049.642) [-1052.345] * (-1054.695) (-1058.265) [-1054.792] (-1054.667) -- 0:00:55
666500 -- (-1052.227) (-1060.432) (-1051.528) [-1057.248] * (-1055.079) (-1060.993) (-1051.541) [-1054.905] -- 0:00:55
667000 -- (-1053.672) (-1054.349) (-1055.036) [-1056.603] * (-1049.070) [-1054.665] (-1051.467) (-1055.220) -- 0:00:55
667500 -- (-1058.297) [-1054.416] (-1053.406) (-1054.617) * [-1049.931] (-1055.090) (-1054.477) (-1061.563) -- 0:00:55
668000 -- (-1056.432) [-1052.904] (-1054.308) (-1053.732) * (-1049.299) [-1052.936] (-1055.736) (-1052.981) -- 0:00:55
668500 -- (-1056.492) [-1057.608] (-1053.339) (-1055.529) * (-1053.111) [-1053.384] (-1055.733) (-1054.901) -- 0:00:55
669000 -- (-1056.324) [-1053.347] (-1051.912) (-1060.688) * (-1057.187) [-1052.868] (-1062.315) (-1055.858) -- 0:00:54
669500 -- (-1054.567) (-1062.432) [-1052.631] (-1057.494) * (-1050.276) (-1052.695) [-1057.457] (-1057.245) -- 0:00:54
670000 -- (-1055.598) [-1064.075] (-1055.403) (-1051.835) * (-1053.551) (-1053.542) [-1056.111] (-1052.406) -- 0:00:54
Average standard deviation of split frequencies: 0.000000
670500 -- (-1053.144) (-1059.611) [-1049.304] (-1055.922) * (-1053.522) (-1056.326) [-1054.320] (-1055.311) -- 0:00:54
671000 -- [-1059.680] (-1052.897) (-1049.109) (-1054.863) * (-1055.714) [-1054.156] (-1057.336) (-1060.034) -- 0:00:54
671500 -- (-1059.640) (-1055.253) (-1053.778) [-1053.698] * (-1055.325) [-1051.154] (-1051.862) (-1057.183) -- 0:00:54
672000 -- (-1056.353) [-1056.802] (-1054.537) (-1056.148) * (-1054.951) (-1056.006) [-1051.285] (-1059.872) -- 0:00:54
672500 -- [-1054.196] (-1053.012) (-1051.770) (-1052.997) * (-1052.061) (-1049.787) [-1051.995] (-1051.970) -- 0:00:54
673000 -- [-1061.049] (-1057.185) (-1059.773) (-1049.664) * [-1053.502] (-1053.265) (-1058.846) (-1058.312) -- 0:00:54
673500 -- [-1054.544] (-1053.790) (-1059.547) (-1053.318) * (-1055.505) (-1060.147) (-1069.473) [-1053.405] -- 0:00:54
674000 -- (-1055.066) (-1056.637) (-1056.011) [-1053.151] * (-1054.966) [-1054.395] (-1051.383) (-1059.227) -- 0:00:54
674500 -- (-1051.289) (-1055.549) (-1057.837) [-1053.682] * (-1061.582) (-1056.705) [-1051.538] (-1050.789) -- 0:00:54
675000 -- (-1057.480) (-1059.288) (-1058.808) [-1054.662] * (-1054.798) (-1053.170) (-1051.759) [-1056.432] -- 0:00:53
Average standard deviation of split frequencies: 0.000000
675500 -- [-1052.066] (-1056.988) (-1053.877) (-1052.202) * (-1051.997) (-1059.569) (-1052.464) [-1061.622] -- 0:00:53
676000 -- (-1050.688) [-1061.965] (-1058.542) (-1056.009) * (-1058.040) (-1049.690) [-1052.244] (-1052.571) -- 0:00:53
676500 -- (-1052.186) (-1055.407) (-1053.575) [-1052.951] * (-1060.721) [-1052.191] (-1057.374) (-1053.847) -- 0:00:53
677000 -- (-1061.530) [-1053.563] (-1052.240) (-1055.143) * (-1055.761) [-1050.380] (-1062.625) (-1053.841) -- 0:00:53
677500 -- (-1055.928) [-1054.309] (-1055.539) (-1054.687) * [-1055.524] (-1053.286) (-1054.509) (-1054.291) -- 0:00:53
678000 -- (-1054.384) (-1055.695) [-1055.714] (-1055.232) * (-1056.503) [-1050.687] (-1051.548) (-1056.179) -- 0:00:53
678500 -- (-1057.955) [-1054.919] (-1058.012) (-1049.733) * (-1056.568) [-1054.670] (-1056.849) (-1054.146) -- 0:00:53
679000 -- (-1063.161) (-1053.169) [-1058.053] (-1053.686) * [-1059.401] (-1050.536) (-1058.054) (-1050.461) -- 0:00:53
679500 -- (-1057.428) (-1055.063) [-1061.923] (-1052.311) * [-1051.278] (-1052.154) (-1057.874) (-1052.470) -- 0:00:53
680000 -- [-1053.619] (-1064.034) (-1061.899) (-1053.086) * (-1058.128) [-1055.711] (-1057.052) (-1057.831) -- 0:00:53
Average standard deviation of split frequencies: 0.000000
680500 -- (-1058.757) (-1055.080) [-1052.775] (-1057.645) * (-1054.172) [-1053.612] (-1050.811) (-1057.434) -- 0:00:53
681000 -- (-1059.350) (-1066.342) (-1059.080) [-1058.172] * [-1058.128] (-1058.427) (-1053.645) (-1054.446) -- 0:00:52
681500 -- (-1054.012) (-1055.871) (-1054.315) [-1058.910] * (-1069.568) [-1053.068] (-1056.248) (-1057.748) -- 0:00:52
682000 -- [-1053.046] (-1059.537) (-1051.835) (-1058.876) * [-1058.109] (-1055.157) (-1054.610) (-1052.414) -- 0:00:52
682500 -- (-1052.728) (-1054.053) [-1055.080] (-1063.173) * (-1066.153) (-1052.951) (-1059.228) [-1052.417] -- 0:00:52
683000 -- (-1061.241) (-1056.850) [-1052.718] (-1058.278) * [-1059.250] (-1056.209) (-1058.246) (-1054.060) -- 0:00:52
683500 -- (-1054.108) (-1057.686) [-1052.962] (-1053.359) * (-1055.589) [-1051.593] (-1051.938) (-1050.655) -- 0:00:52
684000 -- (-1054.965) (-1053.597) (-1067.254) [-1058.032] * (-1056.063) (-1051.952) (-1056.566) [-1049.325] -- 0:00:52
684500 -- [-1052.361] (-1057.380) (-1057.765) (-1053.765) * [-1051.389] (-1053.900) (-1058.321) (-1054.517) -- 0:00:52
685000 -- (-1054.238) (-1056.119) (-1058.366) [-1056.624] * (-1057.031) (-1054.282) (-1059.772) [-1051.883] -- 0:00:52
Average standard deviation of split frequencies: 0.000000
685500 -- (-1054.162) (-1058.140) [-1056.023] (-1058.435) * (-1056.175) [-1058.651] (-1062.822) (-1054.487) -- 0:00:52
686000 -- [-1054.350] (-1054.423) (-1063.317) (-1053.098) * (-1061.455) (-1053.252) (-1056.811) [-1053.311] -- 0:00:52
686500 -- (-1056.093) [-1062.124] (-1060.418) (-1058.665) * (-1051.204) (-1052.731) [-1050.794] (-1054.376) -- 0:00:52
687000 -- (-1055.084) (-1061.936) (-1062.558) [-1051.475] * [-1055.200] (-1051.140) (-1058.743) (-1061.197) -- 0:00:51
687500 -- [-1054.813] (-1061.953) (-1056.380) (-1058.230) * (-1056.541) [-1052.975] (-1058.488) (-1055.775) -- 0:00:51
688000 -- (-1060.497) (-1055.814) (-1057.716) [-1056.419] * (-1052.770) (-1054.103) [-1057.256] (-1051.339) -- 0:00:51
688500 -- (-1055.657) [-1054.237] (-1055.064) (-1053.320) * [-1056.755] (-1054.051) (-1053.380) (-1053.391) -- 0:00:51
689000 -- (-1061.186) (-1054.536) [-1052.327] (-1049.207) * (-1055.748) [-1057.085] (-1054.416) (-1053.489) -- 0:00:51
689500 -- (-1060.369) (-1057.118) [-1059.438] (-1056.348) * (-1056.826) (-1059.787) [-1055.881] (-1051.814) -- 0:00:51
690000 -- (-1058.994) (-1055.960) [-1054.377] (-1052.959) * (-1050.634) (-1056.039) [-1054.613] (-1057.839) -- 0:00:51
Average standard deviation of split frequencies: 0.000000
690500 -- (-1050.576) [-1054.570] (-1055.723) (-1059.453) * (-1052.954) (-1057.514) [-1051.809] (-1053.987) -- 0:00:51
691000 -- (-1052.225) (-1054.843) [-1050.875] (-1061.372) * (-1056.058) [-1053.739] (-1054.606) (-1059.101) -- 0:00:51
691500 -- [-1059.563] (-1052.563) (-1057.687) (-1053.499) * (-1051.868) [-1058.891] (-1052.661) (-1053.698) -- 0:00:51
692000 -- (-1060.193) [-1060.439] (-1049.518) (-1051.519) * (-1052.971) [-1059.376] (-1055.315) (-1055.870) -- 0:00:51
692500 -- (-1055.640) (-1060.347) [-1054.269] (-1050.851) * (-1060.237) (-1059.718) [-1050.082] (-1056.691) -- 0:00:51
693000 -- (-1059.160) [-1053.102] (-1055.479) (-1056.796) * (-1056.059) (-1060.559) [-1053.934] (-1056.655) -- 0:00:50
693500 -- (-1060.991) (-1058.643) [-1056.188] (-1057.940) * (-1053.764) (-1057.615) [-1055.578] (-1059.524) -- 0:00:50
694000 -- [-1051.880] (-1060.814) (-1056.240) (-1054.268) * (-1055.419) (-1055.141) (-1050.744) [-1057.922] -- 0:00:50
694500 -- [-1056.136] (-1056.473) (-1058.857) (-1051.693) * (-1056.435) [-1053.279] (-1063.470) (-1060.713) -- 0:00:50
695000 -- (-1052.919) (-1053.192) (-1060.809) [-1049.805] * [-1051.076] (-1053.211) (-1050.718) (-1064.556) -- 0:00:50
Average standard deviation of split frequencies: 0.000000
695500 -- (-1055.762) [-1055.420] (-1056.820) (-1053.795) * (-1055.836) (-1056.797) [-1054.217] (-1054.510) -- 0:00:50
696000 -- (-1051.352) [-1053.942] (-1060.683) (-1054.424) * (-1064.169) [-1049.563] (-1059.172) (-1053.348) -- 0:00:50
696500 -- (-1053.253) (-1051.647) [-1051.409] (-1053.487) * [-1050.943] (-1057.919) (-1058.639) (-1054.378) -- 0:00:50
697000 -- [-1050.748] (-1053.239) (-1055.521) (-1061.684) * [-1057.612] (-1061.937) (-1052.606) (-1057.200) -- 0:00:50
697500 -- (-1051.867) [-1052.406] (-1056.501) (-1056.809) * [-1050.226] (-1062.584) (-1054.681) (-1054.535) -- 0:00:50
698000 -- (-1058.802) (-1063.074) [-1055.013] (-1056.517) * [-1054.387] (-1054.903) (-1058.624) (-1059.286) -- 0:00:50
698500 -- (-1051.213) [-1056.386] (-1061.777) (-1064.304) * [-1050.882] (-1059.024) (-1059.409) (-1062.864) -- 0:00:50
699000 -- (-1062.095) (-1061.443) (-1050.688) [-1050.888] * (-1061.192) (-1054.068) [-1051.489] (-1064.929) -- 0:00:49
699500 -- (-1056.645) (-1063.356) (-1053.090) [-1057.358] * [-1051.967] (-1051.406) (-1052.080) (-1059.642) -- 0:00:49
700000 -- (-1056.655) (-1056.235) (-1061.456) [-1053.490] * (-1052.414) (-1059.416) [-1054.112] (-1051.161) -- 0:00:49
Average standard deviation of split frequencies: 0.000000
700500 -- (-1065.984) (-1057.650) (-1053.155) [-1057.606] * (-1058.017) (-1051.132) [-1059.765] (-1054.235) -- 0:00:49
701000 -- [-1056.625] (-1059.140) (-1057.729) (-1053.235) * (-1055.050) (-1053.191) (-1052.027) [-1054.296] -- 0:00:49
701500 -- (-1055.158) (-1058.082) [-1057.753] (-1054.934) * (-1061.259) (-1054.142) [-1056.895] (-1055.342) -- 0:00:49
702000 -- (-1061.287) (-1054.083) [-1053.908] (-1053.134) * (-1054.401) (-1057.008) (-1058.408) [-1059.067] -- 0:00:49
702500 -- (-1061.648) [-1053.252] (-1055.972) (-1053.272) * [-1055.271] (-1059.103) (-1060.171) (-1059.363) -- 0:00:49
703000 -- (-1057.295) [-1053.727] (-1059.662) (-1056.923) * (-1053.679) (-1055.116) (-1053.877) [-1052.694] -- 0:00:49
703500 -- (-1054.957) (-1056.783) [-1052.345] (-1055.261) * [-1056.027] (-1052.253) (-1051.387) (-1058.607) -- 0:00:49
704000 -- (-1057.332) [-1053.947] (-1059.743) (-1054.857) * [-1053.198] (-1051.594) (-1050.598) (-1057.873) -- 0:00:49
704500 -- [-1055.733] (-1056.838) (-1058.777) (-1059.266) * (-1053.965) (-1054.080) (-1059.398) [-1055.977] -- 0:00:49
705000 -- [-1052.697] (-1052.739) (-1066.262) (-1057.026) * [-1055.550] (-1054.219) (-1054.135) (-1053.090) -- 0:00:48
Average standard deviation of split frequencies: 0.000000
705500 -- (-1053.101) (-1055.203) [-1055.088] (-1051.790) * [-1057.923] (-1056.891) (-1058.052) (-1058.036) -- 0:00:48
706000 -- (-1059.490) [-1051.257] (-1052.425) (-1055.711) * (-1062.714) (-1058.830) (-1060.976) [-1054.238] -- 0:00:48
706500 -- (-1057.409) (-1055.810) [-1060.466] (-1060.439) * (-1054.653) (-1057.162) (-1050.894) [-1054.786] -- 0:00:48
707000 -- (-1058.954) (-1059.713) [-1058.977] (-1060.352) * (-1059.136) [-1059.179] (-1059.859) (-1054.194) -- 0:00:48
707500 -- (-1054.509) [-1057.511] (-1055.960) (-1067.242) * (-1062.871) (-1055.241) (-1055.252) [-1052.628] -- 0:00:48
708000 -- [-1055.504] (-1059.630) (-1051.336) (-1062.883) * (-1054.239) (-1059.357) (-1055.267) [-1050.817] -- 0:00:48
708500 -- (-1052.109) (-1058.504) [-1050.275] (-1054.409) * [-1058.398] (-1060.277) (-1060.283) (-1052.672) -- 0:00:48
709000 -- [-1053.913] (-1054.664) (-1053.063) (-1050.592) * [-1057.470] (-1053.058) (-1053.991) (-1053.786) -- 0:00:48
709500 -- (-1055.069) (-1052.557) (-1054.901) [-1051.031] * (-1056.961) (-1056.862) [-1056.906] (-1051.718) -- 0:00:48
710000 -- (-1057.626) (-1053.642) [-1053.062] (-1051.309) * (-1056.169) (-1054.187) (-1056.814) [-1055.990] -- 0:00:48
Average standard deviation of split frequencies: 0.000000
710500 -- (-1054.333) [-1055.018] (-1052.038) (-1054.062) * (-1057.480) (-1059.978) [-1052.399] (-1054.056) -- 0:00:48
711000 -- [-1053.558] (-1052.524) (-1054.551) (-1060.365) * (-1065.925) (-1057.840) [-1054.458] (-1057.145) -- 0:00:47
711500 -- (-1054.223) [-1056.492] (-1054.633) (-1059.877) * (-1061.824) [-1058.336] (-1058.532) (-1051.069) -- 0:00:47
712000 -- (-1055.855) (-1054.559) [-1056.987] (-1050.904) * (-1059.765) (-1051.299) (-1054.214) [-1054.962] -- 0:00:47
712500 -- (-1059.610) (-1055.206) (-1063.970) [-1052.878] * (-1054.897) (-1056.282) (-1056.217) [-1051.022] -- 0:00:47
713000 -- (-1053.794) (-1059.163) [-1056.941] (-1054.121) * (-1052.441) (-1055.450) [-1057.422] (-1053.219) -- 0:00:47
713500 -- (-1057.570) (-1055.974) (-1053.970) [-1055.046] * (-1050.599) (-1054.442) (-1059.325) [-1058.761] -- 0:00:47
714000 -- (-1056.711) (-1058.092) (-1058.658) [-1054.884] * (-1058.183) (-1055.721) (-1055.063) [-1050.582] -- 0:00:47
714500 -- (-1057.599) (-1058.115) (-1057.939) [-1049.318] * (-1049.481) (-1051.153) [-1056.067] (-1051.404) -- 0:00:47
715000 -- (-1056.835) [-1055.719] (-1065.415) (-1054.055) * [-1051.303] (-1052.756) (-1058.481) (-1056.732) -- 0:00:47
Average standard deviation of split frequencies: 0.000000
715500 -- (-1057.315) (-1054.609) [-1058.352] (-1055.537) * [-1052.622] (-1055.181) (-1053.825) (-1052.214) -- 0:00:47
716000 -- [-1056.941] (-1052.571) (-1051.637) (-1053.169) * (-1051.690) [-1054.587] (-1058.596) (-1061.774) -- 0:00:47
716500 -- (-1057.459) (-1058.969) [-1056.734] (-1062.073) * [-1056.671] (-1050.151) (-1051.998) (-1058.756) -- 0:00:47
717000 -- (-1054.115) (-1055.169) (-1051.660) [-1061.040] * (-1061.619) [-1052.728] (-1058.181) (-1056.607) -- 0:00:46
717500 -- (-1057.377) [-1050.901] (-1059.062) (-1054.471) * (-1058.064) (-1051.851) [-1065.469] (-1057.795) -- 0:00:46
718000 -- (-1062.159) (-1049.481) [-1058.051] (-1061.056) * (-1054.616) (-1053.855) [-1059.027] (-1064.155) -- 0:00:46
718500 -- (-1055.346) (-1054.540) (-1058.006) [-1055.511] * (-1053.126) (-1056.968) [-1055.342] (-1051.238) -- 0:00:46
719000 -- [-1051.509] (-1058.748) (-1054.745) (-1059.511) * (-1064.865) [-1055.093] (-1060.205) (-1054.638) -- 0:00:46
719500 -- (-1057.235) (-1052.033) (-1066.676) [-1051.549] * (-1052.487) (-1055.904) (-1058.835) [-1050.876] -- 0:00:46
720000 -- [-1052.225] (-1055.214) (-1062.434) (-1054.019) * (-1056.275) [-1054.477] (-1060.440) (-1050.769) -- 0:00:46
Average standard deviation of split frequencies: 0.000000
720500 -- (-1055.100) [-1051.346] (-1058.295) (-1050.301) * (-1056.184) [-1053.308] (-1059.439) (-1056.006) -- 0:00:46
721000 -- (-1063.376) (-1052.906) (-1053.915) [-1056.807] * [-1052.031] (-1054.020) (-1053.768) (-1054.895) -- 0:00:46
721500 -- (-1057.980) [-1050.654] (-1054.173) (-1053.344) * (-1056.984) [-1049.274] (-1053.768) (-1056.857) -- 0:00:46
722000 -- (-1055.862) (-1053.039) (-1057.520) [-1051.683] * (-1057.940) [-1052.983] (-1054.731) (-1053.822) -- 0:00:46
722500 -- (-1056.715) [-1055.897] (-1058.008) (-1052.537) * (-1056.167) (-1056.475) (-1053.480) [-1061.240] -- 0:00:46
723000 -- (-1054.685) [-1057.495] (-1058.495) (-1056.876) * (-1051.442) (-1055.864) [-1056.207] (-1059.381) -- 0:00:45
723500 -- (-1056.856) (-1054.769) [-1053.098] (-1059.550) * (-1061.036) (-1051.645) [-1051.598] (-1056.924) -- 0:00:45
724000 -- [-1051.716] (-1056.608) (-1066.608) (-1053.068) * (-1056.756) [-1054.201] (-1062.222) (-1066.369) -- 0:00:45
724500 -- [-1055.358] (-1054.092) (-1050.835) (-1056.267) * (-1058.271) (-1052.713) [-1054.203] (-1062.453) -- 0:00:45
725000 -- (-1054.842) (-1056.146) [-1050.668] (-1053.697) * (-1056.355) [-1054.195] (-1054.428) (-1057.825) -- 0:00:45
Average standard deviation of split frequencies: 0.000000
725500 -- (-1050.762) (-1057.664) (-1057.979) [-1052.600] * [-1055.659] (-1054.693) (-1053.291) (-1055.068) -- 0:00:45
726000 -- (-1056.265) (-1054.970) [-1051.965] (-1057.164) * (-1054.227) (-1061.180) (-1056.891) [-1056.930] -- 0:00:45
726500 -- (-1062.375) (-1059.441) (-1054.314) [-1053.095] * [-1053.597] (-1059.107) (-1056.881) (-1057.833) -- 0:00:45
727000 -- (-1054.312) (-1062.620) (-1053.948) [-1054.345] * (-1051.136) [-1055.671] (-1051.712) (-1058.611) -- 0:00:45
727500 -- (-1058.031) [-1057.020] (-1053.560) (-1055.742) * [-1052.978] (-1058.185) (-1056.371) (-1059.951) -- 0:00:45
728000 -- (-1057.941) [-1057.960] (-1059.776) (-1058.906) * [-1054.387] (-1054.213) (-1057.355) (-1062.918) -- 0:00:45
728500 -- (-1057.459) (-1053.607) [-1056.661] (-1058.433) * [-1056.442] (-1056.638) (-1057.320) (-1062.201) -- 0:00:45
729000 -- (-1054.133) [-1051.100] (-1054.611) (-1061.439) * [-1061.326] (-1055.663) (-1059.766) (-1052.639) -- 0:00:44
729500 -- (-1058.195) (-1049.940) [-1058.039] (-1057.715) * (-1060.950) (-1054.020) (-1060.382) [-1052.741] -- 0:00:44
730000 -- (-1057.264) [-1049.699] (-1067.513) (-1064.841) * (-1054.507) (-1056.559) (-1053.336) [-1050.569] -- 0:00:44
Average standard deviation of split frequencies: 0.000000
730500 -- (-1059.295) (-1058.824) [-1052.661] (-1060.551) * (-1064.620) (-1057.642) (-1054.773) [-1055.978] -- 0:00:44
731000 -- [-1054.474] (-1051.883) (-1054.182) (-1059.011) * (-1058.172) (-1053.553) [-1054.241] (-1051.672) -- 0:00:44
731500 -- (-1063.453) (-1050.696) [-1053.032] (-1055.971) * (-1052.824) [-1055.416] (-1054.946) (-1058.117) -- 0:00:44
732000 -- (-1056.929) (-1052.405) (-1054.884) [-1056.455] * (-1054.083) [-1054.516] (-1052.337) (-1053.663) -- 0:00:44
732500 -- (-1055.180) (-1054.404) [-1054.067] (-1057.985) * (-1052.373) (-1055.248) [-1054.217] (-1058.554) -- 0:00:44
733000 -- [-1053.089] (-1056.836) (-1049.864) (-1057.928) * (-1053.671) [-1055.545] (-1051.662) (-1058.413) -- 0:00:44
733500 -- (-1054.907) (-1054.291) (-1060.741) [-1058.370] * [-1052.207] (-1057.448) (-1052.905) (-1055.954) -- 0:00:44
734000 -- (-1061.887) (-1054.782) [-1051.704] (-1059.511) * (-1056.132) [-1056.145] (-1055.448) (-1056.899) -- 0:00:44
734500 -- (-1063.986) (-1058.320) [-1057.216] (-1053.335) * (-1053.924) (-1050.646) [-1055.924] (-1061.394) -- 0:00:44
735000 -- (-1055.683) (-1057.242) (-1055.265) [-1055.133] * (-1057.822) (-1053.234) [-1055.281] (-1056.984) -- 0:00:43
Average standard deviation of split frequencies: 0.000000
735500 -- (-1056.324) [-1051.831] (-1054.239) (-1059.097) * (-1057.467) [-1051.865] (-1061.806) (-1055.473) -- 0:00:43
736000 -- (-1057.430) (-1058.867) [-1051.002] (-1052.409) * (-1056.407) [-1050.735] (-1057.629) (-1053.992) -- 0:00:43
736500 -- (-1052.061) [-1051.474] (-1055.965) (-1052.012) * [-1053.651] (-1053.488) (-1054.667) (-1060.435) -- 0:00:43
737000 -- [-1052.853] (-1061.856) (-1059.344) (-1056.088) * (-1057.035) [-1057.215] (-1053.505) (-1056.198) -- 0:00:43
737500 -- (-1052.917) (-1058.116) (-1052.054) [-1057.097] * (-1057.509) (-1069.029) (-1049.918) [-1056.363] -- 0:00:43
738000 -- (-1051.431) [-1054.230] (-1057.327) (-1056.093) * [-1052.668] (-1064.884) (-1051.498) (-1055.894) -- 0:00:43
738500 -- (-1061.152) (-1055.916) (-1053.348) [-1052.851] * (-1064.541) (-1055.476) [-1058.912] (-1064.259) -- 0:00:43
739000 -- (-1059.496) (-1050.323) [-1059.743] (-1055.098) * [-1053.560] (-1056.275) (-1056.058) (-1054.530) -- 0:00:43
739500 -- [-1054.223] (-1052.858) (-1062.327) (-1054.273) * (-1057.325) (-1057.239) [-1053.950] (-1061.689) -- 0:00:43
740000 -- (-1058.001) [-1054.248] (-1060.611) (-1057.551) * (-1064.639) (-1055.860) (-1054.573) [-1050.397] -- 0:00:43
Average standard deviation of split frequencies: 0.000000
740500 -- (-1053.577) (-1050.025) (-1055.235) [-1055.187] * [-1076.929] (-1052.622) (-1055.299) (-1055.260) -- 0:00:43
741000 -- (-1056.424) (-1060.347) (-1059.009) [-1057.786] * (-1059.396) (-1062.379) (-1054.503) [-1053.675] -- 0:00:42
741500 -- [-1051.189] (-1059.262) (-1064.292) (-1054.162) * (-1053.250) (-1058.033) (-1058.239) [-1056.818] -- 0:00:42
742000 -- (-1052.468) (-1058.747) [-1056.612] (-1053.102) * [-1052.320] (-1066.905) (-1058.278) (-1058.739) -- 0:00:42
742500 -- (-1054.227) [-1053.838] (-1055.957) (-1060.027) * [-1052.979] (-1053.903) (-1062.360) (-1057.366) -- 0:00:42
743000 -- [-1058.539] (-1059.175) (-1057.277) (-1056.653) * (-1052.559) (-1051.889) (-1062.122) [-1055.593] -- 0:00:42
743500 -- (-1056.600) (-1060.463) [-1052.052] (-1053.274) * (-1055.335) (-1053.637) [-1052.993] (-1053.178) -- 0:00:42
744000 -- (-1053.085) (-1060.327) [-1058.384] (-1066.374) * (-1051.278) (-1052.275) [-1054.147] (-1056.172) -- 0:00:42
744500 -- (-1066.122) [-1054.232] (-1058.078) (-1057.993) * (-1057.109) (-1060.631) (-1054.500) [-1054.535] -- 0:00:42
745000 -- (-1066.995) [-1058.983] (-1059.492) (-1056.409) * (-1054.187) [-1056.376] (-1055.159) (-1058.029) -- 0:00:42
Average standard deviation of split frequencies: 0.000000
745500 -- (-1060.117) (-1055.261) [-1054.014] (-1054.741) * [-1054.777] (-1057.472) (-1053.446) (-1054.850) -- 0:00:42
746000 -- (-1053.114) (-1056.147) (-1063.285) [-1053.584] * (-1056.298) (-1063.209) (-1064.512) [-1053.579] -- 0:00:42
746500 -- (-1057.731) (-1050.200) [-1057.074] (-1057.981) * (-1056.177) [-1051.065] (-1056.225) (-1058.939) -- 0:00:42
747000 -- (-1057.909) (-1052.485) [-1050.795] (-1055.505) * (-1064.844) [-1056.567] (-1056.490) (-1051.963) -- 0:00:41
747500 -- (-1060.905) (-1050.925) [-1052.248] (-1054.384) * [-1052.718] (-1051.151) (-1059.981) (-1049.650) -- 0:00:41
748000 -- (-1049.335) (-1053.600) [-1049.988] (-1051.408) * (-1059.705) [-1054.912] (-1062.234) (-1054.098) -- 0:00:41
748500 -- (-1062.034) [-1051.345] (-1057.914) (-1057.184) * (-1055.304) (-1053.974) [-1057.748] (-1055.555) -- 0:00:41
749000 -- (-1062.103) (-1052.459) (-1058.455) [-1057.842] * (-1054.944) (-1055.732) (-1055.610) [-1051.771] -- 0:00:41
749500 -- (-1056.627) (-1051.821) (-1063.263) [-1055.065] * (-1054.066) (-1066.057) [-1054.635] (-1052.945) -- 0:00:41
750000 -- [-1057.716] (-1053.329) (-1052.362) (-1052.995) * (-1053.328) [-1059.091] (-1062.269) (-1053.876) -- 0:00:41
Average standard deviation of split frequencies: 0.000000
750500 -- (-1060.690) (-1052.155) [-1058.103] (-1056.973) * (-1053.760) (-1053.037) (-1057.176) [-1053.053] -- 0:00:41
751000 -- (-1059.827) [-1056.675] (-1059.749) (-1053.103) * [-1054.926] (-1054.674) (-1071.298) (-1059.820) -- 0:00:41
751500 -- (-1057.095) (-1051.784) (-1063.247) [-1059.610] * (-1057.140) (-1052.534) [-1056.508] (-1061.243) -- 0:00:41
752000 -- (-1060.103) [-1053.723] (-1060.243) (-1061.100) * (-1058.876) (-1054.801) [-1054.713] (-1055.734) -- 0:00:41
752500 -- [-1052.475] (-1055.121) (-1059.284) (-1063.087) * (-1053.031) (-1056.089) [-1058.592] (-1052.937) -- 0:00:41
753000 -- [-1049.433] (-1054.492) (-1057.026) (-1055.356) * (-1059.122) [-1050.873] (-1060.812) (-1053.654) -- 0:00:41
753500 -- (-1054.860) (-1052.047) [-1055.690] (-1054.762) * [-1052.080] (-1055.986) (-1053.847) (-1054.806) -- 0:00:40
754000 -- (-1055.097) (-1052.716) (-1056.684) [-1053.230] * (-1051.026) (-1053.868) (-1053.282) [-1053.445] -- 0:00:40
754500 -- (-1057.520) [-1057.516] (-1054.487) (-1060.365) * [-1053.456] (-1050.991) (-1053.932) (-1060.445) -- 0:00:40
755000 -- (-1058.521) (-1055.122) (-1055.081) [-1059.636] * (-1053.751) (-1052.561) [-1054.257] (-1062.206) -- 0:00:40
Average standard deviation of split frequencies: 0.000000
755500 -- (-1056.861) (-1059.758) (-1054.816) [-1054.968] * [-1054.733] (-1062.008) (-1050.311) (-1058.468) -- 0:00:40
756000 -- (-1057.605) (-1058.218) [-1053.622] (-1050.128) * (-1049.065) (-1059.313) [-1057.726] (-1055.897) -- 0:00:40
756500 -- (-1054.422) [-1055.199] (-1058.127) (-1051.609) * (-1053.901) [-1053.348] (-1054.356) (-1060.560) -- 0:00:40
757000 -- (-1058.716) (-1058.533) (-1058.588) [-1051.829] * (-1057.834) (-1059.055) [-1053.096] (-1062.423) -- 0:00:40
757500 -- [-1054.643] (-1054.534) (-1052.729) (-1054.608) * [-1054.108] (-1058.279) (-1061.363) (-1054.370) -- 0:00:40
758000 -- [-1054.871] (-1051.209) (-1061.798) (-1054.982) * (-1055.138) [-1058.702] (-1062.050) (-1055.126) -- 0:00:40
758500 -- (-1060.284) (-1054.539) [-1052.728] (-1055.445) * (-1058.386) (-1051.424) [-1056.560] (-1052.973) -- 0:00:40
759000 -- (-1054.078) (-1058.831) [-1057.593] (-1055.604) * (-1055.462) [-1054.373] (-1062.929) (-1052.291) -- 0:00:40
759500 -- [-1052.115] (-1057.036) (-1056.678) (-1061.042) * (-1052.875) [-1052.966] (-1052.786) (-1066.530) -- 0:00:39
760000 -- (-1057.315) (-1053.072) [-1057.593] (-1056.772) * [-1054.247] (-1055.627) (-1055.324) (-1061.219) -- 0:00:39
Average standard deviation of split frequencies: 0.000000
760500 -- (-1064.184) (-1060.039) [-1052.661] (-1056.445) * (-1055.369) (-1050.831) (-1052.087) [-1054.214] -- 0:00:39
761000 -- (-1055.191) [-1052.169] (-1055.316) (-1059.659) * (-1056.354) [-1048.962] (-1049.726) (-1058.894) -- 0:00:39
761500 -- [-1058.072] (-1054.049) (-1057.155) (-1057.447) * [-1057.288] (-1052.352) (-1055.230) (-1054.327) -- 0:00:39
762000 -- (-1059.333) [-1052.813] (-1054.296) (-1048.945) * [-1053.829] (-1059.170) (-1055.031) (-1054.464) -- 0:00:39
762500 -- (-1058.888) [-1051.982] (-1055.093) (-1057.350) * (-1055.075) (-1054.527) (-1054.868) [-1052.293] -- 0:00:39
763000 -- [-1056.153] (-1053.883) (-1056.333) (-1061.767) * (-1053.347) (-1051.638) (-1063.770) [-1055.077] -- 0:00:39
763500 -- (-1056.475) (-1051.552) (-1057.649) [-1060.455] * (-1055.574) (-1052.813) (-1063.168) [-1054.293] -- 0:00:39
764000 -- [-1054.565] (-1053.764) (-1055.668) (-1055.353) * [-1054.051] (-1054.356) (-1055.102) (-1056.099) -- 0:00:39
764500 -- [-1054.067] (-1055.317) (-1060.983) (-1057.085) * [-1053.501] (-1059.549) (-1055.516) (-1053.839) -- 0:00:39
765000 -- (-1059.700) [-1053.988] (-1053.122) (-1057.082) * [-1053.744] (-1060.885) (-1051.651) (-1056.574) -- 0:00:39
Average standard deviation of split frequencies: 0.000000
765500 -- (-1054.727) (-1054.498) (-1052.288) [-1051.655] * (-1052.020) [-1053.870] (-1061.293) (-1059.097) -- 0:00:38
766000 -- (-1054.205) [-1054.289] (-1060.495) (-1056.906) * (-1054.940) (-1058.830) (-1052.895) [-1061.028] -- 0:00:38
766500 -- (-1059.282) (-1054.250) [-1055.669] (-1052.634) * (-1058.320) (-1058.070) [-1052.033] (-1058.663) -- 0:00:38
767000 -- (-1057.712) (-1053.834) (-1056.314) [-1050.186] * [-1054.086] (-1055.332) (-1051.117) (-1056.200) -- 0:00:38
767500 -- [-1055.087] (-1053.818) (-1054.910) (-1052.362) * (-1056.049) [-1051.060] (-1056.170) (-1056.988) -- 0:00:38
768000 -- (-1057.274) (-1054.439) (-1057.662) [-1056.776] * (-1060.079) (-1056.073) (-1052.149) [-1052.007] -- 0:00:38
768500 -- (-1056.855) [-1056.766] (-1051.398) (-1051.985) * (-1063.169) (-1059.628) (-1058.303) [-1050.642] -- 0:00:38
769000 -- (-1055.869) [-1051.661] (-1054.930) (-1052.809) * (-1065.052) [-1055.023] (-1054.527) (-1055.329) -- 0:00:38
769500 -- [-1052.832] (-1061.549) (-1058.344) (-1053.315) * (-1063.172) (-1054.321) (-1054.696) [-1053.883] -- 0:00:38
770000 -- [-1055.564] (-1052.703) (-1053.233) (-1053.683) * (-1060.816) [-1059.683] (-1057.314) (-1052.257) -- 0:00:38
Average standard deviation of split frequencies: 0.000000
770500 -- [-1056.984] (-1062.298) (-1054.447) (-1054.716) * [-1053.430] (-1055.553) (-1064.597) (-1051.181) -- 0:00:38
771000 -- [-1050.777] (-1057.901) (-1055.815) (-1052.047) * (-1054.853) (-1055.153) [-1055.684] (-1054.418) -- 0:00:38
771500 -- [-1051.920] (-1054.561) (-1053.098) (-1052.333) * (-1052.604) (-1061.115) [-1053.082] (-1055.424) -- 0:00:37
772000 -- [-1052.762] (-1052.869) (-1057.028) (-1060.009) * (-1063.814) (-1052.246) [-1051.200] (-1055.465) -- 0:00:37
772500 -- (-1053.675) (-1056.532) (-1062.930) [-1057.502] * (-1055.642) (-1055.698) [-1053.191] (-1059.468) -- 0:00:37
773000 -- (-1056.367) (-1054.047) [-1053.986] (-1059.397) * [-1056.094] (-1058.375) (-1050.939) (-1058.216) -- 0:00:37
773500 -- [-1055.053] (-1055.565) (-1053.915) (-1055.823) * (-1053.694) [-1051.762] (-1053.263) (-1063.419) -- 0:00:37
774000 -- [-1059.625] (-1060.617) (-1056.738) (-1052.721) * [-1050.877] (-1052.344) (-1053.022) (-1057.279) -- 0:00:37
774500 -- [-1053.016] (-1062.042) (-1056.387) (-1056.740) * [-1051.493] (-1054.958) (-1051.851) (-1061.787) -- 0:00:37
775000 -- [-1054.256] (-1048.987) (-1054.454) (-1056.962) * (-1056.341) [-1057.078] (-1053.241) (-1053.300) -- 0:00:37
Average standard deviation of split frequencies: 0.000000
775500 -- (-1051.946) [-1048.152] (-1063.602) (-1052.495) * (-1053.065) [-1060.194] (-1059.134) (-1052.843) -- 0:00:37
776000 -- [-1051.964] (-1057.557) (-1055.020) (-1056.121) * (-1057.828) [-1053.949] (-1060.127) (-1055.476) -- 0:00:37
776500 -- (-1052.133) (-1058.785) (-1052.094) [-1057.388] * (-1055.708) (-1057.550) [-1054.348] (-1059.682) -- 0:00:37
777000 -- (-1048.997) [-1057.635] (-1059.267) (-1057.382) * (-1057.157) (-1051.157) (-1052.543) [-1050.622] -- 0:00:37
777500 -- [-1056.087] (-1059.743) (-1056.118) (-1060.067) * (-1052.169) (-1057.337) [-1057.929] (-1062.736) -- 0:00:36
778000 -- (-1052.530) (-1060.927) [-1054.655] (-1057.880) * (-1053.767) [-1055.634] (-1053.541) (-1053.270) -- 0:00:36
778500 -- [-1058.198] (-1053.053) (-1052.009) (-1062.416) * (-1050.924) (-1055.915) [-1053.724] (-1057.432) -- 0:00:36
779000 -- (-1060.551) [-1052.078] (-1061.223) (-1051.243) * (-1051.710) (-1050.013) (-1057.947) [-1058.385] -- 0:00:36
779500 -- (-1055.638) [-1050.102] (-1055.853) (-1050.346) * (-1056.548) (-1058.826) [-1057.525] (-1057.491) -- 0:00:36
780000 -- (-1059.693) [-1051.679] (-1053.168) (-1057.542) * (-1058.127) (-1055.302) (-1055.455) [-1050.329] -- 0:00:36
Average standard deviation of split frequencies: 0.000000
780500 -- (-1060.523) (-1053.270) (-1053.851) [-1054.058] * (-1055.219) (-1055.720) [-1054.353] (-1051.284) -- 0:00:36
781000 -- [-1054.210] (-1056.061) (-1055.114) (-1056.024) * (-1052.513) [-1052.904] (-1049.953) (-1050.949) -- 0:00:36
781500 -- (-1054.304) [-1057.016] (-1052.025) (-1059.574) * (-1053.591) (-1056.667) [-1051.764] (-1053.675) -- 0:00:36
782000 -- (-1056.242) [-1058.463] (-1054.586) (-1055.487) * [-1052.049] (-1054.836) (-1061.401) (-1051.897) -- 0:00:36
782500 -- [-1057.589] (-1054.207) (-1054.576) (-1061.752) * (-1054.913) (-1056.002) [-1052.053] (-1058.247) -- 0:00:36
783000 -- (-1053.414) [-1056.436] (-1070.361) (-1056.076) * (-1050.429) (-1059.295) [-1050.994] (-1057.127) -- 0:00:36
783500 -- (-1053.959) [-1051.023] (-1054.867) (-1056.363) * (-1056.929) (-1061.347) [-1055.220] (-1056.763) -- 0:00:35
784000 -- (-1051.977) (-1052.895) (-1053.637) [-1056.313] * (-1058.659) (-1065.729) [-1054.710] (-1056.558) -- 0:00:35
784500 -- [-1057.497] (-1053.009) (-1054.233) (-1057.808) * (-1050.156) [-1060.270] (-1058.426) (-1055.681) -- 0:00:35
785000 -- [-1052.256] (-1056.370) (-1052.107) (-1055.455) * (-1052.075) (-1063.714) [-1058.661] (-1059.364) -- 0:00:35
Average standard deviation of split frequencies: 0.000000
785500 -- (-1060.245) (-1056.823) [-1051.789] (-1063.633) * [-1049.557] (-1060.978) (-1062.655) (-1059.815) -- 0:00:35
786000 -- (-1056.396) (-1055.827) [-1055.584] (-1057.541) * [-1052.745] (-1064.225) (-1058.908) (-1059.030) -- 0:00:35
786500 -- (-1058.001) (-1058.830) [-1050.720] (-1057.287) * (-1056.762) (-1065.250) [-1053.884] (-1061.104) -- 0:00:35
787000 -- [-1057.314] (-1061.832) (-1056.206) (-1052.333) * (-1055.758) (-1067.391) [-1057.803] (-1057.225) -- 0:00:35
787500 -- (-1058.190) [-1050.858] (-1053.341) (-1055.580) * (-1056.654) (-1056.675) (-1052.445) [-1055.562] -- 0:00:35
788000 -- [-1055.990] (-1058.079) (-1055.018) (-1053.069) * (-1057.580) (-1054.167) [-1056.456] (-1053.990) -- 0:00:35
788500 -- [-1050.749] (-1059.965) (-1060.194) (-1064.237) * (-1060.109) (-1054.038) (-1059.661) [-1055.051] -- 0:00:35
789000 -- [-1052.359] (-1053.987) (-1056.948) (-1062.154) * (-1053.201) (-1054.239) [-1052.975] (-1056.653) -- 0:00:35
789500 -- (-1059.586) (-1054.443) [-1056.276] (-1054.737) * (-1050.048) [-1059.507] (-1053.242) (-1056.551) -- 0:00:34
790000 -- (-1055.397) [-1058.948] (-1053.611) (-1059.877) * (-1049.995) (-1056.523) (-1056.834) [-1057.293] -- 0:00:34
Average standard deviation of split frequencies: 0.000000
790500 -- (-1059.897) (-1065.248) [-1052.033] (-1056.611) * [-1053.670] (-1055.659) (-1060.491) (-1060.702) -- 0:00:34
791000 -- (-1054.118) [-1051.640] (-1055.200) (-1052.278) * [-1049.902] (-1053.234) (-1057.836) (-1060.760) -- 0:00:34
791500 -- [-1053.047] (-1059.950) (-1054.355) (-1055.605) * [-1057.033] (-1059.940) (-1058.660) (-1056.771) -- 0:00:34
792000 -- (-1055.716) [-1057.771] (-1054.104) (-1053.433) * (-1050.904) (-1054.130) [-1052.001] (-1059.196) -- 0:00:34
792500 -- (-1060.736) (-1058.489) (-1053.852) [-1054.058] * (-1058.643) (-1053.334) [-1052.495] (-1054.644) -- 0:00:34
793000 -- (-1050.404) [-1050.335] (-1053.843) (-1053.103) * [-1054.067] (-1063.918) (-1053.291) (-1051.620) -- 0:00:34
793500 -- [-1059.491] (-1058.510) (-1053.822) (-1058.067) * (-1056.345) (-1056.346) [-1060.889] (-1058.182) -- 0:00:34
794000 -- [-1056.122] (-1054.073) (-1053.222) (-1051.294) * (-1052.710) (-1051.252) (-1064.755) [-1055.914] -- 0:00:34
794500 -- (-1053.119) (-1057.605) [-1054.321] (-1053.642) * (-1062.721) [-1057.678] (-1060.377) (-1059.184) -- 0:00:34
795000 -- (-1055.959) (-1051.576) [-1049.455] (-1065.169) * [-1053.811] (-1062.622) (-1065.178) (-1056.797) -- 0:00:34
Average standard deviation of split frequencies: 0.000000
795500 -- [-1053.517] (-1053.971) (-1052.482) (-1054.914) * (-1058.212) [-1053.928] (-1052.997) (-1053.654) -- 0:00:33
796000 -- [-1052.088] (-1052.357) (-1059.832) (-1051.485) * (-1051.529) (-1055.646) (-1057.368) [-1050.404] -- 0:00:33
796500 -- (-1058.418) [-1054.103] (-1057.188) (-1055.847) * (-1054.623) (-1057.270) [-1059.438] (-1055.539) -- 0:00:33
797000 -- [-1057.483] (-1053.243) (-1061.953) (-1056.529) * (-1056.796) (-1059.009) (-1057.311) [-1050.992] -- 0:00:33
797500 -- (-1060.855) (-1059.477) (-1058.646) [-1057.915] * (-1056.738) [-1056.188] (-1052.925) (-1050.629) -- 0:00:33
798000 -- (-1061.405) (-1060.624) [-1056.578] (-1054.241) * (-1054.972) (-1053.066) (-1056.661) [-1056.313] -- 0:00:33
798500 -- (-1054.409) (-1060.855) [-1050.568] (-1058.084) * (-1053.931) (-1054.435) [-1053.570] (-1055.669) -- 0:00:33
799000 -- (-1056.027) [-1056.730] (-1052.698) (-1052.994) * (-1059.387) [-1055.179] (-1054.178) (-1056.226) -- 0:00:33
799500 -- (-1055.372) (-1059.471) (-1055.481) [-1051.462] * (-1057.451) (-1049.312) [-1055.057] (-1053.992) -- 0:00:33
800000 -- [-1054.095] (-1059.520) (-1054.391) (-1057.619) * (-1050.817) (-1051.732) [-1050.535] (-1063.959) -- 0:00:33
Average standard deviation of split frequencies: 0.000000
800500 -- (-1063.621) (-1058.783) (-1052.222) [-1052.585] * (-1052.664) (-1051.675) (-1055.927) [-1054.629] -- 0:00:33
801000 -- (-1056.953) (-1058.830) [-1059.759] (-1055.152) * [-1051.863] (-1054.895) (-1059.201) (-1053.414) -- 0:00:33
801500 -- [-1055.668] (-1060.462) (-1058.790) (-1055.151) * (-1053.259) (-1058.808) (-1059.031) [-1052.425] -- 0:00:32
802000 -- [-1056.416] (-1054.656) (-1060.085) (-1056.304) * [-1051.547] (-1069.900) (-1059.261) (-1055.786) -- 0:00:32
802500 -- (-1057.155) (-1057.388) (-1059.364) [-1066.660] * (-1058.548) (-1064.034) (-1052.794) [-1051.308] -- 0:00:32
803000 -- [-1056.642] (-1054.886) (-1056.263) (-1054.607) * (-1059.259) (-1068.633) (-1051.510) [-1056.260] -- 0:00:32
803500 -- (-1051.457) (-1059.874) [-1054.569] (-1056.610) * [-1055.049] (-1065.667) (-1057.011) (-1055.525) -- 0:00:32
804000 -- (-1059.154) [-1062.120] (-1057.427) (-1055.976) * (-1061.785) (-1061.468) [-1052.835] (-1058.136) -- 0:00:32
804500 -- (-1052.510) [-1054.874] (-1053.607) (-1054.109) * (-1053.949) (-1068.375) (-1055.384) [-1062.368] -- 0:00:32
805000 -- (-1060.204) [-1052.573] (-1051.202) (-1056.468) * (-1060.432) (-1067.705) (-1060.155) [-1055.190] -- 0:00:32
Average standard deviation of split frequencies: 0.000000
805500 -- (-1057.517) (-1052.439) (-1050.441) [-1055.104] * (-1058.139) (-1065.990) (-1054.567) [-1057.452] -- 0:00:32
806000 -- [-1052.366] (-1054.649) (-1051.336) (-1052.505) * [-1054.697] (-1062.804) (-1055.154) (-1058.219) -- 0:00:32
806500 -- (-1054.600) [-1056.677] (-1052.926) (-1061.722) * (-1062.669) (-1059.002) [-1050.327] (-1051.629) -- 0:00:32
807000 -- (-1052.620) [-1054.342] (-1053.686) (-1056.094) * [-1053.437] (-1055.531) (-1051.781) (-1057.094) -- 0:00:32
807500 -- [-1054.917] (-1049.673) (-1058.535) (-1052.263) * (-1053.066) (-1053.800) [-1058.473] (-1052.091) -- 0:00:31
808000 -- (-1051.631) (-1059.571) (-1055.215) [-1051.959] * (-1051.945) [-1054.736] (-1063.200) (-1055.738) -- 0:00:31
808500 -- (-1057.276) [-1051.842] (-1050.823) (-1057.906) * [-1056.906] (-1050.185) (-1056.097) (-1058.825) -- 0:00:31
809000 -- [-1060.478] (-1055.011) (-1052.032) (-1058.170) * (-1052.988) (-1055.191) [-1052.236] (-1055.467) -- 0:00:31
809500 -- [-1061.478] (-1059.753) (-1060.462) (-1051.366) * (-1049.273) [-1058.036] (-1053.909) (-1064.232) -- 0:00:31
810000 -- (-1055.356) [-1053.188] (-1066.637) (-1053.355) * (-1057.497) (-1049.765) (-1054.347) [-1049.313] -- 0:00:31
Average standard deviation of split frequencies: 0.000000
810500 -- (-1054.513) (-1057.507) (-1063.995) [-1050.881] * (-1056.158) [-1058.055] (-1056.024) (-1058.730) -- 0:00:31
811000 -- [-1051.307] (-1058.946) (-1068.478) (-1054.143) * (-1057.679) [-1052.604] (-1057.658) (-1052.935) -- 0:00:31
811500 -- (-1055.735) [-1053.408] (-1063.783) (-1055.533) * [-1054.332] (-1048.960) (-1057.055) (-1052.681) -- 0:00:31
812000 -- (-1062.646) [-1055.587] (-1057.000) (-1051.038) * (-1057.680) [-1056.620] (-1062.818) (-1057.512) -- 0:00:31
812500 -- (-1055.324) (-1055.026) (-1061.540) [-1054.928] * (-1053.801) (-1053.069) [-1055.155] (-1059.434) -- 0:00:31
813000 -- [-1056.602] (-1055.631) (-1057.992) (-1052.424) * [-1055.344] (-1060.490) (-1054.194) (-1067.340) -- 0:00:31
813500 -- (-1052.305) (-1061.615) [-1056.596] (-1056.085) * (-1054.163) (-1058.540) [-1053.327] (-1062.724) -- 0:00:30
814000 -- (-1052.861) [-1052.473] (-1055.058) (-1059.774) * (-1053.590) [-1056.719] (-1054.502) (-1057.516) -- 0:00:30
814500 -- (-1063.945) (-1055.835) [-1058.910] (-1058.156) * (-1055.206) [-1052.027] (-1053.426) (-1051.610) -- 0:00:30
815000 -- (-1060.152) [-1051.777] (-1051.234) (-1061.033) * [-1050.589] (-1055.412) (-1053.258) (-1053.476) -- 0:00:30
Average standard deviation of split frequencies: 0.000000
815500 -- (-1062.443) (-1053.811) (-1053.357) [-1054.578] * (-1058.657) [-1052.431] (-1057.506) (-1052.725) -- 0:00:30
816000 -- (-1069.224) (-1058.421) [-1053.445] (-1060.686) * (-1055.668) (-1050.454) [-1050.732] (-1051.870) -- 0:00:30
816500 -- (-1059.021) (-1057.660) (-1058.936) [-1055.588] * (-1054.686) [-1050.467] (-1060.813) (-1058.045) -- 0:00:30
817000 -- (-1057.983) (-1056.301) [-1059.020] (-1058.533) * (-1064.984) (-1062.249) (-1051.764) [-1054.884] -- 0:00:30
817500 -- [-1053.136] (-1052.520) (-1056.556) (-1060.785) * (-1054.657) [-1055.984] (-1053.058) (-1055.437) -- 0:00:30
818000 -- (-1055.060) (-1055.259) (-1056.877) [-1052.599] * (-1055.684) (-1052.146) (-1057.513) [-1051.393] -- 0:00:30
818500 -- (-1062.765) (-1061.540) [-1053.809] (-1056.316) * (-1061.615) (-1054.554) (-1053.356) [-1060.677] -- 0:00:30
819000 -- (-1058.376) (-1062.144) (-1054.789) [-1053.467] * [-1053.229] (-1052.493) (-1051.906) (-1060.848) -- 0:00:30
819500 -- [-1055.845] (-1059.071) (-1054.503) (-1053.277) * [-1049.842] (-1055.344) (-1053.120) (-1053.208) -- 0:00:29
820000 -- (-1068.934) (-1053.916) [-1053.112] (-1059.928) * (-1056.448) (-1052.728) (-1058.905) [-1056.430] -- 0:00:29
Average standard deviation of split frequencies: 0.000000
820500 -- (-1061.884) (-1052.408) (-1052.893) [-1053.927] * (-1053.274) (-1053.657) [-1053.183] (-1058.540) -- 0:00:29
821000 -- (-1059.941) (-1052.025) [-1056.330] (-1057.027) * (-1055.622) (-1055.551) (-1060.178) [-1049.631] -- 0:00:29
821500 -- (-1060.483) [-1055.260] (-1060.053) (-1059.691) * (-1051.884) (-1053.226) (-1054.354) [-1052.208] -- 0:00:29
822000 -- (-1060.151) [-1051.655] (-1063.947) (-1056.561) * [-1051.175] (-1060.236) (-1058.836) (-1051.409) -- 0:00:29
822500 -- (-1058.338) [-1058.387] (-1051.530) (-1055.519) * (-1066.376) (-1060.784) (-1054.625) [-1053.689] -- 0:00:29
823000 -- (-1060.058) [-1056.722] (-1053.348) (-1051.964) * (-1061.690) [-1056.171] (-1055.849) (-1054.277) -- 0:00:29
823500 -- [-1055.626] (-1060.983) (-1053.893) (-1057.400) * (-1056.717) (-1056.491) (-1059.948) [-1054.141] -- 0:00:29
824000 -- [-1050.603] (-1051.388) (-1055.451) (-1060.158) * (-1056.629) (-1054.442) [-1058.081] (-1056.465) -- 0:00:29
824500 -- (-1055.951) (-1058.618) [-1061.792] (-1060.495) * (-1063.711) [-1050.436] (-1055.025) (-1056.164) -- 0:00:29
825000 -- [-1055.345] (-1060.155) (-1066.647) (-1055.620) * (-1053.213) [-1050.497] (-1051.648) (-1059.507) -- 0:00:29
Average standard deviation of split frequencies: 0.000000
825500 -- (-1050.323) (-1063.617) (-1066.784) [-1052.313] * (-1057.274) [-1060.346] (-1054.401) (-1053.958) -- 0:00:28
826000 -- (-1053.145) [-1057.590] (-1062.215) (-1054.767) * [-1055.451] (-1058.468) (-1056.107) (-1057.209) -- 0:00:28
826500 -- (-1054.835) (-1057.569) [-1058.788] (-1052.188) * (-1059.824) [-1058.331] (-1057.208) (-1054.231) -- 0:00:28
827000 -- (-1054.145) [-1050.794] (-1056.025) (-1052.327) * [-1062.513] (-1053.563) (-1062.592) (-1057.823) -- 0:00:28
827500 -- (-1056.643) (-1054.472) (-1056.715) [-1053.636] * (-1053.016) [-1052.284] (-1054.734) (-1061.389) -- 0:00:28
828000 -- (-1055.246) (-1053.209) (-1059.772) [-1054.800] * (-1056.411) (-1057.014) (-1054.770) [-1055.557] -- 0:00:28
828500 -- (-1052.238) (-1058.448) (-1059.693) [-1053.681] * [-1054.819] (-1051.342) (-1056.161) (-1057.452) -- 0:00:28
829000 -- [-1053.128] (-1062.391) (-1055.267) (-1050.198) * (-1052.034) (-1054.394) (-1054.599) [-1053.698] -- 0:00:28
829500 -- (-1055.229) (-1055.183) (-1057.882) [-1051.669] * [-1052.746] (-1054.954) (-1055.421) (-1051.339) -- 0:00:28
830000 -- [-1055.729] (-1057.065) (-1055.784) (-1053.078) * [-1054.936] (-1056.972) (-1060.713) (-1056.299) -- 0:00:28
Average standard deviation of split frequencies: 0.000000
830500 -- (-1050.786) [-1052.554] (-1052.275) (-1054.582) * [-1052.184] (-1049.982) (-1052.814) (-1051.568) -- 0:00:28
831000 -- (-1053.639) (-1052.901) [-1053.810] (-1052.551) * (-1051.961) [-1057.594] (-1060.115) (-1050.471) -- 0:00:28
831500 -- (-1058.791) [-1055.158] (-1054.271) (-1051.260) * (-1050.853) (-1051.942) [-1054.319] (-1056.532) -- 0:00:27
832000 -- [-1053.574] (-1060.280) (-1063.762) (-1057.004) * (-1055.646) (-1055.253) (-1056.163) [-1047.433] -- 0:00:27
832500 -- (-1051.055) [-1052.221] (-1057.414) (-1053.107) * (-1054.891) (-1058.430) [-1054.696] (-1056.102) -- 0:00:27
833000 -- (-1053.672) (-1051.228) (-1064.821) [-1059.744] * (-1057.558) (-1055.141) (-1064.959) [-1053.472] -- 0:00:27
833500 -- (-1052.767) [-1055.778] (-1057.079) (-1053.882) * (-1051.809) [-1050.181] (-1054.736) (-1052.585) -- 0:00:27
834000 -- (-1064.478) (-1053.736) [-1057.873] (-1055.666) * [-1058.011] (-1053.101) (-1059.778) (-1050.350) -- 0:00:27
834500 -- (-1057.627) (-1059.211) [-1050.779] (-1054.165) * (-1053.176) (-1052.711) (-1057.378) [-1060.533] -- 0:00:27
835000 -- (-1060.036) (-1058.824) (-1053.904) [-1049.652] * (-1052.081) [-1050.825] (-1054.189) (-1051.291) -- 0:00:27
Average standard deviation of split frequencies: 0.000000
835500 -- (-1053.161) (-1060.692) (-1061.873) [-1053.231] * (-1052.157) (-1050.957) [-1058.777] (-1056.913) -- 0:00:27
836000 -- (-1054.889) (-1058.094) (-1056.072) [-1051.397] * (-1051.898) (-1055.057) [-1052.640] (-1054.054) -- 0:00:27
836500 -- (-1053.180) (-1057.178) (-1053.799) [-1051.768] * (-1052.689) (-1052.128) (-1058.555) [-1052.248] -- 0:00:27
837000 -- (-1059.660) (-1052.662) [-1058.516] (-1056.344) * (-1053.289) [-1057.350] (-1054.748) (-1051.194) -- 0:00:27
837500 -- (-1055.931) (-1055.024) [-1053.853] (-1051.849) * (-1052.652) (-1054.257) (-1055.060) [-1057.402] -- 0:00:26
838000 -- (-1057.162) (-1053.840) [-1061.403] (-1053.282) * (-1058.233) (-1056.296) (-1055.858) [-1056.548] -- 0:00:26
838500 -- (-1055.858) [-1052.031] (-1052.053) (-1055.359) * (-1055.664) [-1053.582] (-1054.270) (-1053.385) -- 0:00:26
839000 -- (-1056.600) [-1052.981] (-1059.633) (-1053.047) * (-1056.503) [-1055.293] (-1053.767) (-1064.273) -- 0:00:26
839500 -- [-1057.051] (-1053.958) (-1057.663) (-1049.399) * (-1057.812) (-1052.715) [-1056.433] (-1054.790) -- 0:00:26
840000 -- (-1060.830) (-1052.361) (-1060.061) [-1053.730] * (-1055.194) (-1055.451) [-1052.768] (-1054.028) -- 0:00:26
Average standard deviation of split frequencies: 0.000000
840500 -- (-1053.407) (-1054.183) [-1061.458] (-1057.872) * [-1054.329] (-1053.444) (-1057.660) (-1057.066) -- 0:00:26
841000 -- (-1054.786) (-1057.058) (-1057.467) [-1054.323] * (-1058.993) (-1053.114) [-1051.241] (-1055.670) -- 0:00:26
841500 -- (-1052.058) (-1054.229) (-1058.453) [-1059.906] * (-1056.362) (-1055.684) (-1057.627) [-1050.824] -- 0:00:26
842000 -- (-1054.993) (-1056.153) (-1058.020) [-1059.142] * [-1050.000] (-1061.004) (-1049.827) (-1054.869) -- 0:00:26
842500 -- (-1055.641) (-1056.705) [-1053.452] (-1056.524) * (-1054.031) (-1058.049) [-1054.185] (-1051.531) -- 0:00:26
843000 -- (-1054.579) [-1052.909] (-1052.072) (-1050.896) * (-1053.396) [-1056.411] (-1059.296) (-1057.446) -- 0:00:26
843500 -- (-1055.228) [-1059.515] (-1059.384) (-1051.901) * (-1054.161) (-1053.603) (-1052.716) [-1054.553] -- 0:00:25
844000 -- (-1056.603) (-1056.189) [-1054.624] (-1059.158) * (-1048.904) (-1052.908) [-1052.744] (-1059.432) -- 0:00:25
844500 -- (-1061.485) (-1060.317) (-1053.345) [-1057.838] * (-1053.140) [-1051.076] (-1052.437) (-1053.929) -- 0:00:25
845000 -- [-1056.752] (-1058.774) (-1058.984) (-1060.231) * (-1056.838) (-1049.674) (-1053.987) [-1059.449] -- 0:00:25
Average standard deviation of split frequencies: 0.000000
845500 -- (-1052.133) (-1056.765) (-1066.751) [-1060.205] * [-1051.198] (-1053.673) (-1050.174) (-1056.765) -- 0:00:25
846000 -- (-1053.951) (-1052.301) (-1062.331) [-1059.376] * [-1051.858] (-1059.735) (-1057.404) (-1056.058) -- 0:00:25
846500 -- (-1060.977) [-1061.265] (-1055.494) (-1054.048) * (-1056.094) [-1053.481] (-1057.855) (-1054.019) -- 0:00:25
847000 -- (-1059.193) [-1049.723] (-1055.364) (-1054.675) * (-1052.545) [-1053.085] (-1059.394) (-1057.815) -- 0:00:25
847500 -- [-1051.436] (-1054.729) (-1056.121) (-1055.927) * (-1051.996) (-1057.366) (-1057.113) [-1054.388] -- 0:00:25
848000 -- (-1062.250) (-1056.920) (-1055.992) [-1055.181] * (-1059.926) (-1054.705) (-1058.940) [-1057.051] -- 0:00:25
848500 -- (-1054.249) (-1058.384) (-1056.402) [-1051.926] * [-1059.084] (-1054.482) (-1058.774) (-1058.678) -- 0:00:25
849000 -- (-1057.559) (-1060.282) [-1056.069] (-1056.705) * (-1059.755) (-1050.133) (-1057.695) [-1053.790] -- 0:00:25
849500 -- (-1055.085) [-1055.484] (-1056.316) (-1056.860) * (-1059.381) [-1053.542] (-1061.604) (-1053.613) -- 0:00:24
850000 -- [-1056.640] (-1054.916) (-1055.950) (-1058.050) * (-1056.072) (-1053.633) [-1057.650] (-1052.125) -- 0:00:24
Average standard deviation of split frequencies: 0.000000
850500 -- (-1052.410) [-1053.583] (-1061.695) (-1053.716) * (-1052.695) (-1057.713) [-1052.696] (-1057.118) -- 0:00:24
851000 -- (-1055.207) (-1059.088) [-1054.694] (-1053.464) * [-1051.297] (-1053.646) (-1058.927) (-1052.387) -- 0:00:24
851500 -- [-1058.055] (-1057.801) (-1049.980) (-1052.561) * (-1057.724) [-1054.791] (-1054.476) (-1055.913) -- 0:00:24
852000 -- (-1051.585) (-1063.885) [-1055.313] (-1052.201) * (-1053.005) (-1061.517) (-1055.629) [-1056.090] -- 0:00:24
852500 -- [-1051.941] (-1053.115) (-1062.998) (-1055.197) * (-1055.662) (-1050.813) (-1049.691) [-1059.250] -- 0:00:24
853000 -- (-1054.006) (-1050.529) [-1056.702] (-1055.563) * [-1059.721] (-1060.769) (-1061.835) (-1053.491) -- 0:00:24
853500 -- (-1060.263) [-1049.715] (-1053.139) (-1062.372) * [-1059.889] (-1055.495) (-1054.064) (-1056.000) -- 0:00:24
854000 -- [-1053.307] (-1053.089) (-1056.925) (-1060.476) * (-1056.508) (-1054.835) [-1051.574] (-1053.929) -- 0:00:24
854500 -- [-1055.570] (-1052.444) (-1059.807) (-1053.750) * (-1056.589) (-1055.824) (-1055.014) [-1053.135] -- 0:00:24
855000 -- [-1053.453] (-1053.404) (-1055.365) (-1057.203) * [-1053.018] (-1058.830) (-1061.209) (-1056.569) -- 0:00:24
Average standard deviation of split frequencies: 0.000000
855500 -- (-1055.641) [-1061.241] (-1053.497) (-1054.409) * [-1064.217] (-1056.929) (-1055.280) (-1050.630) -- 0:00:23
856000 -- (-1052.795) (-1059.231) [-1058.844] (-1056.040) * [-1059.502] (-1059.490) (-1061.263) (-1060.394) -- 0:00:23
856500 -- (-1051.509) (-1057.536) (-1050.267) [-1057.964] * (-1059.767) (-1063.570) [-1057.494] (-1053.199) -- 0:00:23
857000 -- (-1054.381) (-1054.455) (-1053.210) [-1058.186] * (-1062.741) (-1057.202) (-1053.370) [-1054.723] -- 0:00:23
857500 -- [-1056.339] (-1063.601) (-1055.340) (-1052.464) * (-1051.960) (-1054.515) [-1058.992] (-1055.974) -- 0:00:23
858000 -- (-1050.633) (-1056.167) (-1056.447) [-1052.820] * [-1050.879] (-1056.253) (-1055.170) (-1057.347) -- 0:00:23
858500 -- (-1058.024) (-1055.695) [-1055.539] (-1052.730) * (-1054.247) (-1057.501) [-1051.503] (-1057.523) -- 0:00:23
859000 -- (-1055.176) (-1058.978) (-1052.347) [-1057.951] * (-1054.772) (-1054.551) [-1052.657] (-1054.869) -- 0:00:23
859500 -- (-1055.730) (-1053.206) [-1053.519] (-1054.984) * (-1055.721) (-1059.593) [-1053.429] (-1054.248) -- 0:00:23
860000 -- (-1054.318) [-1056.212] (-1054.552) (-1066.102) * (-1055.321) [-1058.926] (-1059.620) (-1050.947) -- 0:00:23
Average standard deviation of split frequencies: 0.000000
860500 -- (-1055.789) [-1053.752] (-1053.312) (-1055.585) * (-1052.791) (-1050.775) (-1049.660) [-1052.020] -- 0:00:23
861000 -- (-1058.056) (-1060.353) (-1056.551) [-1053.061] * (-1058.687) [-1052.402] (-1051.417) (-1054.111) -- 0:00:23
861500 -- (-1063.212) (-1055.943) [-1049.928] (-1055.951) * (-1057.661) [-1053.891] (-1061.044) (-1054.308) -- 0:00:22
862000 -- [-1051.144] (-1055.260) (-1053.161) (-1051.979) * (-1061.285) (-1055.926) [-1061.159] (-1052.132) -- 0:00:22
862500 -- [-1057.713] (-1057.120) (-1049.816) (-1055.328) * [-1054.926] (-1055.870) (-1057.871) (-1054.086) -- 0:00:22
863000 -- [-1059.435] (-1057.609) (-1061.176) (-1055.971) * (-1065.069) (-1058.195) (-1056.472) [-1056.787] -- 0:00:22
863500 -- (-1051.037) [-1056.192] (-1058.335) (-1058.647) * (-1061.953) [-1055.703] (-1052.850) (-1056.038) -- 0:00:22
864000 -- (-1051.622) (-1061.434) (-1057.775) [-1055.846] * (-1056.871) (-1051.012) [-1057.256] (-1053.781) -- 0:00:22
864500 -- (-1053.679) (-1051.750) [-1056.785] (-1053.258) * (-1054.238) [-1050.871] (-1060.009) (-1056.724) -- 0:00:22
865000 -- (-1051.352) [-1052.678] (-1050.103) (-1057.135) * (-1053.870) (-1054.212) [-1054.872] (-1056.226) -- 0:00:22
Average standard deviation of split frequencies: 0.000000
865500 -- (-1058.537) (-1056.862) (-1061.928) [-1051.788] * (-1057.584) (-1051.983) [-1056.121] (-1059.814) -- 0:00:22
866000 -- (-1053.896) (-1052.975) [-1058.325] (-1051.031) * (-1058.749) (-1057.349) [-1057.288] (-1054.717) -- 0:00:22
866500 -- (-1053.319) [-1053.515] (-1059.486) (-1051.095) * (-1058.589) (-1064.029) [-1053.485] (-1054.487) -- 0:00:22
867000 -- (-1050.005) [-1050.798] (-1062.693) (-1052.612) * [-1054.540] (-1054.660) (-1056.460) (-1063.219) -- 0:00:22
867500 -- [-1051.866] (-1057.390) (-1054.682) (-1050.240) * [-1053.460] (-1058.399) (-1057.185) (-1058.031) -- 0:00:21
868000 -- (-1055.691) (-1053.559) [-1056.328] (-1067.169) * [-1054.508] (-1060.234) (-1053.980) (-1054.713) -- 0:00:21
868500 -- (-1055.115) [-1057.414] (-1055.256) (-1050.988) * [-1053.292] (-1061.185) (-1059.904) (-1053.701) -- 0:00:21
869000 -- (-1058.304) [-1053.419] (-1057.047) (-1058.729) * (-1056.813) (-1061.015) (-1064.086) [-1053.012] -- 0:00:21
869500 -- (-1054.726) (-1058.878) [-1062.635] (-1060.662) * [-1055.897] (-1059.353) (-1057.526) (-1055.676) -- 0:00:21
870000 -- (-1063.745) [-1056.898] (-1052.209) (-1058.744) * [-1051.150] (-1059.942) (-1052.744) (-1055.819) -- 0:00:21
Average standard deviation of split frequencies: 0.000000
870500 -- (-1057.358) (-1060.722) (-1051.552) [-1058.978] * [-1057.032] (-1058.439) (-1053.934) (-1058.014) -- 0:00:21
871000 -- (-1059.505) (-1056.650) [-1052.154] (-1061.996) * (-1057.428) (-1053.851) (-1054.754) [-1049.940] -- 0:00:21
871500 -- (-1051.509) (-1063.616) [-1053.952] (-1060.194) * (-1056.841) (-1058.284) (-1053.767) [-1051.178] -- 0:00:21
872000 -- (-1057.230) (-1063.823) (-1051.702) [-1052.856] * (-1060.909) [-1057.213] (-1051.015) (-1057.890) -- 0:00:21
872500 -- (-1052.110) (-1056.842) (-1051.479) [-1053.234] * (-1051.181) (-1053.564) [-1051.288] (-1058.459) -- 0:00:21
873000 -- [-1050.167] (-1064.690) (-1056.401) (-1054.434) * (-1056.691) (-1053.992) (-1054.860) [-1057.199] -- 0:00:21
873500 -- (-1056.192) (-1053.318) [-1053.177] (-1052.592) * (-1070.013) (-1056.669) [-1053.098] (-1055.998) -- 0:00:20
874000 -- (-1053.567) (-1058.498) (-1057.579) [-1053.483] * (-1063.170) [-1054.179] (-1054.139) (-1055.188) -- 0:00:20
874500 -- [-1055.102] (-1055.861) (-1053.766) (-1059.921) * [-1062.214] (-1058.998) (-1058.836) (-1050.943) -- 0:00:20
875000 -- (-1052.468) [-1055.710] (-1057.928) (-1068.928) * (-1060.238) (-1060.586) (-1053.850) [-1051.757] -- 0:00:20
Average standard deviation of split frequencies: 0.000000
875500 -- (-1054.144) [-1052.354] (-1061.223) (-1057.989) * (-1056.788) (-1056.287) [-1052.859] (-1057.887) -- 0:00:20
876000 -- (-1051.560) [-1053.602] (-1059.597) (-1067.018) * (-1059.601) (-1054.348) [-1056.803] (-1051.880) -- 0:00:20
876500 -- (-1051.862) (-1057.897) [-1054.459] (-1060.942) * [-1055.635] (-1050.469) (-1053.736) (-1057.031) -- 0:00:20
877000 -- [-1055.580] (-1055.616) (-1055.078) (-1058.192) * (-1059.960) (-1057.957) [-1053.268] (-1062.048) -- 0:00:20
877500 -- (-1050.914) (-1061.004) [-1054.953] (-1056.520) * [-1052.600] (-1052.973) (-1053.997) (-1060.637) -- 0:00:20
878000 -- [-1049.739] (-1051.894) (-1060.682) (-1060.635) * (-1060.984) (-1055.357) [-1048.667] (-1059.881) -- 0:00:20
878500 -- (-1055.469) (-1053.171) [-1056.384] (-1062.009) * [-1056.594] (-1064.151) (-1052.345) (-1052.072) -- 0:00:20
879000 -- (-1054.388) (-1054.395) (-1059.059) [-1056.691] * (-1059.089) (-1050.658) (-1052.712) [-1056.969] -- 0:00:20
879500 -- [-1059.500] (-1062.815) (-1053.715) (-1055.033) * (-1057.439) [-1051.411] (-1052.406) (-1054.216) -- 0:00:20
880000 -- (-1055.536) [-1061.374] (-1054.891) (-1054.390) * (-1059.963) (-1052.742) [-1067.129] (-1056.367) -- 0:00:19
Average standard deviation of split frequencies: 0.000000
880500 -- (-1054.112) [-1055.346] (-1059.145) (-1052.928) * (-1054.785) [-1050.505] (-1056.796) (-1056.341) -- 0:00:19
881000 -- [-1050.763] (-1051.933) (-1053.770) (-1058.711) * (-1059.119) (-1057.411) [-1054.190] (-1053.827) -- 0:00:19
881500 -- (-1059.149) [-1051.758] (-1049.589) (-1054.740) * (-1055.715) (-1057.565) (-1052.162) [-1052.997] -- 0:00:19
882000 -- (-1053.062) (-1053.804) (-1054.118) [-1054.783] * (-1054.061) [-1052.194] (-1055.054) (-1058.271) -- 0:00:19
882500 -- (-1049.193) (-1068.025) (-1051.324) [-1052.339] * (-1054.420) (-1054.342) [-1055.124] (-1056.041) -- 0:00:19
883000 -- (-1052.252) (-1056.947) [-1053.274] (-1058.542) * [-1056.040] (-1056.386) (-1052.655) (-1055.759) -- 0:00:19
883500 -- (-1052.269) (-1059.742) [-1053.145] (-1059.469) * (-1055.145) (-1061.060) [-1051.455] (-1050.142) -- 0:00:19
884000 -- (-1060.332) (-1059.006) (-1051.647) [-1049.591] * (-1054.765) (-1057.889) (-1060.040) [-1052.267] -- 0:00:19
884500 -- (-1055.528) (-1060.509) (-1050.312) [-1052.790] * (-1052.659) (-1061.435) [-1049.579] (-1054.206) -- 0:00:19
885000 -- (-1060.776) (-1062.861) [-1056.689] (-1057.287) * (-1055.521) (-1058.203) (-1056.680) [-1058.380] -- 0:00:19
Average standard deviation of split frequencies: 0.000000
885500 -- (-1060.070) [-1058.098] (-1053.107) (-1061.034) * (-1053.685) (-1054.103) [-1050.941] (-1057.792) -- 0:00:19
886000 -- (-1050.885) (-1060.973) [-1054.878] (-1065.806) * (-1051.499) (-1054.752) [-1051.920] (-1057.856) -- 0:00:18
886500 -- (-1051.385) (-1064.564) (-1056.424) [-1053.108] * (-1051.450) [-1052.893] (-1057.211) (-1056.104) -- 0:00:18
887000 -- (-1052.274) [-1056.755] (-1058.225) (-1061.673) * (-1052.717) [-1058.132] (-1062.516) (-1056.675) -- 0:00:18
887500 -- [-1053.659] (-1058.383) (-1059.222) (-1059.809) * (-1053.805) [-1062.274] (-1051.084) (-1057.810) -- 0:00:18
888000 -- [-1055.166] (-1066.772) (-1057.879) (-1061.890) * [-1054.947] (-1059.218) (-1057.705) (-1057.150) -- 0:00:18
888500 -- (-1063.919) (-1059.424) [-1052.585] (-1063.468) * (-1051.467) [-1055.756] (-1055.888) (-1054.039) -- 0:00:18
889000 -- (-1051.652) (-1058.253) [-1055.686] (-1059.974) * (-1063.603) [-1050.322] (-1055.692) (-1052.163) -- 0:00:18
889500 -- [-1050.928] (-1059.378) (-1062.801) (-1059.371) * (-1055.363) [-1051.981] (-1052.439) (-1050.811) -- 0:00:18
890000 -- [-1055.314] (-1054.005) (-1054.302) (-1057.436) * (-1059.670) (-1057.956) (-1053.123) [-1053.226] -- 0:00:18
Average standard deviation of split frequencies: 0.000000
890500 -- (-1053.381) [-1052.662] (-1058.478) (-1053.148) * (-1062.428) [-1052.826] (-1061.237) (-1053.531) -- 0:00:18
891000 -- (-1054.011) (-1055.418) (-1051.490) [-1057.508] * (-1058.293) (-1056.961) (-1060.143) [-1054.969] -- 0:00:18
891500 -- (-1056.577) [-1055.866] (-1050.722) (-1056.496) * (-1063.400) (-1051.162) [-1050.799] (-1053.038) -- 0:00:18
892000 -- (-1052.912) (-1054.049) [-1056.312] (-1059.747) * (-1059.269) (-1052.417) (-1053.891) [-1056.064] -- 0:00:17
892500 -- (-1069.071) [-1053.426] (-1058.105) (-1058.811) * [-1051.848] (-1056.118) (-1059.955) (-1055.919) -- 0:00:17
893000 -- (-1051.982) [-1055.913] (-1056.722) (-1056.782) * (-1053.920) (-1052.009) [-1054.264] (-1051.022) -- 0:00:17
893500 -- (-1058.456) [-1054.177] (-1053.826) (-1054.320) * (-1066.384) [-1050.527] (-1051.160) (-1059.066) -- 0:00:17
894000 -- (-1063.026) (-1053.628) [-1054.348] (-1062.202) * [-1053.673] (-1059.480) (-1053.096) (-1052.283) -- 0:00:17
894500 -- [-1060.954] (-1048.883) (-1050.803) (-1058.977) * [-1053.191] (-1052.596) (-1051.854) (-1054.572) -- 0:00:17
895000 -- (-1060.221) (-1054.187) [-1054.089] (-1065.384) * (-1057.543) (-1055.458) (-1053.801) [-1055.821] -- 0:00:17
Average standard deviation of split frequencies: 0.000000
895500 -- (-1057.240) (-1056.976) [-1050.680] (-1057.578) * (-1061.186) [-1059.491] (-1063.458) (-1053.905) -- 0:00:17
896000 -- (-1053.959) (-1057.856) (-1052.097) [-1050.210] * (-1057.877) [-1056.810] (-1065.689) (-1060.893) -- 0:00:17
896500 -- (-1056.404) (-1053.215) (-1052.477) [-1053.361] * (-1054.484) (-1057.047) [-1055.757] (-1054.638) -- 0:00:17
897000 -- [-1056.886] (-1057.123) (-1054.181) (-1055.485) * [-1050.451] (-1060.154) (-1053.703) (-1053.636) -- 0:00:17
897500 -- (-1052.344) [-1052.024] (-1055.950) (-1060.223) * (-1054.108) (-1050.173) [-1053.722] (-1052.148) -- 0:00:17
898000 -- (-1053.165) [-1053.469] (-1055.402) (-1061.186) * [-1057.399] (-1062.703) (-1053.088) (-1058.909) -- 0:00:16
898500 -- (-1054.337) (-1061.178) [-1052.702] (-1056.706) * (-1053.616) (-1056.777) [-1054.160] (-1058.251) -- 0:00:16
899000 -- (-1061.014) (-1052.506) [-1055.993] (-1055.846) * (-1054.275) [-1052.481] (-1056.413) (-1059.286) -- 0:00:16
899500 -- [-1052.729] (-1054.435) (-1055.519) (-1053.921) * (-1060.961) (-1051.895) [-1052.489] (-1056.025) -- 0:00:16
900000 -- [-1051.552] (-1056.129) (-1054.491) (-1054.912) * (-1059.978) (-1058.169) [-1051.959] (-1053.624) -- 0:00:16
Average standard deviation of split frequencies: 0.000000
900500 -- (-1061.367) (-1055.989) [-1060.372] (-1058.887) * (-1061.853) [-1049.897] (-1056.170) (-1051.261) -- 0:00:16
901000 -- (-1050.711) (-1057.165) [-1055.156] (-1055.161) * (-1057.025) (-1056.070) (-1061.657) [-1061.056] -- 0:00:16
901500 -- (-1054.288) (-1052.379) [-1057.342] (-1053.600) * (-1057.122) (-1051.950) (-1061.049) [-1056.307] -- 0:00:16
902000 -- (-1059.864) (-1054.150) (-1055.855) [-1057.146] * (-1060.737) (-1060.024) (-1063.799) [-1057.152] -- 0:00:16
902500 -- (-1055.686) (-1053.699) [-1052.237] (-1049.428) * (-1055.695) (-1056.795) [-1055.898] (-1053.460) -- 0:00:16
903000 -- [-1053.286] (-1057.421) (-1060.312) (-1051.616) * (-1056.322) [-1057.558] (-1055.911) (-1052.121) -- 0:00:16
903500 -- (-1062.750) (-1054.913) [-1053.411] (-1056.030) * (-1059.235) [-1054.928] (-1052.963) (-1051.925) -- 0:00:16
904000 -- (-1053.807) (-1057.438) (-1054.543) [-1051.028] * (-1065.716) (-1055.690) [-1050.237] (-1053.825) -- 0:00:15
904500 -- [-1053.121] (-1054.518) (-1051.843) (-1056.444) * (-1061.772) [-1054.549] (-1053.358) (-1055.929) -- 0:00:15
905000 -- (-1058.081) [-1058.576] (-1053.468) (-1059.620) * (-1054.727) [-1052.781] (-1053.461) (-1060.234) -- 0:00:15
Average standard deviation of split frequencies: 0.000000
905500 -- (-1054.528) (-1058.944) (-1057.197) [-1058.594] * (-1056.178) (-1059.391) [-1054.691] (-1052.436) -- 0:00:15
906000 -- [-1054.691] (-1062.873) (-1056.821) (-1057.663) * (-1054.679) [-1057.247] (-1052.671) (-1055.990) -- 0:00:15
906500 -- [-1050.601] (-1054.126) (-1052.290) (-1052.623) * (-1055.488) [-1058.951] (-1055.630) (-1063.596) -- 0:00:15
907000 -- (-1050.684) (-1051.845) (-1050.105) [-1055.752] * (-1053.877) (-1056.513) (-1055.319) [-1053.411] -- 0:00:15
907500 -- (-1053.043) (-1054.118) [-1053.771] (-1058.333) * (-1052.147) (-1065.918) (-1056.954) [-1053.923] -- 0:00:15
908000 -- (-1056.144) [-1054.741] (-1064.788) (-1058.926) * (-1051.804) (-1066.400) [-1061.072] (-1054.164) -- 0:00:15
908500 -- (-1057.329) [-1053.622] (-1063.382) (-1054.436) * (-1065.453) (-1062.764) (-1051.008) [-1059.504] -- 0:00:15
909000 -- [-1053.629] (-1062.033) (-1062.295) (-1060.031) * (-1055.608) (-1050.982) [-1057.362] (-1054.279) -- 0:00:15
909500 -- (-1059.440) (-1053.521) (-1058.855) [-1054.371] * [-1061.666] (-1050.343) (-1055.330) (-1056.916) -- 0:00:15
910000 -- (-1053.105) [-1058.058] (-1054.989) (-1054.626) * (-1055.630) (-1048.575) [-1060.384] (-1055.270) -- 0:00:14
Average standard deviation of split frequencies: 0.000000
910500 -- (-1054.244) (-1059.470) (-1059.709) [-1050.870] * (-1055.730) (-1061.012) (-1060.223) [-1056.343] -- 0:00:14
911000 -- (-1055.556) (-1056.152) [-1053.163] (-1055.979) * [-1052.109] (-1053.281) (-1055.056) (-1061.945) -- 0:00:14
911500 -- (-1051.418) (-1058.363) [-1052.424] (-1056.630) * [-1051.792] (-1061.481) (-1055.706) (-1053.751) -- 0:00:14
912000 -- (-1057.101) (-1055.177) (-1054.595) [-1052.152] * [-1055.713] (-1051.798) (-1056.466) (-1056.866) -- 0:00:14
912500 -- (-1057.354) [-1051.668] (-1057.956) (-1054.199) * (-1054.741) (-1055.121) (-1057.846) [-1058.205] -- 0:00:14
913000 -- (-1055.401) (-1053.884) [-1056.251] (-1057.959) * (-1058.420) (-1051.607) (-1051.906) [-1052.415] -- 0:00:14
913500 -- [-1052.786] (-1049.638) (-1054.803) (-1058.406) * [-1053.928] (-1054.346) (-1053.812) (-1053.875) -- 0:00:14
914000 -- (-1052.246) [-1055.227] (-1053.044) (-1059.727) * (-1055.678) [-1054.049] (-1052.754) (-1054.141) -- 0:00:14
914500 -- (-1055.097) [-1052.121] (-1050.372) (-1054.774) * (-1053.044) [-1053.415] (-1055.160) (-1055.935) -- 0:00:14
915000 -- (-1057.159) (-1057.128) [-1051.157] (-1056.810) * (-1056.841) (-1057.239) [-1052.600] (-1054.582) -- 0:00:14
Average standard deviation of split frequencies: 0.000000
915500 -- (-1057.641) [-1050.834] (-1055.503) (-1059.491) * (-1057.092) (-1060.970) [-1054.402] (-1059.908) -- 0:00:14
916000 -- (-1059.747) (-1059.175) (-1055.295) [-1055.587] * (-1054.241) [-1057.646] (-1056.675) (-1057.961) -- 0:00:13
916500 -- (-1057.891) [-1056.569] (-1054.266) (-1053.482) * (-1057.304) [-1061.476] (-1059.930) (-1058.358) -- 0:00:13
917000 -- (-1054.119) (-1057.794) [-1054.670] (-1054.237) * (-1053.698) (-1063.078) (-1059.755) [-1055.297] -- 0:00:13
917500 -- (-1054.788) (-1061.678) [-1052.423] (-1057.578) * (-1053.866) (-1048.976) (-1056.675) [-1056.527] -- 0:00:13
918000 -- (-1059.854) (-1059.717) (-1050.922) [-1052.387] * (-1053.032) [-1054.143] (-1058.883) (-1052.946) -- 0:00:13
918500 -- [-1053.361] (-1060.669) (-1054.338) (-1055.326) * (-1052.032) [-1057.868] (-1058.732) (-1056.837) -- 0:00:13
919000 -- (-1052.709) (-1059.553) (-1055.721) [-1051.842] * (-1057.538) [-1054.222] (-1053.571) (-1055.536) -- 0:00:13
919500 -- (-1059.267) (-1057.214) (-1055.099) [-1050.028] * [-1058.167] (-1059.608) (-1055.500) (-1058.819) -- 0:00:13
920000 -- [-1054.532] (-1053.749) (-1053.849) (-1053.833) * (-1059.870) (-1057.741) [-1052.498] (-1051.201) -- 0:00:13
Average standard deviation of split frequencies: 0.000000
920500 -- (-1058.132) (-1052.765) [-1055.992] (-1056.765) * (-1054.796) (-1057.467) (-1056.666) [-1053.535] -- 0:00:13
921000 -- (-1055.627) (-1054.366) [-1053.676] (-1054.661) * [-1052.583] (-1056.933) (-1058.531) (-1059.865) -- 0:00:13
921500 -- (-1058.152) (-1051.783) [-1053.785] (-1056.165) * (-1051.435) (-1055.440) [-1057.590] (-1052.715) -- 0:00:13
922000 -- [-1052.156] (-1058.811) (-1049.204) (-1061.285) * (-1052.759) (-1058.700) (-1050.550) [-1053.166] -- 0:00:12
922500 -- [-1055.410] (-1059.097) (-1053.418) (-1050.859) * (-1049.971) (-1055.566) [-1056.722] (-1057.182) -- 0:00:12
923000 -- (-1053.206) [-1056.265] (-1054.446) (-1050.965) * (-1054.306) (-1060.174) [-1052.476] (-1056.706) -- 0:00:12
923500 -- (-1060.857) [-1052.744] (-1057.745) (-1053.935) * (-1055.522) (-1055.309) (-1061.811) [-1055.967] -- 0:00:12
924000 -- (-1057.801) (-1052.798) (-1056.099) [-1051.375] * (-1053.730) (-1056.536) [-1054.692] (-1055.907) -- 0:00:12
924500 -- (-1059.733) [-1054.972] (-1062.789) (-1051.346) * (-1056.698) [-1054.172] (-1054.540) (-1061.285) -- 0:00:12
925000 -- (-1054.125) (-1055.751) [-1063.544] (-1054.271) * (-1062.427) [-1055.428] (-1055.380) (-1061.915) -- 0:00:12
Average standard deviation of split frequencies: 0.000000
925500 -- (-1056.227) [-1057.514] (-1059.787) (-1050.580) * (-1053.636) [-1052.437] (-1054.853) (-1056.334) -- 0:00:12
926000 -- (-1058.824) (-1056.172) (-1062.643) [-1057.441] * (-1051.269) (-1058.309) [-1055.247] (-1059.666) -- 0:00:12
926500 -- [-1050.293] (-1059.984) (-1059.575) (-1057.651) * (-1051.898) (-1055.402) (-1054.289) [-1055.368] -- 0:00:12
927000 -- (-1052.094) (-1058.170) [-1060.614] (-1054.834) * (-1058.636) (-1052.050) (-1057.798) [-1052.293] -- 0:00:12
927500 -- (-1053.538) [-1053.244] (-1053.410) (-1050.688) * (-1052.473) (-1054.481) (-1051.245) [-1053.378] -- 0:00:12
928000 -- (-1053.829) (-1058.004) (-1059.026) [-1052.506] * [-1053.239] (-1052.402) (-1056.511) (-1055.055) -- 0:00:11
928500 -- (-1056.761) [-1049.399] (-1056.022) (-1052.704) * (-1054.665) (-1061.151) [-1053.295] (-1052.003) -- 0:00:11
929000 -- (-1053.829) (-1054.126) (-1054.287) [-1055.961] * (-1053.831) (-1054.627) [-1060.883] (-1059.322) -- 0:00:11
929500 -- (-1054.305) (-1060.442) [-1053.778] (-1056.128) * (-1060.788) (-1059.229) (-1060.312) [-1057.002] -- 0:00:11
930000 -- [-1051.237] (-1054.111) (-1052.227) (-1055.290) * (-1054.763) (-1049.755) (-1057.166) [-1052.502] -- 0:00:11
Average standard deviation of split frequencies: 0.000000
930500 -- (-1050.675) [-1054.567] (-1057.432) (-1056.785) * [-1051.602] (-1053.260) (-1056.542) (-1051.939) -- 0:00:11
931000 -- (-1053.413) (-1054.038) [-1052.128] (-1058.550) * (-1055.105) [-1054.109] (-1055.983) (-1065.159) -- 0:00:11
931500 -- (-1055.538) (-1055.607) [-1063.216] (-1055.536) * (-1052.439) (-1056.635) (-1061.550) [-1051.833] -- 0:00:11
932000 -- (-1054.218) (-1059.843) (-1054.115) [-1053.982] * (-1054.279) (-1053.395) (-1057.726) [-1053.343] -- 0:00:11
932500 -- (-1055.806) (-1066.458) (-1054.965) [-1058.731] * (-1055.371) [-1056.259] (-1059.274) (-1051.225) -- 0:00:11
933000 -- (-1056.462) [-1055.112] (-1057.342) (-1056.855) * (-1060.533) (-1057.218) (-1055.669) [-1049.401] -- 0:00:11
933500 -- (-1062.706) (-1051.510) (-1056.810) [-1058.482] * [-1055.181] (-1055.477) (-1057.078) (-1054.330) -- 0:00:11
934000 -- (-1052.422) (-1061.317) (-1062.193) [-1055.167] * (-1053.626) [-1053.240] (-1053.238) (-1052.926) -- 0:00:10
934500 -- (-1060.272) (-1054.364) [-1055.620] (-1060.080) * [-1055.892] (-1057.926) (-1056.494) (-1053.789) -- 0:00:10
935000 -- (-1056.043) (-1053.352) (-1055.749) [-1060.846] * [-1051.975] (-1054.748) (-1063.672) (-1055.686) -- 0:00:10
Average standard deviation of split frequencies: 0.000000
935500 -- (-1055.186) (-1056.444) (-1053.825) [-1057.419] * (-1061.956) (-1056.838) (-1063.044) [-1050.587] -- 0:00:10
936000 -- (-1053.928) (-1056.493) (-1056.091) [-1055.243] * (-1058.535) [-1051.126] (-1051.545) (-1054.890) -- 0:00:10
936500 -- (-1050.090) (-1053.666) (-1052.868) [-1061.194] * (-1058.257) (-1050.824) (-1056.260) [-1055.653] -- 0:00:10
937000 -- (-1053.390) (-1056.443) [-1053.426] (-1054.332) * (-1061.224) (-1052.840) (-1052.308) [-1056.089] -- 0:00:10
937500 -- (-1053.581) [-1052.987] (-1060.590) (-1057.814) * (-1061.119) [-1054.997] (-1061.491) (-1057.390) -- 0:00:10
938000 -- (-1058.010) (-1063.838) [-1052.756] (-1064.568) * (-1056.821) (-1053.281) (-1054.822) [-1061.329] -- 0:00:10
938500 -- (-1055.759) (-1060.909) [-1057.004] (-1061.327) * (-1059.980) [-1049.648] (-1055.074) (-1052.322) -- 0:00:10
939000 -- (-1065.115) (-1056.144) (-1053.412) [-1055.251] * (-1056.898) [-1056.179] (-1053.925) (-1053.023) -- 0:00:10
939500 -- (-1054.861) (-1052.113) (-1057.598) [-1057.903] * (-1051.837) (-1054.656) (-1054.466) [-1050.905] -- 0:00:10
940000 -- (-1061.155) (-1059.911) (-1054.451) [-1055.411] * (-1058.934) (-1052.537) [-1050.858] (-1053.638) -- 0:00:09
Average standard deviation of split frequencies: 0.000000
940500 -- [-1053.820] (-1053.623) (-1050.759) (-1053.564) * (-1058.515) [-1052.660] (-1057.374) (-1054.588) -- 0:00:09
941000 -- (-1053.909) [-1055.238] (-1053.601) (-1053.867) * [-1056.571] (-1052.928) (-1052.871) (-1054.813) -- 0:00:09
941500 -- (-1051.928) (-1056.947) [-1053.430] (-1056.414) * (-1056.379) (-1054.194) (-1054.378) [-1052.661] -- 0:00:09
942000 -- (-1054.301) (-1060.021) [-1054.305] (-1058.635) * (-1056.659) [-1055.892] (-1061.314) (-1059.194) -- 0:00:09
942500 -- (-1051.419) (-1067.827) [-1054.953] (-1054.953) * (-1054.610) (-1055.402) [-1050.894] (-1057.003) -- 0:00:09
943000 -- (-1057.354) (-1056.326) (-1053.803) [-1055.419] * (-1053.619) (-1056.955) (-1054.150) [-1054.243] -- 0:00:09
943500 -- [-1054.049] (-1060.642) (-1052.465) (-1065.538) * (-1055.635) (-1058.412) (-1051.445) [-1052.442] -- 0:00:09
944000 -- (-1052.801) (-1059.741) (-1054.139) [-1051.143] * [-1053.999] (-1054.379) (-1051.423) (-1055.761) -- 0:00:09
944500 -- [-1052.519] (-1066.639) (-1054.146) (-1056.850) * (-1060.412) [-1053.837] (-1053.589) (-1055.947) -- 0:00:09
945000 -- [-1054.720] (-1057.924) (-1059.270) (-1057.371) * (-1059.111) [-1053.709] (-1052.375) (-1057.679) -- 0:00:09
Average standard deviation of split frequencies: 0.000000
945500 -- [-1052.778] (-1054.335) (-1051.946) (-1056.422) * (-1060.191) [-1051.434] (-1053.340) (-1058.539) -- 0:00:09
946000 -- (-1056.415) [-1049.866] (-1060.018) (-1052.130) * (-1054.536) [-1051.494] (-1058.891) (-1059.037) -- 0:00:08
946500 -- (-1051.913) (-1058.489) [-1057.594] (-1052.603) * (-1057.010) (-1052.820) (-1055.713) [-1055.146] -- 0:00:08
947000 -- [-1051.160] (-1057.832) (-1050.911) (-1054.133) * (-1065.113) [-1060.264] (-1050.952) (-1053.476) -- 0:00:08
947500 -- [-1052.189] (-1060.461) (-1059.538) (-1059.636) * (-1053.592) [-1055.750] (-1052.463) (-1051.912) -- 0:00:08
948000 -- (-1054.420) (-1055.916) [-1053.415] (-1062.545) * (-1058.859) (-1065.504) [-1059.737] (-1052.757) -- 0:00:08
948500 -- (-1053.742) [-1055.749] (-1055.410) (-1064.823) * (-1059.702) (-1061.380) (-1064.094) [-1056.223] -- 0:00:08
949000 -- [-1053.403] (-1057.888) (-1064.515) (-1060.594) * (-1052.859) (-1057.245) (-1063.222) [-1060.540] -- 0:00:08
949500 -- (-1051.800) [-1058.056] (-1057.815) (-1057.228) * (-1058.568) (-1053.624) [-1049.992] (-1057.862) -- 0:00:08
950000 -- (-1053.241) (-1057.240) [-1049.976] (-1058.741) * (-1052.497) [-1054.693] (-1054.593) (-1056.246) -- 0:00:08
Average standard deviation of split frequencies: 0.000000
950500 -- (-1055.690) (-1056.029) [-1058.138] (-1054.950) * (-1054.864) (-1053.640) (-1051.981) [-1053.339] -- 0:00:08
951000 -- [-1055.061] (-1067.476) (-1050.674) (-1060.645) * (-1052.200) (-1056.550) (-1055.440) [-1057.519] -- 0:00:08
951500 -- [-1056.216] (-1058.130) (-1053.701) (-1053.278) * (-1055.328) [-1051.820] (-1054.935) (-1057.491) -- 0:00:08
952000 -- [-1063.670] (-1055.989) (-1057.868) (-1054.852) * (-1052.031) (-1054.569) [-1055.955] (-1058.447) -- 0:00:07
952500 -- (-1056.732) (-1054.323) [-1060.184] (-1053.273) * [-1053.024] (-1054.113) (-1055.542) (-1055.107) -- 0:00:07
953000 -- [-1049.797] (-1051.991) (-1053.054) (-1055.276) * [-1053.756] (-1057.532) (-1060.070) (-1056.374) -- 0:00:07
953500 -- (-1052.378) (-1053.925) (-1055.763) [-1055.373] * (-1063.744) (-1051.072) [-1052.430] (-1058.139) -- 0:00:07
954000 -- (-1058.044) [-1054.886] (-1053.505) (-1055.190) * (-1053.297) (-1057.392) [-1051.902] (-1056.993) -- 0:00:07
954500 -- [-1055.184] (-1056.232) (-1060.915) (-1057.296) * [-1052.310] (-1055.219) (-1053.083) (-1059.617) -- 0:00:07
955000 -- (-1061.200) [-1051.556] (-1055.510) (-1053.373) * [-1051.199] (-1060.124) (-1054.373) (-1061.198) -- 0:00:07
Average standard deviation of split frequencies: 0.000000
955500 -- (-1054.328) (-1050.732) (-1058.778) [-1055.585] * [-1054.537] (-1054.794) (-1056.604) (-1061.191) -- 0:00:07
956000 -- (-1059.764) [-1050.558] (-1051.759) (-1052.016) * [-1058.146] (-1054.009) (-1062.293) (-1064.394) -- 0:00:07
956500 -- (-1065.396) [-1053.891] (-1055.130) (-1056.161) * (-1052.145) (-1059.964) [-1052.333] (-1055.024) -- 0:00:07
957000 -- (-1058.247) (-1056.892) (-1054.688) [-1054.204] * (-1061.209) [-1056.381] (-1053.730) (-1059.310) -- 0:00:07
957500 -- (-1055.698) (-1055.398) (-1064.970) [-1052.947] * (-1063.886) (-1061.699) (-1055.000) [-1050.304] -- 0:00:07
958000 -- (-1060.094) (-1065.246) (-1055.813) [-1059.278] * (-1059.481) (-1057.219) [-1053.911] (-1054.529) -- 0:00:06
958500 -- (-1054.671) (-1061.244) [-1057.008] (-1059.792) * (-1062.088) [-1054.724] (-1057.666) (-1058.142) -- 0:00:06
959000 -- (-1053.690) [-1055.538] (-1063.913) (-1052.633) * (-1056.388) (-1052.262) (-1054.300) [-1057.763] -- 0:00:06
959500 -- (-1051.389) (-1053.053) (-1058.800) [-1048.799] * (-1057.817) (-1053.024) (-1056.289) [-1057.591] -- 0:00:06
960000 -- [-1051.933] (-1055.174) (-1060.598) (-1060.637) * (-1051.225) (-1052.941) [-1052.402] (-1052.111) -- 0:00:06
Average standard deviation of split frequencies: 0.000000
960500 -- (-1057.946) [-1057.095] (-1058.913) (-1058.995) * (-1052.337) [-1055.743] (-1054.256) (-1059.958) -- 0:00:06
961000 -- (-1054.378) [-1054.995] (-1057.202) (-1061.407) * (-1051.226) (-1053.096) [-1057.602] (-1059.236) -- 0:00:06
961500 -- (-1056.461) (-1060.278) (-1054.533) [-1059.900] * (-1055.136) (-1053.489) [-1052.850] (-1055.641) -- 0:00:06
962000 -- (-1055.709) (-1063.133) (-1057.578) [-1055.435] * (-1058.230) [-1052.715] (-1055.474) (-1058.503) -- 0:00:06
962500 -- (-1050.304) (-1056.429) [-1058.690] (-1052.910) * (-1061.840) (-1063.411) (-1056.689) [-1055.985] -- 0:00:06
963000 -- (-1051.989) (-1053.784) [-1056.961] (-1057.290) * (-1058.934) [-1055.964] (-1054.204) (-1052.750) -- 0:00:06
963500 -- (-1058.813) [-1052.785] (-1054.972) (-1056.860) * [-1056.638] (-1060.560) (-1055.922) (-1056.373) -- 0:00:06
964000 -- (-1054.722) (-1053.924) [-1055.513] (-1052.998) * (-1051.771) (-1052.865) [-1050.871] (-1058.602) -- 0:00:05
964500 -- (-1056.244) [-1053.691] (-1058.203) (-1059.567) * (-1052.866) [-1054.543] (-1056.604) (-1059.818) -- 0:00:05
965000 -- (-1053.219) (-1055.939) [-1052.584] (-1057.766) * (-1052.366) [-1050.836] (-1053.765) (-1056.451) -- 0:00:05
Average standard deviation of split frequencies: 0.000000
965500 -- [-1054.252] (-1058.187) (-1056.754) (-1053.014) * (-1051.647) (-1051.971) (-1055.846) [-1061.746] -- 0:00:05
966000 -- (-1059.081) (-1060.670) (-1053.657) [-1051.048] * (-1051.735) (-1056.977) [-1053.438] (-1059.866) -- 0:00:05
966500 -- (-1055.382) (-1050.314) [-1058.790] (-1051.859) * (-1053.869) (-1057.365) [-1052.748] (-1062.330) -- 0:00:05
967000 -- (-1055.074) (-1053.607) [-1055.090] (-1054.243) * (-1058.978) (-1052.970) [-1055.794] (-1054.607) -- 0:00:05
967500 -- (-1055.038) [-1052.593] (-1057.279) (-1059.949) * (-1055.280) [-1060.114] (-1057.713) (-1055.372) -- 0:00:05
968000 -- (-1055.283) (-1052.416) (-1054.026) [-1055.376] * (-1056.867) (-1065.618) [-1055.991] (-1060.252) -- 0:00:05
968500 -- [-1060.844] (-1055.269) (-1054.707) (-1058.278) * (-1053.241) (-1052.580) [-1055.266] (-1049.263) -- 0:00:05
969000 -- [-1053.713] (-1057.597) (-1058.742) (-1056.663) * (-1056.273) (-1057.775) (-1055.021) [-1054.432] -- 0:00:05
969500 -- (-1050.877) (-1054.149) [-1056.635] (-1055.024) * [-1056.246] (-1050.738) (-1053.875) (-1058.726) -- 0:00:05
970000 -- (-1055.911) [-1058.168] (-1055.680) (-1050.571) * [-1053.416] (-1052.560) (-1050.127) (-1052.272) -- 0:00:04
Average standard deviation of split frequencies: 0.000000
970500 -- [-1054.434] (-1057.691) (-1053.339) (-1057.972) * (-1060.344) (-1055.276) [-1054.499] (-1053.651) -- 0:00:04
971000 -- (-1060.038) [-1060.118] (-1056.105) (-1062.771) * (-1056.608) (-1055.388) [-1054.845] (-1056.699) -- 0:00:04
971500 -- (-1053.958) (-1060.744) [-1052.808] (-1063.746) * (-1056.243) (-1054.898) (-1054.342) [-1052.880] -- 0:00:04
972000 -- (-1052.025) (-1062.518) [-1052.887] (-1053.960) * [-1051.297] (-1050.080) (-1058.233) (-1053.141) -- 0:00:04
972500 -- (-1055.475) (-1059.787) (-1056.815) [-1054.956] * (-1051.329) (-1052.100) [-1055.457] (-1056.407) -- 0:00:04
973000 -- (-1060.204) (-1054.288) [-1054.763] (-1057.424) * [-1052.250] (-1053.282) (-1057.371) (-1052.118) -- 0:00:04
973500 -- (-1054.803) (-1053.023) (-1054.374) [-1057.633] * (-1050.194) [-1053.528] (-1061.042) (-1056.411) -- 0:00:04
974000 -- (-1056.031) [-1055.328] (-1053.517) (-1056.716) * (-1057.630) [-1055.158] (-1060.719) (-1056.492) -- 0:00:04
974500 -- (-1054.523) (-1057.088) [-1051.836] (-1056.316) * (-1055.102) (-1057.366) (-1062.836) [-1057.232] -- 0:00:04
975000 -- [-1055.085] (-1053.055) (-1054.470) (-1050.089) * (-1052.804) [-1052.984] (-1057.812) (-1061.857) -- 0:00:04
Average standard deviation of split frequencies: 0.000000
975500 -- (-1053.687) [-1051.983] (-1052.015) (-1055.845) * (-1051.090) (-1053.232) [-1052.053] (-1059.678) -- 0:00:04
976000 -- (-1051.315) (-1050.774) [-1055.325] (-1059.557) * (-1052.145) (-1054.506) (-1060.463) [-1056.244] -- 0:00:03
976500 -- (-1051.206) (-1060.463) [-1054.188] (-1053.510) * (-1055.340) (-1058.149) (-1060.995) [-1052.733] -- 0:00:03
977000 -- (-1063.917) (-1051.462) [-1053.943] (-1052.691) * (-1055.278) (-1055.515) [-1057.084] (-1055.063) -- 0:00:03
977500 -- [-1056.079] (-1052.362) (-1056.850) (-1061.207) * [-1053.287] (-1055.156) (-1053.949) (-1054.708) -- 0:00:03
978000 -- (-1054.686) (-1050.982) [-1052.614] (-1050.165) * [-1055.288] (-1056.333) (-1053.324) (-1059.323) -- 0:00:03
978500 -- (-1049.592) (-1051.769) (-1060.332) [-1052.209] * [-1057.249] (-1049.628) (-1052.716) (-1058.192) -- 0:00:03
979000 -- (-1052.622) (-1051.650) (-1061.574) [-1054.549] * (-1053.940) (-1055.311) [-1049.041] (-1059.535) -- 0:00:03
979500 -- (-1054.433) (-1056.595) (-1059.172) [-1054.050] * [-1053.343] (-1056.290) (-1056.439) (-1054.447) -- 0:00:03
980000 -- [-1061.442] (-1051.660) (-1063.646) (-1051.808) * (-1052.482) (-1055.596) (-1058.671) [-1049.880] -- 0:00:03
Average standard deviation of split frequencies: 0.000000
980500 -- (-1059.893) (-1053.102) [-1058.110] (-1054.373) * (-1055.076) (-1051.987) [-1053.051] (-1052.553) -- 0:00:03
981000 -- (-1062.757) (-1052.265) (-1057.919) [-1057.327] * (-1052.561) [-1053.596] (-1056.180) (-1054.935) -- 0:00:03
981500 -- (-1052.438) [-1053.079] (-1049.348) (-1054.186) * (-1054.290) (-1052.441) (-1053.386) [-1053.996] -- 0:00:03
982000 -- (-1055.039) [-1060.135] (-1050.013) (-1052.200) * [-1058.160] (-1053.748) (-1052.910) (-1052.964) -- 0:00:02
982500 -- (-1052.178) (-1056.959) [-1058.008] (-1055.595) * (-1054.376) (-1055.454) [-1053.533] (-1055.455) -- 0:00:02
983000 -- (-1060.049) (-1052.329) [-1056.190] (-1060.069) * (-1057.185) [-1052.284] (-1056.188) (-1053.566) -- 0:00:02
983500 -- (-1051.489) (-1051.296) (-1057.902) [-1052.371] * (-1054.588) (-1052.998) [-1056.424] (-1056.997) -- 0:00:02
984000 -- [-1051.701] (-1053.881) (-1056.224) (-1056.346) * (-1052.394) (-1052.377) (-1060.519) [-1052.515] -- 0:00:02
984500 -- (-1070.890) (-1059.927) (-1050.959) [-1052.600] * [-1053.421] (-1058.587) (-1060.607) (-1057.392) -- 0:00:02
985000 -- (-1060.643) (-1051.039) (-1054.025) [-1055.141] * (-1051.872) (-1051.986) [-1057.229] (-1065.750) -- 0:00:02
Average standard deviation of split frequencies: 0.000000
985500 -- (-1056.971) (-1056.996) (-1057.204) [-1050.093] * [-1051.525] (-1057.748) (-1055.405) (-1051.841) -- 0:00:02
986000 -- (-1054.159) (-1058.591) (-1053.816) [-1059.679] * (-1055.490) [-1055.225] (-1055.811) (-1054.565) -- 0:00:02
986500 -- (-1055.855) (-1053.735) (-1058.571) [-1056.905] * [-1051.853] (-1053.047) (-1057.165) (-1057.206) -- 0:00:02
987000 -- (-1055.130) [-1052.078] (-1059.690) (-1053.272) * (-1052.935) (-1059.999) [-1053.545] (-1052.052) -- 0:00:02
987500 -- [-1051.136] (-1055.662) (-1061.486) (-1054.777) * [-1051.980] (-1056.650) (-1050.096) (-1056.403) -- 0:00:02
988000 -- (-1055.947) (-1053.362) (-1052.456) [-1051.230] * (-1048.650) [-1055.544] (-1054.952) (-1058.092) -- 0:00:01
988500 -- [-1051.041] (-1050.610) (-1060.484) (-1051.853) * (-1056.929) (-1059.953) [-1052.161] (-1050.677) -- 0:00:01
989000 -- (-1054.848) (-1054.083) (-1054.360) [-1053.293] * (-1058.999) (-1056.868) [-1052.315] (-1055.345) -- 0:00:01
989500 -- (-1055.252) (-1059.480) [-1050.998] (-1060.360) * (-1059.861) [-1053.330] (-1054.361) (-1053.926) -- 0:00:01
990000 -- (-1052.774) [-1051.966] (-1056.591) (-1058.172) * [-1055.491] (-1062.856) (-1053.224) (-1052.274) -- 0:00:01
Average standard deviation of split frequencies: 0.000000
990500 -- (-1051.124) (-1055.869) (-1055.589) [-1052.979] * (-1056.992) [-1054.351] (-1056.620) (-1057.846) -- 0:00:01
991000 -- [-1054.666] (-1052.799) (-1058.884) (-1056.839) * (-1057.496) (-1058.946) [-1051.705] (-1054.826) -- 0:00:01
991500 -- (-1061.582) [-1055.598] (-1048.707) (-1049.603) * (-1057.030) (-1057.643) [-1056.865] (-1057.575) -- 0:00:01
992000 -- [-1050.277] (-1058.103) (-1051.860) (-1052.709) * [-1054.007] (-1065.770) (-1056.404) (-1049.421) -- 0:00:01
992500 -- [-1053.324] (-1058.083) (-1058.892) (-1058.930) * (-1057.978) [-1054.852] (-1051.876) (-1059.696) -- 0:00:01
993000 -- (-1053.521) [-1055.120] (-1058.693) (-1056.615) * (-1054.307) (-1061.560) [-1055.612] (-1058.424) -- 0:00:01
993500 -- [-1051.963] (-1050.562) (-1052.922) (-1058.188) * (-1056.715) (-1058.315) [-1052.982] (-1052.680) -- 0:00:01
994000 -- (-1054.808) (-1056.734) [-1055.908] (-1053.231) * (-1052.662) (-1055.379) (-1057.484) [-1056.753] -- 0:00:00
994500 -- (-1055.095) [-1049.949] (-1054.762) (-1054.801) * (-1055.267) (-1054.299) [-1054.798] (-1052.699) -- 0:00:00
995000 -- (-1057.144) (-1056.545) (-1057.260) [-1050.951] * (-1054.883) [-1054.597] (-1062.214) (-1059.140) -- 0:00:00
Average standard deviation of split frequencies: 0.000000
995500 -- (-1055.861) (-1051.240) [-1052.297] (-1057.699) * (-1054.318) (-1050.969) [-1052.918] (-1049.837) -- 0:00:00
996000 -- [-1054.469] (-1053.536) (-1056.785) (-1052.987) * (-1056.093) (-1061.352) [-1053.940] (-1050.019) -- 0:00:00
996500 -- (-1058.877) (-1051.986) (-1054.061) [-1057.737] * (-1051.796) (-1051.548) (-1051.198) [-1055.717] -- 0:00:00
997000 -- (-1052.317) (-1053.627) (-1054.210) [-1055.744] * (-1053.923) (-1055.240) [-1064.576] (-1057.264) -- 0:00:00
997500 -- (-1054.029) (-1052.422) (-1051.202) [-1056.511] * (-1049.996) (-1058.283) (-1062.557) [-1054.389] -- 0:00:00
998000 -- (-1058.527) (-1052.882) (-1057.518) [-1059.075] * (-1054.196) (-1053.858) [-1055.300] (-1056.514) -- 0:00:00
998500 -- (-1057.974) (-1061.594) [-1061.268] (-1060.101) * (-1057.177) [-1049.362] (-1062.035) (-1051.730) -- 0:00:00
999000 -- (-1057.953) (-1050.930) [-1051.868] (-1066.876) * (-1053.155) [-1053.782] (-1059.347) (-1057.123) -- 0:00:00
999500 -- [-1057.829] (-1060.392) (-1053.970) (-1050.010) * (-1054.332) [-1055.384] (-1053.463) (-1053.892) -- 0:00:00
1000000 -- (-1054.353) (-1053.742) (-1055.435) [-1056.471] * [-1058.009] (-1054.496) (-1058.290) (-1055.540) -- 0:00:00
Average standard deviation of split frequencies: 0.000000
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1054.352518 -- 14.972343
Chain 1 -- -1054.352519 -- 14.972343
Chain 2 -- -1053.742199 -- 15.443789
Chain 2 -- -1053.742199 -- 15.443789
Chain 3 -- -1055.434712 -- 16.449669
Chain 3 -- -1055.434712 -- 16.449669
Chain 4 -- -1056.470749 -- 13.836499
Chain 4 -- -1056.470747 -- 13.836499
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1058.009370 -- 16.923022
Chain 1 -- -1058.009370 -- 16.923022
Chain 2 -- -1054.496277 -- 15.324122
Chain 2 -- -1054.496278 -- 15.324122
Chain 3 -- -1058.289568 -- 16.005303
Chain 3 -- -1058.289568 -- 16.005303
Chain 4 -- -1055.539547 -- 13.298436
Chain 4 -- -1055.539547 -- 13.298436
Analysis completed in 2 mins 46 seconds
Analysis used 166.52 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1046.95
Likelihood of best state for "cold" chain of run 2 was -1047.30
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
59.9 % ( 56 %) Dirichlet(Revmat{all})
73.0 % ( 62 %) Slider(Revmat{all})
31.4 % ( 27 %) Dirichlet(Pi{all})
32.8 % ( 26 %) Slider(Pi{all})
57.6 % ( 33 %) Multiplier(Alpha{1,2})
57.8 % ( 32 %) Multiplier(Alpha{3})
78.6 % ( 55 %) Slider(Pinvar{all})
0.0 % ( 0 %) ExtSPR(Tau{all},V{all})
0.0 % ( 0 %) ExtTBR(Tau{all},V{all})
0.0 % ( 0 %) NNI(Tau{all},V{all})
0.0 % ( 0 %) ParsSPR(Tau{all},V{all})
26.2 % ( 21 %) Multiplier(V{all})
33.1 % ( 43 %) Nodeslider(V{all})
25.8 % ( 21 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
59.4 % ( 51 %) Dirichlet(Revmat{all})
73.7 % ( 56 %) Slider(Revmat{all})
31.8 % ( 27 %) Dirichlet(Pi{all})
32.7 % ( 21 %) Slider(Pi{all})
56.8 % ( 28 %) Multiplier(Alpha{1,2})
57.0 % ( 28 %) Multiplier(Alpha{3})
78.3 % ( 52 %) Slider(Pinvar{all})
0.0 % ( 0 %) ExtSPR(Tau{all},V{all})
0.0 % ( 0 %) ExtTBR(Tau{all},V{all})
0.0 % ( 0 %) NNI(Tau{all},V{all})
0.0 % ( 0 %) ParsSPR(Tau{all},V{all})
26.3 % ( 22 %) Multiplier(V{all})
33.0 % ( 34 %) Nodeslider(V{all})
25.7 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.56
2 | 167175 0.85 0.71
3 | 166217 167076 0.86
4 | 166607 166645 166280
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.83 0.69 0.56
2 | 166664 0.85 0.71
3 | 166125 165990 0.86
4 | 167873 166638 166710
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1053.20
| 1 1 |
| 2 1 2 2 1 |
| 2 2 2 |
| 2 1 1 1 2 21|
| 2 2 2 2 1 12 22 12 |
|1 1 1 12 12 1 2 1 1 2 11 |
| 1 2 * 11 2121 1 1 211 2 1 2 |
| * 2 1 22 2 1 2 122 2 2 2|
| 2 2 1 11 1 1 11 2 2 1 21 |
|2 22 2 1 1 2 1 1 2 1 |
| 1 1 2 2 2 2 1 |
| 1 1 1 1 |
| 1 2 2 |
| 2 2 2 1 |
| 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1056.23
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1052.03 -1060.35
2 -1052.04 -1069.62
--------------------------------------
TOTAL -1052.04 -1068.92
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.307863 0.001516 0.237861 0.387492 0.304719 1410.01 1455.51 1.000
r(A<->C){all} 0.100680 0.001142 0.038355 0.168811 0.098047 639.05 717.98 1.000
r(A<->G){all} 0.304926 0.002725 0.208409 0.407673 0.302280 706.59 833.55 1.000
r(A<->T){all} 0.160653 0.001547 0.084756 0.235129 0.158463 1013.06 1024.57 1.000
r(C<->G){all} 0.171433 0.002079 0.082661 0.255912 0.167821 812.83 814.49 1.000
r(C<->T){all} 0.187351 0.002086 0.101043 0.277245 0.184308 878.88 912.45 1.000
r(G<->T){all} 0.074957 0.001001 0.014956 0.132249 0.072202 849.66 985.82 1.000
pi(A){all} 0.276284 0.000427 0.235328 0.315524 0.276312 1183.86 1271.57 1.000
pi(C){all} 0.226119 0.000382 0.189261 0.264358 0.225750 1007.73 1047.17 1.000
pi(G){all} 0.240699 0.000397 0.199932 0.278203 0.240218 1165.51 1298.65 1.000
pi(T){all} 0.256898 0.000408 0.217296 0.295636 0.256744 976.82 1009.60 1.000
alpha{1,2} 0.890394 0.251277 0.195949 1.915220 0.770264 1314.29 1367.30 1.001
alpha{3} 1.009960 0.315957 0.231232 2.174552 0.871490 1501.00 1501.00 1.000
pinvar{all} 0.137164 0.010167 0.000082 0.325879 0.118108 1251.65 1306.62 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ...**
7 -- .**..
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3002 1.000000 0.000000 1.000000 1.000000 2
7 3002 1.000000 0.000000 1.000000 1.000000 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/3/Acp53C14b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.026290 0.000089 0.009385 0.044479 0.025079 1.000 2
length{all}[2] 0.023608 0.000066 0.008996 0.039168 0.022472 1.000 2
length{all}[3] 0.010161 0.000029 0.000920 0.020555 0.009295 1.000 2
length{all}[4] 0.076126 0.000344 0.043906 0.115047 0.074345 1.000 2
length{all}[5] 0.085547 0.000381 0.051041 0.124001 0.083876 1.000 2
length{all}[6] 0.059422 0.000278 0.028076 0.092037 0.057747 1.000 2
length{all}[7] 0.026709 0.000095 0.010027 0.046901 0.025336 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.000000
Maximum standard deviation of split frequencies = 0.000000
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C2 (2)
|----------------100----------------+
+ \------------------------------------ C3 (3)
|
| /------------------------------------ C4 (4)
\----------------100----------------+
\------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/------------- C1 (1)
|
| /----------- C2 (2)
|------------+
+ \----- C3 (3)
|
| /-------------------------------------- C4 (4)
\----------------------------+
\------------------------------------------- C5 (5)
|---------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (1 tree sampled):
99 % credible set contains 1 tree
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 396
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sequences read..
Counting site patterns.. 0:00
105 patterns at 132 / 132 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
102480 bytes for conP
14280 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), (4, 5)); MP score: 91
153720 bytes for conP, adjusted
0.077900 0.068910 0.061472 0.025743 0.150168 0.196272 0.214530 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -1074.179300
Iterating by ming2
Initial: fx= 1074.179300
x= 0.07790 0.06891 0.06147 0.02574 0.15017 0.19627 0.21453 0.30000 1.30000
1 h-m-p 0.0000 0.0020 101.4216 +++YCYYCC 1063.972887 5 0.0016 25 | 0/9
2 h-m-p 0.0001 0.0006 2013.5529 +YCYC 1049.257835 3 0.0003 42 | 0/9
3 h-m-p 0.0005 0.0026 180.0396 YYCCC 1045.536599 4 0.0007 60 | 0/9
4 h-m-p 0.0008 0.0038 67.1223 CYCCC 1043.585217 4 0.0012 79 | 0/9
5 h-m-p 0.0008 0.0041 86.7899 CYCC 1042.458695 3 0.0008 96 | 0/9
6 h-m-p 0.0015 0.0107 43.7256 YCCC 1040.879388 3 0.0032 113 | 0/9
7 h-m-p 0.0008 0.0050 182.5307 +YYYYCCC 1031.961437 6 0.0029 134 | 0/9
8 h-m-p 0.0008 0.0038 104.4324 YYCC 1031.242143 3 0.0007 150 | 0/9
9 h-m-p 0.0228 0.1202 3.0077 -YC 1031.220624 1 0.0026 164 | 0/9
10 h-m-p 0.0264 4.2642 0.2956 ++CCCC 1028.501866 3 0.4052 184 | 0/9
11 h-m-p 0.5954 2.9768 0.0882 CCCC 1027.448724 3 0.7186 211 | 0/9
12 h-m-p 1.6000 8.0000 0.0299 CCCC 1026.697862 3 2.4569 238 | 0/9
13 h-m-p 1.1493 5.7463 0.0511 YCYCCC 1025.564168 5 2.7396 267 | 0/9
14 h-m-p 1.6000 8.0000 0.0365 CCC 1025.338978 2 1.3355 292 | 0/9
15 h-m-p 1.6000 8.0000 0.0230 CC 1025.268540 1 2.2919 315 | 0/9
16 h-m-p 1.4980 8.0000 0.0351 YCC 1025.243078 2 1.1767 339 | 0/9
17 h-m-p 1.6000 8.0000 0.0170 C 1025.227335 0 1.5955 360 | 0/9
18 h-m-p 1.6000 8.0000 0.0084 YC 1025.225034 1 1.1000 382 | 0/9
19 h-m-p 1.6000 8.0000 0.0013 C 1025.224875 0 1.2892 403 | 0/9
20 h-m-p 1.6000 8.0000 0.0002 Y 1025.224871 0 1.1825 424 | 0/9
21 h-m-p 1.6000 8.0000 0.0000 Y 1025.224871 0 1.0807 445 | 0/9
22 h-m-p 1.6000 8.0000 0.0000 C 1025.224871 0 1.6000 466 | 0/9
23 h-m-p 1.6000 8.0000 0.0000 Y 1025.224871 0 1.6000 487 | 0/9
24 h-m-p 1.6000 8.0000 0.0000 -Y 1025.224871 0 0.1000 509
Out..
lnL = -1025.224871
510 lfun, 510 eigenQcodon, 3570 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), (4, 5)); MP score: 91
0.077900 0.068910 0.061472 0.025743 0.150168 0.196272 0.214530 1.482737 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 7.135530
np = 10
lnL0 = -1029.938337
Iterating by ming2
Initial: fx= 1029.938337
x= 0.07790 0.06891 0.06147 0.02574 0.15017 0.19627 0.21453 1.48274 0.57321 0.49224
1 h-m-p 0.0000 0.0023 25.5971 +++YYYCCCC 1029.698428 6 0.0007 27 | 0/10
2 h-m-p 0.0002 0.0036 71.1585 +YYC 1029.116377 2 0.0008 43 | 0/10
3 h-m-p 0.0007 0.0077 77.3102 +YYYYC 1026.975325 4 0.0027 61 | 0/10
4 h-m-p 0.0008 0.0039 92.8698 YCCCCC 1026.190654 5 0.0009 83 | 0/10
5 h-m-p 0.0023 0.0114 16.6892 CC 1026.112089 1 0.0009 98 | 0/10
6 h-m-p 0.0037 0.1652 4.0372 CC 1026.104950 1 0.0009 113 | 0/10
7 h-m-p 0.0017 0.2030 2.0789 ++YC 1026.050156 1 0.0173 129 | 0/10
8 h-m-p 0.0044 0.0442 8.2156 +YC 1025.766453 1 0.0233 144 | 0/10
9 h-m-p 0.0290 0.1451 1.9113 YCC 1025.749115 2 0.0056 160 | 0/10
10 h-m-p 0.0142 1.0599 0.7490 ++CYC 1025.146821 2 0.2116 178 | 0/10
11 h-m-p 0.1151 0.5753 0.7654 CCC 1025.095747 2 0.1449 205 | 0/10
12 h-m-p 1.6000 8.0000 0.0428 YC 1025.057226 1 0.7917 229 | 0/10
13 h-m-p 1.6000 8.0000 0.0109 YC 1025.055925 1 0.8661 253 | 0/10
14 h-m-p 1.6000 8.0000 0.0014 YC 1025.055907 1 0.8215 277 | 0/10
15 h-m-p 1.6000 8.0000 0.0001 Y 1025.055906 0 0.8343 300 | 0/10
16 h-m-p 1.6000 8.0000 0.0000 Y 1025.055906 0 0.9029 323 | 0/10
17 h-m-p 1.6000 8.0000 0.0000 Y 1025.055906 0 1.0039 346 | 0/10
18 h-m-p 1.6000 8.0000 0.0000 C 1025.055906 0 1.4174 369 | 0/10
19 h-m-p 1.6000 8.0000 0.0000 Y 1025.055906 0 1.1150 392 | 0/10
20 h-m-p 1.6000 8.0000 0.0000 ---C 1025.055906 0 0.0063 418
Out..
lnL = -1025.055906
419 lfun, 1257 eigenQcodon, 5866 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), (4, 5)); MP score: 91
initial w for M2:NSpselection reset.
0.077900 0.068910 0.061472 0.025743 0.150168 0.196272 0.214530 1.501645 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.558230
np = 12
lnL0 = -1034.779381
Iterating by ming2
Initial: fx= 1034.779381
x= 0.07790 0.06891 0.06147 0.02574 0.15017 0.19627 0.21453 1.50165 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0039 30.4739 +++YCCC 1034.220153 3 0.0012 25 | 0/12
2 h-m-p 0.0004 0.0107 87.2724 CYCCC 1033.862926 4 0.0004 47 | 0/12
3 h-m-p 0.0008 0.0078 36.9266 YCCC 1033.218032 3 0.0019 67 | 0/12
4 h-m-p 0.0013 0.0090 50.6710 YCCCC 1031.926090 4 0.0031 89 | 0/12
5 h-m-p 0.0003 0.0017 168.1564 YCCCCC 1030.854080 5 0.0008 113 | 0/12
6 h-m-p 0.0020 0.0101 17.0088 YYCC 1030.735322 3 0.0014 132 | 0/12
7 h-m-p 0.0023 0.1086 10.2027 +C 1030.445688 0 0.0092 148 | 0/12
8 h-m-p 0.0037 0.0710 25.6893 ++CCCC 1026.724540 3 0.0529 171 | 0/12
9 h-m-p 0.0043 0.0215 22.5448 YYC 1026.526684 2 0.0035 188 | 0/12
10 h-m-p 0.0225 0.1176 3.4732 ++ 1025.608456 m 0.1176 203 | 1/12
11 h-m-p 0.5254 3.6267 0.5843 YYCC 1025.114675 3 0.4653 222 | 1/12
12 h-m-p 1.4648 8.0000 0.1856 CC 1025.070804 1 0.5229 250 | 1/12
13 h-m-p 1.6000 8.0000 0.0431 YC 1025.062227 1 0.7178 277 | 1/12
14 h-m-p 0.5462 8.0000 0.0567 YC 1025.058639 1 1.2606 304 | 1/12
15 h-m-p 1.5902 8.0000 0.0449 CC 1025.056475 1 1.2686 332 | 1/12
16 h-m-p 1.6000 8.0000 0.0264 YC 1025.055932 1 1.1059 359 | 1/12
17 h-m-p 1.6000 8.0000 0.0062 YC 1025.055907 1 0.8732 386 | 1/12
18 h-m-p 1.6000 8.0000 0.0012 Y 1025.055906 0 0.9624 412 | 1/12
19 h-m-p 1.6000 8.0000 0.0002 Y 1025.055906 0 0.8106 438 | 1/12
20 h-m-p 1.6000 8.0000 0.0000 Y 1025.055906 0 1.0183 464 | 1/12
21 h-m-p 1.6000 8.0000 0.0000 -Y 1025.055906 0 0.1000 491 | 1/12
22 h-m-p 0.0600 8.0000 0.0000 ---C 1025.055906 0 0.0002 520
Out..
lnL = -1025.055906
521 lfun, 2084 eigenQcodon, 10941 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1031.650775 S = -961.083084 -64.181851
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 105 patterns 0:07
did 20 / 105 patterns 0:07
did 30 / 105 patterns 0:07
did 40 / 105 patterns 0:07
did 50 / 105 patterns 0:07
did 60 / 105 patterns 0:07
did 70 / 105 patterns 0:07
did 80 / 105 patterns 0:07
did 90 / 105 patterns 0:07
did 100 / 105 patterns 0:07
did 105 / 105 patterns 0:07
Time used: 0:07
Model 3: discrete
TREE # 1
(1, (2, 3), (4, 5)); MP score: 91
0.077900 0.068910 0.061472 0.025743 0.150168 0.196272 0.214530 1.501645 0.331355 0.382499 0.180452 0.450485 0.754286
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 9.705086
np = 13
lnL0 = -1025.173959
Iterating by ming2
Initial: fx= 1025.173959
x= 0.07790 0.06891 0.06147 0.02574 0.15017 0.19627 0.21453 1.50165 0.33136 0.38250 0.18045 0.45049 0.75429
1 h-m-p 0.0000 0.0022 20.6124 +++YCCC 1025.072911 3 0.0005 26 | 0/13
2 h-m-p 0.0003 0.0063 27.5095 YC 1024.959561 1 0.0006 43 | 0/13
3 h-m-p 0.0012 0.0209 13.1735 CCC 1024.863237 2 0.0017 63 | 0/13
4 h-m-p 0.0018 0.0143 13.1268 CCC 1024.751768 2 0.0027 83 | 0/13
5 h-m-p 0.0008 0.0040 35.8904 YCCC 1024.571158 3 0.0017 104 | 0/13
6 h-m-p 0.0024 0.0121 7.8830 CC 1024.538483 1 0.0021 122 | 0/13
7 h-m-p 0.0035 0.0209 4.6145 CC 1024.532509 1 0.0010 140 | 0/13
8 h-m-p 0.0014 0.0324 3.1156 ++YCC 1024.454271 2 0.0257 161 | 0/13
9 h-m-p 0.0004 0.0020 11.5114 ++ 1024.428014 m 0.0020 177 | 0/13
10 h-m-p -0.0000 -0.0000 1.6512
h-m-p: -2.18204942e-18 -1.09102471e-17 1.65123400e+00 1024.428014
.. | 0/13
11 h-m-p 0.0000 0.0096 6.8765 ++YC 1024.410863 1 0.0007 209 | 0/13
12 h-m-p 0.0004 0.0260 12.8128 CCC 1024.395356 2 0.0005 229 | 0/13
13 h-m-p 0.0007 0.0550 8.0447 YC 1024.375451 1 0.0013 246 | 0/13
14 h-m-p 0.0021 0.0489 5.0440 YC 1024.366675 1 0.0013 263 | 0/13
15 h-m-p 0.0014 0.5495 4.8632 YC 1024.351376 1 0.0032 280 | 0/13
16 h-m-p 0.0087 0.1137 1.7642 YC 1024.347058 1 0.0042 297 | 0/13
17 h-m-p 0.0011 0.0140 6.7182 YC 1024.337913 1 0.0025 314 | 0/13
18 h-m-p 0.0010 0.0051 12.0207 ++ 1024.290417 m 0.0051 330 | 1/13
19 h-m-p 0.0082 0.1306 7.0885 CC 1024.282352 1 0.0028 348 | 1/13
20 h-m-p 0.0150 0.6388 1.3388 +CCC 1024.244357 2 0.0871 369 | 1/13
21 h-m-p 0.1467 5.5092 0.7949 CC 1024.235202 1 0.0574 387 | 1/13
22 h-m-p 1.2187 8.0000 0.0374 YC 1024.231272 1 0.8189 416 | 1/13
23 h-m-p 0.2554 8.0000 0.1201 YC 1024.229814 1 0.1565 445 | 1/13
24 h-m-p 1.6000 8.0000 0.0073 C 1024.229432 0 1.5299 473 | 1/13
25 h-m-p 1.6000 8.0000 0.0005 Y 1024.229430 0 1.1525 501 | 1/13
26 h-m-p 1.6000 8.0000 0.0001 Y 1024.229430 0 1.0470 529 | 1/13
27 h-m-p 1.6000 8.0000 0.0000 Y 1024.229430 0 0.9886 557 | 1/13
28 h-m-p 1.6000 8.0000 0.0000 --C 1024.229430 0 0.0250 587
Out..
lnL = -1024.229430
588 lfun, 2352 eigenQcodon, 12348 P(t)
Time used: 0:11
Model 7: beta
TREE # 1
(1, (2, 3), (4, 5)); MP score: 91
0.077900 0.068910 0.061472 0.025743 0.150168 0.196272 0.214530 1.478634 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 11.874968
np = 10
lnL0 = -1025.489354
Iterating by ming2
Initial: fx= 1025.489354
x= 0.07790 0.06891 0.06147 0.02574 0.15017 0.19627 0.21453 1.47863 0.66567 1.54913
1 h-m-p 0.0000 0.0019 22.1969 ++YCCC 1025.387133 3 0.0004 22 | 0/10
2 h-m-p 0.0003 0.0056 25.8120 YCC 1025.262203 2 0.0007 38 | 0/10
3 h-m-p 0.0012 0.4045 14.7473 YCCC 1025.136355 3 0.0019 56 | 0/10
4 h-m-p 0.0021 0.0245 13.6667 CCCC 1024.978574 3 0.0035 75 | 0/10
5 h-m-p 0.0011 0.0283 43.4688 YCCC 1024.709928 3 0.0021 93 | 0/10
6 h-m-p 0.0053 0.0462 17.1772 CCC 1024.621652 2 0.0020 110 | 0/10
7 h-m-p 0.0027 0.0134 10.2004 CY 1024.608122 1 0.0007 125 | 0/10
8 h-m-p 0.0098 0.7949 0.6869 C 1024.607453 0 0.0028 138 | 0/10
9 h-m-p 0.0160 8.0000 0.3242 +YC 1024.599859 1 0.1353 163 | 0/10
10 h-m-p 0.3275 8.0000 0.1339 YC 1024.587330 1 0.5789 187 | 0/10
11 h-m-p 1.6000 8.0000 0.0109 CC 1024.587002 1 2.4542 212 | 0/10
12 h-m-p 1.6000 8.0000 0.0151 YC 1024.586588 1 3.6243 236 | 0/10
13 h-m-p 1.6000 8.0000 0.0014 Y 1024.586583 0 1.0545 259 | 0/10
14 h-m-p 1.6000 8.0000 0.0000 Y 1024.586583 0 1.0281 282 | 0/10
15 h-m-p 1.6000 8.0000 0.0000 Y 1024.586583 0 0.6680 305 | 0/10
16 h-m-p 1.6000 8.0000 0.0000 ----C 1024.586583 0 0.0016 332
Out..
lnL = -1024.586583
333 lfun, 3663 eigenQcodon, 23310 P(t)
Time used: 0:18
Model 8: beta&w>1
TREE # 1
(1, (2, 3), (4, 5)); MP score: 91
initial w for M8:NSbetaw>1 reset.
0.077900 0.068910 0.061472 0.025743 0.150168 0.196272 0.214530 1.485391 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 10.178725
np = 12
lnL0 = -1029.044284
Iterating by ming2
Initial: fx= 1029.044284
x= 0.07790 0.06891 0.06147 0.02574 0.15017 0.19627 0.21453 1.48539 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0017 30.3699 +++YYCC 1028.778903 3 0.0005 24 | 0/12
2 h-m-p 0.0002 0.0036 65.7905 +YYCC 1028.109099 3 0.0008 44 | 0/12
3 h-m-p 0.0009 0.0043 61.7862 YCCC 1027.162516 3 0.0016 64 | 0/12
4 h-m-p 0.0007 0.0033 42.0083 ++ 1025.668490 m 0.0033 79 | 1/12
5 h-m-p 0.0012 0.0083 108.7477 CYC 1024.803411 2 0.0012 97 | 1/12
6 h-m-p 0.0059 0.0297 17.3719 CCC 1024.650923 2 0.0019 116 | 1/12
7 h-m-p 0.0020 0.0098 14.0641 CCC 1024.615505 2 0.0007 135 | 1/12
8 h-m-p 0.0120 0.4881 0.8567 CC 1024.614480 1 0.0026 152 | 1/12
9 h-m-p 0.0526 8.0000 0.0425 +YC 1024.598969 1 0.4281 180 | 1/12
10 h-m-p 0.3661 8.0000 0.0497 CC 1024.591702 1 0.3230 208 | 1/12
11 h-m-p 0.2333 8.0000 0.0689 YC 1024.591113 1 0.1508 235 | 1/12
12 h-m-p 0.2432 8.0000 0.0427 +YC 1024.589902 1 0.7214 263 | 1/12
13 h-m-p 0.5248 8.0000 0.0587 CC 1024.589054 1 0.7542 291 | 1/12
14 h-m-p 1.1315 8.0000 0.0391 +CC 1024.586864 1 3.9434 320 | 1/12
15 h-m-p 1.6000 8.0000 0.0103 YC 1024.586791 1 1.0392 347 | 1/12
16 h-m-p 1.6000 8.0000 0.0014 Y 1024.586791 0 1.1959 373 | 1/12
17 h-m-p 1.6000 8.0000 0.0001 Y 1024.586791 0 3.9631 399 | 1/12
18 h-m-p 0.9683 8.0000 0.0003 ++ 1024.586790 m 8.0000 425 | 1/12
19 h-m-p 0.0316 8.0000 0.0881 +++C 1024.586770 0 1.9217 454 | 1/12
20 h-m-p 1.6000 8.0000 0.0790 ++ 1024.586644 m 8.0000 480 | 1/12
21 h-m-p 0.0555 0.2776 1.0634 ++ 1024.586602 m 0.2776 506 | 2/12
22 h-m-p 0.4090 8.0000 0.0044 Y 1024.586593 0 1.0199 521 | 2/12
23 h-m-p 1.6000 8.0000 0.0003 Y 1024.586593 0 0.9990 546 | 2/12
24 h-m-p 1.6000 8.0000 0.0000 Y 1024.586593 0 1.0649 571 | 2/12
25 h-m-p 1.6000 8.0000 0.0000 Y 1024.586593 0 1.6000 596 | 2/12
26 h-m-p 1.3288 8.0000 0.0000 ----Y 1024.586593 0 0.0013 625
Out..
lnL = -1024.586593
626 lfun, 7512 eigenQcodon, 48202 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1030.966513 S = -961.237324 -63.810679
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 105 patterns 0:34
did 20 / 105 patterns 0:34
did 30 / 105 patterns 0:34
did 40 / 105 patterns 0:34
did 50 / 105 patterns 0:34
did 60 / 105 patterns 0:34
did 70 / 105 patterns 0:35
did 80 / 105 patterns 0:35
did 90 / 105 patterns 0:35
did 100 / 105 patterns 0:35
did 105 / 105 patterns 0:35
Time used: 0:35
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=132
D_melanogaster_Acp53C14b-PB MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLA
D_sechellia_Acp53C14b-PB MSVIKSIFVLSILAVCLISRETEAQATIGESWGRLGKCTQVGIETLTSLA
D_simulans_Acp53C14b-PB MSVIKSIFVLSILAVCLIPRETEAQATIGESWGRLGKCTQVGIETLTSLA
D_yakuba_Acp53C14b-PB MSGFKSIFLLSFLAVFLIPRDTEAQATLNESWGKLAKCTQVGIETLTTLA
D_erecta_Acp53C14b-PB MSGMKSVFLLSFLAVLLIPRETVAQATISETWSKLGKCTHVGIQTLTTLA
** :**:*:**:*** **.*:* ****:.*:*.:*.***:*.*:***:**
D_melanogaster_Acp53C14b-PB DKIVPTVYELKQCSGYVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKC
D_sechellia_Acp53C14b-PB NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKLVFDEPKC
D_simulans_Acp53C14b-PB NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKMVFDEPKC
D_yakuba_Acp53C14b-PB DGVIPTVYELKQCSGYVSLEPPNGSHRKVTWYLKITYEFFKKLVFDEPRC
D_erecta_Acp53C14b-PB NKIVPTVYELSQCSGFVFLEPPNGKQRRVTWYLKISYEFFKKLVFDEPRC
: ::******.****:* ***.**..*::*****::******:*****:*
D_melanogaster_Acp53C14b-PB LHGLLNKLAATIKPFAEQISGLGCLDEEDYII
D_sechellia_Acp53C14b-PB LHSLLTKLGATIKPFAEQISGLGCSDEEDYII
D_simulans_Acp53C14b-PB LHSLLTKLGATIKPFAEQISGLGCLDEEDYII
D_yakuba_Acp53C14b-PB LHSLLNKLAVTIKPYAEQISALGCLDEEDYII
D_erecta_Acp53C14b-PB LHSLLNKLAFTIKPFAEQISVLGCLDEEDYII
**.**.**. ****:***** *** *******
>D_melanogaster_Acp53C14b-PB ATGAGCGTGATCAAGTCCATATTTCTGCTCAGTATTTTGGCTGTCTGCCT CATTCCCCGGGAGACGGAGGCCCAGGCCACTATAAGTGAAAGCTGGGGAA GGCTGGGCAAGTGTACTCAGGTGGCCATCGAAACACTGACCAGCCTGGCC GATAAAATCGTCCCGACCGTATATGAGTTGAAACAATGCTCCGGATACGT AACTTTGGAACCGGCAAACGGCAAAGACAGAAAGATTACCTGGTACCTAA AGGTATCCTATGAATTCTTCAAGAAACTTGTCTTTGACGAACCCAAATGT CTGCACGGTCTACTGAACAAGTTGGCTGCCACAATCAAACCATTTGCCGA GCAGATATCGGGATTAGGTTGCTTGGACGAAGAAGATTATATCATT >D_sechellia_Acp53C14b-PB ATGAGCGTGATCAAGTCCATATTTGTGCTCAGTATTTTGGCTGTTTGCCT TATATCACGGGAGACGGAGGCCCAGGCCACTATTGGTGAAAGCTGGGGAA GGCTGGGCAAGTGTACTCAGGTGGGCATCGAAACTCTGACCAGCCTGGCC AACAAAATCGTCCCGACCGTTTATGAGTTGAAACAATGCTCCGGATACGT ATCTTTGGAACCGCCAAACGGCAAAGACAGGAAGATTACCTGGTACCTAA AGGTATCCTATGAATTCTTCAAGAAACTGGTCTTTGATGAGCCCAAATGT CTGCACAGTCTACTGACCAAGTTAGGTGCCACAATCAAACCATTTGCCGA GCAGATATCGGGACTAGGTTGCTCGGACGAGGAAGATTATATCATT >D_simulans_Acp53C14b-PB ATGAGCGTGATCAAGTCCATATTTGTGCTCAGTATTTTGGCTGTCTGCCT TATTCCCCGGGAGACGGAGGCCCAGGCCACTATTGGTGAAAGCTGGGGAA GGCTGGGCAAGTGTACTCAGGTGGGCATCGAAACACTGACCAGCCTGGCC AACAAAATCGTCCCGACCGTTTATGAGTTGAAACAATGCTCCGGATACGT ATCTTTGGAACCGCCAAACGGCAAAGACAGGAAGATTACCTGGTACCTCA AGGTATCCTATGAATTCTTCAAGAAAATGGTCTTTGACGAGCCCAAATGT CTGCACAGTCTACTGACCAAGTTAGGTGCCACAATCAAACCATTTGCCGA GCAGATATCGGGACTGGGTTGCTTGGACGAAGAAGATTATATCATT >D_yakuba_Acp53C14b-PB ATGAGCGGGTTCAAGTCCATATTTCTGCTCAGTTTTTTGGCTGTATTCCT TATCCCACGGGACACTGAGGCACAGGCCACTTTAAATGAAAGCTGGGGAA AGCTGGCCAAATGTACTCAGGTGGGCATCGAAACACTGACCACCCTGGCC GACGGAGTTATCCCGACCGTATATGAGTTGAAACAGTGCTCCGGATACGT GTCTTTGGAACCGCCAAACGGCTCACATAGAAAGGTCACCTGGTACCTGA AGATAACCTATGAATTCTTCAAGAAACTGGTCTTTGACGAACCCAGATGT CTGCACAGTCTTCTCAACAAGTTGGCTGTTACCATTAAACCATATGCCGA GCAGATATCGGCACTAGGTTGCTTGGACGAAGAAGATTATATCATT >D_erecta_Acp53C14b-PB ATGAGCGGGATGAAGTCCGTATTTTTGCTCAGTTTTTTGGCTGTCTTGCT TATCCCCCGAGAAACTGTGGCGCAGGCCACTATAAGTGAAACCTGGAGTA AGCTGGGAAAATGTACTCATGTGGGCATCCAAACACTGACCACCCTGGCC AACAAAATTGTCCCGACCGTATATGAGTTGTCACAATGCTCCGGATTCGT TTTTTTGGAGCCGCCGAACGGCAAACAGAGAAGGGTTACCTGGTACCTAA AGATATCCTATGAATTCTTCAAGAAACTGGTCTTTGACGAACCCAGATGT CTGCACAGTCTTCTGAACAAGTTAGCTTTTACAATCAAACCTTTTGCCGA ACAGATATCGGTACTAGGTTGCTTGGACGAAGAAGATTATATCATT
>D_melanogaster_Acp53C14b-PB MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLA DKIVPTVYELKQCSGYVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKC LHGLLNKLAATIKPFAEQISGLGCLDEEDYII >D_sechellia_Acp53C14b-PB MSVIKSIFVLSILAVCLISRETEAQATIGESWGRLGKCTQVGIETLTSLA NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKLVFDEPKC LHSLLTKLGATIKPFAEQISGLGCSDEEDYII >D_simulans_Acp53C14b-PB MSVIKSIFVLSILAVCLIPRETEAQATIGESWGRLGKCTQVGIETLTSLA NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKMVFDEPKC LHSLLTKLGATIKPFAEQISGLGCLDEEDYII >D_yakuba_Acp53C14b-PB MSGFKSIFLLSFLAVFLIPRDTEAQATLNESWGKLAKCTQVGIETLTTLA DGVIPTVYELKQCSGYVSLEPPNGSHRKVTWYLKITYEFFKKLVFDEPRC LHSLLNKLAVTIKPYAEQISALGCLDEEDYII >D_erecta_Acp53C14b-PB MSGMKSVFLLSFLAVLLIPRETVAQATISETWSKLGKCTHVGIQTLTTLA NKIVPTVYELSQCSGFVFLEPPNGKQRRVTWYLKISYEFFKKLVFDEPRC LHSLLNKLAFTIKPFAEQISVLGCLDEEDYII
#NEXUS
[ID: 4195242839]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_Acp53C14b-PB
D_sechellia_Acp53C14b-PB
D_simulans_Acp53C14b-PB
D_yakuba_Acp53C14b-PB
D_erecta_Acp53C14b-PB
;
end;
begin trees;
translate
1 D_melanogaster_Acp53C14b-PB,
2 D_sechellia_Acp53C14b-PB,
3 D_simulans_Acp53C14b-PB,
4 D_yakuba_Acp53C14b-PB,
5 D_erecta_Acp53C14b-PB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02507946,(2:0.02247195,3:0.009294809)1.000:0.02533617,(4:0.07434458,5:0.08387563)1.000:0.05774712);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02507946,(2:0.02247195,3:0.009294809):0.02533617,(4:0.07434458,5:0.08387563):0.05774712);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PB4b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PB4b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PB4b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1052.03 -1060.35
2 -1052.04 -1069.62
--------------------------------------
TOTAL -1052.04 -1068.92
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PB4b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PB4b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PB4b-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.307863 0.001516 0.237861 0.387492 0.304719 1410.01 1455.51 1.000
r(A<->C){all} 0.100680 0.001142 0.038355 0.168811 0.098047 639.05 717.98 1.000
r(A<->G){all} 0.304926 0.002725 0.208409 0.407673 0.302280 706.59 833.55 1.000
r(A<->T){all} 0.160653 0.001547 0.084756 0.235129 0.158463 1013.06 1024.57 1.000
r(C<->G){all} 0.171433 0.002079 0.082661 0.255912 0.167821 812.83 814.49 1.000
r(C<->T){all} 0.187351 0.002086 0.101043 0.277245 0.184308 878.88 912.45 1.000
r(G<->T){all} 0.074957 0.001001 0.014956 0.132249 0.072202 849.66 985.82 1.000
pi(A){all} 0.276284 0.000427 0.235328 0.315524 0.276312 1183.86 1271.57 1.000
pi(C){all} 0.226119 0.000382 0.189261 0.264358 0.225750 1007.73 1047.17 1.000
pi(G){all} 0.240699 0.000397 0.199932 0.278203 0.240218 1165.51 1298.65 1.000
pi(T){all} 0.256898 0.000408 0.217296 0.295636 0.256744 976.82 1009.60 1.000
alpha{1,2} 0.890394 0.251277 0.195949 1.915220 0.770264 1314.29 1367.30 1.001
alpha{3} 1.009960 0.315957 0.231232 2.174552 0.871490 1501.00 1501.00 1.000
pinvar{all} 0.137164 0.010167 0.000082 0.325879 0.118108 1251.65 1306.62 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PB4b-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 132
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 6 | Ser TCT 0 1 1 1 0 | Tyr TAT 3 3 3 4 3 | Cys TGT 2 2 2 2 2
TTC 2 2 2 4 3 | TCC 3 3 3 2 3 | TAC 2 2 2 2 1 | TGC 3 3 3 2 2
Leu TTA 1 1 1 1 1 | TCA 0 1 0 1 1 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 5 3 4 5 6 | TCG 1 2 1 1 1 | TAG 0 0 0 0 0 | Trp TGG 2 2 2 2 2
----------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 2 2 | Pro CCT 0 0 0 0 1 | His CAT 0 0 0 1 1 | Arg CGT 0 0 0 0 0
CTC 2 1 2 2 1 | CCC 2 1 2 1 2 | CAC 1 1 1 1 1 | CGC 0 0 0 0 0
CTA 2 3 1 1 2 | CCA 1 2 2 3 0 | Gln CAA 1 1 1 0 2 | CGA 0 0 0 0 1
CTG 6 6 6 7 6 | CCG 2 2 2 2 3 | CAG 3 3 3 4 3 | CGG 1 1 1 1 0
----------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 5 2 2 | Thr ACT 3 3 2 3 3 | Asn AAT 0 0 0 1 0 | Ser AGT 2 2 2 2 4
ATC 5 5 5 4 4 | ACC 3 4 4 6 5 | AAC 2 2 2 2 3 | AGC 3 3 3 2 1
ATA 3 3 2 3 3 | ACA 2 1 2 1 2 | Lys AAA 6 6 6 4 5 | Arg AGA 1 0 0 2 2
Met ATG 1 1 2 1 2 | ACG 1 1 1 0 0 | AAG 6 6 6 6 5 | AGG 1 2 2 0 1
----------------------------------------------------------------------------------------------------------------------
Val GTT 0 2 1 2 2 | Ala GCT 2 1 1 2 2 | Asp GAT 2 2 1 1 1 | Gly GGT 2 3 3 1 1
GTC 3 2 3 2 3 | GCC 6 5 5 4 3 | GAC 3 2 3 4 2 | GGC 2 3 3 2 2
GTA 3 2 2 2 3 | GCA 1 0 0 2 0 | Glu GAA 7 5 6 7 7 | GGA 3 3 3 3 2
GTG 2 3 3 2 2 | GCG 0 0 0 0 1 | GAG 4 6 5 3 2 | GGG 0 0 0 1 1
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Acp53C14b-PB
position 1: T:0.20455 C:0.16667 A:0.32576 G:0.30303
position 2: T:0.32576 C:0.20455 A:0.30303 G:0.16667
position 3: T:0.18182 C:0.31818 A:0.23485 G:0.26515
Average T:0.23737 C:0.22980 A:0.28788 G:0.24495
#2: D_sechellia_Acp53C14b-PB
position 1: T:0.21212 C:0.16667 A:0.32576 G:0.29545
position 2: T:0.31818 C:0.20455 A:0.29545 G:0.18182
position 3: T:0.20455 C:0.29545 A:0.21212 G:0.28788
Average T:0.24495 C:0.22222 A:0.27778 G:0.25505
#3: D_simulans_Acp53C14b-PB
position 1: T:0.20455 C:0.16667 A:0.33333 G:0.29545
position 2: T:0.32576 C:0.19697 A:0.29545 G:0.18182
position 3: T:0.18939 C:0.32576 A:0.19697 G:0.28788
Average T:0.23990 C:0.22980 A:0.27525 G:0.25505
#4: D_yakuba_Acp53C14b-PB
position 1: T:0.22727 C:0.18939 A:0.29545 G:0.28788
position 2: T:0.32576 C:0.21970 A:0.30303 G:0.15152
position 3: T:0.20455 C:0.30303 A:0.22727 G:0.26515
Average T:0.25253 C:0.23737 A:0.27525 G:0.23485
#5: D_erecta_Acp53C14b-PB
position 1: T:0.23485 C:0.18939 A:0.31818 G:0.25758
position 2: T:0.36364 C:0.20455 A:0.27273 G:0.15909
position 3: T:0.22727 C:0.27273 A:0.23485 G:0.26515
Average T:0.27525 C:0.22222 A:0.27525 G:0.22727
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 3 | Tyr Y TAT 16 | Cys C TGT 10
TTC 13 | TCC 14 | TAC 9 | TGC 13
Leu L TTA 5 | TCA 3 | *** * TAA 0 | *** * TGA 0
TTG 23 | TCG 6 | TAG 0 | Trp W TGG 10
------------------------------------------------------------------------------
Leu L CTT 7 | Pro P CCT 1 | His H CAT 2 | Arg R CGT 0
CTC 8 | CCC 8 | CAC 5 | CGC 0
CTA 9 | CCA 8 | Gln Q CAA 5 | CGA 1
CTG 31 | CCG 11 | CAG 16 | CGG 4
------------------------------------------------------------------------------
Ile I ATT 17 | Thr T ACT 14 | Asn N AAT 1 | Ser S AGT 12
ATC 23 | ACC 22 | AAC 11 | AGC 12
ATA 14 | ACA 8 | Lys K AAA 27 | Arg R AGA 5
Met M ATG 7 | ACG 3 | AAG 29 | AGG 6
------------------------------------------------------------------------------
Val V GTT 7 | Ala A GCT 8 | Asp D GAT 7 | Gly G GGT 10
GTC 13 | GCC 23 | GAC 14 | GGC 12
GTA 12 | GCA 3 | Glu E GAA 32 | GGA 14
GTG 12 | GCG 1 | GAG 20 | GGG 2
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.21667 C:0.17576 A:0.31970 G:0.28788
position 2: T:0.33182 C:0.20606 A:0.29394 G:0.16818
position 3: T:0.20152 C:0.30303 A:0.22121 G:0.27424
Average T:0.25000 C:0.22828 A:0.27828 G:0.24343
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Acp53C14b-PB
D_sechellia_Acp53C14b-PB 0.2084 (0.0373 0.1792)
D_simulans_Acp53C14b-PB 0.2898 (0.0355 0.1224) 0.1104 (0.0100 0.0905)
D_yakuba_Acp53C14b-PB 0.3718 (0.0989 0.2660) 0.3734 (0.1126 0.3015) 0.3733 (0.1083 0.2901)
D_erecta_Acp53C14b-PB 0.4058 (0.1120 0.2759) 0.3628 (0.1162 0.3202) 0.4041 (0.1119 0.2768) 0.4729 (0.1084 0.2291)
Model 0: one-ratio
TREE # 1: (1, (2, 3), (4, 5)); MP score: 91
lnL(ntime: 7 np: 9): -1025.224871 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.070896 0.072434 0.062609 0.023198 0.155912 0.205503 0.229391 1.482737 0.360905
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.81994
(1: 0.070896, (2: 0.062609, 3: 0.023198): 0.072434, (4: 0.205503, 5: 0.229391): 0.155912);
(D_melanogaster_Acp53C14b-PB: 0.070896, (D_sechellia_Acp53C14b-PB: 0.062609, D_simulans_Acp53C14b-PB: 0.023198): 0.072434, (D_yakuba_Acp53C14b-PB: 0.205503, D_erecta_Acp53C14b-PB: 0.229391): 0.155912);
Detailed output identifying parameters
kappa (ts/tv) = 1.48274
omega (dN/dS) = 0.36090
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.071 299.8 96.2 0.3609 0.0165 0.0458 5.0 4.4
6..7 0.072 299.8 96.2 0.3609 0.0169 0.0468 5.1 4.5
7..2 0.063 299.8 96.2 0.3609 0.0146 0.0404 4.4 3.9
7..3 0.023 299.8 96.2 0.3609 0.0054 0.0150 1.6 1.4
6..8 0.156 299.8 96.2 0.3609 0.0363 0.1007 10.9 9.7
8..4 0.206 299.8 96.2 0.3609 0.0479 0.1327 14.4 12.8
8..5 0.229 299.8 96.2 0.3609 0.0535 0.1481 16.0 14.3
tree length for dN: 0.1911
tree length for dS: 0.5295
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 91
lnL(ntime: 7 np: 10): -1025.055906 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.071402 0.072703 0.062809 0.023228 0.159246 0.209053 0.232470 1.501645 0.824585 0.261661
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.83091
(1: 0.071402, (2: 0.062809, 3: 0.023228): 0.072703, (4: 0.209053, 5: 0.232470): 0.159246);
(D_melanogaster_Acp53C14b-PB: 0.071402, (D_sechellia_Acp53C14b-PB: 0.062809, D_simulans_Acp53C14b-PB: 0.023228): 0.072703, (D_yakuba_Acp53C14b-PB: 0.209053, D_erecta_Acp53C14b-PB: 0.232470): 0.159246);
Detailed output identifying parameters
kappa (ts/tv) = 1.50165
dN/dS (w) for site classes (K=2)
p: 0.82459 0.17541
w: 0.26166 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.071 299.6 96.4 0.3912 0.0173 0.0441 5.2 4.3
6..7 0.073 299.6 96.4 0.3912 0.0176 0.0449 5.3 4.3
7..2 0.063 299.6 96.4 0.3912 0.0152 0.0388 4.5 3.7
7..3 0.023 299.6 96.4 0.3912 0.0056 0.0144 1.7 1.4
6..8 0.159 299.6 96.4 0.3912 0.0385 0.0984 11.5 9.5
8..4 0.209 299.6 96.4 0.3912 0.0505 0.1292 15.1 12.5
8..5 0.232 299.6 96.4 0.3912 0.0562 0.1437 16.8 13.8
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 91
lnL(ntime: 7 np: 12): -1025.055906 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.071402 0.072703 0.062809 0.023228 0.159246 0.209053 0.232470 1.501645 0.824585 0.099857 0.261661 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.83091
(1: 0.071402, (2: 0.062809, 3: 0.023228): 0.072703, (4: 0.209053, 5: 0.232470): 0.159246);
(D_melanogaster_Acp53C14b-PB: 0.071402, (D_sechellia_Acp53C14b-PB: 0.062809, D_simulans_Acp53C14b-PB: 0.023228): 0.072703, (D_yakuba_Acp53C14b-PB: 0.209053, D_erecta_Acp53C14b-PB: 0.232470): 0.159246);
Detailed output identifying parameters
kappa (ts/tv) = 1.50165
dN/dS (w) for site classes (K=3)
p: 0.82459 0.09986 0.07556
w: 0.26166 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.071 299.6 96.4 0.3912 0.0173 0.0441 5.2 4.3
6..7 0.073 299.6 96.4 0.3912 0.0176 0.0449 5.3 4.3
7..2 0.063 299.6 96.4 0.3912 0.0152 0.0388 4.5 3.7
7..3 0.023 299.6 96.4 0.3912 0.0056 0.0144 1.7 1.4
6..8 0.159 299.6 96.4 0.3912 0.0385 0.0984 11.5 9.5
8..4 0.209 299.6 96.4 0.3912 0.0505 0.1292 15.1 12.5
8..5 0.232 299.6 96.4 0.3912 0.0562 0.1437 16.8 13.8
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp53C14b-PB)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.073 0.277 0.418 0.213 0.019 0.000 0.000 0.000 0.000 0.000
w2: 0.654 0.180 0.069 0.033 0.019 0.013 0.010 0.008 0.007 0.007
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.031
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.019 0.086
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.004 0.014 0.048 0.148
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.003 0.012 0.030 0.078 0.176
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.003 0.009 0.025 0.044 0.093 0.163
sum of density on p0-p1 = 1.000000
Time used: 0:07
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 91
lnL(ntime: 7 np: 13): -1024.229430 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.071401 0.072778 0.062858 0.023222 0.158638 0.208721 0.233261 1.478634 0.303950 0.433462 0.000001 0.535530 0.535530
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.83088
(1: 0.071401, (2: 0.062858, 3: 0.023222): 0.072778, (4: 0.208721, 5: 0.233261): 0.158638);
(D_melanogaster_Acp53C14b-PB: 0.071401, (D_sechellia_Acp53C14b-PB: 0.062858, D_simulans_Acp53C14b-PB: 0.023222): 0.072778, (D_yakuba_Acp53C14b-PB: 0.208721, D_erecta_Acp53C14b-PB: 0.233261): 0.158638);
Detailed output identifying parameters
kappa (ts/tv) = 1.47863
dN/dS (w) for site classes (K=3)
p: 0.30395 0.43346 0.26259
w: 0.00000 0.53553 0.53553
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.071 299.8 96.2 0.3728 0.0169 0.0453 5.1 4.4
6..7 0.073 299.8 96.2 0.3728 0.0172 0.0462 5.2 4.4
7..2 0.063 299.8 96.2 0.3728 0.0149 0.0399 4.5 3.8
7..3 0.023 299.8 96.2 0.3728 0.0055 0.0147 1.6 1.4
6..8 0.159 299.8 96.2 0.3728 0.0375 0.1007 11.3 9.7
8..4 0.209 299.8 96.2 0.3728 0.0494 0.1325 14.8 12.7
8..5 0.233 299.8 96.2 0.3728 0.0552 0.1481 16.6 14.2
Naive Empirical Bayes (NEB) analysis
Time used: 0:11
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 91
lnL(ntime: 7 np: 10): -1024.586583 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.071389 0.072730 0.062817 0.023217 0.158946 0.208935 0.232911 1.485391 0.885561 1.454202
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.83095
(1: 0.071389, (2: 0.062817, 3: 0.023217): 0.072730, (4: 0.208935, 5: 0.232911): 0.158946);
(D_melanogaster_Acp53C14b-PB: 0.071389, (D_sechellia_Acp53C14b-PB: 0.062817, D_simulans_Acp53C14b-PB: 0.023217): 0.072730, (D_yakuba_Acp53C14b-PB: 0.208935, D_erecta_Acp53C14b-PB: 0.232911): 0.158946);
Detailed output identifying parameters
kappa (ts/tv) = 1.48539
Parameters in M7 (beta):
p = 0.88556 q = 1.45420
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.02315 0.08121 0.14707 0.21927 0.29778 0.38325 0.47708 0.58193 0.70348 0.85948
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.071 299.8 96.2 0.3774 0.0170 0.0450 5.1 4.3
6..7 0.073 299.8 96.2 0.3774 0.0173 0.0459 5.2 4.4
7..2 0.063 299.8 96.2 0.3774 0.0149 0.0396 4.5 3.8
7..3 0.023 299.8 96.2 0.3774 0.0055 0.0146 1.7 1.4
6..8 0.159 299.8 96.2 0.3774 0.0378 0.1002 11.3 9.6
8..4 0.209 299.8 96.2 0.3774 0.0497 0.1317 14.9 12.7
8..5 0.233 299.8 96.2 0.3774 0.0554 0.1469 16.6 14.1
Time used: 0:18
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 91
lnL(ntime: 7 np: 12): -1024.586593 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.071389 0.072730 0.062817 0.023217 0.158947 0.208935 0.232911 1.485392 0.999990 0.885567 1.454241 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.83095
(1: 0.071389, (2: 0.062817, 3: 0.023217): 0.072730, (4: 0.208935, 5: 0.232911): 0.158947);
(D_melanogaster_Acp53C14b-PB: 0.071389, (D_sechellia_Acp53C14b-PB: 0.062817, D_simulans_Acp53C14b-PB: 0.023217): 0.072730, (D_yakuba_Acp53C14b-PB: 0.208935, D_erecta_Acp53C14b-PB: 0.232911): 0.158947);
Detailed output identifying parameters
kappa (ts/tv) = 1.48539
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.88557 q = 1.45424
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.02315 0.08121 0.14706 0.21926 0.29777 0.38325 0.47708 0.58192 0.70347 0.85948 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.071 299.8 96.2 0.3774 0.0170 0.0450 5.1 4.3
6..7 0.073 299.8 96.2 0.3774 0.0173 0.0459 5.2 4.4
7..2 0.063 299.8 96.2 0.3774 0.0149 0.0396 4.5 3.8
7..3 0.023 299.8 96.2 0.3774 0.0055 0.0146 1.7 1.4
6..8 0.159 299.8 96.2 0.3774 0.0378 0.1002 11.3 9.6
8..4 0.209 299.8 96.2 0.3774 0.0497 0.1317 14.9 12.7
8..5 0.233 299.8 96.2 0.3774 0.0554 0.1469 16.6 14.1
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp53C14b-PB)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.019 0.139 0.841
p : 0.017 0.111 0.205 0.250 0.210 0.123 0.055 0.020 0.007 0.002
q : 0.004 0.012 0.041 0.062 0.086 0.111 0.136 0.160 0.183 0.206
ws: 0.748 0.165 0.047 0.017 0.008 0.005 0.003 0.003 0.002 0.002
Time used: 0:35
Model 1: NearlyNeutral -1025.055906 Model 2: PositiveSelection -1025.055906 Model 0: one-ratio -1025.224871 Model 3: discrete -1024.22943 Model 7: beta -1024.586583 Model 8: beta&w>1 -1024.586593 Model 0 vs 1 0.3379299999996874 Model 2 vs 1 0.0 Model 8 vs 7 1.9999999949504854E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
