--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Mon Nov 07 18:18:33 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/155/CG44001-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1789.18 -1805.47
2 -1788.41 -1803.52
--------------------------------------
TOTAL -1788.72 -1804.90
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.812780 0.009808 0.639946 1.022091 0.804760 1350.06 1425.53 1.000
r(A<->C){all} 0.067109 0.000438 0.032360 0.112124 0.065070 831.75 1002.00 1.000
r(A<->G){all} 0.269761 0.002011 0.177680 0.353763 0.267918 777.55 821.06 1.000
r(A<->T){all} 0.102813 0.000794 0.050458 0.156228 0.101164 951.19 983.27 1.001
r(C<->G){all} 0.068227 0.000316 0.034977 0.102103 0.067321 985.04 997.49 1.000
r(C<->T){all} 0.436030 0.002731 0.330122 0.535725 0.434439 772.03 783.20 1.000
r(G<->T){all} 0.056060 0.000375 0.022565 0.095763 0.053828 916.46 943.00 1.000
pi(A){all} 0.255027 0.000326 0.220620 0.291287 0.254799 990.87 1167.67 1.000
pi(C){all} 0.261784 0.000297 0.229700 0.296894 0.260927 1092.43 1151.76 1.000
pi(G){all} 0.292053 0.000339 0.258719 0.329390 0.291770 1055.40 1095.11 1.000
pi(T){all} 0.191136 0.000245 0.160613 0.221824 0.190695 1202.37 1239.43 1.000
alpha{1,2} 0.130919 0.001157 0.062071 0.202198 0.132481 1159.72 1195.31 1.001
alpha{3} 2.651678 0.821332 1.072129 4.397730 2.533001 1015.58 1234.94 1.000
pinvar{all} 0.249232 0.007738 0.073720 0.409747 0.257439 1147.58 1208.10 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1670.84949
Model 2: PositiveSelection -1670.84949
Model 0: one-ratio -1675.583797
Model 3: discrete -1669.173666
Model 7: beta -1669.483312
Model 8: beta&w>1 -1669.329818
Model 0 vs 1 9.468613999999889
Model 2 vs 1 0.0
Model 8 vs 7 0.30698800000027404
>C1
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
AMMGHLEIVKLLVEHKANLLLQDESGQTALHRAVMRGHLEVCRILLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C2
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMDRDGCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
AMMGHLEIVKLLVEHKANLLLQDECGQTALHRAVMRGHLEVCRILLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C3
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMDRDGCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
AMMGHLEIVKLLVEHKANLLLQDECGQTALHRAVMRGHLEVCRILLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C4
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLVEGKADVNAVTKAGATALHRA
AMMGHLEIVKVLFEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C5
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
AMMGHLEIVKVLVEHKADLLLQDECGQTALHRAAMRGHLEVCRFLLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C6
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QAMARDGCDYTALHYAARNGNVPICKLLLDEGKVDVNAVTKAGATSLHRA
AMMGHLEIVKLLAEHKANLLLQDECGQSALHRAAMRGHLEVCRLLLQKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C7
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLEEGKADVNAVTKAGATSLHRA
AMMGHLEIVKLLAEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLQKEP
TLKLVQDKKEKIAFEYITENANDDFKLLLKP
>C8
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLEEGKADVNAVTKAGASSLHRS
AMMGHLDIVKLLAEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLQKEP
TLKLVKDKKDKIAFEYITENANDDFKLLLKP
>C9
MDHHNADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNELERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATSLHRA
AMMGHLEIVKLLSGHKANLLLQDECGQSALHRAAMRGHLEVCRFLLQQEP
ALKLVKDNKNKIAFEYIMENANDDFKLLLKP
>C10
MDHHNADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLDEGKVDVNAVTKAGATSLHRA
AMMGHLEIVKLLVEHKANLLLQDECGQSALHRAAMRGHLEVCRFLLQQEP
ALKLIKDNKNKIAFEYIMENANDDFKLLLKP
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=181
C1 MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
C2 MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
C3 MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
C4 MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
C5 MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
C6 MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
C7 MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
C8 MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
C9 MDHHNADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNELERVREFIKKG
C10 MDHHNADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
** *.**********************************:**********
C1 QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
C2 QSMDRDGCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
C3 QSMDRDGCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
C4 QSMARDDCDYTALHYAARNGNEPICKLLLVEGKADVNAVTKAGATALHRA
C5 QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
C6 QAMARDGCDYTALHYAARNGNVPICKLLLDEGKVDVNAVTKAGATSLHRA
C7 QSMARDDCDYTALHYAARNGNEPICKLLLEEGKADVNAVTKAGATSLHRA
C8 QSMARDDCDYTALHYAARNGNEPICKLLLEEGKADVNAVTKAGASSLHRS
C9 QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATSLHRA
C10 QSMARDDCDYTALHYAARNGNEPICKLLLDEGKVDVNAVTKAGATSLHRA
*:* **.************** ******* ***.**********::***:
C1 AMMGHLEIVKLLVEHKANLLLQDESGQTALHRAVMRGHLEVCRILLAKEP
C2 AMMGHLEIVKLLVEHKANLLLQDECGQTALHRAVMRGHLEVCRILLAKEP
C3 AMMGHLEIVKLLVEHKANLLLQDECGQTALHRAVMRGHLEVCRILLAKEP
C4 AMMGHLEIVKVLFEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLAKEP
C5 AMMGHLEIVKVLVEHKADLLLQDECGQTALHRAAMRGHLEVCRFLLAKEP
C6 AMMGHLEIVKLLAEHKANLLLQDECGQSALHRAAMRGHLEVCRLLLQKEP
C7 AMMGHLEIVKLLAEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLQKEP
C8 AMMGHLDIVKLLAEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLQKEP
C9 AMMGHLEIVKLLSGHKANLLLQDECGQSALHRAAMRGHLEVCRFLLQQEP
C10 AMMGHLEIVKLLVEHKANLLLQDECGQSALHRAAMRGHLEVCRFLLQQEP
******:***:* ***:******.**:*****.*********:** :**
C1 TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
C2 TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
C3 TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
C4 TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
C5 TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
C6 TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
C7 TLKLVQDKKEKIAFEYITENANDDFKLLLKP
C8 TLKLVKDKKDKIAFEYITENANDDFKLLLKP
C9 ALKLVKDNKNKIAFEYIMENANDDFKLLLKP
C10 ALKLIKDNKNKIAFEYIMENANDDFKLLLKP
:***::*:*:******* *************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 181 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 181 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [16290]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [16290]--->[16290]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/155/CG44001-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.533 Mb, Max= 30.958 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
AMMGHLEIVKLLVEHKANLLLQDESGQTALHRAVMRGHLEVCRILLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C2
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMDRDGCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
AMMGHLEIVKLLVEHKANLLLQDECGQTALHRAVMRGHLEVCRILLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C3
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMDRDGCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
AMMGHLEIVKLLVEHKANLLLQDECGQTALHRAVMRGHLEVCRILLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C4
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLVEGKADVNAVTKAGATALHRA
AMMGHLEIVKVLFEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C5
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
AMMGHLEIVKVLVEHKADLLLQDECGQTALHRAAMRGHLEVCRFLLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C6
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QAMARDGCDYTALHYAARNGNVPICKLLLDEGKVDVNAVTKAGATSLHRA
AMMGHLEIVKLLAEHKANLLLQDECGQSALHRAAMRGHLEVCRLLLQKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C7
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLEEGKADVNAVTKAGATSLHRA
AMMGHLEIVKLLAEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLQKEP
TLKLVQDKKEKIAFEYITENANDDFKLLLKP
>C8
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLEEGKADVNAVTKAGASSLHRS
AMMGHLDIVKLLAEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLQKEP
TLKLVKDKKDKIAFEYITENANDDFKLLLKP
>C9
MDHHNADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNELERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATSLHRA
AMMGHLEIVKLLSGHKANLLLQDECGQSALHRAAMRGHLEVCRFLLQQEP
ALKLVKDNKNKIAFEYIMENANDDFKLLLKP
>C10
MDHHNADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLDEGKVDVNAVTKAGATSLHRA
AMMGHLEIVKLLVEHKANLLLQDECGQSALHRAAMRGHLEVCRFLLQQEP
ALKLIKDNKNKIAFEYIMENANDDFKLLLKP
FORMAT of file /tmp/tmp903351863132346029aln Not Supported[FATAL:T-COFFEE]
>C1
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
AMMGHLEIVKLLVEHKANLLLQDESGQTALHRAVMRGHLEVCRILLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C2
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMDRDGCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
AMMGHLEIVKLLVEHKANLLLQDECGQTALHRAVMRGHLEVCRILLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C3
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMDRDGCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
AMMGHLEIVKLLVEHKANLLLQDECGQTALHRAVMRGHLEVCRILLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C4
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLVEGKADVNAVTKAGATALHRA
AMMGHLEIVKVLFEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C5
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
AMMGHLEIVKVLVEHKADLLLQDECGQTALHRAAMRGHLEVCRFLLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C6
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QAMARDGCDYTALHYAARNGNVPICKLLLDEGKVDVNAVTKAGATSLHRA
AMMGHLEIVKLLAEHKANLLLQDECGQSALHRAAMRGHLEVCRLLLQKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C7
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLEEGKADVNAVTKAGATSLHRA
AMMGHLEIVKLLAEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLQKEP
TLKLVQDKKEKIAFEYITENANDDFKLLLKP
>C8
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLEEGKADVNAVTKAGASSLHRS
AMMGHLDIVKLLAEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLQKEP
TLKLVKDKKDKIAFEYITENANDDFKLLLKP
>C9
MDHHNADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNELERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATSLHRA
AMMGHLEIVKLLSGHKANLLLQDECGQSALHRAAMRGHLEVCRFLLQQEP
ALKLVKDNKNKIAFEYIMENANDDFKLLLKP
>C10
MDHHNADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLDEGKVDVNAVTKAGATSLHRA
AMMGHLEIVKLLVEHKANLLLQDECGQSALHRAAMRGHLEVCRFLLQQEP
ALKLIKDNKNKIAFEYIMENANDDFKLLLKP
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:181 S:100 BS:181
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# PW_SEQ_DISTANCES
BOT 0 1 98.34 C1 C2 98.34
TOP 1 0 98.34 C2 C1 98.34
BOT 0 2 98.34 C1 C3 98.34
TOP 2 0 98.34 C3 C1 98.34
BOT 0 3 96.69 C1 C4 96.69
TOP 3 0 96.69 C4 C1 96.69
BOT 0 4 97.24 C1 C5 97.24
TOP 4 0 97.24 C5 C1 97.24
BOT 0 5 93.92 C1 C6 93.92
TOP 5 0 93.92 C6 C1 93.92
BOT 0 6 94.48 C1 C7 94.48
TOP 6 0 94.48 C7 C1 94.48
BOT 0 7 93.92 C1 C8 93.92
TOP 7 0 93.92 C8 C1 93.92
BOT 0 8 91.71 C1 C9 91.71
TOP 8 0 91.71 C9 C1 91.71
BOT 0 9 92.27 C1 C10 92.27
TOP 9 0 92.27 C10 C1 92.27
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 96.13 C2 C4 96.13
TOP 3 1 96.13 C4 C2 96.13
BOT 1 4 96.69 C2 C5 96.69
TOP 4 1 96.69 C5 C2 96.69
BOT 1 5 94.48 C2 C6 94.48
TOP 5 1 94.48 C6 C2 94.48
BOT 1 6 93.92 C2 C7 93.92
TOP 6 1 93.92 C7 C2 93.92
BOT 1 7 93.37 C2 C8 93.37
TOP 7 1 93.37 C8 C2 93.37
BOT 1 8 91.16 C2 C9 91.16
TOP 8 1 91.16 C9 C2 91.16
BOT 1 9 91.71 C2 C10 91.71
TOP 9 1 91.71 C10 C2 91.71
BOT 2 3 96.13 C3 C4 96.13
TOP 3 2 96.13 C4 C3 96.13
BOT 2 4 96.69 C3 C5 96.69
TOP 4 2 96.69 C5 C3 96.69
BOT 2 5 94.48 C3 C6 94.48
TOP 5 2 94.48 C6 C3 94.48
BOT 2 6 93.92 C3 C7 93.92
TOP 6 2 93.92 C7 C3 93.92
BOT 2 7 93.37 C3 C8 93.37
TOP 7 2 93.37 C8 C3 93.37
BOT 2 8 91.16 C3 C9 91.16
TOP 8 2 91.16 C9 C3 91.16
BOT 2 9 91.71 C3 C10 91.71
TOP 9 2 91.71 C10 C3 91.71
BOT 3 4 98.34 C4 C5 98.34
TOP 4 3 98.34 C5 C4 98.34
BOT 3 5 93.92 C4 C6 93.92
TOP 5 3 93.92 C6 C4 93.92
BOT 3 6 95.58 C4 C7 95.58
TOP 6 3 95.58 C7 C4 95.58
BOT 3 7 95.03 C4 C8 95.03
TOP 7 3 95.03 C8 C4 95.03
BOT 3 8 92.27 C4 C9 92.27
TOP 8 3 92.27 C9 C4 92.27
BOT 3 9 92.27 C4 C10 92.27
TOP 9 3 92.27 C10 C4 92.27
BOT 4 5 93.92 C5 C6 93.92
TOP 5 4 93.92 C6 C5 93.92
BOT 4 6 95.03 C5 C7 95.03
TOP 6 4 95.03 C7 C5 95.03
BOT 4 7 94.48 C5 C8 94.48
TOP 7 4 94.48 C8 C5 94.48
BOT 4 8 92.27 C5 C9 92.27
TOP 8 4 92.27 C9 C5 92.27
BOT 4 9 92.82 C5 C10 92.82
TOP 9 4 92.82 C10 C5 92.82
BOT 5 6 94.48 C6 C7 94.48
TOP 6 5 94.48 C7 C6 94.48
BOT 5 7 93.92 C6 C8 93.92
TOP 7 5 93.92 C8 C6 93.92
BOT 5 8 92.27 C6 C9 92.27
TOP 8 5 92.27 C9 C6 92.27
BOT 5 9 93.37 C6 C10 93.37
TOP 9 5 93.37 C10 C6 93.37
BOT 6 7 97.24 C7 C8 97.24
TOP 7 6 97.24 C8 C7 97.24
BOT 6 8 92.82 C7 C9 92.82
TOP 8 6 92.82 C9 C7 92.82
BOT 6 9 92.82 C7 C10 92.82
TOP 9 6 92.82 C10 C7 92.82
BOT 7 8 91.71 C8 C9 91.71
TOP 8 7 91.71 C9 C8 91.71
BOT 7 9 91.71 C8 C10 91.71
TOP 9 7 91.71 C10 C8 91.71
BOT 8 9 97.24 C9 C10 97.24
TOP 9 8 97.24 C10 C9 97.24
AVG 0 C1 * 95.21
AVG 1 C2 * 95.09
AVG 2 C3 * 95.09
AVG 3 C4 * 95.15
AVG 4 C5 * 95.27
AVG 5 C6 * 93.86
AVG 6 C7 * 94.48
AVG 7 C8 * 93.86
AVG 8 C9 * 92.51
AVG 9 C10 * 92.88
TOT TOT * 94.34
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGATCCACATAGTGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC
C2 ATGGATCCACATAGTGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC
C3 ATGGATCCACATAGTGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC
C4 ATGGATCCACATAGTGCGGACAACTGTAAGTGCCACAAGCAGACGCAGCC
C5 ATGGATCCACATAGTGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC
C6 ATGGATCCACATAGCGCGGACAACTGCAAGTGCCACAAGCAAACGCAGCC
C7 ATGGATCCCCACAGCGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC
C8 ATGGATCCCCATAGCGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC
C9 ATGGATCACCATAACGCCGACAACTGCAAATGCCACAAGCAGACGCAGCC
C10 ATGGATCACCACAACGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC
*******..** *. ** ******** **.***********.********
C1 GGCACAGCAGACGTTAAGCGACATGGACTTCGATCGAGGCATTTGGAATG
C2 GGCACAGCAGACGTTAAGCGACATGGACTTCGATCGAGGCATCTGGAATG
C3 GGCACAGCAGACGTTAAGCGACATGGACTTCGATCGAGGCATCTGGAATG
C4 GGCACAGCAGACGTTAAGCGACATGGACTTCGATCGAGGCATCTGGAATG
C5 GGCACAGCAGACGTTAAGTGACATGGACTTCGATCGAGGCATCTGGAATG
C6 GGCACAGCAGACGCTCAGCGACATGGACTTCGATCGAGGCATCTGGAATG
C7 GGCCCAGCAGACACTTAGCGACATGGACTTCGATCGCGGCATCTGGAATG
C8 GGCTCAGCAGACGCTCAGCGACATGGACTTCGATCGGGGCATCTGGAATG
C9 GGCACAGCAGACGCTCAGCGACATGGACTTTGACCGGGGCATTTGGAATG
C10 GGCACAGCAGACGCTCAGCGACATGGACTTTGATCGGGGCATCTGGAATG
*** ********. * ** *********** ** ** ***** *******
C1 CAGCTATCTATAACGAAGTGGAGCGTGTAAGAGAGTTTATCAAGAAGGGC
C2 CAGCTATCTATAACGAAGTGGAGCGTGTAAGGGAGTTTATCAAGAAGGGC
C3 CAGCTATCTATAACGAAGTGGAGCGTGTAAGGGAGTTTATCAAGAAGGGC
C4 CAGCTATCTATAACGAAGTGGAGCGTGTTAGGGAGTTTATCAAGAAGGGT
C5 CAGCTATCTATAACGAAGTGGAGCGTGTAAGGGAGTTTATCAAGAAGGGT
C6 CAGCTATCTACAACGAGGTGGAGCGTGTGAGGGAGTTCATCAAGAAGGGC
C7 CTGCTATCTACAACGAAGTGGAGCGCGTCAGGGAGTTCATTAAGAAGGGC
C8 CTGCTATTTATAACGAAGTGGAACGCGTCAGGGAGTTCATCAAGAAGGGC
C9 CAGCTATCTATAACGAACTGGAACGTGTAAGGGAGTTCATCAAGAAGGGC
C10 CGGCTATCTATAACGAAGTGGAACGTGTGAGGGAGTTCATCAAGAAGGGC
* ***** ** *****. ****.** ** **.***** ** ********
C1 CAGTCGATGGCTCGCGATGACTGCGACTATACGGCTCTGCACTATGCGGC
C2 CAGTCAATGGATCGCGATGGCTGCGACTATACCGCTCTGCACTATGCGGC
C3 CAGTCAATGGATCGCGATGGCTGCGACTATACCGCTCTGCACTATGCGGC
C4 CAGTCGATGGCTCGGGATGACTGCGACTACACCGCTCTGCACTATGCGGC
C5 CAGTCGATGGCTCGGGACGACTGCGACTACACCGCTCTGCACTATGCGGC
C6 CAGGCCATGGCTCGCGATGGCTGCGACTATACGGCTCTGCACTATGCGGC
C7 CAGTCCATGGCTCGGGATGACTGCGACTATACGGCTCTGCACTATGCAGC
C8 CAGTCTATGGCTCGGGATGACTGCGACTATACGGCTCTGCACTATGCGGC
C9 CAGTCCATGGCTCGGGATGACTGCGACTATACGGCTTTGCACTATGCAGC
C10 CAGTCCATGGCTCGGGATGACTGCGATTATACGGCTTTGCACTATGCGGC
*** * ****.*** ** *.****** ** ** *** **********.**
C1 CCGCAATGGGAACGAGCCCATCTGCAAGCTGCTTCTCGACGAGGGCAAGG
C2 CCGCAATGGGAACGAGCCGATCTGCAAGCTGCTTCTCGACGAGGGCAAGG
C3 CCGCAATGGGAACGAGCCCATCTGCAAGCTGCTTCTCGACGAGGGCAAGG
C4 CCGCAATGGGAACGAGCCCATCTGCAAGCTGCTCCTCGTCGAGGGCAAGG
C5 CCGCAATGGGAACGAGCCCATCTGCAAGCTGCTTCTCGACGAGGGCAAGG
C6 CCGTAATGGCAACGTGCCCATCTGCAAGCTGCTTCTCGACGAGGGCAAAG
C7 CCGCAATGGCAATGAGCCCATCTGCAAGCTGCTCCTCGAAGAGGGCAAGG
C8 CCGCAATGGCAACGAGCCCATCTGCAAGCTGCTTCTCGAAGAAGGCAAGG
C9 CCGCAATGGCAACGAGCCAATCTGCAAGCTACTCCTCGACGAGGGCAAAG
C10 CCGCAATGGCAATGAACCAATTTGTAAGCTACTTCTCGATGAGGGCAAAG
*** ***** ** *:.** ** ** *****.** ****: **.*****.*
C1 CAGACGTGAATGCTGTGACCAAAGCAGGAGCCACCGCGCTGCATCGTGCA
C2 CAGACGTAAATGCAGTGACCAAGGCAGGAGCCACCGCGCTGCATCGTGCA
C3 CAGACGTGAATGCTGTGACCAAGGCAGGAGCCACCGCGCTGCATCGTGCA
C4 CAGACGTGAATGCTGTGACCAAGGCAGGAGCCACCGCGCTTCATCGTGCA
C5 CAGACGTGAATGCTGTGACCAAGGCTGGAGCTACCGCGCTGCATCGTGCA
C6 TGGATGTAAATGCTGTGACCAAGGCGGGAGCCACCTCCCTGCATCGCGCA
C7 CAGATGTGAATGCTGTGACCAAGGCAGGAGCCACCTCCCTGCATCGCGCC
C8 CAGATGTGAATGCTGTGACCAAGGCAGGAGCCAGCTCCCTGCATCGCTCA
C9 CAGATGTAAATGCTGTGACCAAAGCAGGAGCCACATCACTGCACCGAGCA
C10 TAGATGTGAATGCTGTGACCAAGGCAGGAGCCACCTCCCTGCACCGAGCA
.** **.*****:********.** ***** * . * ** ** ** *.
C1 GCCATGATGGGCCACTTGGAAATCGTGAAGCTACTGGTCGAGCACAAGGC
C2 GCCATGATGGGCCACTTGGAGATCGTGAAGCTACTGGTCGAGCACAAGGC
C3 GCCATGATGGGCCACTTGGAGATCGTGAAGCTACTGGTCGAGCACAAGGC
C4 GCCATGATGGGCCACTTGGAGATTGTGAAGGTACTGTTCGAGCACAAGGC
C5 GCCATGATGGGCCACTTGGAAATTGTGAAGGTACTGGTCGAGCACAAGGC
C6 GCTATGATGGGCCACTTGGAGATTGTTAAGCTGCTGGCCGAGCACAAGGC
C7 GCCATGATGGGCCACTTGGAGATCGTCAAGCTGCTGGCCGAGCACAAGGC
C8 GCTATGATGGGCCACTTGGACATTGTGAAGCTACTGGCCGAGCACAAGGC
C9 GCCATGATGGGCCATTTGGAGATTGTTAAGCTACTGTCGGGACACAAGGC
C10 GCCATGATGGGACATTTGGAGATTGTTAAGCTACTGGTGGAGCACAAGGC
** ********.** ***** ** ** *** *.*** *..********
C1 TAATCTTCTGCTGCAGGACGAGAGCGGACAGACCGCTTTGCATCGAGCAG
C2 TAATCTTCTGCTGCAGGACGAGTGCGGACAGACTGCTTTGCATCGAGCAG
C3 TAATCTTCTGCTGCAGGACGAGTGCGGACAGACTGCTTTGCATCGAGCAG
C4 TAATCTTCTGCTGCAGGACGAGTGCGGACAGACTGCTTTGCATCGAGCAG
C5 TGATCTCCTTCTGCAGGACGAGTGCGGGCAGACTGCATTGCATCGGGCAG
C6 GAATCTGCTGCTGCAGGACGAGTGCGGACAGAGTGCTTTGCATCGGGCAG
C7 GAATCTTCTGCTGCAGGACGAGTGCGGGCAGACTGCTTTGCACCGGGCAG
C8 GAATCTTCTGCTGCAGGATGAGTGCGGACAGACTGCCTTGCATCGGGCTG
C9 TAATCTTCTGCTCCAGGACGAGTGCGGACAGAGTGCTTTGCATCGGGCAG
C10 GAATCTTCTGCTGCAGGACGAGTGCGGGCAGAGTGCCTTGCATCGGGCTG
.**** ** ** ***** ***:****.**** ** ***** **.**:*
C1 TGATGCGGGGCCACCTGGAGGTGTGTCGCATTCTGCTGGCAAAGGAGCCA
C2 TGATGCGGGGCCACCTGGAGGTGTGTCGCATTCTGCTGGCGAAGGAGCCG
C3 TGATGCGAGGCCACCTGGAGGTGTGTCGCATTCTGCTGGCGAAGGAGCCG
C4 CGATGCGAGGCCACCTGGAGGTGTGTCGCTTTCTGCTGGCGAAGGAGCCG
C5 CGATGCGGGGCCACCTGGAGGTGTGTCGCTTTCTGCTGGCAAAGGAGCCG
C6 CCATGCGTGGCCACCTGGAGGTGTGTCGCCTGCTGCTGCAAAAGGAGCCG
C7 CAATGCGGGGCCACCTCGAGGTGTGCCGCTTTCTGCTGCAGAAGGAACCG
C8 CAATGCGGGGCCACCTCGAGGTGTGTCGCTTTCTGCTGCAGAAGGAACCG
C9 CGATGCGTGGGCATCTGGAGGTGTGTCGTTTCCTGCTGCAGCAGGAACCG
C10 CGATGCGTGGCCATCTGGAGGTGTGTCGCTTTCTGCTGCAGCAGGAACCC
***** ** ** ** ******** ** * ****** ...****.**
C1 ACACTTAAGCTGGTCAAGGATAAAAAGGACAAAATTGCATTTGAGTACAT
C2 ACTCTTAAGCTGGTCAAAGATAAAAAGGACAAAATTGCATTTGAGTACAT
C3 ACTCTTAAGCTGGTCAAAGATAAAAAGGACAAAATTGCATTTGAGTACAT
C4 ACTCTTAAACTGGTCAAGGATAAAAAGGACAAAATTGCATTTGAGTACAT
C5 ACTCTTAAACTGGTTAAGGATAAAAAGGACAAAATTGCATTTGAGTACAT
C6 ACACTCAAGCTGGTCAAGGATAAAAAGGATAAAATCGCATTTGAGTACAT
C7 ACACTCAAGCTGGTCCAGGATAAAAAGGAAAAAATTGCATTTGAGTACAT
C8 ACACTCAAACTGGTCAAGGATAAGAAGGATAAAATTGCATTTGAGTACAT
C9 GCACTCAAGCTGGTCAAGGATAACAAGAACAAAATTGCATTTGAATACAT
C10 GCACTCAAGCTGATTAAGGATAACAAGAATAAAATTGCATTTGAATACAT
.*:** **.***.* .*.***** ***.* ***** ********.*****
C1 CATGGAGAACGCCAATGATGATTTTAAGCTGCTGCTGAAGCCC
C2 CATGGAGAACGCCAATGATGACTTTAAGCTGCTGCTGAAGCCC
C3 CATGGAGAACGCCAATGATGACTTTAAGCTGCTGCTGAAGCCC
C4 CATGGAGAACGCCAATGATGACTTTAAGCTGCTGCTAAAGCCC
C5 CATGGAGAACGCCAATGATGACTTTAAGCTGCTGCTGAAGCCC
C6 CATGGAGAACGCCAATGATGACTTTAAGCTATTGCTGAAGCCC
C7 CACGGAGAACGCCAATGACGACTTTAAGCTACTGCTGAAGCCC
C8 CACGGAGAACGCCAATGATGACTTTAAGCTACTGCTGAAGCCC
C9 CATGGAAAACGCCAATGATGACTTTAAGCTATTGCTGAAGCCC
C10 CATGGAGAACGCCAACGACGACTTCAAGCTACTGCTGAAACCC
** ***.******** ** ** ** *****. ****.**.***
>C1
ATGGATCCACATAGTGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC
GGCACAGCAGACGTTAAGCGACATGGACTTCGATCGAGGCATTTGGAATG
CAGCTATCTATAACGAAGTGGAGCGTGTAAGAGAGTTTATCAAGAAGGGC
CAGTCGATGGCTCGCGATGACTGCGACTATACGGCTCTGCACTATGCGGC
CCGCAATGGGAACGAGCCCATCTGCAAGCTGCTTCTCGACGAGGGCAAGG
CAGACGTGAATGCTGTGACCAAAGCAGGAGCCACCGCGCTGCATCGTGCA
GCCATGATGGGCCACTTGGAAATCGTGAAGCTACTGGTCGAGCACAAGGC
TAATCTTCTGCTGCAGGACGAGAGCGGACAGACCGCTTTGCATCGAGCAG
TGATGCGGGGCCACCTGGAGGTGTGTCGCATTCTGCTGGCAAAGGAGCCA
ACACTTAAGCTGGTCAAGGATAAAAAGGACAAAATTGCATTTGAGTACAT
CATGGAGAACGCCAATGATGATTTTAAGCTGCTGCTGAAGCCC
>C2
ATGGATCCACATAGTGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC
GGCACAGCAGACGTTAAGCGACATGGACTTCGATCGAGGCATCTGGAATG
CAGCTATCTATAACGAAGTGGAGCGTGTAAGGGAGTTTATCAAGAAGGGC
CAGTCAATGGATCGCGATGGCTGCGACTATACCGCTCTGCACTATGCGGC
CCGCAATGGGAACGAGCCGATCTGCAAGCTGCTTCTCGACGAGGGCAAGG
CAGACGTAAATGCAGTGACCAAGGCAGGAGCCACCGCGCTGCATCGTGCA
GCCATGATGGGCCACTTGGAGATCGTGAAGCTACTGGTCGAGCACAAGGC
TAATCTTCTGCTGCAGGACGAGTGCGGACAGACTGCTTTGCATCGAGCAG
TGATGCGGGGCCACCTGGAGGTGTGTCGCATTCTGCTGGCGAAGGAGCCG
ACTCTTAAGCTGGTCAAAGATAAAAAGGACAAAATTGCATTTGAGTACAT
CATGGAGAACGCCAATGATGACTTTAAGCTGCTGCTGAAGCCC
>C3
ATGGATCCACATAGTGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC
GGCACAGCAGACGTTAAGCGACATGGACTTCGATCGAGGCATCTGGAATG
CAGCTATCTATAACGAAGTGGAGCGTGTAAGGGAGTTTATCAAGAAGGGC
CAGTCAATGGATCGCGATGGCTGCGACTATACCGCTCTGCACTATGCGGC
CCGCAATGGGAACGAGCCCATCTGCAAGCTGCTTCTCGACGAGGGCAAGG
CAGACGTGAATGCTGTGACCAAGGCAGGAGCCACCGCGCTGCATCGTGCA
GCCATGATGGGCCACTTGGAGATCGTGAAGCTACTGGTCGAGCACAAGGC
TAATCTTCTGCTGCAGGACGAGTGCGGACAGACTGCTTTGCATCGAGCAG
TGATGCGAGGCCACCTGGAGGTGTGTCGCATTCTGCTGGCGAAGGAGCCG
ACTCTTAAGCTGGTCAAAGATAAAAAGGACAAAATTGCATTTGAGTACAT
CATGGAGAACGCCAATGATGACTTTAAGCTGCTGCTGAAGCCC
>C4
ATGGATCCACATAGTGCGGACAACTGTAAGTGCCACAAGCAGACGCAGCC
GGCACAGCAGACGTTAAGCGACATGGACTTCGATCGAGGCATCTGGAATG
CAGCTATCTATAACGAAGTGGAGCGTGTTAGGGAGTTTATCAAGAAGGGT
CAGTCGATGGCTCGGGATGACTGCGACTACACCGCTCTGCACTATGCGGC
CCGCAATGGGAACGAGCCCATCTGCAAGCTGCTCCTCGTCGAGGGCAAGG
CAGACGTGAATGCTGTGACCAAGGCAGGAGCCACCGCGCTTCATCGTGCA
GCCATGATGGGCCACTTGGAGATTGTGAAGGTACTGTTCGAGCACAAGGC
TAATCTTCTGCTGCAGGACGAGTGCGGACAGACTGCTTTGCATCGAGCAG
CGATGCGAGGCCACCTGGAGGTGTGTCGCTTTCTGCTGGCGAAGGAGCCG
ACTCTTAAACTGGTCAAGGATAAAAAGGACAAAATTGCATTTGAGTACAT
CATGGAGAACGCCAATGATGACTTTAAGCTGCTGCTAAAGCCC
>C5
ATGGATCCACATAGTGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC
GGCACAGCAGACGTTAAGTGACATGGACTTCGATCGAGGCATCTGGAATG
CAGCTATCTATAACGAAGTGGAGCGTGTAAGGGAGTTTATCAAGAAGGGT
CAGTCGATGGCTCGGGACGACTGCGACTACACCGCTCTGCACTATGCGGC
CCGCAATGGGAACGAGCCCATCTGCAAGCTGCTTCTCGACGAGGGCAAGG
CAGACGTGAATGCTGTGACCAAGGCTGGAGCTACCGCGCTGCATCGTGCA
GCCATGATGGGCCACTTGGAAATTGTGAAGGTACTGGTCGAGCACAAGGC
TGATCTCCTTCTGCAGGACGAGTGCGGGCAGACTGCATTGCATCGGGCAG
CGATGCGGGGCCACCTGGAGGTGTGTCGCTTTCTGCTGGCAAAGGAGCCG
ACTCTTAAACTGGTTAAGGATAAAAAGGACAAAATTGCATTTGAGTACAT
CATGGAGAACGCCAATGATGACTTTAAGCTGCTGCTGAAGCCC
>C6
ATGGATCCACATAGCGCGGACAACTGCAAGTGCCACAAGCAAACGCAGCC
GGCACAGCAGACGCTCAGCGACATGGACTTCGATCGAGGCATCTGGAATG
CAGCTATCTACAACGAGGTGGAGCGTGTGAGGGAGTTCATCAAGAAGGGC
CAGGCCATGGCTCGCGATGGCTGCGACTATACGGCTCTGCACTATGCGGC
CCGTAATGGCAACGTGCCCATCTGCAAGCTGCTTCTCGACGAGGGCAAAG
TGGATGTAAATGCTGTGACCAAGGCGGGAGCCACCTCCCTGCATCGCGCA
GCTATGATGGGCCACTTGGAGATTGTTAAGCTGCTGGCCGAGCACAAGGC
GAATCTGCTGCTGCAGGACGAGTGCGGACAGAGTGCTTTGCATCGGGCAG
CCATGCGTGGCCACCTGGAGGTGTGTCGCCTGCTGCTGCAAAAGGAGCCG
ACACTCAAGCTGGTCAAGGATAAAAAGGATAAAATCGCATTTGAGTACAT
CATGGAGAACGCCAATGATGACTTTAAGCTATTGCTGAAGCCC
>C7
ATGGATCCCCACAGCGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC
GGCCCAGCAGACACTTAGCGACATGGACTTCGATCGCGGCATCTGGAATG
CTGCTATCTACAACGAAGTGGAGCGCGTCAGGGAGTTCATTAAGAAGGGC
CAGTCCATGGCTCGGGATGACTGCGACTATACGGCTCTGCACTATGCAGC
CCGCAATGGCAATGAGCCCATCTGCAAGCTGCTCCTCGAAGAGGGCAAGG
CAGATGTGAATGCTGTGACCAAGGCAGGAGCCACCTCCCTGCATCGCGCC
GCCATGATGGGCCACTTGGAGATCGTCAAGCTGCTGGCCGAGCACAAGGC
GAATCTTCTGCTGCAGGACGAGTGCGGGCAGACTGCTTTGCACCGGGCAG
CAATGCGGGGCCACCTCGAGGTGTGCCGCTTTCTGCTGCAGAAGGAACCG
ACACTCAAGCTGGTCCAGGATAAAAAGGAAAAAATTGCATTTGAGTACAT
CACGGAGAACGCCAATGACGACTTTAAGCTACTGCTGAAGCCC
>C8
ATGGATCCCCATAGCGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC
GGCTCAGCAGACGCTCAGCGACATGGACTTCGATCGGGGCATCTGGAATG
CTGCTATTTATAACGAAGTGGAACGCGTCAGGGAGTTCATCAAGAAGGGC
CAGTCTATGGCTCGGGATGACTGCGACTATACGGCTCTGCACTATGCGGC
CCGCAATGGCAACGAGCCCATCTGCAAGCTGCTTCTCGAAGAAGGCAAGG
CAGATGTGAATGCTGTGACCAAGGCAGGAGCCAGCTCCCTGCATCGCTCA
GCTATGATGGGCCACTTGGACATTGTGAAGCTACTGGCCGAGCACAAGGC
GAATCTTCTGCTGCAGGATGAGTGCGGACAGACTGCCTTGCATCGGGCTG
CAATGCGGGGCCACCTCGAGGTGTGTCGCTTTCTGCTGCAGAAGGAACCG
ACACTCAAACTGGTCAAGGATAAGAAGGATAAAATTGCATTTGAGTACAT
CACGGAGAACGCCAATGATGACTTTAAGCTACTGCTGAAGCCC
>C9
ATGGATCACCATAACGCCGACAACTGCAAATGCCACAAGCAGACGCAGCC
GGCACAGCAGACGCTCAGCGACATGGACTTTGACCGGGGCATTTGGAATG
CAGCTATCTATAACGAACTGGAACGTGTAAGGGAGTTCATCAAGAAGGGC
CAGTCCATGGCTCGGGATGACTGCGACTATACGGCTTTGCACTATGCAGC
CCGCAATGGCAACGAGCCAATCTGCAAGCTACTCCTCGACGAGGGCAAAG
CAGATGTAAATGCTGTGACCAAAGCAGGAGCCACATCACTGCACCGAGCA
GCCATGATGGGCCATTTGGAGATTGTTAAGCTACTGTCGGGACACAAGGC
TAATCTTCTGCTCCAGGACGAGTGCGGACAGAGTGCTTTGCATCGGGCAG
CGATGCGTGGGCATCTGGAGGTGTGTCGTTTCCTGCTGCAGCAGGAACCG
GCACTCAAGCTGGTCAAGGATAACAAGAACAAAATTGCATTTGAATACAT
CATGGAAAACGCCAATGATGACTTTAAGCTATTGCTGAAGCCC
>C10
ATGGATCACCACAACGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC
GGCACAGCAGACGCTCAGCGACATGGACTTTGATCGGGGCATCTGGAATG
CGGCTATCTATAACGAAGTGGAACGTGTGAGGGAGTTCATCAAGAAGGGC
CAGTCCATGGCTCGGGATGACTGCGATTATACGGCTTTGCACTATGCGGC
CCGCAATGGCAATGAACCAATTTGTAAGCTACTTCTCGATGAGGGCAAAG
TAGATGTGAATGCTGTGACCAAGGCAGGAGCCACCTCCCTGCACCGAGCA
GCCATGATGGGACATTTGGAGATTGTTAAGCTACTGGTGGAGCACAAGGC
GAATCTTCTGCTGCAGGACGAGTGCGGGCAGAGTGCCTTGCATCGGGCTG
CGATGCGTGGCCATCTGGAGGTGTGTCGCTTTCTGCTGCAGCAGGAACCC
GCACTCAAGCTGATTAAGGATAACAAGAATAAAATTGCATTTGAATACAT
CATGGAGAACGCCAACGACGACTTCAAGCTACTGCTGAAACCC
>C1
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
AMMGHLEIVKLLVEHKANLLLQDESGQTALHRAVMRGHLEVCRILLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C2
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMDRDGCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
AMMGHLEIVKLLVEHKANLLLQDECGQTALHRAVMRGHLEVCRILLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C3
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMDRDGCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
AMMGHLEIVKLLVEHKANLLLQDECGQTALHRAVMRGHLEVCRILLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C4
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLVEGKADVNAVTKAGATALHRA
AMMGHLEIVKVLFEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C5
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
AMMGHLEIVKVLVEHKADLLLQDECGQTALHRAAMRGHLEVCRFLLAKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C6
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QAMARDGCDYTALHYAARNGNVPICKLLLDEGKVDVNAVTKAGATSLHRA
AMMGHLEIVKLLAEHKANLLLQDECGQSALHRAAMRGHLEVCRLLLQKEP
TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
>C7
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLEEGKADVNAVTKAGATSLHRA
AMMGHLEIVKLLAEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLQKEP
TLKLVQDKKEKIAFEYITENANDDFKLLLKP
>C8
MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLEEGKADVNAVTKAGASSLHRS
AMMGHLDIVKLLAEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLQKEP
TLKLVKDKKDKIAFEYITENANDDFKLLLKP
>C9
MDHHNADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNELERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATSLHRA
AMMGHLEIVKLLSGHKANLLLQDECGQSALHRAAMRGHLEVCRFLLQQEP
ALKLVKDNKNKIAFEYIMENANDDFKLLLKP
>C10
MDHHNADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
QSMARDDCDYTALHYAARNGNEPICKLLLDEGKVDVNAVTKAGATSLHRA
AMMGHLEIVKLLVEHKANLLLQDECGQSALHRAAMRGHLEVCRFLLQQEP
ALKLIKDNKNKIAFEYIMENANDDFKLLLKP
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 10 taxa and 543 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478542009
Setting output file names to "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1321288580
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 6504523351
Seed = 1836514271
Swapseed = 1478542009
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 22 unique site patterns
Division 2 has 18 unique site patterns
Division 3 has 93 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2523.440364 -- -24.412588
Chain 2 -- -2564.049231 -- -24.412588
Chain 3 -- -2455.573928 -- -24.412588
Chain 4 -- -2463.442907 -- -24.412588
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2502.853386 -- -24.412588
Chain 2 -- -2566.408853 -- -24.412588
Chain 3 -- -2452.955499 -- -24.412588
Chain 4 -- -2575.366421 -- -24.412588
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2523.440] (-2564.049) (-2455.574) (-2463.443) * [-2502.853] (-2566.409) (-2452.955) (-2575.366)
500 -- (-1863.709) (-1875.417) (-1860.238) [-1853.857] * (-1879.855) (-1876.280) [-1868.384] (-1878.179) -- 0:00:00
1000 -- (-1858.118) (-1852.069) (-1834.752) [-1837.173] * (-1848.846) [-1845.746] (-1854.725) (-1856.415) -- 0:16:39
1500 -- (-1850.376) [-1824.164] (-1825.200) (-1812.782) * (-1835.240) (-1820.103) [-1818.969] (-1828.498) -- 0:11:05
2000 -- (-1839.566) [-1807.895] (-1810.287) (-1791.626) * (-1814.474) (-1806.578) [-1800.882] (-1832.840) -- 0:08:19
2500 -- (-1821.823) (-1807.573) [-1808.667] (-1793.770) * (-1797.522) [-1800.398] (-1793.606) (-1810.752) -- 0:06:39
3000 -- (-1806.383) (-1801.343) (-1805.424) [-1790.703] * (-1800.369) [-1797.233] (-1799.324) (-1806.579) -- 0:05:32
3500 -- (-1793.552) (-1793.121) (-1805.138) [-1791.614] * (-1789.512) (-1792.628) (-1797.295) [-1799.627] -- 0:09:29
4000 -- (-1796.394) (-1797.391) (-1796.197) [-1793.496] * [-1797.104] (-1793.706) (-1804.714) (-1795.113) -- 0:08:18
4500 -- [-1799.304] (-1790.605) (-1801.495) (-1792.079) * (-1796.203) (-1791.227) (-1794.930) [-1789.861] -- 0:07:22
5000 -- [-1794.967] (-1788.920) (-1801.525) (-1801.385) * (-1804.556) (-1793.090) [-1796.602] (-1789.620) -- 0:06:38
Average standard deviation of split frequencies: 0.062854
5500 -- (-1795.702) [-1794.576] (-1799.392) (-1789.680) * (-1788.366) (-1792.051) [-1798.349] (-1791.918) -- 0:06:01
6000 -- (-1788.524) [-1792.738] (-1802.122) (-1796.074) * (-1805.152) (-1795.590) (-1798.852) [-1791.100] -- 0:05:31
6500 -- [-1794.862] (-1796.979) (-1805.560) (-1789.135) * (-1796.014) (-1794.941) [-1795.212] (-1791.915) -- 0:07:38
7000 -- [-1791.629] (-1790.701) (-1793.976) (-1803.998) * (-1788.198) [-1798.648] (-1793.570) (-1800.668) -- 0:07:05
7500 -- (-1799.125) [-1789.608] (-1786.162) (-1793.610) * (-1805.807) [-1792.358] (-1788.912) (-1794.195) -- 0:06:37
8000 -- (-1799.110) (-1813.570) [-1790.419] (-1796.001) * (-1794.975) [-1797.080] (-1797.214) (-1799.915) -- 0:06:12
8500 -- (-1800.424) (-1794.542) (-1800.860) [-1790.893] * (-1794.272) (-1802.495) (-1794.690) [-1798.013] -- 0:05:49
9000 -- (-1791.118) [-1798.150] (-1792.934) (-1791.605) * [-1789.388] (-1801.502) (-1792.812) (-1791.428) -- 0:05:30
9500 -- (-1795.879) [-1795.561] (-1803.059) (-1790.980) * (-1793.176) (-1797.436) (-1797.738) [-1794.845] -- 0:06:57
10000 -- (-1804.117) [-1797.809] (-1796.689) (-1796.036) * (-1799.891) [-1793.414] (-1806.503) (-1800.898) -- 0:06:36
Average standard deviation of split frequencies: 0.073657
10500 -- (-1796.121) [-1797.544] (-1798.249) (-1795.907) * (-1799.507) [-1802.486] (-1796.907) (-1802.106) -- 0:06:16
11000 -- (-1804.014) [-1798.461] (-1793.827) (-1792.964) * (-1796.316) (-1792.123) (-1794.187) [-1801.482] -- 0:05:59
11500 -- (-1789.912) [-1800.633] (-1787.679) (-1792.549) * (-1797.225) (-1801.004) (-1795.929) [-1789.273] -- 0:05:43
12000 -- (-1796.065) (-1795.959) [-1788.960] (-1790.701) * (-1793.958) (-1799.200) [-1795.373] (-1799.240) -- 0:06:51
12500 -- [-1792.375] (-1794.277) (-1793.965) (-1799.105) * (-1793.911) (-1794.976) (-1797.487) [-1795.022] -- 0:06:35
13000 -- (-1803.897) (-1803.836) (-1790.415) [-1786.649] * (-1794.598) (-1802.972) [-1788.758] (-1793.281) -- 0:06:19
13500 -- [-1790.311] (-1791.492) (-1790.629) (-1793.803) * (-1800.748) (-1798.046) (-1801.041) [-1789.591] -- 0:06:05
14000 -- (-1795.656) [-1789.316] (-1794.496) (-1786.030) * (-1802.571) (-1792.625) (-1792.763) [-1786.147] -- 0:05:52
14500 -- (-1792.022) [-1794.191] (-1801.128) (-1797.042) * (-1793.895) [-1791.774] (-1789.421) (-1792.307) -- 0:05:39
15000 -- (-1792.490) (-1792.055) (-1794.414) [-1790.249] * [-1790.243] (-1799.112) (-1791.947) (-1797.821) -- 0:06:34
Average standard deviation of split frequencies: 0.029463
15500 -- [-1790.391] (-1805.507) (-1788.769) (-1799.794) * (-1795.207) (-1790.463) [-1786.936] (-1802.631) -- 0:06:21
16000 -- (-1790.431) [-1806.152] (-1804.315) (-1798.400) * (-1804.135) (-1801.448) [-1795.084] (-1790.444) -- 0:06:09
16500 -- (-1793.823) (-1796.734) [-1791.990] (-1797.455) * [-1786.190] (-1794.186) (-1796.718) (-1794.589) -- 0:05:57
17000 -- (-1791.937) (-1796.610) (-1795.428) [-1796.643] * (-1803.039) (-1793.777) (-1790.620) [-1792.355] -- 0:05:46
17500 -- (-1788.267) [-1793.778] (-1795.609) (-1793.174) * (-1799.876) (-1811.453) (-1794.296) [-1795.094] -- 0:05:36
18000 -- (-1801.202) (-1798.721) (-1801.371) [-1794.513] * (-1799.943) (-1789.073) (-1793.658) [-1793.214] -- 0:06:21
18500 -- (-1799.355) (-1798.998) [-1800.297] (-1797.333) * (-1797.565) [-1790.870] (-1795.582) (-1794.417) -- 0:06:11
19000 -- (-1805.293) [-1791.425] (-1801.591) (-1798.072) * (-1789.463) [-1794.617] (-1790.862) (-1795.472) -- 0:06:01
19500 -- (-1797.869) (-1792.906) (-1797.985) [-1792.245] * [-1791.881] (-1798.320) (-1797.934) (-1791.201) -- 0:05:51
20000 -- (-1791.821) [-1795.993] (-1791.623) (-1797.287) * [-1796.467] (-1794.014) (-1791.113) (-1800.797) -- 0:05:43
Average standard deviation of split frequencies: 0.017741
20500 -- (-1795.822) [-1793.125] (-1791.672) (-1795.171) * [-1799.911] (-1799.414) (-1801.465) (-1797.038) -- 0:06:22
21000 -- (-1796.317) (-1795.562) (-1803.742) [-1789.043] * [-1789.446] (-1799.052) (-1794.868) (-1796.119) -- 0:06:12
21500 -- (-1794.955) (-1793.637) (-1798.693) [-1791.645] * [-1797.385] (-1794.479) (-1798.040) (-1804.009) -- 0:06:04
22000 -- (-1792.791) (-1794.140) (-1798.176) [-1793.613] * [-1792.003] (-1793.232) (-1793.831) (-1798.253) -- 0:05:55
22500 -- (-1800.675) [-1795.993] (-1801.840) (-1796.767) * (-1795.817) (-1791.897) [-1788.582] (-1804.376) -- 0:05:47
23000 -- (-1791.208) [-1792.260] (-1796.207) (-1796.491) * (-1796.613) (-1797.960) [-1789.359] (-1816.542) -- 0:05:39
23500 -- (-1788.300) (-1793.992) [-1797.990] (-1804.700) * (-1789.540) [-1795.377] (-1793.499) (-1805.076) -- 0:06:13
24000 -- [-1792.763] (-1792.347) (-1795.073) (-1800.337) * (-1789.501) (-1797.562) [-1789.605] (-1792.746) -- 0:06:06
24500 -- (-1794.361) (-1798.941) (-1795.488) [-1795.176] * (-1797.245) (-1790.398) (-1794.705) [-1798.983] -- 0:05:58
25000 -- (-1807.674) [-1793.794] (-1791.420) (-1795.005) * (-1800.596) [-1796.684] (-1797.000) (-1786.079) -- 0:05:51
Average standard deviation of split frequencies: 0.034449
25500 -- [-1787.857] (-1799.795) (-1793.308) (-1796.549) * [-1797.767] (-1799.919) (-1798.987) (-1792.889) -- 0:05:43
26000 -- (-1792.931) (-1794.322) [-1786.413] (-1798.560) * (-1799.759) [-1792.355] (-1797.656) (-1798.876) -- 0:05:37
26500 -- (-1799.127) (-1803.097) [-1792.210] (-1791.558) * (-1794.478) (-1802.440) [-1798.450] (-1792.479) -- 0:06:07
27000 -- (-1797.215) [-1786.875] (-1804.597) (-1798.760) * (-1793.954) (-1795.269) (-1794.598) [-1787.066] -- 0:06:00
27500 -- (-1798.913) [-1792.263] (-1815.546) (-1793.403) * [-1787.524] (-1803.169) (-1806.568) (-1799.646) -- 0:05:53
28000 -- (-1797.068) [-1790.900] (-1806.186) (-1792.614) * (-1802.423) (-1803.465) (-1799.607) [-1792.192] -- 0:05:47
28500 -- (-1788.269) (-1801.344) [-1798.168] (-1788.587) * (-1796.893) (-1798.809) (-1799.384) [-1792.742] -- 0:05:40
29000 -- (-1798.032) (-1796.959) [-1792.414] (-1793.981) * (-1793.452) [-1790.156] (-1794.920) (-1797.454) -- 0:06:08
29500 -- (-1798.619) (-1792.262) (-1795.771) [-1790.293] * (-1801.904) (-1792.339) (-1795.781) [-1793.456] -- 0:06:01
30000 -- (-1803.979) (-1805.688) [-1798.660] (-1798.225) * (-1792.263) (-1808.028) [-1792.455] (-1793.838) -- 0:05:55
Average standard deviation of split frequencies: 0.023912
30500 -- (-1798.688) [-1795.508] (-1800.594) (-1797.095) * [-1791.552] (-1799.493) (-1792.894) (-1797.384) -- 0:05:49
31000 -- (-1799.294) [-1791.819] (-1793.608) (-1794.902) * [-1790.709] (-1789.860) (-1788.033) (-1790.367) -- 0:05:43
31500 -- [-1792.373] (-1807.855) (-1794.464) (-1793.409) * (-1798.959) [-1794.242] (-1787.182) (-1799.115) -- 0:05:38
32000 -- [-1794.240] (-1802.474) (-1796.220) (-1803.176) * (-1793.696) (-1791.613) (-1798.188) [-1794.464] -- 0:06:03
32500 -- [-1795.015] (-1801.440) (-1793.367) (-1791.572) * (-1788.669) (-1794.782) (-1796.033) [-1793.593] -- 0:05:57
33000 -- [-1793.926] (-1796.271) (-1804.092) (-1793.869) * (-1791.719) [-1796.870] (-1792.155) (-1791.113) -- 0:05:51
33500 -- [-1795.004] (-1803.927) (-1814.074) (-1788.073) * (-1795.130) [-1792.702] (-1791.797) (-1792.823) -- 0:05:46
34000 -- [-1788.827] (-1797.139) (-1797.088) (-1790.581) * (-1791.843) (-1793.959) (-1798.312) [-1791.163] -- 0:05:40
34500 -- (-1798.601) (-1796.173) (-1790.266) [-1803.610] * (-1797.139) [-1801.295] (-1790.457) (-1793.296) -- 0:06:03
35000 -- (-1792.302) [-1789.424] (-1804.665) (-1799.003) * (-1791.269) [-1790.965] (-1795.601) (-1793.704) -- 0:05:58
Average standard deviation of split frequencies: 0.030554
35500 -- [-1793.631] (-1801.976) (-1792.825) (-1794.239) * (-1796.765) (-1792.672) (-1796.657) [-1792.698] -- 0:05:53
36000 -- (-1794.767) (-1795.222) (-1804.820) [-1787.788] * (-1803.752) (-1792.896) [-1792.572] (-1792.169) -- 0:05:48
36500 -- (-1789.516) (-1794.066) (-1797.308) [-1791.535] * (-1793.406) (-1795.108) [-1801.694] (-1795.968) -- 0:05:43
37000 -- [-1797.102] (-1796.522) (-1792.189) (-1792.091) * [-1793.659] (-1795.947) (-1801.455) (-1793.544) -- 0:05:38
37500 -- [-1796.513] (-1799.407) (-1800.417) (-1794.106) * (-1797.999) [-1793.968] (-1792.442) (-1797.052) -- 0:05:59
38000 -- (-1795.006) [-1801.240] (-1793.249) (-1790.446) * (-1802.488) [-1789.260] (-1792.112) (-1789.896) -- 0:05:54
38500 -- (-1799.097) (-1795.019) (-1795.654) [-1792.129] * (-1794.708) [-1794.529] (-1792.105) (-1794.842) -- 0:05:49
39000 -- (-1797.142) [-1792.847] (-1796.487) (-1801.729) * (-1796.046) [-1797.010] (-1792.532) (-1797.902) -- 0:05:44
39500 -- [-1793.730] (-1794.624) (-1793.695) (-1792.437) * (-1791.587) [-1794.079] (-1794.149) (-1792.407) -- 0:05:40
40000 -- (-1790.439) (-1797.271) (-1798.974) [-1790.248] * (-1794.279) [-1794.665] (-1792.676) (-1804.793) -- 0:06:00
Average standard deviation of split frequencies: 0.027048
40500 -- (-1796.659) [-1788.888] (-1801.748) (-1797.392) * [-1795.178] (-1791.373) (-1798.011) (-1792.627) -- 0:05:55
41000 -- (-1807.777) (-1800.762) [-1796.309] (-1797.000) * (-1792.397) (-1798.241) (-1789.654) [-1792.049] -- 0:05:50
41500 -- (-1796.460) (-1797.296) [-1793.236] (-1795.196) * (-1790.784) [-1793.122] (-1798.749) (-1802.615) -- 0:05:46
42000 -- [-1793.645] (-1800.475) (-1801.340) (-1791.739) * (-1799.931) (-1798.825) [-1799.088] (-1796.794) -- 0:05:42
42500 -- (-1794.471) (-1794.460) [-1798.583] (-1798.926) * (-1807.766) [-1788.290] (-1793.474) (-1793.652) -- 0:05:37
43000 -- (-1791.241) [-1796.468] (-1792.232) (-1791.235) * [-1796.678] (-1798.639) (-1796.759) (-1792.638) -- 0:05:56
43500 -- [-1792.202] (-1796.196) (-1810.105) (-1795.600) * [-1789.612] (-1797.065) (-1799.264) (-1793.545) -- 0:05:51
44000 -- [-1789.856] (-1799.711) (-1798.370) (-1799.362) * (-1798.815) (-1795.799) [-1792.182] (-1798.821) -- 0:05:47
44500 -- (-1796.311) (-1800.457) [-1797.490] (-1803.371) * [-1795.406] (-1795.972) (-1791.121) (-1799.512) -- 0:05:43
45000 -- (-1804.484) (-1793.252) (-1806.982) [-1793.020] * [-1789.878] (-1795.580) (-1799.673) (-1791.741) -- 0:05:39
Average standard deviation of split frequencies: 0.026189
45500 -- (-1795.138) (-1793.345) (-1796.766) [-1788.892] * (-1785.227) [-1790.219] (-1790.827) (-1796.796) -- 0:05:56
46000 -- (-1802.749) (-1786.760) [-1787.639] (-1792.721) * (-1792.942) [-1794.132] (-1789.814) (-1791.179) -- 0:05:52
46500 -- (-1795.055) (-1799.195) [-1791.281] (-1801.840) * [-1791.118] (-1802.194) (-1795.168) (-1798.150) -- 0:05:48
47000 -- (-1806.180) (-1798.901) (-1794.758) [-1792.743] * (-1798.219) [-1796.834] (-1794.634) (-1797.866) -- 0:05:44
47500 -- (-1799.102) [-1791.202] (-1798.314) (-1802.664) * (-1791.317) [-1789.494] (-1792.904) (-1800.374) -- 0:05:40
48000 -- (-1799.877) [-1795.478] (-1796.721) (-1801.321) * [-1791.844] (-1794.263) (-1793.369) (-1790.872) -- 0:05:37
48500 -- (-1793.702) (-1793.473) (-1793.089) [-1794.389] * (-1802.404) [-1798.326] (-1799.190) (-1796.719) -- 0:05:53
49000 -- (-1796.383) (-1800.280) [-1793.866] (-1794.535) * (-1794.581) (-1800.040) (-1797.377) [-1791.107] -- 0:05:49
49500 -- [-1797.969] (-1793.904) (-1794.630) (-1797.443) * (-1793.774) (-1795.889) (-1796.272) [-1793.806] -- 0:05:45
50000 -- (-1794.148) (-1791.345) (-1800.118) [-1787.674] * [-1806.586] (-1796.182) (-1791.318) (-1794.463) -- 0:05:42
Average standard deviation of split frequencies: 0.028946
50500 -- (-1798.741) [-1795.379] (-1789.364) (-1794.978) * [-1795.066] (-1797.144) (-1794.363) (-1792.187) -- 0:05:38
51000 -- [-1790.179] (-1796.036) (-1795.680) (-1801.204) * (-1795.597) [-1791.241] (-1791.562) (-1798.008) -- 0:05:34
51500 -- [-1794.810] (-1793.663) (-1800.788) (-1795.588) * (-1792.405) (-1802.255) (-1790.790) [-1785.192] -- 0:05:49
52000 -- (-1801.474) (-1791.319) [-1789.649] (-1796.670) * (-1795.121) (-1801.044) (-1788.667) [-1782.503] -- 0:05:46
52500 -- (-1791.517) (-1801.654) (-1792.796) [-1790.622] * (-1795.244) (-1793.063) [-1798.709] (-1796.555) -- 0:05:42
53000 -- [-1797.191] (-1796.073) (-1795.730) (-1794.414) * (-1795.167) [-1791.218] (-1790.996) (-1798.227) -- 0:05:39
53500 -- (-1797.876) (-1798.017) [-1790.470] (-1797.671) * [-1789.939] (-1793.187) (-1785.702) (-1795.827) -- 0:05:36
54000 -- (-1799.508) (-1797.802) (-1795.676) [-1790.156] * (-1791.819) [-1790.077] (-1794.928) (-1798.023) -- 0:05:50
54500 -- (-1798.650) (-1800.292) [-1795.295] (-1802.313) * (-1793.243) (-1793.872) (-1791.256) [-1795.186] -- 0:05:46
55000 -- (-1800.418) (-1792.999) [-1799.567] (-1795.434) * (-1794.884) (-1790.708) (-1791.341) [-1791.438] -- 0:05:43
Average standard deviation of split frequencies: 0.023383
55500 -- (-1797.191) [-1798.181] (-1805.441) (-1792.689) * (-1795.739) (-1798.264) (-1795.690) [-1791.290] -- 0:05:40
56000 -- (-1803.202) [-1792.984] (-1799.122) (-1789.111) * (-1800.872) (-1800.461) (-1796.503) [-1792.777] -- 0:05:37
56500 -- (-1796.452) (-1795.925) [-1796.429] (-1790.195) * (-1799.305) [-1793.784] (-1798.552) (-1789.313) -- 0:05:33
57000 -- (-1798.754) (-1799.172) [-1799.087] (-1797.963) * (-1793.278) (-1800.529) (-1794.878) [-1787.558] -- 0:05:47
57500 -- (-1807.053) (-1791.116) (-1801.810) [-1794.367] * (-1792.403) (-1789.190) (-1799.107) [-1791.323] -- 0:05:44
58000 -- [-1794.657] (-1800.407) (-1794.651) (-1792.739) * (-1791.906) (-1814.999) (-1798.467) [-1790.979] -- 0:05:41
58500 -- [-1804.696] (-1798.532) (-1794.780) (-1793.403) * (-1796.314) (-1792.013) [-1794.399] (-1800.999) -- 0:05:37
59000 -- (-1797.611) (-1790.110) [-1794.902] (-1797.150) * (-1803.616) [-1799.922] (-1801.350) (-1802.950) -- 0:05:34
59500 -- (-1794.245) (-1788.512) (-1798.404) [-1795.498] * (-1793.326) [-1789.209] (-1804.810) (-1793.892) -- 0:05:31
60000 -- [-1791.582] (-1794.229) (-1800.845) (-1793.600) * (-1797.087) (-1796.245) [-1803.179] (-1800.078) -- 0:05:44
Average standard deviation of split frequencies: 0.021584
60500 -- (-1790.650) [-1792.525] (-1796.287) (-1794.649) * (-1793.916) (-1801.432) (-1797.481) [-1790.286] -- 0:05:41
61000 -- (-1809.577) (-1791.748) [-1804.264] (-1794.895) * (-1787.750) (-1799.313) (-1798.824) [-1788.540] -- 0:05:38
61500 -- (-1790.463) (-1796.094) (-1802.862) [-1795.131] * (-1799.098) (-1793.426) (-1802.521) [-1794.362] -- 0:05:35
62000 -- (-1795.759) (-1795.197) [-1796.207] (-1793.295) * (-1811.212) (-1801.222) [-1798.013] (-1788.577) -- 0:05:32
62500 -- (-1798.267) (-1791.760) [-1788.337] (-1791.588) * (-1795.902) (-1801.814) [-1800.153] (-1794.190) -- 0:05:45
63000 -- (-1805.238) (-1791.312) [-1794.673] (-1797.866) * [-1791.205] (-1801.490) (-1792.746) (-1787.777) -- 0:05:42
63500 -- (-1795.450) (-1806.036) [-1790.782] (-1794.675) * (-1793.554) (-1793.987) (-1793.961) [-1796.887] -- 0:05:39
64000 -- (-1800.005) (-1798.280) (-1792.014) [-1798.985] * (-1799.057) (-1804.150) (-1803.573) [-1796.432] -- 0:05:36
64500 -- (-1793.287) (-1795.590) (-1795.384) [-1798.270] * [-1791.182] (-1793.447) (-1802.359) (-1789.076) -- 0:05:33
65000 -- (-1798.816) [-1792.883] (-1799.950) (-1801.992) * [-1791.813] (-1797.398) (-1804.427) (-1792.361) -- 0:05:30
Average standard deviation of split frequencies: 0.025396
65500 -- (-1798.332) [-1803.893] (-1796.511) (-1804.840) * (-1800.947) [-1799.256] (-1799.558) (-1801.310) -- 0:05:42
66000 -- [-1793.631] (-1800.357) (-1802.305) (-1797.734) * (-1800.506) (-1795.472) [-1803.872] (-1795.327) -- 0:05:39
66500 -- [-1791.042] (-1803.546) (-1801.787) (-1794.181) * [-1798.801] (-1788.335) (-1809.446) (-1791.572) -- 0:05:36
67000 -- (-1796.576) (-1792.351) [-1790.944] (-1790.538) * (-1797.323) (-1791.645) [-1797.976] (-1791.707) -- 0:05:34
67500 -- [-1793.872] (-1796.747) (-1793.834) (-1790.794) * [-1787.440] (-1797.963) (-1804.433) (-1790.217) -- 0:05:31
68000 -- (-1797.641) [-1791.302] (-1795.303) (-1796.378) * (-1806.896) (-1797.726) (-1800.420) [-1789.235] -- 0:05:42
68500 -- (-1799.352) [-1793.467] (-1792.282) (-1804.362) * [-1791.761] (-1797.731) (-1792.229) (-1793.808) -- 0:05:39
69000 -- [-1800.099] (-1798.187) (-1794.569) (-1793.732) * [-1794.095] (-1796.783) (-1805.929) (-1788.498) -- 0:05:37
69500 -- (-1797.919) [-1792.830] (-1794.967) (-1796.175) * [-1794.166] (-1790.950) (-1802.824) (-1794.726) -- 0:05:34
70000 -- [-1799.428] (-1799.861) (-1793.867) (-1791.887) * [-1791.002] (-1796.493) (-1804.275) (-1801.593) -- 0:05:32
Average standard deviation of split frequencies: 0.031872
70500 -- (-1798.147) (-1794.093) (-1799.956) [-1789.001] * (-1792.673) [-1794.966] (-1808.342) (-1797.422) -- 0:05:29
71000 -- (-1798.165) (-1798.848) (-1795.886) [-1790.266] * (-1796.453) (-1789.548) (-1798.258) [-1793.781] -- 0:05:40
71500 -- [-1793.617] (-1801.988) (-1794.012) (-1797.590) * [-1793.774] (-1788.253) (-1789.352) (-1804.924) -- 0:05:37
72000 -- [-1793.257] (-1798.414) (-1796.805) (-1794.039) * (-1801.832) (-1794.616) (-1790.508) [-1788.252] -- 0:05:35
72500 -- [-1795.311] (-1802.881) (-1791.266) (-1790.679) * (-1794.926) (-1794.140) (-1793.539) [-1788.113] -- 0:05:32
73000 -- (-1801.071) (-1805.570) (-1791.453) [-1787.520] * (-1798.279) (-1790.281) [-1789.791] (-1797.235) -- 0:05:30
73500 -- [-1791.437] (-1805.847) (-1797.233) (-1794.282) * (-1794.503) (-1789.502) (-1799.354) [-1788.075] -- 0:05:27
74000 -- (-1793.673) [-1797.914] (-1805.172) (-1790.487) * (-1795.969) (-1792.019) (-1791.456) [-1786.799] -- 0:05:37
74500 -- [-1790.540] (-1795.114) (-1793.405) (-1798.928) * (-1806.708) (-1787.928) [-1792.275] (-1791.509) -- 0:05:35
75000 -- (-1795.905) (-1796.799) (-1801.230) [-1787.990] * (-1813.643) (-1795.819) [-1796.388] (-1798.110) -- 0:05:33
Average standard deviation of split frequencies: 0.027568
75500 -- [-1796.316] (-1791.237) (-1792.188) (-1798.575) * (-1791.812) [-1792.422] (-1789.644) (-1790.518) -- 0:05:30
76000 -- (-1791.942) (-1794.367) [-1788.624] (-1794.635) * (-1795.468) (-1792.877) (-1791.234) [-1791.872] -- 0:05:28
76500 -- [-1789.517] (-1792.884) (-1800.144) (-1800.454) * (-1795.428) (-1797.488) (-1789.299) [-1792.267] -- 0:05:38
77000 -- (-1791.540) (-1800.761) [-1801.619] (-1802.180) * (-1793.381) [-1789.870] (-1795.489) (-1794.403) -- 0:05:35
77500 -- [-1790.887] (-1794.587) (-1804.652) (-1797.714) * (-1794.622) (-1797.303) (-1790.834) [-1792.820] -- 0:05:33
78000 -- (-1795.349) [-1794.663] (-1804.261) (-1799.172) * (-1794.177) [-1800.904] (-1799.560) (-1801.152) -- 0:05:30
78500 -- (-1790.188) [-1790.595] (-1809.311) (-1799.433) * [-1795.709] (-1794.008) (-1792.794) (-1807.636) -- 0:05:28
79000 -- (-1787.708) [-1793.620] (-1802.551) (-1797.353) * (-1796.874) [-1797.931] (-1795.061) (-1790.242) -- 0:05:26
79500 -- [-1790.038] (-1789.515) (-1802.941) (-1801.668) * (-1799.214) (-1798.648) (-1795.125) [-1793.316] -- 0:05:35
80000 -- [-1790.986] (-1797.159) (-1798.616) (-1803.048) * (-1800.508) (-1802.491) [-1789.213] (-1798.830) -- 0:05:33
Average standard deviation of split frequencies: 0.024674
80500 -- [-1785.954] (-1795.185) (-1800.344) (-1799.488) * [-1795.802] (-1797.935) (-1803.645) (-1808.987) -- 0:05:31
81000 -- [-1796.465] (-1805.397) (-1800.007) (-1793.465) * [-1794.578] (-1793.354) (-1790.937) (-1792.910) -- 0:05:29
81500 -- [-1797.701] (-1796.462) (-1811.395) (-1802.449) * [-1792.369] (-1792.019) (-1790.742) (-1795.192) -- 0:05:26
82000 -- (-1793.324) (-1794.724) (-1792.377) [-1798.006] * (-1799.449) [-1793.371] (-1793.911) (-1801.823) -- 0:05:35
82500 -- (-1809.945) (-1796.357) [-1794.245] (-1797.244) * (-1804.778) (-1787.221) (-1794.261) [-1796.504] -- 0:05:33
83000 -- (-1803.832) (-1791.016) (-1799.279) [-1794.959] * (-1798.850) (-1800.386) (-1796.137) [-1790.118] -- 0:05:31
83500 -- (-1805.715) (-1797.470) [-1794.374] (-1796.608) * (-1797.019) (-1789.043) (-1804.885) [-1789.170] -- 0:05:29
84000 -- (-1799.170) (-1799.957) [-1789.091] (-1797.005) * (-1796.790) (-1802.874) (-1804.931) [-1789.664] -- 0:05:27
84500 -- [-1791.871] (-1807.576) (-1790.415) (-1796.678) * (-1794.505) (-1797.700) (-1792.708) [-1790.265] -- 0:05:35
85000 -- (-1794.403) [-1791.416] (-1799.712) (-1801.190) * [-1790.737] (-1799.890) (-1803.865) (-1793.359) -- 0:05:33
Average standard deviation of split frequencies: 0.028625
85500 -- (-1791.050) (-1798.010) (-1791.169) [-1795.980] * [-1792.769] (-1793.745) (-1792.119) (-1790.303) -- 0:05:31
86000 -- [-1799.831] (-1798.770) (-1791.671) (-1796.057) * (-1788.950) (-1801.397) [-1792.027] (-1792.501) -- 0:05:29
86500 -- [-1795.638] (-1796.495) (-1796.750) (-1796.787) * (-1793.557) (-1793.297) [-1793.634] (-1799.264) -- 0:05:27
87000 -- (-1793.866) (-1804.452) [-1787.565] (-1811.489) * (-1794.157) (-1795.987) (-1797.397) [-1797.264] -- 0:05:35
87500 -- (-1792.397) [-1792.884] (-1797.819) (-1795.804) * (-1793.644) (-1802.432) (-1794.740) [-1794.653] -- 0:05:33
88000 -- [-1794.392] (-1792.707) (-1794.321) (-1805.212) * [-1796.399] (-1793.676) (-1797.591) (-1790.983) -- 0:05:31
88500 -- [-1795.295] (-1803.204) (-1795.825) (-1794.284) * (-1793.907) (-1793.035) [-1790.842] (-1797.529) -- 0:05:29
89000 -- (-1805.012) (-1791.014) [-1800.005] (-1795.347) * (-1797.424) (-1796.220) [-1790.891] (-1802.303) -- 0:05:27
89500 -- (-1798.557) (-1799.394) (-1808.049) [-1790.779] * (-1796.748) [-1793.062] (-1792.227) (-1789.762) -- 0:05:25
90000 -- (-1803.808) (-1799.976) (-1805.089) [-1795.423] * (-1801.512) (-1806.182) (-1801.243) [-1789.622] -- 0:05:33
Average standard deviation of split frequencies: 0.020220
90500 -- (-1818.405) [-1791.837] (-1792.894) (-1797.742) * (-1802.028) (-1790.638) (-1802.433) [-1798.172] -- 0:05:31
91000 -- (-1807.847) (-1789.850) (-1795.575) [-1788.265] * (-1800.647) [-1790.986] (-1803.120) (-1793.434) -- 0:05:29
91500 -- (-1798.300) (-1801.763) [-1788.334] (-1789.052) * (-1801.201) (-1790.647) [-1797.623] (-1791.460) -- 0:05:27
92000 -- (-1805.906) [-1791.062] (-1794.905) (-1799.168) * (-1800.901) [-1789.991] (-1800.322) (-1799.120) -- 0:05:25
92500 -- (-1801.939) [-1792.625] (-1792.455) (-1802.260) * (-1799.320) [-1792.632] (-1804.372) (-1791.041) -- 0:05:33
93000 -- (-1802.193) (-1793.666) [-1790.485] (-1796.508) * (-1799.002) (-1790.369) [-1806.328] (-1796.265) -- 0:05:31
93500 -- (-1794.106) (-1792.151) [-1798.772] (-1793.552) * (-1801.940) (-1798.786) (-1807.642) [-1791.008] -- 0:05:29
94000 -- (-1794.395) [-1800.614] (-1798.209) (-1796.028) * (-1799.265) [-1800.378] (-1798.970) (-1792.912) -- 0:05:27
94500 -- (-1798.130) (-1789.935) [-1789.683] (-1798.187) * (-1799.346) [-1789.129] (-1797.068) (-1791.507) -- 0:05:25
95000 -- (-1795.377) [-1794.683] (-1809.573) (-1801.332) * [-1797.839] (-1792.661) (-1797.175) (-1794.405) -- 0:05:23
Average standard deviation of split frequencies: 0.014186
95500 -- (-1792.982) (-1790.887) [-1787.315] (-1795.881) * (-1796.172) (-1793.362) (-1790.610) [-1792.926] -- 0:05:31
96000 -- [-1788.215] (-1791.744) (-1797.256) (-1796.461) * (-1796.793) (-1800.754) (-1796.276) [-1796.264] -- 0:05:29
96500 -- [-1793.259] (-1801.800) (-1796.410) (-1796.469) * [-1791.517] (-1795.737) (-1787.633) (-1799.113) -- 0:05:27
97000 -- (-1792.531) (-1798.218) [-1791.934] (-1797.880) * (-1799.089) [-1790.203] (-1793.280) (-1800.352) -- 0:05:25
97500 -- (-1793.447) (-1796.106) (-1800.894) [-1787.678] * (-1808.278) (-1796.162) [-1790.861] (-1802.152) -- 0:05:23
98000 -- (-1793.690) [-1802.168] (-1791.914) (-1794.089) * [-1804.221] (-1802.664) (-1787.824) (-1802.351) -- 0:05:22
98500 -- (-1792.844) (-1786.881) [-1796.667] (-1804.536) * (-1797.310) [-1789.271] (-1794.959) (-1804.339) -- 0:05:29
99000 -- [-1789.758] (-1797.890) (-1802.485) (-1802.748) * [-1795.315] (-1792.724) (-1795.562) (-1796.676) -- 0:05:27
99500 -- [-1792.729] (-1797.926) (-1803.022) (-1799.279) * (-1795.162) (-1801.053) (-1796.157) [-1794.856] -- 0:05:25
100000 -- (-1790.830) (-1796.807) (-1804.543) [-1793.515] * (-1788.885) (-1791.909) (-1789.284) [-1796.375] -- 0:05:24
Average standard deviation of split frequencies: 0.016130
100500 -- (-1804.211) [-1794.113] (-1794.782) (-1799.270) * (-1792.236) [-1792.687] (-1794.320) (-1794.834) -- 0:05:22
101000 -- (-1795.720) [-1797.372] (-1807.451) (-1790.000) * (-1794.212) [-1797.270] (-1804.123) (-1791.453) -- 0:05:29
101500 -- (-1791.493) [-1800.152] (-1793.593) (-1789.222) * (-1798.142) (-1793.788) [-1789.054] (-1799.740) -- 0:05:27
102000 -- (-1800.757) (-1791.304) [-1796.124] (-1794.828) * (-1797.793) (-1791.113) [-1796.510] (-1797.378) -- 0:05:25
102500 -- (-1803.310) (-1796.997) (-1795.875) [-1793.259] * (-1809.208) [-1790.749] (-1795.169) (-1794.971) -- 0:05:23
103000 -- (-1795.608) (-1794.053) (-1795.995) [-1789.151] * (-1805.198) [-1794.933] (-1793.622) (-1801.271) -- 0:05:22
103500 -- (-1798.482) [-1789.607] (-1795.120) (-1796.133) * (-1787.618) (-1790.416) (-1796.723) [-1795.510] -- 0:05:20
104000 -- (-1798.087) (-1797.043) [-1796.755] (-1794.305) * (-1797.620) (-1796.451) (-1789.057) [-1801.197] -- 0:05:27
104500 -- (-1794.166) [-1793.324] (-1795.325) (-1803.021) * [-1787.144] (-1794.330) (-1808.917) (-1800.303) -- 0:05:25
105000 -- (-1796.167) [-1793.279] (-1793.563) (-1800.354) * (-1803.653) (-1795.235) (-1801.793) [-1787.591] -- 0:05:23
Average standard deviation of split frequencies: 0.020260
105500 -- (-1795.724) (-1798.185) [-1793.561] (-1794.464) * (-1803.942) [-1792.592] (-1789.881) (-1794.953) -- 0:05:22
106000 -- (-1798.952) (-1804.247) (-1799.693) [-1799.803] * (-1791.503) (-1791.548) (-1798.049) [-1794.079] -- 0:05:20
106500 -- [-1796.017] (-1793.114) (-1798.512) (-1806.365) * (-1799.985) [-1797.380] (-1798.082) (-1798.255) -- 0:05:27
107000 -- (-1798.572) [-1785.802] (-1793.167) (-1795.776) * [-1794.546] (-1796.178) (-1799.171) (-1792.757) -- 0:05:25
107500 -- (-1797.098) [-1794.489] (-1794.337) (-1803.059) * (-1793.711) [-1798.458] (-1802.340) (-1789.827) -- 0:05:23
108000 -- (-1797.698) (-1796.519) [-1788.157] (-1794.421) * (-1803.081) (-1797.562) [-1795.051] (-1793.473) -- 0:05:22
108500 -- (-1794.116) [-1799.123] (-1796.860) (-1795.224) * [-1793.288] (-1789.720) (-1791.748) (-1797.885) -- 0:05:20
109000 -- (-1799.131) (-1792.188) [-1789.235] (-1791.221) * (-1798.750) [-1792.624] (-1794.969) (-1794.107) -- 0:05:18
109500 -- (-1799.672) (-1803.469) [-1791.469] (-1796.998) * [-1790.293] (-1789.815) (-1792.423) (-1797.032) -- 0:05:25
110000 -- (-1797.121) [-1795.304] (-1796.928) (-1789.680) * [-1789.728] (-1795.958) (-1795.494) (-1798.037) -- 0:05:23
Average standard deviation of split frequencies: 0.022718
110500 -- (-1802.095) (-1793.075) (-1795.884) [-1791.775] * [-1795.566] (-1788.280) (-1795.641) (-1799.225) -- 0:05:21
111000 -- [-1792.051] (-1793.716) (-1792.644) (-1793.944) * (-1802.275) (-1792.967) (-1794.700) [-1799.077] -- 0:05:20
111500 -- (-1795.853) [-1788.807] (-1787.928) (-1796.970) * (-1804.729) (-1794.776) (-1808.233) [-1795.189] -- 0:05:18
112000 -- (-1794.753) [-1785.839] (-1800.936) (-1795.193) * (-1799.075) (-1793.706) (-1801.668) [-1790.254] -- 0:05:25
112500 -- (-1795.133) [-1802.117] (-1797.385) (-1804.009) * (-1797.684) (-1792.834) (-1797.811) [-1789.178] -- 0:05:23
113000 -- (-1795.730) (-1793.698) (-1795.331) [-1790.101] * (-1799.901) (-1793.463) (-1794.296) [-1790.302] -- 0:05:21
113500 -- (-1794.378) (-1795.937) (-1790.377) [-1789.998] * (-1798.837) (-1793.111) (-1798.424) [-1796.974] -- 0:05:20
114000 -- [-1788.536] (-1795.409) (-1803.639) (-1787.026) * [-1792.205] (-1794.084) (-1804.671) (-1793.693) -- 0:05:18
114500 -- [-1795.921] (-1793.033) (-1799.121) (-1800.415) * (-1801.112) [-1794.647] (-1793.581) (-1790.859) -- 0:05:17
115000 -- (-1794.339) (-1799.022) [-1796.860] (-1789.559) * (-1793.768) [-1792.586] (-1796.582) (-1795.255) -- 0:05:23
Average standard deviation of split frequencies: 0.021222
115500 -- (-1800.861) (-1798.732) [-1794.540] (-1801.046) * (-1792.892) [-1791.017] (-1796.961) (-1797.538) -- 0:05:21
116000 -- [-1793.608] (-1799.100) (-1788.353) (-1792.726) * (-1794.690) (-1796.518) (-1799.480) [-1797.453] -- 0:05:20
116500 -- [-1796.816] (-1791.934) (-1795.026) (-1797.942) * (-1810.679) [-1791.623] (-1800.131) (-1801.332) -- 0:05:18
117000 -- (-1797.420) (-1797.943) [-1794.260] (-1798.564) * (-1800.061) (-1801.940) (-1798.780) [-1792.555] -- 0:05:16
117500 -- (-1792.139) [-1791.805] (-1790.387) (-1790.075) * (-1797.350) [-1791.467] (-1792.895) (-1794.211) -- 0:05:22
118000 -- (-1796.730) [-1791.129] (-1796.229) (-1795.583) * [-1797.859] (-1801.721) (-1798.157) (-1795.251) -- 0:05:21
118500 -- (-1790.735) [-1799.153] (-1793.768) (-1801.552) * (-1799.690) (-1793.854) (-1801.180) [-1792.949] -- 0:05:19
119000 -- (-1795.842) (-1797.122) (-1795.888) [-1791.003] * [-1793.671] (-1789.769) (-1794.151) (-1793.820) -- 0:05:18
119500 -- [-1788.248] (-1794.917) (-1796.334) (-1811.230) * (-1803.739) [-1793.996] (-1797.406) (-1794.824) -- 0:05:16
120000 -- (-1798.783) (-1797.010) [-1790.215] (-1791.552) * (-1796.087) (-1794.940) [-1787.985] (-1801.624) -- 0:05:15
Average standard deviation of split frequencies: 0.021704
120500 -- (-1794.205) [-1797.110] (-1793.303) (-1797.757) * (-1799.334) (-1801.180) (-1789.399) [-1797.025] -- 0:05:21
121000 -- (-1794.188) (-1799.397) [-1789.964] (-1798.311) * (-1791.933) (-1795.206) (-1795.866) [-1789.163] -- 0:05:19
121500 -- (-1791.362) [-1799.347] (-1792.111) (-1794.512) * (-1793.495) [-1806.541] (-1796.734) (-1792.668) -- 0:05:18
122000 -- (-1799.356) (-1797.144) (-1795.578) [-1792.128] * (-1795.586) (-1794.584) (-1805.392) [-1801.042] -- 0:05:16
122500 -- (-1797.949) (-1791.719) [-1794.942] (-1791.176) * [-1793.975] (-1795.956) (-1796.205) (-1793.855) -- 0:05:15
123000 -- (-1798.626) (-1792.875) (-1798.614) [-1788.336] * (-1799.330) (-1791.116) [-1794.010] (-1789.557) -- 0:05:13
123500 -- (-1797.745) (-1792.127) (-1803.825) [-1791.308] * (-1801.472) (-1793.564) (-1790.920) [-1792.361] -- 0:05:19
124000 -- [-1788.548] (-1789.129) (-1791.233) (-1796.429) * (-1810.166) [-1790.546] (-1796.567) (-1802.992) -- 0:05:17
124500 -- (-1787.135) [-1801.795] (-1795.045) (-1795.955) * [-1793.300] (-1791.124) (-1790.460) (-1796.723) -- 0:05:16
125000 -- [-1790.263] (-1804.695) (-1796.016) (-1811.355) * [-1796.500] (-1792.357) (-1792.171) (-1799.606) -- 0:05:15
Average standard deviation of split frequencies: 0.021201
125500 -- (-1792.701) (-1804.431) [-1793.683] (-1790.865) * (-1798.381) (-1801.719) [-1788.699] (-1796.223) -- 0:05:13
126000 -- (-1797.005) (-1802.163) [-1797.844] (-1793.551) * (-1809.522) (-1794.698) [-1795.807] (-1787.940) -- 0:05:19
126500 -- (-1792.633) (-1798.116) [-1795.896] (-1796.151) * (-1793.783) (-1796.901) [-1793.023] (-1792.319) -- 0:05:17
127000 -- [-1786.651] (-1796.172) (-1796.422) (-1793.645) * (-1798.490) [-1799.278] (-1796.084) (-1800.510) -- 0:05:16
127500 -- (-1792.639) (-1808.600) [-1795.994] (-1799.196) * (-1794.000) (-1798.548) [-1794.850] (-1800.860) -- 0:05:14
128000 -- (-1806.466) (-1801.179) [-1791.456] (-1802.006) * [-1790.655] (-1800.650) (-1797.714) (-1800.912) -- 0:05:13
128500 -- (-1796.879) (-1804.467) (-1795.252) [-1797.054] * (-1796.044) (-1797.861) [-1796.034] (-1802.575) -- 0:05:11
129000 -- (-1798.437) (-1797.477) [-1799.710] (-1794.941) * [-1802.742] (-1796.037) (-1797.826) (-1796.471) -- 0:05:17
129500 -- (-1796.423) (-1802.978) [-1807.472] (-1796.018) * (-1795.739) (-1803.447) [-1791.235] (-1793.179) -- 0:05:15
130000 -- (-1796.630) [-1796.195] (-1808.150) (-1799.339) * (-1789.989) (-1793.983) [-1800.852] (-1791.240) -- 0:05:14
Average standard deviation of split frequencies: 0.018840
130500 -- (-1802.409) (-1799.146) [-1793.569] (-1799.287) * (-1790.198) [-1795.330] (-1796.639) (-1799.863) -- 0:05:13
131000 -- (-1797.475) (-1798.972) (-1801.904) [-1792.360] * (-1790.353) (-1799.719) [-1790.106] (-1797.396) -- 0:05:11
131500 -- (-1788.804) (-1803.340) [-1807.023] (-1798.084) * (-1792.031) (-1789.675) (-1795.334) [-1789.743] -- 0:05:17
132000 -- (-1796.169) (-1806.499) (-1801.285) [-1792.793] * [-1789.937] (-1798.326) (-1798.444) (-1790.237) -- 0:05:15
132500 -- (-1797.554) (-1806.382) [-1794.052] (-1796.913) * (-1798.813) [-1792.273] (-1799.967) (-1797.373) -- 0:05:14
133000 -- [-1797.884] (-1794.981) (-1800.429) (-1795.228) * (-1790.342) (-1789.751) [-1792.878] (-1792.190) -- 0:05:12
133500 -- (-1811.545) (-1793.094) [-1792.029] (-1799.206) * (-1795.852) (-1797.742) [-1797.550] (-1799.999) -- 0:05:11
134000 -- (-1795.521) (-1797.989) [-1794.408] (-1798.191) * (-1789.552) [-1795.348] (-1801.100) (-1792.798) -- 0:05:10
134500 -- [-1794.739] (-1810.215) (-1794.745) (-1796.551) * [-1786.310] (-1808.270) (-1800.511) (-1805.040) -- 0:05:15
135000 -- [-1793.726] (-1792.719) (-1802.788) (-1792.350) * (-1801.327) [-1796.032] (-1786.847) (-1796.219) -- 0:05:13
Average standard deviation of split frequencies: 0.018486
135500 -- [-1793.169] (-1792.663) (-1805.030) (-1793.788) * (-1805.728) [-1787.092] (-1798.867) (-1787.596) -- 0:05:12
136000 -- (-1795.198) (-1800.442) [-1798.592] (-1794.770) * (-1793.568) (-1797.077) (-1792.570) [-1800.728] -- 0:05:11
136500 -- [-1792.722] (-1800.795) (-1805.153) (-1787.587) * [-1794.770] (-1787.062) (-1795.356) (-1789.230) -- 0:05:09
137000 -- (-1795.404) (-1795.394) [-1797.311] (-1789.057) * (-1801.876) (-1795.274) (-1793.213) [-1787.119] -- 0:05:14
137500 -- (-1794.293) (-1794.699) [-1797.993] (-1798.651) * [-1804.390] (-1798.157) (-1794.167) (-1794.645) -- 0:05:13
138000 -- (-1796.973) (-1795.701) [-1797.852] (-1794.599) * (-1793.818) (-1798.103) [-1793.409] (-1797.966) -- 0:05:12
138500 -- (-1798.099) [-1790.890] (-1794.063) (-1789.538) * [-1794.157] (-1797.648) (-1797.851) (-1801.470) -- 0:05:11
139000 -- (-1792.996) (-1793.241) (-1793.802) [-1788.265] * [-1792.026] (-1796.249) (-1803.006) (-1798.408) -- 0:05:09
139500 -- [-1788.373] (-1797.598) (-1792.565) (-1797.952) * (-1792.848) (-1791.300) (-1802.789) [-1788.957] -- 0:05:08
140000 -- [-1788.760] (-1789.040) (-1798.039) (-1796.739) * (-1805.796) [-1795.654] (-1804.307) (-1797.292) -- 0:05:13
Average standard deviation of split frequencies: 0.014894
140500 -- (-1796.013) [-1798.599] (-1796.564) (-1804.847) * (-1799.283) (-1790.483) (-1795.241) [-1792.583] -- 0:05:11
141000 -- (-1795.142) (-1797.222) (-1796.094) [-1794.367] * [-1795.263] (-1791.690) (-1805.130) (-1788.297) -- 0:05:10
141500 -- (-1794.284) [-1792.284] (-1790.595) (-1791.967) * (-1793.395) (-1794.279) (-1798.961) [-1793.939] -- 0:05:09
142000 -- (-1795.587) (-1796.931) [-1787.387] (-1797.784) * (-1800.633) [-1793.331] (-1797.062) (-1796.533) -- 0:05:08
142500 -- [-1793.750] (-1798.455) (-1806.825) (-1798.438) * (-1797.878) (-1790.595) (-1805.639) [-1794.012] -- 0:05:12
143000 -- (-1791.572) (-1801.039) (-1813.351) [-1800.579] * (-1796.833) (-1800.345) (-1800.215) [-1792.726] -- 0:05:11
143500 -- (-1794.110) [-1796.664] (-1800.768) (-1802.086) * (-1794.396) [-1791.134] (-1791.729) (-1798.336) -- 0:05:10
144000 -- [-1794.748] (-1795.995) (-1790.800) (-1799.896) * (-1791.879) (-1791.143) (-1800.362) [-1790.812] -- 0:05:09
144500 -- (-1802.856) (-1803.452) (-1789.680) [-1799.761] * (-1786.058) (-1792.844) [-1797.666] (-1797.030) -- 0:05:07
145000 -- [-1793.186] (-1794.372) (-1794.962) (-1793.188) * (-1794.213) (-1793.769) (-1797.016) [-1786.749] -- 0:05:06
Average standard deviation of split frequencies: 0.016503
145500 -- (-1792.933) (-1798.623) (-1794.450) [-1788.131] * (-1791.282) (-1795.729) (-1793.768) [-1791.633] -- 0:05:11
146000 -- (-1792.625) (-1800.009) [-1792.946] (-1792.946) * [-1790.230] (-1801.600) (-1799.557) (-1790.247) -- 0:05:10
146500 -- (-1798.615) (-1797.859) [-1790.405] (-1800.182) * (-1799.380) (-1794.711) [-1801.309] (-1800.309) -- 0:05:08
147000 -- (-1792.201) (-1804.016) (-1793.760) [-1794.425] * (-1800.519) (-1789.702) [-1801.090] (-1792.251) -- 0:05:07
147500 -- [-1788.083] (-1801.149) (-1798.608) (-1796.476) * (-1792.277) (-1794.148) (-1789.373) [-1793.237] -- 0:05:06
148000 -- [-1792.964] (-1802.553) (-1794.042) (-1793.898) * (-1789.708) (-1796.847) [-1796.155] (-1801.438) -- 0:05:05
148500 -- [-1792.754] (-1800.224) (-1793.111) (-1803.861) * [-1799.590] (-1798.817) (-1797.230) (-1798.854) -- 0:05:09
149000 -- (-1801.551) (-1797.205) [-1790.252] (-1800.354) * (-1797.631) [-1791.480] (-1806.363) (-1799.242) -- 0:05:08
149500 -- [-1803.347] (-1801.257) (-1798.094) (-1798.469) * (-1797.103) (-1801.009) (-1796.811) [-1799.480] -- 0:05:07
150000 -- (-1801.249) [-1795.362] (-1796.533) (-1798.603) * [-1798.488] (-1795.322) (-1794.579) (-1795.243) -- 0:05:06
Average standard deviation of split frequencies: 0.016687
150500 -- (-1809.062) (-1799.642) [-1791.013] (-1788.815) * (-1793.464) (-1792.429) (-1796.410) [-1794.311] -- 0:05:04
151000 -- (-1796.640) [-1795.012] (-1787.275) (-1794.582) * (-1790.806) (-1800.242) (-1800.418) [-1793.124] -- 0:05:09
151500 -- (-1800.410) (-1796.985) (-1791.693) [-1793.130] * [-1794.783] (-1794.066) (-1800.015) (-1793.531) -- 0:05:08
152000 -- [-1793.883] (-1800.422) (-1792.677) (-1805.499) * (-1792.396) [-1790.019] (-1799.593) (-1796.021) -- 0:05:06
152500 -- [-1789.444] (-1799.026) (-1791.805) (-1793.390) * (-1794.419) (-1794.463) (-1795.179) [-1798.668] -- 0:05:05
153000 -- (-1796.757) (-1794.192) (-1796.536) [-1790.940] * (-1793.608) [-1798.543] (-1795.261) (-1800.973) -- 0:05:04
153500 -- (-1795.768) (-1793.886) [-1798.380] (-1806.520) * (-1796.285) [-1800.882] (-1797.542) (-1797.197) -- 0:05:03
154000 -- [-1791.172] (-1794.758) (-1797.451) (-1795.462) * [-1793.659] (-1796.226) (-1791.561) (-1799.737) -- 0:05:07
154500 -- (-1789.656) (-1793.651) [-1794.743] (-1789.663) * [-1798.714] (-1786.481) (-1798.832) (-1794.130) -- 0:05:06
155000 -- [-1798.576] (-1805.627) (-1791.351) (-1801.665) * [-1793.180] (-1793.401) (-1804.189) (-1800.964) -- 0:05:05
Average standard deviation of split frequencies: 0.017124
155500 -- (-1789.978) (-1796.017) [-1793.552] (-1795.489) * (-1803.703) [-1793.842] (-1806.091) (-1791.641) -- 0:05:04
156000 -- (-1797.592) [-1792.853] (-1795.874) (-1804.576) * (-1793.603) [-1791.531] (-1795.305) (-1798.383) -- 0:05:02
156500 -- (-1791.252) (-1791.409) [-1786.935] (-1810.200) * (-1795.576) (-1794.699) (-1788.715) [-1798.242] -- 0:05:07
157000 -- [-1792.228] (-1798.118) (-1791.834) (-1797.023) * (-1805.537) (-1791.630) (-1797.595) [-1802.734] -- 0:05:06
157500 -- (-1803.446) [-1793.087] (-1790.113) (-1801.184) * [-1794.674] (-1795.136) (-1794.745) (-1793.555) -- 0:05:04
158000 -- (-1796.205) (-1793.120) [-1792.615] (-1793.826) * (-1795.524) [-1807.429] (-1794.651) (-1802.873) -- 0:05:03
158500 -- (-1794.108) (-1794.522) [-1790.997] (-1798.742) * [-1792.896] (-1791.636) (-1784.546) (-1796.971) -- 0:05:02
159000 -- (-1792.029) (-1801.358) [-1784.032] (-1796.197) * [-1792.696] (-1798.411) (-1791.962) (-1798.482) -- 0:05:01
159500 -- (-1798.755) (-1789.466) [-1790.880] (-1803.819) * [-1794.112] (-1791.955) (-1795.076) (-1803.056) -- 0:05:05
160000 -- (-1797.373) [-1795.222] (-1790.724) (-1798.174) * (-1793.978) [-1792.148] (-1805.076) (-1796.889) -- 0:05:04
Average standard deviation of split frequencies: 0.012388
160500 -- [-1794.495] (-1798.057) (-1798.069) (-1788.287) * (-1805.649) (-1804.401) (-1796.577) [-1794.907] -- 0:05:03
161000 -- (-1793.935) (-1796.137) [-1795.199] (-1795.267) * [-1790.992] (-1792.511) (-1797.451) (-1804.430) -- 0:05:02
161500 -- [-1790.253] (-1804.032) (-1796.572) (-1796.820) * [-1797.085] (-1797.653) (-1793.162) (-1803.168) -- 0:05:01
162000 -- (-1796.755) (-1804.531) (-1794.011) [-1793.219] * [-1795.458] (-1794.002) (-1804.362) (-1794.769) -- 0:05:05
162500 -- (-1795.257) (-1802.831) [-1787.035] (-1795.582) * (-1792.126) [-1790.505] (-1795.997) (-1795.059) -- 0:05:04
163000 -- [-1803.605] (-1797.584) (-1806.062) (-1795.407) * (-1797.736) [-1791.974] (-1792.205) (-1799.404) -- 0:05:02
163500 -- (-1800.230) [-1799.254] (-1803.291) (-1801.698) * (-1791.251) (-1803.057) [-1796.375] (-1801.906) -- 0:05:01
164000 -- [-1804.366] (-1795.816) (-1799.285) (-1799.556) * [-1796.723] (-1803.001) (-1803.027) (-1797.262) -- 0:05:00
164500 -- (-1799.128) [-1793.143] (-1796.309) (-1791.849) * [-1792.355] (-1821.323) (-1788.333) (-1795.335) -- 0:04:59
165000 -- [-1790.228] (-1804.482) (-1798.502) (-1798.922) * [-1795.313] (-1803.198) (-1804.686) (-1800.631) -- 0:05:03
Average standard deviation of split frequencies: 0.013883
165500 -- (-1797.151) (-1800.351) [-1798.047] (-1796.168) * (-1798.892) [-1800.098] (-1794.799) (-1788.621) -- 0:05:02
166000 -- (-1803.574) (-1794.113) (-1802.020) [-1795.214] * (-1797.225) (-1809.491) (-1797.241) [-1793.903] -- 0:05:01
166500 -- (-1797.945) [-1795.720] (-1792.302) (-1801.864) * (-1796.361) (-1806.815) [-1796.777] (-1794.916) -- 0:05:00
167000 -- (-1806.184) [-1787.966] (-1807.713) (-1793.513) * (-1801.482) [-1788.731] (-1801.594) (-1798.855) -- 0:04:59
167500 -- [-1796.458] (-1795.967) (-1798.499) (-1800.230) * (-1795.964) (-1790.742) (-1805.053) [-1793.618] -- 0:05:03
168000 -- (-1795.361) (-1796.116) [-1799.961] (-1793.493) * (-1793.795) [-1792.145] (-1787.030) (-1794.876) -- 0:05:02
168500 -- [-1790.443] (-1811.278) (-1798.966) (-1807.893) * (-1793.647) (-1795.484) (-1800.383) [-1789.337] -- 0:05:01
169000 -- [-1790.763] (-1807.283) (-1796.998) (-1803.994) * (-1794.446) (-1791.400) (-1800.734) [-1797.907] -- 0:04:59
169500 -- (-1795.169) (-1810.356) (-1797.241) [-1797.411] * (-1798.993) [-1800.207] (-1803.223) (-1794.376) -- 0:04:58
170000 -- (-1804.333) (-1796.938) (-1800.224) [-1789.460] * [-1798.006] (-1786.276) (-1801.456) (-1788.593) -- 0:04:57
Average standard deviation of split frequencies: 0.014118
170500 -- (-1800.204) [-1788.771] (-1798.242) (-1800.511) * (-1799.917) [-1792.440] (-1794.335) (-1798.680) -- 0:05:01
171000 -- (-1789.154) (-1794.310) (-1799.226) [-1801.718] * [-1791.679] (-1799.605) (-1794.488) (-1795.656) -- 0:05:00
171500 -- (-1795.673) [-1793.161] (-1790.513) (-1796.018) * (-1792.005) [-1793.046] (-1795.652) (-1796.445) -- 0:04:59
172000 -- (-1785.049) (-1791.691) [-1794.941] (-1798.506) * (-1795.185) (-1792.158) [-1789.738] (-1799.249) -- 0:04:58
172500 -- (-1790.769) (-1792.876) (-1813.650) [-1789.286] * (-1791.025) (-1796.622) [-1795.796] (-1806.894) -- 0:04:57
173000 -- (-1791.512) (-1789.126) [-1791.034] (-1803.810) * (-1790.918) (-1799.958) [-1789.297] (-1798.330) -- 0:05:01
173500 -- (-1795.732) [-1789.631] (-1795.560) (-1795.387) * [-1795.935] (-1800.450) (-1797.375) (-1803.330) -- 0:05:00
174000 -- (-1792.521) [-1792.671] (-1790.475) (-1792.527) * [-1799.606] (-1792.634) (-1793.540) (-1792.501) -- 0:04:59
174500 -- (-1806.946) (-1787.656) [-1791.860] (-1806.037) * (-1794.365) (-1792.836) [-1787.169] (-1792.102) -- 0:04:58
175000 -- [-1793.373] (-1790.695) (-1801.041) (-1800.010) * (-1800.084) [-1794.105] (-1800.293) (-1795.997) -- 0:04:57
Average standard deviation of split frequencies: 0.011904
175500 -- [-1790.869] (-1791.703) (-1788.394) (-1796.684) * (-1800.822) [-1793.257] (-1804.364) (-1792.645) -- 0:05:00
176000 -- (-1797.525) (-1806.771) [-1797.112] (-1794.347) * [-1791.432] (-1793.205) (-1797.027) (-1810.991) -- 0:04:59
176500 -- (-1792.050) (-1797.454) (-1806.489) [-1792.889] * (-1791.201) (-1802.745) [-1790.622] (-1796.426) -- 0:04:58
177000 -- [-1793.002] (-1804.524) (-1802.549) (-1798.660) * (-1795.348) (-1797.811) [-1791.405] (-1792.142) -- 0:04:57
177500 -- (-1792.233) [-1795.226] (-1792.713) (-1802.554) * [-1794.416] (-1798.660) (-1793.462) (-1801.201) -- 0:04:56
178000 -- (-1793.907) (-1803.614) [-1791.290] (-1795.353) * (-1789.823) (-1789.821) [-1789.736] (-1804.300) -- 0:05:00
178500 -- (-1793.361) (-1797.688) [-1794.199] (-1807.292) * [-1796.164] (-1799.703) (-1795.510) (-1792.445) -- 0:04:59
179000 -- (-1792.523) (-1804.173) (-1793.143) [-1790.742] * (-1801.856) (-1786.308) (-1803.378) [-1795.856] -- 0:04:58
179500 -- (-1786.997) (-1801.423) [-1792.980] (-1788.506) * [-1790.541] (-1798.035) (-1798.757) (-1796.223) -- 0:04:57
180000 -- (-1798.525) (-1805.441) (-1790.368) [-1798.626] * (-1801.857) [-1802.113] (-1794.802) (-1791.322) -- 0:04:56
Average standard deviation of split frequencies: 0.013046
180500 -- (-1798.000) (-1788.749) (-1791.694) [-1792.187] * (-1799.305) (-1798.259) (-1796.483) [-1800.580] -- 0:04:55
181000 -- (-1800.504) (-1792.000) (-1792.299) [-1793.632] * [-1792.268] (-1794.402) (-1793.396) (-1791.069) -- 0:04:58
181500 -- [-1799.380] (-1807.419) (-1796.799) (-1789.188) * (-1797.796) [-1789.652] (-1792.304) (-1792.495) -- 0:04:57
182000 -- (-1793.681) (-1804.283) [-1793.691] (-1798.590) * (-1796.175) (-1797.868) (-1795.728) [-1795.475] -- 0:04:56
182500 -- (-1792.619) (-1791.143) (-1795.103) [-1788.807] * (-1788.140) [-1792.606] (-1785.994) (-1799.959) -- 0:04:55
183000 -- [-1789.942] (-1789.880) (-1787.491) (-1797.727) * (-1792.208) [-1796.163] (-1793.510) (-1791.953) -- 0:04:54
183500 -- (-1794.362) (-1799.690) [-1787.320] (-1793.256) * [-1795.204] (-1790.274) (-1802.350) (-1793.458) -- 0:04:58
184000 -- (-1796.063) (-1798.408) [-1792.691] (-1795.731) * (-1801.586) [-1790.375] (-1798.578) (-1790.138) -- 0:04:57
184500 -- [-1795.242] (-1800.010) (-1792.672) (-1786.477) * (-1795.357) (-1794.299) [-1799.653] (-1796.420) -- 0:04:56
185000 -- (-1793.186) [-1790.426] (-1795.176) (-1790.912) * [-1791.044] (-1791.605) (-1789.854) (-1796.890) -- 0:04:55
Average standard deviation of split frequencies: 0.012109
185500 -- [-1791.110] (-1795.667) (-1791.479) (-1808.243) * (-1788.174) (-1798.899) [-1797.350] (-1802.196) -- 0:04:54
186000 -- (-1790.420) [-1789.401] (-1792.089) (-1804.635) * (-1797.133) (-1799.666) [-1797.208] (-1799.310) -- 0:04:53
186500 -- [-1800.939] (-1792.915) (-1786.113) (-1791.212) * [-1794.391] (-1802.647) (-1793.621) (-1800.394) -- 0:04:56
187000 -- (-1798.498) (-1795.849) [-1793.139] (-1792.736) * [-1795.391] (-1791.461) (-1794.376) (-1796.306) -- 0:04:55
187500 -- (-1796.544) [-1795.646] (-1798.003) (-1791.269) * (-1801.246) (-1786.529) [-1789.447] (-1798.264) -- 0:04:54
188000 -- [-1800.035] (-1802.367) (-1803.692) (-1790.401) * (-1794.421) [-1792.956] (-1793.546) (-1793.643) -- 0:04:53
188500 -- (-1790.908) (-1801.035) [-1798.782] (-1794.803) * [-1799.232] (-1794.555) (-1799.235) (-1787.300) -- 0:04:52
189000 -- (-1798.791) [-1797.475] (-1787.594) (-1797.195) * [-1795.055] (-1790.942) (-1807.896) (-1794.247) -- 0:04:56
189500 -- [-1793.967] (-1793.703) (-1791.543) (-1798.969) * (-1796.235) (-1800.825) (-1798.638) [-1793.444] -- 0:04:55
190000 -- (-1796.443) [-1800.913] (-1792.041) (-1790.953) * [-1796.616] (-1791.190) (-1798.507) (-1794.840) -- 0:04:54
Average standard deviation of split frequencies: 0.010439
190500 -- (-1804.104) [-1790.103] (-1798.087) (-1795.355) * (-1789.982) [-1798.393] (-1798.192) (-1792.572) -- 0:04:53
191000 -- (-1801.593) (-1794.448) (-1793.555) [-1786.886] * [-1793.878] (-1789.948) (-1801.268) (-1799.537) -- 0:04:52
191500 -- [-1794.976] (-1799.074) (-1794.444) (-1792.379) * (-1797.422) (-1800.943) (-1789.042) [-1789.246] -- 0:04:55
192000 -- [-1793.371] (-1800.422) (-1798.272) (-1792.891) * (-1795.617) (-1799.043) (-1793.238) [-1792.483] -- 0:04:54
192500 -- (-1792.657) (-1803.225) [-1793.816] (-1804.092) * [-1792.919] (-1791.426) (-1799.356) (-1792.869) -- 0:04:53
193000 -- (-1797.007) (-1797.096) [-1790.855] (-1802.998) * (-1796.661) (-1800.634) (-1794.082) [-1793.120] -- 0:04:52
193500 -- (-1795.091) (-1806.578) [-1790.301] (-1797.552) * (-1794.990) [-1799.441] (-1792.150) (-1797.396) -- 0:04:51
194000 -- (-1800.547) [-1791.189] (-1798.148) (-1790.488) * (-1801.950) (-1809.194) (-1801.577) [-1791.105] -- 0:04:50
194500 -- (-1794.387) [-1798.412] (-1797.786) (-1793.918) * (-1796.928) (-1798.449) (-1807.767) [-1796.223] -- 0:04:54
195000 -- (-1794.550) (-1802.097) [-1796.085] (-1797.867) * (-1794.282) (-1796.152) [-1794.374] (-1799.452) -- 0:04:53
Average standard deviation of split frequencies: 0.011491
195500 -- (-1795.551) (-1795.526) (-1793.344) [-1797.589] * [-1792.041] (-1799.590) (-1792.990) (-1799.576) -- 0:04:52
196000 -- (-1799.864) [-1785.550] (-1794.189) (-1793.017) * (-1795.735) (-1800.258) (-1795.150) [-1788.620] -- 0:04:51
196500 -- (-1796.276) (-1791.101) (-1795.988) [-1798.672] * (-1788.801) (-1796.518) (-1799.326) [-1792.111] -- 0:04:50
197000 -- (-1799.021) [-1791.612] (-1804.610) (-1801.223) * (-1795.849) (-1802.589) (-1798.178) [-1799.795] -- 0:04:53
197500 -- (-1795.452) (-1790.929) (-1788.696) [-1791.465] * (-1798.003) [-1792.536] (-1796.998) (-1801.063) -- 0:04:52
198000 -- (-1792.386) (-1790.850) (-1796.171) [-1789.722] * (-1792.717) [-1787.942] (-1794.718) (-1792.777) -- 0:04:51
198500 -- (-1808.750) (-1785.777) (-1802.976) [-1800.778] * [-1784.362] (-1794.564) (-1799.555) (-1806.898) -- 0:04:50
199000 -- (-1801.810) (-1794.212) (-1798.837) [-1793.421] * (-1789.085) [-1789.872] (-1798.513) (-1799.062) -- 0:04:49
199500 -- (-1793.223) (-1789.853) [-1795.668] (-1795.723) * (-1790.022) (-1796.805) (-1796.648) [-1794.047] -- 0:04:48
200000 -- (-1791.933) (-1799.951) [-1790.967] (-1796.864) * [-1791.206] (-1795.659) (-1794.532) (-1801.633) -- 0:04:52
Average standard deviation of split frequencies: 0.013312
200500 -- [-1795.757] (-1799.593) (-1793.656) (-1798.276) * (-1796.698) (-1794.686) (-1796.457) [-1794.559] -- 0:04:51
201000 -- (-1802.838) (-1801.165) (-1793.809) [-1790.477] * (-1790.588) (-1792.248) (-1795.793) [-1797.479] -- 0:04:50
201500 -- (-1797.919) [-1793.133] (-1795.432) (-1799.064) * (-1801.397) (-1799.281) (-1790.943) [-1789.309] -- 0:04:49
202000 -- [-1794.155] (-1799.311) (-1793.000) (-1795.455) * (-1799.956) (-1796.990) [-1800.004] (-1795.819) -- 0:04:48
202500 -- (-1791.431) (-1802.226) [-1795.008] (-1793.367) * (-1796.355) (-1798.676) [-1788.555] (-1796.235) -- 0:04:47
203000 -- (-1792.543) (-1803.227) (-1804.366) [-1798.705] * (-1795.237) (-1806.280) [-1785.156] (-1799.977) -- 0:04:50
203500 -- (-1800.891) (-1788.698) [-1794.612] (-1795.491) * (-1795.216) (-1792.925) [-1796.912] (-1800.220) -- 0:04:49
204000 -- (-1806.242) [-1789.285] (-1797.706) (-1800.262) * [-1799.689] (-1794.024) (-1799.970) (-1793.707) -- 0:04:48
204500 -- (-1803.713) [-1794.494] (-1800.770) (-1789.168) * (-1808.876) (-1790.413) [-1792.836] (-1794.379) -- 0:04:47
205000 -- (-1801.201) (-1797.436) [-1791.886] (-1790.794) * (-1800.988) [-1791.324] (-1794.659) (-1799.270) -- 0:04:46
Average standard deviation of split frequencies: 0.010679
205500 -- [-1791.514] (-1793.726) (-1797.113) (-1790.326) * (-1801.835) (-1794.487) [-1791.226] (-1797.891) -- 0:04:49
206000 -- [-1797.041] (-1791.437) (-1795.859) (-1800.619) * (-1800.254) [-1790.068] (-1796.812) (-1796.651) -- 0:04:49
206500 -- (-1802.201) [-1796.700] (-1801.465) (-1798.371) * (-1793.957) (-1795.308) (-1796.820) [-1791.627] -- 0:04:48
207000 -- (-1799.462) [-1797.530] (-1796.740) (-1800.516) * [-1794.461] (-1793.095) (-1791.788) (-1789.247) -- 0:04:47
207500 -- [-1794.783] (-1795.252) (-1799.177) (-1791.576) * [-1790.202] (-1797.871) (-1799.494) (-1786.190) -- 0:04:46
208000 -- (-1799.458) (-1786.152) (-1791.455) [-1793.628] * (-1800.423) [-1791.005] (-1793.925) (-1793.583) -- 0:04:45
208500 -- (-1801.132) [-1791.156] (-1788.313) (-1794.001) * (-1796.062) [-1793.491] (-1793.934) (-1794.182) -- 0:04:48
209000 -- (-1795.246) [-1789.358] (-1805.418) (-1790.418) * (-1788.038) [-1796.850] (-1800.242) (-1795.651) -- 0:04:47
209500 -- [-1794.271] (-1793.511) (-1804.820) (-1788.822) * [-1795.465] (-1790.045) (-1796.571) (-1793.186) -- 0:04:46
210000 -- (-1796.261) (-1788.291) [-1800.417] (-1797.613) * (-1794.467) (-1789.930) (-1793.077) [-1794.204] -- 0:04:45
Average standard deviation of split frequencies: 0.010443
210500 -- (-1809.314) (-1794.667) (-1797.653) [-1790.090] * (-1794.445) (-1791.410) (-1795.181) [-1797.449] -- 0:04:45
211000 -- [-1791.036] (-1796.575) (-1794.752) (-1786.717) * (-1790.663) [-1788.002] (-1793.473) (-1796.811) -- 0:04:47
211500 -- [-1786.658] (-1793.697) (-1798.208) (-1793.383) * (-1792.090) (-1794.148) (-1786.936) [-1795.811] -- 0:04:47
212000 -- (-1798.176) [-1787.209] (-1795.078) (-1797.704) * (-1795.633) [-1789.308] (-1801.694) (-1799.651) -- 0:04:46
212500 -- (-1805.331) (-1800.179) (-1799.358) [-1798.618] * (-1791.902) (-1790.588) (-1799.196) [-1796.991] -- 0:04:45
213000 -- (-1801.425) [-1789.701] (-1791.349) (-1793.187) * (-1793.921) (-1795.757) [-1793.361] (-1798.919) -- 0:04:44
213500 -- (-1797.633) (-1798.283) [-1791.730] (-1800.874) * [-1797.493] (-1798.908) (-1794.574) (-1794.489) -- 0:04:43
214000 -- (-1808.593) (-1804.942) [-1791.193] (-1794.334) * [-1796.553] (-1792.426) (-1795.143) (-1792.096) -- 0:04:46
214500 -- (-1802.367) (-1801.286) (-1795.008) [-1788.094] * (-1800.925) (-1792.382) (-1807.935) [-1799.508] -- 0:04:45
215000 -- (-1800.960) [-1797.052] (-1796.702) (-1797.360) * [-1799.411] (-1803.745) (-1797.823) (-1799.354) -- 0:04:44
Average standard deviation of split frequencies: 0.013580
215500 -- (-1798.831) (-1813.267) (-1790.320) [-1791.047] * (-1803.254) [-1795.319] (-1798.064) (-1795.158) -- 0:04:43
216000 -- (-1805.428) (-1796.787) (-1791.883) [-1792.860] * [-1788.816] (-1793.168) (-1805.319) (-1795.651) -- 0:04:43
216500 -- (-1807.512) (-1790.668) (-1798.910) [-1790.820] * (-1791.982) (-1792.394) (-1800.812) [-1790.736] -- 0:04:45
217000 -- (-1801.049) (-1790.395) [-1791.524] (-1806.603) * (-1792.747) (-1792.685) (-1794.501) [-1797.720] -- 0:04:45
217500 -- [-1800.996] (-1792.531) (-1791.419) (-1797.521) * (-1790.667) (-1805.550) (-1793.424) [-1793.860] -- 0:04:44
218000 -- (-1797.819) [-1796.124] (-1791.722) (-1799.420) * (-1796.633) (-1799.290) [-1788.511] (-1796.851) -- 0:04:43
218500 -- (-1800.021) (-1793.498) (-1801.179) [-1794.203] * [-1787.829] (-1797.330) (-1793.100) (-1794.562) -- 0:04:42
219000 -- (-1802.053) (-1788.378) [-1792.734] (-1812.158) * (-1793.448) [-1796.337] (-1790.786) (-1785.562) -- 0:04:41
219500 -- [-1789.566] (-1797.965) (-1794.941) (-1792.665) * [-1797.480] (-1801.319) (-1792.216) (-1793.815) -- 0:04:44
220000 -- [-1791.203] (-1802.827) (-1793.643) (-1802.084) * (-1793.580) [-1788.026] (-1794.691) (-1806.720) -- 0:04:43
Average standard deviation of split frequencies: 0.014717
220500 -- (-1801.862) (-1793.220) [-1793.291] (-1798.512) * (-1790.516) (-1795.472) [-1798.271] (-1800.046) -- 0:04:42
221000 -- [-1788.503] (-1803.654) (-1804.114) (-1791.329) * (-1791.890) [-1783.708] (-1796.988) (-1792.253) -- 0:04:41
221500 -- [-1790.278] (-1793.810) (-1795.791) (-1791.933) * (-1801.567) [-1789.713] (-1801.166) (-1808.577) -- 0:04:41
222000 -- (-1788.300) [-1792.635] (-1797.351) (-1795.312) * (-1794.437) (-1790.642) (-1816.855) [-1790.139] -- 0:04:40
222500 -- (-1791.790) (-1794.260) [-1799.578] (-1809.882) * (-1790.281) [-1792.871] (-1797.841) (-1787.148) -- 0:04:43
223000 -- (-1805.874) [-1794.339] (-1798.516) (-1805.496) * (-1798.790) (-1805.734) [-1793.166] (-1790.841) -- 0:04:42
223500 -- [-1790.258] (-1795.313) (-1794.217) (-1796.472) * [-1792.270] (-1788.157) (-1806.544) (-1789.795) -- 0:04:41
224000 -- (-1798.742) (-1792.665) [-1789.961] (-1792.231) * (-1796.333) [-1794.738] (-1799.629) (-1788.098) -- 0:04:40
224500 -- (-1794.195) (-1795.206) (-1799.933) [-1799.638] * (-1793.679) [-1795.230] (-1797.260) (-1793.857) -- 0:04:39
225000 -- [-1790.591] (-1798.280) (-1799.166) (-1789.772) * (-1795.895) [-1791.237] (-1800.344) (-1792.272) -- 0:04:42
Average standard deviation of split frequencies: 0.012052
225500 -- (-1798.982) (-1798.360) (-1800.085) [-1795.231] * (-1790.283) (-1790.295) (-1794.884) [-1787.156] -- 0:04:41
226000 -- (-1789.620) [-1792.402] (-1800.450) (-1795.660) * (-1804.281) (-1804.667) (-1789.015) [-1787.663] -- 0:04:40
226500 -- [-1789.182] (-1792.091) (-1800.513) (-1790.727) * (-1788.310) (-1788.130) (-1798.418) [-1793.790] -- 0:04:40
227000 -- [-1794.284] (-1794.955) (-1802.024) (-1794.357) * [-1790.723] (-1788.264) (-1790.558) (-1795.683) -- 0:04:39
227500 -- (-1791.394) [-1797.141] (-1797.985) (-1797.890) * (-1798.840) (-1792.114) [-1793.621] (-1799.281) -- 0:04:38
228000 -- [-1791.559] (-1806.075) (-1803.546) (-1802.284) * (-1803.214) (-1791.457) (-1800.064) [-1799.894] -- 0:04:41
228500 -- [-1787.951] (-1793.871) (-1796.633) (-1801.258) * (-1799.116) (-1793.737) [-1796.599] (-1792.593) -- 0:04:40
229000 -- (-1794.844) (-1795.754) [-1799.053] (-1795.836) * (-1794.030) (-1799.548) (-1792.775) [-1797.179] -- 0:04:39
229500 -- [-1792.287] (-1806.097) (-1801.790) (-1800.588) * (-1806.453) (-1792.888) (-1792.278) [-1793.409] -- 0:04:38
230000 -- (-1791.002) (-1796.073) (-1805.610) [-1795.291] * [-1799.994] (-1793.939) (-1801.089) (-1793.201) -- 0:04:37
Average standard deviation of split frequencies: 0.012943
230500 -- (-1790.263) (-1804.159) (-1800.631) [-1793.499] * (-1799.264) (-1798.103) [-1793.615] (-1797.932) -- 0:04:37
231000 -- [-1789.660] (-1804.468) (-1792.258) (-1794.691) * (-1794.061) [-1791.447] (-1792.033) (-1803.775) -- 0:04:39
231500 -- (-1798.536) (-1795.691) (-1789.991) [-1794.182] * [-1791.440] (-1794.130) (-1794.574) (-1794.172) -- 0:04:38
232000 -- (-1796.984) [-1793.764] (-1793.129) (-1800.159) * (-1788.825) [-1790.583] (-1802.699) (-1797.468) -- 0:04:38
232500 -- (-1801.186) (-1797.378) (-1796.550) [-1791.839] * [-1795.643] (-1797.984) (-1796.809) (-1792.941) -- 0:04:37
233000 -- (-1796.544) (-1789.898) [-1793.910] (-1799.158) * (-1806.849) (-1798.034) (-1797.079) [-1795.902] -- 0:04:36
233500 -- (-1804.011) [-1792.003] (-1796.741) (-1792.840) * (-1796.669) (-1802.654) [-1787.282] (-1795.360) -- 0:04:39
234000 -- (-1801.529) (-1805.473) [-1795.071] (-1797.520) * (-1796.515) (-1810.497) (-1799.075) [-1792.306] -- 0:04:38
234500 -- (-1804.765) (-1799.026) [-1788.490] (-1793.339) * (-1795.558) (-1808.010) [-1792.204] (-1804.172) -- 0:04:37
235000 -- (-1799.243) [-1793.775] (-1792.570) (-1797.247) * (-1797.521) (-1797.242) [-1797.428] (-1794.231) -- 0:04:36
Average standard deviation of split frequencies: 0.012207
235500 -- (-1797.873) [-1800.048] (-1794.026) (-1793.403) * [-1793.041] (-1795.822) (-1794.147) (-1800.465) -- 0:04:35
236000 -- [-1792.221] (-1797.894) (-1794.714) (-1798.962) * (-1795.266) (-1794.083) (-1794.783) [-1794.563] -- 0:04:35
236500 -- (-1800.385) (-1795.614) [-1789.839] (-1798.579) * (-1794.870) [-1793.453] (-1796.598) (-1791.239) -- 0:04:37
237000 -- (-1795.288) (-1790.952) (-1791.772) [-1792.425] * (-1787.694) (-1786.385) [-1790.595] (-1799.273) -- 0:04:36
237500 -- (-1800.743) (-1791.658) [-1790.955] (-1811.656) * (-1796.306) [-1793.091] (-1790.233) (-1791.650) -- 0:04:36
238000 -- (-1799.732) (-1799.637) [-1791.142] (-1791.690) * (-1796.719) (-1793.266) [-1792.656] (-1797.164) -- 0:04:35
238500 -- (-1808.265) (-1794.125) [-1795.381] (-1793.829) * (-1796.490) (-1796.053) (-1793.087) [-1792.990] -- 0:04:34
239000 -- (-1799.934) [-1791.206] (-1791.240) (-1802.748) * [-1797.969] (-1787.639) (-1788.758) (-1794.017) -- 0:04:33
239500 -- (-1795.673) (-1793.882) (-1790.290) [-1789.412] * (-1804.339) [-1794.351] (-1795.339) (-1799.842) -- 0:04:36
240000 -- (-1792.591) (-1793.168) (-1791.548) [-1791.601] * (-1800.152) [-1789.077] (-1789.902) (-1800.067) -- 0:04:35
Average standard deviation of split frequencies: 0.010229
240500 -- (-1795.845) (-1791.529) [-1788.866] (-1803.132) * (-1793.590) [-1799.641] (-1795.863) (-1793.451) -- 0:04:34
241000 -- (-1797.187) (-1796.785) [-1788.755] (-1799.773) * [-1796.198] (-1788.430) (-1793.470) (-1797.580) -- 0:04:33
241500 -- [-1801.444] (-1799.483) (-1796.992) (-1794.492) * [-1791.209] (-1799.442) (-1799.567) (-1796.664) -- 0:04:33
242000 -- [-1795.481] (-1802.694) (-1796.200) (-1793.140) * (-1795.467) (-1798.301) [-1790.572] (-1792.053) -- 0:04:35
242500 -- [-1787.115] (-1796.749) (-1792.220) (-1799.529) * (-1794.716) (-1797.780) (-1796.951) [-1791.124] -- 0:04:34
243000 -- (-1794.802) (-1798.058) [-1800.342] (-1798.582) * (-1792.714) (-1796.067) [-1789.594] (-1796.915) -- 0:04:34
243500 -- (-1794.551) [-1786.909] (-1794.629) (-1799.685) * (-1802.322) (-1797.257) [-1804.702] (-1798.337) -- 0:04:33
244000 -- (-1796.366) [-1785.483] (-1793.698) (-1792.251) * (-1803.733) [-1793.728] (-1789.893) (-1795.441) -- 0:04:32
244500 -- (-1796.529) (-1795.545) [-1791.717] (-1796.986) * [-1793.533] (-1796.322) (-1799.560) (-1795.667) -- 0:04:31
245000 -- (-1796.975) (-1792.515) [-1793.619] (-1801.445) * (-1800.977) (-1793.146) [-1800.306] (-1800.633) -- 0:04:34
Average standard deviation of split frequencies: 0.010220
245500 -- [-1786.051] (-1796.282) (-1790.400) (-1792.685) * (-1793.117) (-1801.934) [-1794.039] (-1801.127) -- 0:04:33
246000 -- (-1797.835) (-1796.021) [-1792.339] (-1797.580) * (-1809.811) [-1792.026] (-1791.201) (-1794.391) -- 0:04:32
246500 -- [-1799.374] (-1790.430) (-1800.704) (-1793.942) * (-1789.774) (-1795.251) (-1802.551) [-1798.210] -- 0:04:32
247000 -- (-1811.483) (-1793.901) (-1794.345) [-1795.657] * (-1798.392) [-1793.119] (-1799.925) (-1792.666) -- 0:04:31
247500 -- [-1789.005] (-1799.239) (-1796.649) (-1795.296) * [-1794.609] (-1790.504) (-1799.615) (-1796.204) -- 0:04:30
248000 -- (-1802.312) [-1792.595] (-1796.646) (-1795.175) * [-1799.559] (-1794.815) (-1798.461) (-1795.827) -- 0:04:32
248500 -- (-1789.584) (-1790.296) [-1792.736] (-1803.207) * [-1797.848] (-1798.066) (-1791.191) (-1799.203) -- 0:04:32
249000 -- (-1795.473) (-1796.515) (-1792.058) [-1793.783] * (-1804.436) (-1800.701) [-1801.830] (-1792.555) -- 0:04:31
249500 -- (-1796.655) (-1796.675) [-1788.030] (-1795.136) * [-1790.456] (-1804.424) (-1789.752) (-1797.326) -- 0:04:30
250000 -- (-1795.283) [-1792.653] (-1792.990) (-1790.403) * (-1791.492) (-1799.847) (-1786.228) [-1793.043] -- 0:04:30
Average standard deviation of split frequencies: 0.008985
250500 -- (-1792.133) (-1795.355) (-1795.092) [-1794.876] * (-1789.659) [-1800.529] (-1803.560) (-1795.015) -- 0:04:32
251000 -- (-1792.322) (-1789.217) (-1795.827) [-1789.537] * [-1794.272] (-1796.959) (-1806.622) (-1800.428) -- 0:04:31
251500 -- (-1791.055) [-1793.718] (-1802.221) (-1804.621) * [-1791.829] (-1794.254) (-1798.884) (-1801.030) -- 0:04:30
252000 -- [-1797.924] (-1797.258) (-1804.157) (-1805.789) * [-1795.212] (-1794.231) (-1791.772) (-1795.519) -- 0:04:30
252500 -- [-1788.854] (-1798.076) (-1800.071) (-1796.624) * [-1796.688] (-1798.533) (-1789.626) (-1797.371) -- 0:04:29
253000 -- [-1793.116] (-1802.752) (-1800.988) (-1795.298) * (-1794.106) [-1794.659] (-1792.342) (-1796.012) -- 0:04:28
253500 -- (-1798.885) (-1798.029) (-1796.718) [-1791.924] * [-1790.623] (-1797.195) (-1790.688) (-1796.309) -- 0:04:30
254000 -- (-1797.508) [-1793.877] (-1797.858) (-1795.256) * [-1790.676] (-1799.862) (-1787.053) (-1795.207) -- 0:04:30
254500 -- (-1797.866) (-1793.747) [-1796.915] (-1798.886) * [-1806.607] (-1795.351) (-1790.620) (-1794.374) -- 0:04:29
255000 -- (-1800.202) (-1789.606) (-1800.649) [-1792.666] * [-1790.879] (-1796.360) (-1794.889) (-1792.355) -- 0:04:28
Average standard deviation of split frequencies: 0.009616
255500 -- (-1798.196) [-1798.112] (-1804.252) (-1798.742) * (-1794.459) (-1793.698) (-1794.378) [-1799.813] -- 0:04:28
256000 -- [-1796.423] (-1793.303) (-1799.408) (-1791.197) * [-1793.328] (-1801.449) (-1800.554) (-1792.404) -- 0:04:30
256500 -- (-1799.582) [-1786.394] (-1796.493) (-1800.831) * (-1800.533) (-1801.238) [-1807.431] (-1794.290) -- 0:04:29
257000 -- (-1802.073) (-1796.740) (-1799.929) [-1799.411] * (-1791.872) [-1795.047] (-1803.815) (-1797.956) -- 0:04:28
257500 -- (-1800.267) (-1799.889) (-1792.798) [-1791.044] * (-1798.941) [-1794.060] (-1799.853) (-1797.611) -- 0:04:28
258000 -- (-1806.280) [-1794.338] (-1802.497) (-1786.412) * (-1792.332) [-1792.699] (-1794.023) (-1794.640) -- 0:04:27
258500 -- (-1799.987) [-1799.590] (-1793.567) (-1792.484) * (-1799.874) [-1791.366] (-1793.998) (-1796.661) -- 0:04:26
259000 -- [-1794.440] (-1801.489) (-1792.376) (-1791.332) * (-1801.867) [-1800.403] (-1797.307) (-1799.255) -- 0:04:28
259500 -- [-1792.540] (-1797.608) (-1793.932) (-1792.380) * (-1793.529) (-1794.876) (-1791.244) [-1791.881] -- 0:04:28
260000 -- [-1790.656] (-1801.680) (-1795.054) (-1797.804) * [-1794.083] (-1793.115) (-1796.703) (-1792.785) -- 0:04:27
Average standard deviation of split frequencies: 0.010650
260500 -- (-1797.477) (-1809.025) (-1798.545) [-1792.664] * (-1790.853) (-1789.549) [-1800.999] (-1794.443) -- 0:04:26
261000 -- (-1797.017) (-1795.409) (-1797.974) [-1794.310] * [-1791.501] (-1789.378) (-1797.990) (-1793.216) -- 0:04:26
261500 -- [-1788.943] (-1801.488) (-1792.652) (-1790.693) * (-1802.091) [-1800.350] (-1795.057) (-1794.654) -- 0:04:25
262000 -- (-1803.734) (-1798.407) (-1786.183) [-1807.862] * [-1793.915] (-1799.023) (-1797.249) (-1790.916) -- 0:04:27
262500 -- [-1793.987] (-1802.001) (-1802.586) (-1809.570) * (-1797.200) (-1800.575) [-1789.216] (-1800.517) -- 0:04:26
263000 -- (-1786.464) (-1799.437) [-1805.611] (-1796.876) * (-1797.841) (-1796.895) (-1788.014) [-1789.980] -- 0:04:26
263500 -- (-1795.324) (-1790.530) (-1793.285) [-1797.457] * (-1789.047) (-1798.323) (-1794.637) [-1784.054] -- 0:04:25
264000 -- (-1793.881) (-1795.302) (-1791.910) [-1794.181] * (-1802.226) (-1791.377) (-1796.980) [-1791.446] -- 0:04:24
264500 -- (-1806.886) (-1803.582) [-1787.156] (-1792.220) * (-1791.370) [-1794.120] (-1793.392) (-1789.533) -- 0:04:24
265000 -- (-1802.036) [-1790.102] (-1805.728) (-1798.148) * (-1797.971) [-1795.221] (-1796.097) (-1790.397) -- 0:04:26
Average standard deviation of split frequencies: 0.008467
265500 -- (-1801.333) (-1791.628) (-1796.061) [-1800.765] * [-1792.091] (-1803.445) (-1809.502) (-1797.866) -- 0:04:25
266000 -- (-1796.684) [-1795.875] (-1803.722) (-1799.634) * (-1798.911) (-1795.352) (-1796.706) [-1796.748] -- 0:04:24
266500 -- (-1797.025) (-1800.221) [-1789.283] (-1796.302) * [-1800.108] (-1797.245) (-1799.112) (-1791.690) -- 0:04:24
267000 -- (-1799.234) [-1787.638] (-1798.584) (-1792.441) * [-1795.251] (-1796.440) (-1799.256) (-1802.240) -- 0:04:23
267500 -- (-1800.547) [-1789.705] (-1798.474) (-1789.858) * [-1796.787] (-1800.948) (-1796.518) (-1793.264) -- 0:04:25
268000 -- (-1788.027) (-1800.809) (-1800.882) [-1792.951] * [-1792.611] (-1801.884) (-1804.684) (-1789.809) -- 0:04:24
268500 -- (-1796.025) (-1800.171) (-1788.285) [-1803.053] * [-1793.269] (-1793.331) (-1798.859) (-1789.412) -- 0:04:24
269000 -- (-1793.691) (-1801.596) [-1801.399] (-1795.135) * [-1790.736] (-1798.279) (-1795.387) (-1788.302) -- 0:04:23
269500 -- (-1794.127) (-1791.417) [-1800.271] (-1793.313) * [-1792.047] (-1795.010) (-1790.960) (-1795.551) -- 0:04:22
270000 -- (-1816.849) [-1787.603] (-1792.130) (-1792.688) * (-1802.347) [-1790.927] (-1794.443) (-1792.040) -- 0:04:22
Average standard deviation of split frequencies: 0.011030
270500 -- (-1795.165) (-1790.958) [-1794.549] (-1798.218) * (-1793.683) [-1786.019] (-1798.401) (-1792.239) -- 0:04:24
271000 -- [-1788.184] (-1799.833) (-1794.516) (-1800.484) * (-1796.198) [-1800.117] (-1796.312) (-1798.574) -- 0:04:23
271500 -- [-1789.201] (-1798.621) (-1805.201) (-1800.681) * (-1788.830) (-1792.682) (-1791.140) [-1790.365] -- 0:04:22
272000 -- (-1793.174) [-1797.807] (-1798.631) (-1805.522) * (-1795.639) (-1790.857) [-1794.836] (-1794.207) -- 0:04:22
272500 -- (-1799.445) (-1799.017) (-1805.309) [-1791.553] * [-1794.966] (-1798.098) (-1803.975) (-1794.335) -- 0:04:21
273000 -- (-1797.244) [-1789.864] (-1799.840) (-1791.940) * (-1794.044) (-1794.514) (-1797.972) [-1796.889] -- 0:04:23
273500 -- (-1801.176) (-1800.320) [-1796.029] (-1799.191) * (-1790.864) (-1800.221) [-1794.031] (-1802.488) -- 0:04:22
274000 -- (-1796.508) [-1795.488] (-1790.415) (-1793.827) * (-1792.235) (-1796.469) [-1794.565] (-1802.085) -- 0:04:22
274500 -- (-1797.445) [-1800.057] (-1792.064) (-1791.950) * (-1800.810) (-1802.444) (-1802.024) [-1794.441] -- 0:04:21
275000 -- [-1790.926] (-1806.290) (-1795.919) (-1790.049) * (-1796.173) (-1802.974) [-1792.515] (-1790.977) -- 0:04:21
Average standard deviation of split frequencies: 0.010817
275500 -- [-1793.765] (-1801.191) (-1796.571) (-1790.750) * (-1802.416) (-1792.748) (-1800.566) [-1791.776] -- 0:04:20
276000 -- [-1788.725] (-1795.057) (-1796.597) (-1794.943) * (-1793.186) (-1793.446) (-1797.468) [-1790.275] -- 0:04:22
276500 -- [-1790.938] (-1807.390) (-1791.622) (-1795.126) * (-1796.654) [-1800.258] (-1797.354) (-1805.057) -- 0:04:21
277000 -- [-1791.996] (-1800.560) (-1796.057) (-1795.610) * (-1793.972) (-1795.855) (-1799.014) [-1791.364] -- 0:04:21
277500 -- (-1793.736) [-1791.390] (-1802.064) (-1795.647) * (-1808.956) (-1801.656) [-1793.884] (-1792.690) -- 0:04:20
278000 -- (-1797.209) (-1807.851) (-1788.391) [-1796.523] * (-1804.422) (-1800.671) (-1792.533) [-1795.848] -- 0:04:19
278500 -- (-1802.937) [-1800.885] (-1794.994) (-1796.079) * (-1789.191) (-1801.756) [-1788.788] (-1790.599) -- 0:04:21
279000 -- (-1798.657) (-1798.510) [-1794.154] (-1791.944) * (-1796.149) [-1791.003] (-1787.359) (-1786.870) -- 0:04:21
279500 -- (-1802.195) (-1807.529) [-1799.676] (-1795.313) * (-1795.514) (-1795.985) (-1793.121) [-1797.553] -- 0:04:20
280000 -- (-1804.470) [-1796.060] (-1804.583) (-1794.668) * [-1790.561] (-1793.672) (-1790.597) (-1799.864) -- 0:04:19
Average standard deviation of split frequencies: 0.012690
280500 -- (-1796.233) (-1801.269) (-1792.698) [-1790.743] * (-1797.581) (-1800.551) [-1794.150] (-1796.784) -- 0:04:19
281000 -- (-1796.939) [-1791.426] (-1792.673) (-1795.793) * (-1795.385) [-1796.917] (-1806.242) (-1794.181) -- 0:04:18
281500 -- (-1800.570) (-1795.981) [-1799.993] (-1797.943) * (-1797.217) (-1792.745) (-1790.248) [-1785.947] -- 0:04:20
282000 -- (-1793.265) (-1801.793) (-1792.754) [-1798.052] * [-1793.092] (-1789.197) (-1795.216) (-1800.636) -- 0:04:19
282500 -- (-1789.799) [-1790.739] (-1797.921) (-1804.204) * (-1791.551) [-1794.310] (-1792.599) (-1789.549) -- 0:04:19
283000 -- (-1803.227) [-1791.207] (-1805.907) (-1792.394) * (-1799.129) (-1802.446) (-1789.628) [-1796.076] -- 0:04:18
283500 -- (-1797.364) (-1795.260) (-1808.169) [-1792.391] * (-1794.459) (-1798.257) [-1792.528] (-1795.841) -- 0:04:17
284000 -- (-1798.327) (-1793.780) (-1791.128) [-1789.468] * [-1787.804] (-1791.422) (-1796.503) (-1793.754) -- 0:04:17
284500 -- [-1793.915] (-1790.136) (-1789.811) (-1793.822) * (-1790.854) [-1796.348] (-1800.318) (-1798.441) -- 0:04:19
285000 -- (-1798.519) (-1793.649) (-1795.613) [-1789.084] * [-1793.874] (-1787.165) (-1802.592) (-1794.753) -- 0:04:18
Average standard deviation of split frequencies: 0.011172
285500 -- (-1799.672) (-1803.214) (-1798.361) [-1790.918] * [-1791.091] (-1791.967) (-1801.393) (-1793.010) -- 0:04:17
286000 -- [-1796.000] (-1796.522) (-1789.244) (-1791.255) * [-1794.568] (-1789.061) (-1798.429) (-1791.317) -- 0:04:17
286500 -- (-1791.065) [-1794.943] (-1804.350) (-1802.071) * (-1805.368) [-1798.065] (-1791.476) (-1797.552) -- 0:04:16
287000 -- [-1795.501] (-1786.479) (-1795.850) (-1795.849) * (-1802.080) (-1794.147) (-1801.906) [-1793.058] -- 0:04:18
287500 -- (-1790.450) [-1790.581] (-1786.150) (-1788.339) * [-1795.439] (-1797.615) (-1798.298) (-1797.182) -- 0:04:17
288000 -- [-1791.803] (-1801.913) (-1790.872) (-1797.688) * (-1795.534) [-1793.601] (-1794.504) (-1792.186) -- 0:04:17
288500 -- (-1788.107) (-1789.238) [-1789.365] (-1797.651) * (-1798.968) (-1796.608) [-1789.505] (-1794.527) -- 0:04:16
289000 -- (-1793.945) (-1800.127) (-1793.726) [-1789.711] * [-1797.279] (-1794.281) (-1796.354) (-1789.184) -- 0:04:15
289500 -- (-1800.002) (-1794.258) (-1790.165) [-1793.061] * [-1790.614] (-1797.742) (-1801.220) (-1792.182) -- 0:04:15
290000 -- [-1798.639] (-1797.942) (-1795.464) (-1798.213) * [-1796.654] (-1795.445) (-1788.748) (-1801.129) -- 0:04:17
Average standard deviation of split frequencies: 0.011533
290500 -- (-1790.514) [-1796.427] (-1792.806) (-1791.395) * (-1795.355) (-1792.042) (-1795.759) [-1790.270] -- 0:04:16
291000 -- [-1790.176] (-1796.199) (-1795.732) (-1793.202) * (-1797.891) (-1795.382) (-1799.531) [-1788.350] -- 0:04:15
291500 -- (-1790.138) (-1793.499) [-1794.838] (-1796.244) * (-1801.510) (-1789.147) (-1790.048) [-1791.331] -- 0:04:15
292000 -- (-1801.518) (-1798.626) (-1793.546) [-1798.073] * (-1806.790) [-1794.692] (-1790.284) (-1802.576) -- 0:04:14
292500 -- (-1795.433) (-1807.774) (-1806.969) [-1799.083] * (-1799.531) (-1793.750) (-1794.550) [-1793.677] -- 0:04:16
293000 -- [-1797.645] (-1800.560) (-1806.101) (-1793.056) * (-1796.794) (-1798.770) [-1796.216] (-1789.829) -- 0:04:15
293500 -- (-1800.730) [-1796.047] (-1800.577) (-1798.094) * (-1792.066) [-1794.506] (-1797.978) (-1802.470) -- 0:04:15
294000 -- [-1794.678] (-1798.317) (-1805.926) (-1801.293) * [-1798.099] (-1800.320) (-1805.191) (-1793.788) -- 0:04:14
294500 -- (-1804.307) [-1797.522] (-1800.164) (-1794.538) * [-1792.357] (-1793.124) (-1798.704) (-1795.972) -- 0:04:13
295000 -- [-1797.411] (-1800.050) (-1802.815) (-1795.068) * [-1797.905] (-1797.763) (-1792.202) (-1802.258) -- 0:04:13
Average standard deviation of split frequencies: 0.012918
295500 -- [-1794.040] (-1792.454) (-1799.944) (-1804.172) * (-1792.385) (-1795.870) [-1788.079] (-1792.986) -- 0:04:15
296000 -- (-1795.386) (-1806.218) [-1797.935] (-1798.393) * (-1790.551) (-1792.544) [-1794.024] (-1804.541) -- 0:04:14
296500 -- (-1794.585) (-1812.551) (-1796.333) [-1794.147] * (-1800.198) [-1789.074] (-1812.723) (-1799.074) -- 0:04:13
297000 -- [-1794.770] (-1794.107) (-1791.662) (-1789.942) * (-1805.348) [-1792.913] (-1794.775) (-1810.284) -- 0:04:13
297500 -- (-1788.729) [-1789.766] (-1790.790) (-1791.864) * (-1793.814) [-1788.952] (-1797.113) (-1807.185) -- 0:04:12
298000 -- (-1793.661) [-1797.327] (-1801.962) (-1796.980) * [-1800.098] (-1799.684) (-1800.946) (-1790.769) -- 0:04:12
298500 -- (-1794.240) [-1792.141] (-1802.565) (-1792.858) * (-1791.568) [-1791.950] (-1795.543) (-1792.824) -- 0:04:13
299000 -- (-1791.849) (-1785.586) (-1797.236) [-1789.304] * (-1794.881) (-1794.044) [-1797.579] (-1795.311) -- 0:04:13
299500 -- (-1793.302) (-1797.435) (-1796.996) [-1800.222] * [-1785.718] (-1797.284) (-1803.533) (-1801.500) -- 0:04:12
300000 -- (-1795.112) (-1801.464) [-1795.837] (-1791.709) * [-1790.469] (-1789.243) (-1797.687) (-1805.909) -- 0:04:12
Average standard deviation of split frequencies: 0.014459
300500 -- (-1791.228) (-1790.697) [-1794.106] (-1803.913) * [-1797.387] (-1795.019) (-1790.400) (-1796.674) -- 0:04:11
301000 -- [-1786.264] (-1799.122) (-1789.255) (-1797.210) * (-1806.992) [-1790.263] (-1793.295) (-1799.516) -- 0:04:13
301500 -- (-1792.361) (-1794.158) [-1797.185] (-1793.096) * (-1791.682) [-1797.235] (-1796.255) (-1791.260) -- 0:04:12
302000 -- (-1797.939) [-1802.137] (-1791.602) (-1797.051) * (-1794.425) (-1787.189) (-1802.594) [-1795.369] -- 0:04:11
302500 -- (-1797.468) (-1797.301) [-1798.989] (-1795.390) * (-1804.299) (-1801.918) [-1794.493] (-1790.174) -- 0:04:11
303000 -- (-1798.319) (-1799.194) (-1793.218) [-1788.789] * (-1798.221) (-1795.261) (-1789.946) [-1793.783] -- 0:04:10
303500 -- (-1796.149) (-1797.600) (-1803.550) [-1794.612] * (-1795.346) [-1802.068] (-1808.004) (-1800.371) -- 0:04:10
304000 -- (-1795.943) (-1796.148) (-1798.820) [-1792.990] * (-1796.354) (-1804.787) (-1793.462) [-1791.031] -- 0:04:11
304500 -- (-1791.412) (-1788.683) (-1798.634) [-1795.984] * (-1801.394) (-1787.210) [-1789.281] (-1791.355) -- 0:04:11
305000 -- (-1797.855) (-1790.425) (-1801.808) [-1792.841] * (-1790.297) (-1796.522) [-1790.303] (-1787.807) -- 0:04:10
Average standard deviation of split frequencies: 0.014378
305500 -- (-1793.930) [-1791.715] (-1803.151) (-1790.464) * (-1794.274) (-1798.799) (-1797.210) [-1795.994] -- 0:04:10
306000 -- (-1796.932) [-1793.483] (-1800.855) (-1789.194) * (-1793.595) [-1799.166] (-1794.478) (-1798.030) -- 0:04:09
306500 -- (-1799.478) [-1792.224] (-1794.858) (-1790.739) * [-1791.394] (-1801.153) (-1808.385) (-1791.640) -- 0:04:08
307000 -- (-1791.830) (-1808.285) [-1796.584] (-1791.793) * [-1804.875] (-1809.527) (-1791.746) (-1801.888) -- 0:04:10
307500 -- (-1805.985) [-1802.736] (-1798.311) (-1792.921) * (-1795.962) (-1792.664) (-1795.770) [-1797.780] -- 0:04:09
308000 -- [-1795.103] (-1795.371) (-1801.997) (-1797.950) * [-1791.091] (-1793.841) (-1790.875) (-1795.465) -- 0:04:09
308500 -- (-1796.100) (-1805.284) (-1799.704) [-1799.411] * (-1785.308) [-1791.942] (-1794.727) (-1796.921) -- 0:04:08
309000 -- [-1791.791] (-1800.075) (-1788.915) (-1794.224) * (-1794.729) [-1793.583] (-1796.712) (-1805.970) -- 0:04:08
309500 -- (-1793.122) (-1790.166) (-1789.467) [-1790.239] * [-1789.200] (-1796.475) (-1800.421) (-1798.307) -- 0:04:09
310000 -- (-1796.906) (-1797.101) (-1801.289) [-1792.213] * [-1795.986] (-1800.000) (-1802.995) (-1808.492) -- 0:04:09
Average standard deviation of split frequencies: 0.014162
310500 -- (-1799.405) (-1794.425) [-1795.181] (-1789.779) * (-1793.583) (-1800.062) [-1795.077] (-1802.351) -- 0:04:08
311000 -- (-1809.310) [-1792.921] (-1793.304) (-1795.493) * (-1790.416) [-1793.725] (-1801.096) (-1796.733) -- 0:04:08
311500 -- (-1795.692) (-1796.583) (-1796.586) [-1790.486] * (-1793.437) [-1793.694] (-1794.091) (-1800.150) -- 0:04:07
312000 -- (-1789.401) (-1802.613) (-1791.832) [-1794.080] * (-1792.033) (-1811.661) [-1791.582] (-1799.732) -- 0:04:06
312500 -- (-1796.119) (-1792.682) (-1805.984) [-1800.939] * (-1790.468) [-1795.498] (-1795.973) (-1794.834) -- 0:04:08
313000 -- [-1794.874] (-1800.171) (-1804.517) (-1798.559) * (-1792.546) (-1801.701) [-1793.063] (-1796.673) -- 0:04:08
313500 -- (-1798.445) [-1792.720] (-1793.974) (-1795.621) * (-1799.028) (-1801.143) (-1795.128) [-1798.752] -- 0:04:07
314000 -- (-1794.364) (-1796.350) [-1788.987] (-1795.729) * (-1794.113) (-1792.881) [-1790.458] (-1798.958) -- 0:04:06
314500 -- (-1802.480) [-1797.032] (-1798.217) (-1795.315) * (-1799.134) (-1796.623) (-1796.567) [-1792.709] -- 0:04:06
315000 -- (-1805.337) [-1791.340] (-1789.164) (-1793.427) * (-1795.283) (-1793.773) [-1800.090] (-1803.591) -- 0:04:05
Average standard deviation of split frequencies: 0.013758
315500 -- (-1797.537) [-1792.718] (-1794.122) (-1802.359) * (-1796.251) (-1794.132) (-1798.846) [-1790.073] -- 0:04:07
316000 -- (-1795.578) (-1794.134) [-1801.281] (-1793.668) * (-1795.336) [-1795.644] (-1795.298) (-1789.868) -- 0:04:06
316500 -- (-1798.891) [-1789.909] (-1803.306) (-1801.652) * [-1786.688] (-1791.060) (-1796.905) (-1810.534) -- 0:04:06
317000 -- (-1804.825) (-1792.298) [-1792.472] (-1803.964) * (-1802.310) [-1791.845] (-1797.291) (-1802.819) -- 0:04:05
317500 -- [-1789.649] (-1792.879) (-1789.833) (-1793.694) * (-1806.409) [-1794.618] (-1795.084) (-1794.698) -- 0:04:05
318000 -- (-1799.292) (-1801.875) [-1798.323] (-1798.659) * (-1807.212) [-1797.570] (-1789.871) (-1790.432) -- 0:04:06
318500 -- (-1795.316) [-1790.889] (-1788.593) (-1798.765) * (-1791.788) (-1796.309) [-1791.973] (-1793.010) -- 0:04:06
319000 -- (-1799.570) (-1792.816) [-1791.202] (-1798.838) * (-1801.561) (-1791.834) (-1801.777) [-1787.972] -- 0:04:05
319500 -- [-1795.387] (-1791.871) (-1791.423) (-1791.806) * (-1806.545) (-1799.890) [-1789.015] (-1792.540) -- 0:04:04
320000 -- (-1789.938) (-1801.614) [-1789.763] (-1803.225) * (-1802.115) (-1796.768) [-1791.621] (-1793.733) -- 0:04:04
Average standard deviation of split frequencies: 0.013067
320500 -- (-1797.722) (-1799.126) (-1804.163) [-1801.536] * (-1795.961) (-1796.622) [-1790.012] (-1796.550) -- 0:04:03
321000 -- [-1788.372] (-1794.547) (-1795.451) (-1798.055) * (-1792.082) (-1792.148) (-1800.759) [-1796.788] -- 0:04:05
321500 -- (-1793.231) (-1799.607) [-1796.227] (-1797.187) * (-1790.511) [-1796.749] (-1792.936) (-1796.737) -- 0:04:04
322000 -- (-1791.579) (-1790.921) (-1790.372) [-1793.475] * (-1797.825) [-1785.390] (-1800.967) (-1798.655) -- 0:04:04
322500 -- [-1790.677] (-1789.532) (-1797.733) (-1799.539) * (-1793.793) [-1787.276] (-1802.703) (-1795.705) -- 0:04:03
323000 -- (-1793.783) (-1796.200) [-1791.808] (-1800.953) * (-1796.984) (-1791.727) [-1796.587] (-1798.997) -- 0:04:03
323500 -- (-1796.310) (-1800.524) [-1797.673] (-1797.296) * (-1797.631) [-1793.969] (-1790.618) (-1792.097) -- 0:04:04
324000 -- [-1789.492] (-1793.213) (-1799.137) (-1805.562) * (-1795.602) (-1788.108) (-1788.006) [-1793.040] -- 0:04:04
324500 -- [-1796.377] (-1793.070) (-1797.271) (-1794.499) * (-1793.569) [-1791.245] (-1796.835) (-1793.226) -- 0:04:03
325000 -- (-1797.593) (-1798.620) [-1793.171] (-1798.863) * [-1792.929] (-1795.174) (-1789.850) (-1797.359) -- 0:04:03
Average standard deviation of split frequencies: 0.012372
325500 -- [-1804.081] (-1795.286) (-1797.313) (-1800.674) * (-1797.268) (-1794.300) (-1796.084) [-1795.031] -- 0:04:02
326000 -- (-1798.736) [-1794.380] (-1799.100) (-1791.809) * [-1790.882] (-1804.333) (-1790.909) (-1797.994) -- 0:04:01
326500 -- [-1793.624] (-1794.790) (-1793.814) (-1815.396) * (-1792.821) [-1794.598] (-1800.363) (-1790.859) -- 0:04:03
327000 -- (-1793.635) (-1794.064) (-1807.643) [-1812.255] * (-1808.508) (-1793.824) [-1796.684] (-1801.693) -- 0:04:02
327500 -- [-1798.770] (-1798.693) (-1794.448) (-1801.565) * (-1792.578) [-1796.369] (-1796.060) (-1798.029) -- 0:04:02
328000 -- (-1793.182) (-1794.392) (-1793.870) [-1790.208] * (-1795.038) [-1787.327] (-1804.406) (-1792.152) -- 0:04:01
328500 -- (-1797.546) [-1795.623] (-1801.331) (-1798.294) * [-1789.950] (-1803.583) (-1798.465) (-1801.550) -- 0:04:01
329000 -- (-1796.315) [-1786.626] (-1796.450) (-1792.583) * (-1795.969) (-1808.594) (-1795.047) [-1789.667] -- 0:04:00
329500 -- (-1801.011) (-1795.906) (-1807.773) [-1802.105] * (-1794.111) (-1791.369) [-1793.762] (-1790.208) -- 0:04:02
330000 -- (-1796.484) (-1793.740) [-1802.673] (-1795.051) * (-1791.907) (-1794.958) [-1794.832] (-1789.655) -- 0:04:01
Average standard deviation of split frequencies: 0.013623
330500 -- [-1802.552] (-1799.454) (-1797.087) (-1793.559) * (-1796.303) [-1795.537] (-1798.751) (-1794.277) -- 0:04:01
331000 -- (-1794.243) [-1792.158] (-1796.059) (-1798.321) * [-1790.390] (-1797.380) (-1790.526) (-1790.705) -- 0:04:00
331500 -- (-1789.559) (-1796.137) [-1788.691] (-1796.266) * (-1789.090) (-1795.118) (-1798.570) [-1790.754] -- 0:03:59
332000 -- (-1800.622) [-1785.658] (-1794.088) (-1793.933) * [-1793.406] (-1791.820) (-1794.348) (-1792.696) -- 0:03:59
332500 -- (-1794.205) (-1795.866) (-1795.218) [-1801.245] * [-1788.333] (-1797.389) (-1798.558) (-1800.279) -- 0:04:00
333000 -- (-1793.877) (-1797.079) (-1802.168) [-1798.581] * (-1791.164) [-1789.923] (-1795.129) (-1800.625) -- 0:04:00
333500 -- (-1800.988) [-1807.503] (-1796.572) (-1804.171) * (-1796.442) [-1787.733] (-1798.034) (-1806.340) -- 0:03:59
334000 -- (-1798.097) (-1796.953) [-1790.196] (-1802.354) * (-1793.657) (-1796.702) (-1800.730) [-1793.402] -- 0:03:59
334500 -- (-1798.418) (-1796.492) (-1804.104) [-1796.384] * (-1797.423) (-1795.595) [-1789.924] (-1795.916) -- 0:03:58
335000 -- (-1801.470) (-1794.944) (-1795.794) [-1785.079] * (-1793.057) (-1798.042) (-1792.988) [-1793.647] -- 0:04:00
Average standard deviation of split frequencies: 0.015277
335500 -- [-1787.022] (-1795.684) (-1795.333) (-1794.073) * (-1793.772) (-1794.597) [-1791.338] (-1799.228) -- 0:03:59
336000 -- (-1798.620) [-1800.645] (-1794.483) (-1799.486) * (-1812.771) (-1795.261) [-1793.876] (-1788.891) -- 0:03:59
336500 -- [-1792.347] (-1796.116) (-1792.900) (-1794.993) * (-1793.981) (-1798.932) (-1799.400) [-1795.217] -- 0:03:58
337000 -- (-1794.276) [-1790.892] (-1802.519) (-1807.922) * (-1787.091) [-1789.329] (-1793.208) (-1797.767) -- 0:03:58
337500 -- (-1804.090) (-1804.917) (-1795.793) [-1791.991] * [-1788.585] (-1790.802) (-1795.472) (-1795.861) -- 0:03:57
338000 -- [-1804.658] (-1799.750) (-1798.612) (-1797.201) * (-1792.560) [-1791.350] (-1793.664) (-1810.901) -- 0:03:58
338500 -- (-1797.225) (-1795.455) (-1798.021) [-1798.146] * [-1797.208] (-1793.355) (-1795.016) (-1793.624) -- 0:03:58
339000 -- [-1793.490] (-1789.564) (-1790.918) (-1801.074) * (-1789.680) (-1804.719) (-1792.747) [-1794.975] -- 0:03:57
339500 -- (-1800.772) (-1792.173) (-1789.232) [-1797.328] * [-1791.742] (-1806.711) (-1789.535) (-1799.902) -- 0:03:57
340000 -- (-1796.938) (-1791.432) (-1796.020) [-1792.237] * [-1797.032] (-1801.308) (-1789.149) (-1795.078) -- 0:03:56
Average standard deviation of split frequencies: 0.016605
340500 -- (-1798.912) [-1790.402] (-1787.839) (-1793.526) * (-1799.887) (-1795.817) (-1796.581) [-1792.826] -- 0:03:58
341000 -- [-1796.707] (-1807.529) (-1794.943) (-1800.454) * (-1800.608) (-1796.744) [-1794.163] (-1800.993) -- 0:03:57
341500 -- (-1800.777) [-1791.544] (-1803.208) (-1793.205) * [-1796.932] (-1795.471) (-1785.174) (-1791.045) -- 0:03:57
342000 -- (-1806.611) (-1799.911) (-1794.105) [-1798.155] * (-1799.555) (-1791.078) (-1793.647) [-1790.324] -- 0:03:56
342500 -- (-1792.149) (-1793.844) (-1798.426) [-1794.676] * (-1796.395) [-1791.098] (-1792.299) (-1799.500) -- 0:03:56
343000 -- (-1788.135) [-1790.092] (-1796.185) (-1789.495) * (-1799.974) [-1793.576] (-1793.287) (-1787.450) -- 0:03:55
343500 -- [-1793.796] (-1793.738) (-1790.431) (-1802.694) * (-1791.630) (-1801.799) (-1799.978) [-1788.682] -- 0:03:56
344000 -- (-1805.918) [-1793.543] (-1796.176) (-1797.466) * (-1805.447) (-1797.376) (-1797.507) [-1795.609] -- 0:03:56
344500 -- (-1792.650) [-1795.249] (-1792.568) (-1799.946) * (-1799.628) (-1794.722) (-1803.190) [-1798.325] -- 0:03:55
345000 -- (-1800.971) (-1797.322) [-1795.581] (-1795.986) * [-1797.986] (-1793.221) (-1803.081) (-1795.333) -- 0:03:55
Average standard deviation of split frequencies: 0.016047
345500 -- [-1797.810] (-1794.012) (-1795.091) (-1793.736) * (-1791.353) (-1787.219) [-1796.552] (-1800.403) -- 0:03:54
346000 -- [-1796.810] (-1796.201) (-1793.376) (-1799.056) * [-1794.040] (-1795.096) (-1796.738) (-1796.031) -- 0:03:54
346500 -- (-1787.966) (-1797.518) (-1796.126) [-1791.637] * (-1802.543) [-1795.020] (-1794.383) (-1800.934) -- 0:03:55
347000 -- (-1785.433) (-1797.242) (-1797.189) [-1791.463] * (-1793.950) [-1798.002] (-1798.846) (-1795.181) -- 0:03:55
347500 -- [-1789.359] (-1790.964) (-1797.170) (-1802.053) * [-1790.614] (-1802.788) (-1802.750) (-1795.982) -- 0:03:54
348000 -- (-1793.251) (-1810.185) [-1793.041] (-1794.064) * (-1791.713) (-1808.886) (-1797.253) [-1795.334] -- 0:03:54
348500 -- (-1798.167) [-1792.129] (-1792.386) (-1790.932) * (-1801.514) (-1806.357) [-1803.348] (-1797.567) -- 0:03:53
349000 -- (-1788.639) (-1797.027) (-1792.074) [-1789.822] * (-1797.859) [-1792.971] (-1802.892) (-1793.544) -- 0:03:55
349500 -- [-1792.771] (-1790.259) (-1794.269) (-1793.424) * (-1811.673) [-1793.538] (-1800.601) (-1799.351) -- 0:03:54
350000 -- (-1786.450) (-1788.662) [-1797.582] (-1793.259) * [-1804.774] (-1799.507) (-1810.221) (-1793.280) -- 0:03:54
Average standard deviation of split frequencies: 0.014638
350500 -- (-1787.053) (-1791.681) [-1791.738] (-1791.822) * (-1797.238) [-1786.879] (-1802.726) (-1798.558) -- 0:03:53
351000 -- (-1794.163) (-1788.897) (-1805.664) [-1796.076] * [-1797.435] (-1798.236) (-1806.306) (-1794.623) -- 0:03:52
351500 -- (-1799.002) (-1793.190) [-1787.428] (-1795.258) * (-1798.772) (-1798.242) [-1794.508] (-1790.116) -- 0:03:52
352000 -- (-1795.037) (-1802.188) (-1797.285) [-1790.953] * (-1797.547) (-1803.062) (-1789.170) [-1794.139] -- 0:03:53
352500 -- (-1794.103) (-1794.011) [-1787.578] (-1794.700) * (-1796.154) [-1791.404] (-1790.134) (-1798.493) -- 0:03:53
353000 -- (-1789.639) (-1794.062) (-1797.047) [-1790.809] * (-1794.869) [-1792.786] (-1793.301) (-1795.363) -- 0:03:52
353500 -- (-1799.325) (-1801.295) [-1794.209] (-1796.421) * [-1786.320] (-1798.793) (-1798.256) (-1786.203) -- 0:03:52
354000 -- (-1799.260) (-1793.426) (-1792.987) [-1802.301] * (-1800.356) (-1793.921) (-1799.108) [-1798.770] -- 0:03:51
354500 -- [-1795.944] (-1811.094) (-1792.656) (-1794.939) * (-1791.888) (-1797.396) (-1798.874) [-1798.096] -- 0:03:53
355000 -- (-1798.826) [-1794.025] (-1794.061) (-1802.838) * (-1789.110) (-1790.343) (-1796.422) [-1790.793] -- 0:03:52
Average standard deviation of split frequencies: 0.014272
355500 -- [-1793.642] (-1801.131) (-1791.835) (-1791.580) * [-1792.223] (-1789.528) (-1807.030) (-1802.390) -- 0:03:52
356000 -- [-1797.460] (-1793.920) (-1797.839) (-1794.960) * (-1796.736) [-1789.340] (-1800.568) (-1791.387) -- 0:03:51
356500 -- [-1792.722] (-1790.852) (-1792.047) (-1794.201) * (-1794.462) (-1798.715) (-1803.794) [-1794.593] -- 0:03:51
357000 -- (-1792.759) [-1797.870] (-1800.537) (-1798.653) * (-1794.540) [-1791.245] (-1798.744) (-1792.317) -- 0:03:50
357500 -- (-1796.750) (-1789.750) (-1803.188) [-1794.337] * [-1797.154] (-1795.679) (-1794.301) (-1800.143) -- 0:03:51
358000 -- [-1797.837] (-1797.820) (-1793.805) (-1801.541) * (-1793.492) [-1797.281] (-1795.560) (-1791.831) -- 0:03:51
358500 -- (-1792.215) (-1790.422) [-1787.285] (-1794.629) * (-1806.407) (-1797.410) (-1798.118) [-1791.560] -- 0:03:50
359000 -- (-1807.686) (-1795.330) (-1801.624) [-1789.817] * (-1811.566) (-1799.219) [-1788.716] (-1791.826) -- 0:03:50
359500 -- [-1801.457] (-1798.161) (-1798.111) (-1789.602) * (-1801.472) (-1796.585) [-1791.798] (-1790.368) -- 0:03:49
360000 -- [-1791.176] (-1797.247) (-1794.264) (-1796.089) * [-1797.726] (-1789.231) (-1800.167) (-1798.734) -- 0:03:49
Average standard deviation of split frequencies: 0.015684
360500 -- (-1790.647) (-1801.733) [-1791.049] (-1797.413) * [-1796.181] (-1790.513) (-1797.950) (-1788.364) -- 0:03:50
361000 -- [-1799.810] (-1794.660) (-1793.242) (-1790.607) * (-1804.827) (-1787.701) (-1794.385) [-1794.526] -- 0:03:50
361500 -- [-1795.340] (-1796.944) (-1795.276) (-1794.241) * (-1794.254) (-1801.065) [-1794.723] (-1800.733) -- 0:03:49
362000 -- (-1796.375) (-1796.939) [-1788.030] (-1792.126) * [-1791.968] (-1796.760) (-1789.623) (-1801.399) -- 0:03:49
362500 -- (-1795.042) (-1796.776) [-1785.520] (-1800.412) * (-1798.918) (-1791.253) [-1791.525] (-1793.263) -- 0:03:48
363000 -- (-1796.850) [-1796.046] (-1787.003) (-1801.082) * (-1802.587) [-1789.986] (-1787.582) (-1795.850) -- 0:03:49
363500 -- (-1789.894) (-1792.413) [-1797.775] (-1800.023) * (-1799.602) [-1789.885] (-1799.061) (-1797.413) -- 0:03:49
364000 -- (-1796.158) [-1797.390] (-1795.092) (-1791.833) * [-1797.321] (-1794.470) (-1795.254) (-1801.646) -- 0:03:48
364500 -- [-1790.499] (-1792.089) (-1803.303) (-1798.453) * [-1793.784] (-1786.144) (-1806.317) (-1791.442) -- 0:03:48
365000 -- [-1792.636] (-1794.384) (-1794.998) (-1804.463) * (-1795.668) [-1788.454] (-1796.040) (-1790.243) -- 0:03:47
Average standard deviation of split frequencies: 0.015170
365500 -- (-1798.379) [-1790.646] (-1801.128) (-1797.029) * (-1792.674) (-1799.650) [-1795.364] (-1797.222) -- 0:03:47
366000 -- (-1794.402) (-1809.627) (-1810.370) [-1792.554] * (-1795.605) [-1797.458] (-1804.168) (-1805.722) -- 0:03:48
366500 -- (-1791.653) (-1797.003) (-1800.784) [-1798.391] * (-1809.380) (-1796.746) [-1796.672] (-1804.823) -- 0:03:48
367000 -- (-1795.602) (-1790.564) (-1797.656) [-1797.530] * (-1792.608) (-1803.528) [-1789.731] (-1805.975) -- 0:03:47
367500 -- (-1793.076) (-1796.415) (-1791.532) [-1791.278] * [-1793.989] (-1795.109) (-1804.578) (-1789.468) -- 0:03:47
368000 -- (-1791.623) [-1790.070] (-1791.703) (-1807.076) * (-1794.616) [-1797.393] (-1789.990) (-1790.873) -- 0:03:48
368500 -- (-1791.230) [-1793.431] (-1797.257) (-1802.200) * (-1805.690) (-1798.539) [-1791.287] (-1787.901) -- 0:03:47
369000 -- [-1791.026] (-1794.434) (-1795.292) (-1795.010) * [-1796.086] (-1800.324) (-1803.421) (-1807.784) -- 0:03:47
369500 -- [-1785.787] (-1796.791) (-1797.765) (-1811.000) * [-1791.433] (-1797.390) (-1797.811) (-1793.131) -- 0:03:46
370000 -- (-1795.755) (-1801.427) [-1795.958] (-1810.343) * [-1789.936] (-1799.462) (-1799.792) (-1796.354) -- 0:03:46
Average standard deviation of split frequencies: 0.014413
370500 -- (-1794.775) [-1792.888] (-1809.486) (-1805.514) * (-1788.858) [-1795.181] (-1791.017) (-1805.103) -- 0:03:45
371000 -- [-1794.213] (-1790.701) (-1798.132) (-1803.331) * (-1790.412) [-1792.235] (-1792.254) (-1797.830) -- 0:03:47
371500 -- (-1799.517) [-1794.622] (-1792.385) (-1799.225) * (-1795.298) [-1788.782] (-1806.173) (-1790.167) -- 0:03:46
372000 -- (-1805.321) (-1795.846) (-1793.074) [-1790.774] * (-1798.215) [-1790.176] (-1800.878) (-1793.639) -- 0:03:46
372500 -- (-1803.562) (-1791.320) (-1801.880) [-1793.014] * [-1797.069] (-1793.526) (-1801.581) (-1792.290) -- 0:03:45
373000 -- (-1792.390) (-1792.445) (-1802.796) [-1787.685] * [-1797.789] (-1786.598) (-1802.790) (-1796.741) -- 0:03:45
373500 -- [-1798.671] (-1788.067) (-1791.569) (-1798.028) * (-1800.076) [-1792.388] (-1798.246) (-1788.377) -- 0:03:46
374000 -- (-1796.879) (-1807.479) (-1793.218) [-1788.886] * (-1802.318) (-1786.108) (-1799.990) [-1800.070] -- 0:03:45
374500 -- (-1793.693) (-1804.153) (-1801.402) [-1794.402] * (-1794.562) (-1800.164) [-1794.578] (-1792.937) -- 0:03:45
375000 -- (-1793.103) (-1793.682) (-1798.500) [-1791.570] * (-1795.398) (-1792.590) [-1796.357] (-1800.627) -- 0:03:45
Average standard deviation of split frequencies: 0.014766
375500 -- (-1803.175) (-1796.310) (-1803.305) [-1799.003] * [-1789.014] (-1788.818) (-1791.345) (-1793.808) -- 0:03:44
376000 -- (-1790.186) [-1797.045] (-1796.651) (-1794.992) * (-1793.332) (-1794.254) (-1797.793) [-1792.792] -- 0:03:44
376500 -- [-1796.594] (-1798.340) (-1797.078) (-1797.023) * [-1795.629] (-1798.111) (-1791.514) (-1796.698) -- 0:03:45
377000 -- (-1795.953) (-1800.574) [-1794.014] (-1797.098) * (-1790.132) (-1796.511) [-1795.036] (-1791.448) -- 0:03:44
377500 -- [-1792.889] (-1796.507) (-1803.738) (-1794.608) * [-1791.464] (-1791.153) (-1801.879) (-1798.353) -- 0:03:44
378000 -- (-1808.260) (-1794.581) (-1794.864) [-1799.461] * [-1797.253] (-1794.131) (-1806.257) (-1790.495) -- 0:03:43
378500 -- [-1791.477] (-1804.351) (-1803.458) (-1797.435) * (-1806.041) [-1794.482] (-1805.798) (-1794.868) -- 0:03:43
379000 -- (-1808.143) [-1792.900] (-1801.191) (-1793.523) * [-1786.477] (-1792.923) (-1791.874) (-1792.995) -- 0:03:44
379500 -- (-1799.197) [-1793.284] (-1804.162) (-1790.232) * (-1790.391) (-1791.087) [-1791.794] (-1798.420) -- 0:03:44
380000 -- (-1793.153) [-1800.465] (-1791.810) (-1801.815) * (-1807.733) (-1793.240) [-1787.358] (-1797.264) -- 0:03:43
Average standard deviation of split frequencies: 0.014585
380500 -- (-1794.748) (-1790.741) [-1787.979] (-1790.975) * (-1792.855) (-1803.889) [-1803.047] (-1793.514) -- 0:03:43
381000 -- (-1794.979) (-1797.525) (-1792.354) [-1795.375] * (-1801.295) (-1792.806) [-1791.284] (-1787.990) -- 0:03:42
381500 -- (-1792.486) [-1792.555] (-1788.344) (-1793.903) * (-1799.335) (-1798.562) [-1788.722] (-1794.619) -- 0:03:42
382000 -- (-1794.556) (-1796.989) [-1795.640] (-1790.568) * [-1789.184] (-1795.587) (-1801.909) (-1789.686) -- 0:03:43
382500 -- (-1803.930) [-1793.899] (-1792.876) (-1793.549) * [-1792.777] (-1799.024) (-1797.366) (-1801.875) -- 0:03:42
383000 -- [-1796.873] (-1793.698) (-1796.273) (-1794.367) * (-1794.915) (-1796.439) (-1790.818) [-1796.565] -- 0:03:42
383500 -- (-1797.567) [-1794.995] (-1793.461) (-1794.932) * [-1790.491] (-1797.127) (-1801.883) (-1809.345) -- 0:03:41
384000 -- [-1793.486] (-1797.868) (-1796.434) (-1795.757) * (-1789.480) (-1792.258) [-1794.443] (-1801.966) -- 0:03:41
384500 -- [-1790.462] (-1788.512) (-1803.244) (-1792.030) * [-1791.000] (-1791.828) (-1797.161) (-1794.065) -- 0:03:40
385000 -- [-1796.792] (-1788.688) (-1793.607) (-1794.037) * (-1797.033) [-1796.529] (-1794.537) (-1795.031) -- 0:03:42
Average standard deviation of split frequencies: 0.013977
385500 -- (-1797.532) [-1792.835] (-1794.923) (-1797.084) * (-1796.918) [-1792.037] (-1789.379) (-1794.134) -- 0:03:41
386000 -- [-1792.239] (-1797.538) (-1792.253) (-1800.970) * (-1788.234) [-1782.040] (-1789.629) (-1795.939) -- 0:03:41
386500 -- (-1788.925) (-1793.025) (-1807.247) [-1794.475] * (-1790.811) (-1792.980) (-1796.182) [-1794.410] -- 0:03:40
387000 -- (-1800.904) (-1797.039) (-1803.268) [-1791.472] * (-1798.688) [-1789.448] (-1796.002) (-1796.863) -- 0:03:40
387500 -- (-1796.193) (-1806.470) (-1803.335) [-1792.448] * [-1798.729] (-1795.615) (-1788.889) (-1791.104) -- 0:03:41
388000 -- (-1797.067) [-1799.013] (-1798.738) (-1793.595) * (-1797.332) (-1804.782) [-1792.055] (-1793.286) -- 0:03:40
388500 -- (-1793.538) (-1801.167) (-1797.220) [-1796.499] * [-1796.177] (-1791.057) (-1796.182) (-1798.540) -- 0:03:40
389000 -- (-1792.336) (-1810.582) (-1801.998) [-1789.152] * (-1791.271) (-1791.969) [-1791.693] (-1796.653) -- 0:03:39
389500 -- (-1792.685) (-1801.212) (-1795.359) [-1793.095] * (-1799.657) (-1791.468) (-1785.933) [-1797.875] -- 0:03:39
390000 -- [-1796.023] (-1803.192) (-1795.054) (-1794.243) * [-1790.545] (-1798.198) (-1805.776) (-1797.891) -- 0:03:38
Average standard deviation of split frequencies: 0.014346
390500 -- (-1792.078) [-1802.083] (-1789.466) (-1797.064) * [-1796.011] (-1797.174) (-1800.710) (-1803.885) -- 0:03:40
391000 -- (-1795.346) (-1801.347) (-1802.266) [-1789.931] * (-1792.721) [-1790.479] (-1797.032) (-1791.252) -- 0:03:39
391500 -- (-1795.283) (-1792.851) [-1801.496] (-1797.118) * (-1803.050) (-1796.052) (-1797.429) [-1792.954] -- 0:03:39
392000 -- (-1792.957) (-1790.510) (-1799.682) [-1794.349] * [-1801.672] (-1795.575) (-1793.166) (-1790.644) -- 0:03:38
392500 -- (-1806.222) (-1800.937) (-1791.645) [-1790.370] * (-1792.710) (-1804.958) [-1800.788] (-1791.505) -- 0:03:38
393000 -- (-1802.751) (-1803.794) (-1795.870) [-1793.141] * [-1785.444] (-1796.165) (-1799.544) (-1791.380) -- 0:03:39
393500 -- (-1794.037) (-1795.383) [-1796.129] (-1796.409) * (-1792.487) (-1800.506) [-1800.116] (-1786.526) -- 0:03:38
394000 -- (-1794.323) (-1796.349) [-1795.725] (-1796.406) * (-1809.633) [-1800.516] (-1793.439) (-1805.284) -- 0:03:38
394500 -- (-1802.980) (-1801.085) [-1794.552] (-1798.345) * (-1794.062) [-1796.845] (-1797.876) (-1800.637) -- 0:03:37
395000 -- (-1796.444) (-1788.013) (-1794.392) [-1794.271] * (-1795.834) [-1797.795] (-1794.593) (-1804.617) -- 0:03:37
Average standard deviation of split frequencies: 0.015475
395500 -- (-1790.614) (-1802.664) [-1791.260] (-1787.655) * (-1794.213) [-1792.567] (-1793.703) (-1797.613) -- 0:03:37
396000 -- (-1798.642) [-1797.564] (-1793.252) (-1795.750) * (-1796.917) (-1800.908) (-1813.505) [-1802.439] -- 0:03:38
396500 -- [-1794.079] (-1799.900) (-1800.843) (-1792.785) * (-1792.338) [-1795.379] (-1799.985) (-1800.629) -- 0:03:37
397000 -- (-1793.330) [-1797.315] (-1792.446) (-1793.446) * [-1790.701] (-1797.914) (-1798.648) (-1789.204) -- 0:03:37
397500 -- (-1798.670) [-1792.029] (-1802.046) (-1795.733) * (-1794.277) (-1807.532) [-1797.390] (-1789.836) -- 0:03:36
398000 -- [-1792.595] (-1795.255) (-1792.810) (-1793.810) * (-1798.912) (-1794.793) [-1797.890] (-1790.832) -- 0:03:36
398500 -- (-1793.853) (-1801.473) [-1800.776] (-1794.360) * (-1803.962) (-1790.981) [-1792.894] (-1790.970) -- 0:03:37
399000 -- (-1784.886) (-1794.601) [-1793.335] (-1794.469) * (-1800.617) [-1787.974] (-1788.809) (-1796.712) -- 0:03:36
399500 -- [-1786.305] (-1792.615) (-1799.452) (-1791.566) * (-1797.413) (-1792.892) (-1796.415) [-1792.146] -- 0:03:36
400000 -- (-1789.345) (-1795.476) (-1795.528) [-1801.876] * (-1792.172) (-1809.662) (-1798.174) [-1789.893] -- 0:03:36
Average standard deviation of split frequencies: 0.015426
400500 -- [-1792.772] (-1800.999) (-1792.676) (-1798.301) * (-1789.248) (-1799.230) (-1794.310) [-1787.732] -- 0:03:35
401000 -- (-1799.909) [-1798.971] (-1791.081) (-1800.585) * (-1795.893) [-1799.150] (-1794.039) (-1800.875) -- 0:03:35
401500 -- (-1793.311) (-1795.188) [-1799.039] (-1801.664) * (-1794.844) [-1790.417] (-1793.674) (-1802.311) -- 0:03:36
402000 -- (-1795.441) (-1793.231) (-1795.006) [-1789.972] * (-1791.883) [-1787.962] (-1793.128) (-1801.832) -- 0:03:35
402500 -- [-1796.567] (-1786.449) (-1805.006) (-1796.834) * (-1790.497) (-1803.769) [-1800.788] (-1798.732) -- 0:03:35
403000 -- [-1796.600] (-1789.814) (-1799.210) (-1817.925) * [-1788.735] (-1800.209) (-1799.381) (-1803.002) -- 0:03:34
403500 -- (-1799.931) [-1802.385] (-1798.929) (-1806.044) * (-1799.653) (-1789.530) (-1794.368) [-1797.130] -- 0:03:34
404000 -- [-1794.358] (-1791.350) (-1808.761) (-1794.170) * [-1787.556] (-1792.095) (-1808.806) (-1797.681) -- 0:03:35
404500 -- (-1795.849) [-1791.694] (-1805.580) (-1791.097) * [-1792.870] (-1801.545) (-1795.975) (-1786.152) -- 0:03:34
405000 -- (-1792.524) (-1792.261) (-1806.515) [-1789.583] * (-1796.913) [-1799.370] (-1788.395) (-1789.426) -- 0:03:34
Average standard deviation of split frequencies: 0.016513
405500 -- [-1788.668] (-1797.700) (-1795.771) (-1796.796) * (-1798.620) [-1797.756] (-1799.652) (-1798.300) -- 0:03:34
406000 -- (-1793.989) [-1791.398] (-1800.602) (-1798.704) * (-1793.840) [-1793.350] (-1793.211) (-1800.945) -- 0:03:33
406500 -- (-1790.924) (-1798.125) (-1793.176) [-1796.541] * (-1790.386) (-1787.580) [-1794.737] (-1799.033) -- 0:03:33
407000 -- (-1796.274) [-1796.797] (-1802.991) (-1797.684) * [-1790.700] (-1798.257) (-1792.407) (-1792.706) -- 0:03:34
407500 -- (-1793.366) (-1796.844) [-1811.637] (-1792.635) * [-1796.238] (-1797.373) (-1799.494) (-1796.255) -- 0:03:33
408000 -- (-1793.185) (-1802.695) (-1813.106) [-1790.470] * (-1795.662) (-1799.009) [-1802.371] (-1786.794) -- 0:03:33
408500 -- (-1792.768) [-1794.866] (-1802.683) (-1793.591) * (-1794.832) (-1794.030) [-1790.394] (-1799.442) -- 0:03:32
409000 -- [-1795.817] (-1798.184) (-1802.156) (-1793.834) * (-1798.381) (-1799.236) [-1786.642] (-1792.371) -- 0:03:32
409500 -- [-1791.429] (-1801.187) (-1795.692) (-1799.334) * [-1797.124] (-1793.413) (-1800.789) (-1800.152) -- 0:03:33
410000 -- [-1802.808] (-1791.833) (-1804.385) (-1807.449) * [-1792.754] (-1787.582) (-1792.749) (-1797.793) -- 0:03:32
Average standard deviation of split frequencies: 0.014795
410500 -- [-1796.573] (-1800.750) (-1799.680) (-1798.242) * (-1797.306) (-1793.846) [-1797.898] (-1800.696) -- 0:03:32
411000 -- [-1797.339] (-1799.468) (-1793.091) (-1801.021) * (-1791.433) (-1797.481) [-1795.011] (-1802.297) -- 0:03:32
411500 -- (-1790.253) (-1799.070) [-1793.052] (-1800.906) * [-1796.103] (-1806.437) (-1800.995) (-1801.234) -- 0:03:31
412000 -- (-1794.874) [-1800.831] (-1792.394) (-1795.806) * [-1793.609] (-1806.003) (-1798.395) (-1801.709) -- 0:03:31
412500 -- (-1801.050) (-1785.981) (-1793.149) [-1788.593] * (-1794.368) (-1796.870) [-1792.675] (-1791.979) -- 0:03:32
413000 -- (-1796.024) (-1800.746) (-1789.737) [-1793.028] * [-1788.937] (-1797.852) (-1787.066) (-1798.958) -- 0:03:31
413500 -- (-1789.743) [-1796.483] (-1800.631) (-1800.884) * (-1800.779) (-1791.073) [-1794.187] (-1809.506) -- 0:03:31
414000 -- [-1791.930] (-1806.513) (-1798.339) (-1792.825) * (-1796.757) (-1790.868) (-1794.472) [-1798.899] -- 0:03:30
414500 -- [-1797.385] (-1801.351) (-1800.513) (-1807.805) * (-1790.758) (-1797.159) [-1791.653] (-1795.516) -- 0:03:30
415000 -- (-1799.299) (-1799.825) [-1792.666] (-1791.870) * (-1797.494) [-1787.631] (-1790.668) (-1791.781) -- 0:03:30
Average standard deviation of split frequencies: 0.012843
415500 -- (-1799.845) (-1799.651) [-1788.270] (-1794.855) * (-1791.905) [-1795.607] (-1796.947) (-1796.826) -- 0:03:31
416000 -- (-1791.025) (-1797.924) [-1786.328] (-1798.536) * (-1808.500) [-1792.849] (-1793.263) (-1793.838) -- 0:03:30
416500 -- (-1792.631) [-1793.012] (-1804.845) (-1799.883) * (-1799.498) (-1813.370) [-1792.346] (-1796.772) -- 0:03:30
417000 -- (-1802.140) [-1796.943] (-1803.655) (-1796.352) * (-1794.612) [-1786.418] (-1791.638) (-1792.493) -- 0:03:29
417500 -- (-1799.068) (-1798.416) [-1788.758] (-1799.973) * (-1795.056) [-1785.269] (-1791.049) (-1801.154) -- 0:03:29
418000 -- [-1798.793] (-1819.947) (-1789.556) (-1797.428) * (-1796.586) (-1800.186) (-1793.262) [-1797.441] -- 0:03:30
418500 -- (-1794.426) [-1793.907] (-1793.688) (-1791.880) * (-1791.437) (-1790.691) (-1792.679) [-1795.283] -- 0:03:29
419000 -- (-1791.300) (-1798.947) (-1797.707) [-1789.968] * (-1791.579) (-1798.314) (-1804.486) [-1790.095] -- 0:03:29
419500 -- (-1792.106) [-1802.994] (-1806.013) (-1799.357) * (-1795.593) (-1799.258) (-1802.157) [-1799.302] -- 0:03:28
420000 -- (-1801.959) (-1804.093) (-1798.702) [-1790.733] * (-1790.469) (-1799.151) [-1800.395] (-1801.357) -- 0:03:28
Average standard deviation of split frequencies: 0.011953
420500 -- (-1788.720) [-1789.850] (-1798.543) (-1800.362) * [-1787.853] (-1790.299) (-1794.082) (-1794.962) -- 0:03:28
421000 -- (-1797.629) (-1797.420) [-1795.363] (-1807.958) * (-1799.898) (-1793.947) [-1789.583] (-1796.202) -- 0:03:29
421500 -- (-1799.010) [-1792.493] (-1801.754) (-1799.123) * (-1796.145) (-1796.785) [-1798.153] (-1795.066) -- 0:03:28
422000 -- (-1800.188) (-1793.165) [-1796.271] (-1797.792) * (-1797.320) (-1796.904) [-1800.603] (-1798.696) -- 0:03:28
422500 -- [-1793.076] (-1798.074) (-1799.658) (-1786.953) * [-1794.515] (-1792.695) (-1794.461) (-1800.686) -- 0:03:27
423000 -- (-1796.694) [-1799.148] (-1799.391) (-1794.479) * [-1794.259] (-1794.910) (-1792.299) (-1796.686) -- 0:03:27
423500 -- [-1796.815] (-1796.676) (-1806.678) (-1808.832) * (-1786.936) (-1801.212) (-1790.145) [-1798.318] -- 0:03:28
424000 -- (-1794.102) [-1798.828] (-1797.865) (-1802.560) * (-1795.404) (-1795.601) (-1796.092) [-1790.861] -- 0:03:27
424500 -- [-1796.317] (-1791.011) (-1802.992) (-1800.128) * (-1788.659) (-1795.637) [-1798.048] (-1792.761) -- 0:03:27
425000 -- (-1808.946) [-1796.602] (-1798.171) (-1802.021) * [-1802.111] (-1790.878) (-1798.534) (-1792.239) -- 0:03:27
Average standard deviation of split frequencies: 0.011312
425500 -- (-1790.697) (-1792.507) [-1793.126] (-1797.058) * (-1794.048) [-1793.774] (-1796.356) (-1803.299) -- 0:03:26
426000 -- (-1791.893) (-1793.735) [-1796.066] (-1799.732) * (-1793.472) (-1794.095) [-1789.023] (-1801.621) -- 0:03:26
426500 -- [-1790.910] (-1791.508) (-1808.573) (-1801.134) * (-1792.604) [-1788.614] (-1790.383) (-1803.031) -- 0:03:27
427000 -- (-1792.726) (-1803.055) [-1795.444] (-1796.395) * (-1797.767) [-1791.867] (-1786.259) (-1801.091) -- 0:03:26
427500 -- [-1790.082] (-1804.286) (-1799.031) (-1793.677) * (-1789.515) (-1804.461) (-1790.497) [-1792.637] -- 0:03:26
428000 -- (-1787.750) (-1798.000) [-1795.034] (-1790.200) * (-1796.535) [-1795.724] (-1793.603) (-1800.981) -- 0:03:25
428500 -- (-1800.911) [-1806.964] (-1796.466) (-1799.510) * (-1793.858) (-1793.530) [-1799.861] (-1792.247) -- 0:03:25
429000 -- [-1796.180] (-1800.061) (-1795.599) (-1796.595) * (-1804.375) (-1795.551) (-1798.648) [-1794.054] -- 0:03:26
429500 -- (-1792.906) (-1796.165) (-1794.459) [-1795.119] * (-1803.211) [-1791.646] (-1801.703) (-1795.179) -- 0:03:25
430000 -- (-1805.255) (-1796.286) (-1793.918) [-1799.370] * (-1793.235) (-1793.410) (-1794.996) [-1789.926] -- 0:03:25
Average standard deviation of split frequencies: 0.011676
430500 -- (-1795.216) (-1801.550) (-1788.126) [-1793.634] * [-1791.044] (-1799.603) (-1790.181) (-1793.839) -- 0:03:25
431000 -- [-1795.734] (-1797.651) (-1794.845) (-1802.568) * (-1789.994) (-1798.707) [-1794.724] (-1790.413) -- 0:03:24
431500 -- [-1796.916] (-1808.188) (-1798.516) (-1796.319) * (-1792.217) [-1790.701] (-1798.177) (-1796.088) -- 0:03:24
432000 -- [-1801.941] (-1797.246) (-1805.327) (-1790.914) * (-1803.896) [-1795.957] (-1797.018) (-1793.707) -- 0:03:25
432500 -- [-1794.126] (-1801.729) (-1795.972) (-1802.228) * (-1794.767) (-1794.822) (-1791.137) [-1797.509] -- 0:03:24
433000 -- [-1787.353] (-1803.518) (-1792.914) (-1800.934) * (-1794.589) (-1797.947) [-1793.539] (-1798.673) -- 0:03:24
433500 -- (-1791.299) [-1794.718] (-1801.130) (-1793.334) * (-1792.147) (-1799.402) (-1796.550) [-1792.661] -- 0:03:23
434000 -- [-1794.520] (-1792.934) (-1794.500) (-1802.728) * [-1795.952] (-1791.620) (-1799.340) (-1790.909) -- 0:03:23
434500 -- [-1794.208] (-1794.460) (-1790.522) (-1789.135) * [-1793.305] (-1806.396) (-1787.173) (-1799.247) -- 0:03:23
435000 -- (-1797.048) (-1792.555) (-1800.522) [-1784.517] * (-1797.751) (-1800.629) [-1789.409] (-1804.196) -- 0:03:23
Average standard deviation of split frequencies: 0.011893
435500 -- (-1793.523) (-1797.427) [-1795.801] (-1794.599) * (-1800.133) (-1801.419) [-1792.671] (-1802.603) -- 0:03:23
436000 -- (-1794.923) (-1806.614) (-1798.078) [-1794.801] * [-1796.488] (-1792.886) (-1798.137) (-1810.946) -- 0:03:23
436500 -- [-1793.679] (-1796.721) (-1797.813) (-1795.934) * (-1789.824) (-1795.440) [-1800.102] (-1805.416) -- 0:03:22
437000 -- (-1796.191) (-1794.525) [-1805.123] (-1805.197) * (-1795.166) (-1788.349) (-1790.596) [-1793.094] -- 0:03:22
437500 -- (-1793.582) [-1793.959] (-1793.210) (-1794.710) * (-1809.324) (-1795.057) (-1794.291) [-1796.819] -- 0:03:23
438000 -- (-1798.148) (-1794.738) (-1792.925) [-1791.197] * (-1793.070) [-1803.698] (-1793.666) (-1795.890) -- 0:03:22
438500 -- (-1794.820) (-1800.709) (-1800.510) [-1793.186] * (-1814.064) [-1795.173] (-1790.387) (-1801.214) -- 0:03:22
439000 -- (-1796.124) [-1789.692] (-1794.129) (-1793.510) * [-1787.991] (-1793.713) (-1798.225) (-1798.418) -- 0:03:21
439500 -- [-1801.436] (-1793.152) (-1796.942) (-1796.316) * (-1796.606) [-1790.981] (-1793.259) (-1794.142) -- 0:03:21
440000 -- (-1806.491) (-1792.239) [-1790.954] (-1789.354) * (-1799.504) (-1794.433) [-1799.172] (-1802.575) -- 0:03:21
Average standard deviation of split frequencies: 0.012362
440500 -- (-1805.069) (-1798.416) (-1798.567) [-1790.255] * (-1797.473) [-1791.092] (-1797.003) (-1791.037) -- 0:03:21
441000 -- (-1794.552) (-1795.201) [-1785.642] (-1794.720) * (-1795.518) [-1791.027] (-1801.057) (-1803.611) -- 0:03:21
441500 -- [-1791.168] (-1793.052) (-1791.896) (-1795.824) * [-1791.290] (-1804.432) (-1806.139) (-1795.416) -- 0:03:21
442000 -- (-1795.429) (-1794.551) (-1796.365) [-1796.724] * [-1792.229] (-1812.344) (-1798.579) (-1798.324) -- 0:03:20
442500 -- [-1790.710] (-1796.170) (-1796.651) (-1795.252) * (-1791.746) (-1806.358) (-1797.854) [-1802.013] -- 0:03:20
443000 -- [-1796.573] (-1793.395) (-1794.309) (-1796.704) * (-1794.587) (-1793.584) [-1788.372] (-1794.402) -- 0:03:21
443500 -- (-1801.038) (-1800.059) (-1796.923) [-1798.007] * [-1787.893] (-1792.779) (-1807.079) (-1793.917) -- 0:03:20
444000 -- (-1791.119) [-1797.037] (-1799.617) (-1796.947) * [-1788.424] (-1789.126) (-1798.093) (-1796.013) -- 0:03:20
444500 -- (-1787.627) (-1803.524) (-1798.243) [-1790.364] * (-1793.895) (-1793.078) [-1800.494] (-1800.899) -- 0:03:19
445000 -- [-1790.579] (-1812.615) (-1801.929) (-1791.617) * (-1789.923) (-1796.459) [-1793.437] (-1792.587) -- 0:03:19
Average standard deviation of split frequencies: 0.013975
445500 -- (-1789.770) (-1796.747) (-1801.273) [-1792.196] * [-1794.916] (-1799.162) (-1801.570) (-1809.121) -- 0:03:19
446000 -- (-1794.561) (-1795.730) [-1789.974] (-1795.044) * [-1797.063] (-1791.629) (-1802.970) (-1791.649) -- 0:03:19
446500 -- (-1794.117) (-1802.679) (-1796.061) [-1794.313] * (-1801.307) (-1790.113) [-1794.951] (-1801.231) -- 0:03:19
447000 -- (-1797.261) (-1792.002) (-1798.333) [-1794.840] * [-1791.352] (-1790.428) (-1793.843) (-1801.127) -- 0:03:19
447500 -- [-1794.176] (-1794.842) (-1796.902) (-1801.758) * (-1797.385) (-1801.474) [-1794.907] (-1802.133) -- 0:03:18
448000 -- (-1792.968) (-1795.726) (-1803.831) [-1791.407] * (-1798.557) (-1794.729) [-1791.995] (-1799.250) -- 0:03:18
448500 -- (-1799.074) [-1798.225] (-1794.403) (-1793.920) * [-1792.161] (-1795.980) (-1790.530) (-1797.829) -- 0:03:17
449000 -- (-1792.964) [-1794.367] (-1798.925) (-1797.295) * (-1805.748) (-1792.742) (-1796.953) [-1809.767] -- 0:03:18
449500 -- [-1791.033] (-1797.567) (-1790.966) (-1797.670) * (-1799.796) [-1786.242] (-1797.023) (-1799.109) -- 0:03:18
450000 -- (-1797.015) [-1788.152] (-1791.630) (-1806.399) * (-1796.701) (-1792.193) (-1790.403) [-1793.557] -- 0:03:18
Average standard deviation of split frequencies: 0.012668
450500 -- (-1800.891) [-1785.607] (-1791.317) (-1798.338) * (-1793.782) (-1801.175) (-1797.125) [-1796.256] -- 0:03:17
451000 -- (-1793.464) [-1789.536] (-1791.523) (-1791.417) * (-1796.142) (-1802.199) (-1799.186) [-1792.150] -- 0:03:17
451500 -- [-1797.990] (-1790.763) (-1801.973) (-1792.297) * (-1793.663) [-1795.970] (-1798.414) (-1792.981) -- 0:03:18
452000 -- (-1799.626) (-1794.639) (-1800.641) [-1796.434] * (-1798.583) (-1802.458) [-1791.786] (-1793.612) -- 0:03:17
452500 -- (-1793.592) [-1803.138] (-1798.012) (-1794.271) * (-1802.723) (-1801.719) [-1793.302] (-1792.641) -- 0:03:17
453000 -- (-1796.629) [-1792.611] (-1791.838) (-1795.231) * (-1795.902) (-1794.856) [-1796.434] (-1794.744) -- 0:03:16
453500 -- [-1788.848] (-1804.736) (-1790.099) (-1800.498) * (-1800.467) (-1794.719) [-1795.852] (-1783.973) -- 0:03:16
454000 -- (-1797.524) (-1799.289) (-1790.474) [-1792.078] * (-1790.400) (-1803.712) [-1784.351] (-1790.758) -- 0:03:16
454500 -- (-1796.933) (-1798.194) (-1787.216) [-1793.928] * (-1791.364) (-1798.196) [-1791.550] (-1794.466) -- 0:03:16
455000 -- (-1802.601) (-1791.507) [-1793.069] (-1794.904) * (-1798.827) (-1800.336) (-1794.107) [-1797.806] -- 0:03:16
Average standard deviation of split frequencies: 0.012176
455500 -- [-1798.286] (-1787.558) (-1795.178) (-1802.156) * (-1792.181) [-1794.785] (-1795.130) (-1804.814) -- 0:03:16
456000 -- (-1801.080) (-1793.001) [-1794.924] (-1811.780) * (-1804.389) (-1798.477) (-1793.613) [-1804.759] -- 0:03:15
456500 -- (-1794.554) (-1795.294) [-1794.404] (-1794.865) * [-1790.506] (-1793.528) (-1802.975) (-1797.673) -- 0:03:15
457000 -- [-1797.367] (-1800.315) (-1792.446) (-1792.323) * (-1788.160) (-1794.679) (-1803.815) [-1790.803] -- 0:03:16
457500 -- (-1808.392) (-1793.799) (-1788.469) [-1794.672] * (-1798.310) [-1786.910] (-1792.971) (-1802.214) -- 0:03:15
458000 -- [-1787.660] (-1791.285) (-1793.832) (-1796.212) * (-1820.364) (-1787.283) [-1795.304] (-1793.319) -- 0:03:15
458500 -- (-1789.382) (-1785.836) [-1799.279] (-1789.039) * (-1800.282) [-1788.851] (-1796.489) (-1795.695) -- 0:03:14
459000 -- (-1799.036) (-1801.767) [-1790.075] (-1791.094) * (-1800.773) (-1794.478) (-1801.883) [-1790.422] -- 0:03:14
459500 -- [-1790.839] (-1804.116) (-1797.363) (-1793.767) * [-1793.720] (-1799.834) (-1799.223) (-1799.336) -- 0:03:14
460000 -- (-1794.903) [-1789.911] (-1796.168) (-1794.600) * (-1794.161) (-1798.966) [-1793.658] (-1800.677) -- 0:03:14
Average standard deviation of split frequencies: 0.013076
460500 -- (-1789.216) (-1790.416) (-1794.301) [-1791.403] * (-1792.078) [-1799.154] (-1792.350) (-1804.648) -- 0:03:14
461000 -- [-1794.998] (-1798.331) (-1793.968) (-1791.316) * (-1797.396) (-1793.857) (-1793.451) [-1794.582] -- 0:03:14
461500 -- (-1792.391) [-1793.822] (-1798.766) (-1790.807) * (-1789.521) [-1797.859] (-1794.099) (-1791.983) -- 0:03:13
462000 -- [-1797.119] (-1795.489) (-1790.998) (-1796.039) * (-1795.720) [-1793.272] (-1808.262) (-1800.069) -- 0:03:14
462500 -- (-1801.492) (-1789.071) [-1786.999] (-1796.526) * (-1798.444) (-1797.650) (-1796.810) [-1786.738] -- 0:03:14
463000 -- (-1806.538) (-1793.023) [-1794.072] (-1797.436) * (-1801.263) [-1796.465] (-1791.246) (-1800.290) -- 0:03:13
463500 -- (-1801.684) [-1788.423] (-1791.827) (-1788.955) * [-1802.008] (-1804.855) (-1813.379) (-1792.206) -- 0:03:13
464000 -- (-1811.684) [-1792.979] (-1789.344) (-1792.106) * [-1797.362] (-1798.855) (-1797.128) (-1794.974) -- 0:03:12
464500 -- (-1798.392) (-1800.710) [-1796.377] (-1795.378) * (-1791.140) (-1800.214) (-1796.780) [-1800.471] -- 0:03:13
465000 -- (-1797.494) (-1795.887) (-1807.511) [-1794.641] * [-1792.791] (-1791.779) (-1795.475) (-1794.563) -- 0:03:13
Average standard deviation of split frequencies: 0.013263
465500 -- (-1791.657) (-1801.356) (-1793.670) [-1788.646] * [-1794.809] (-1802.323) (-1793.010) (-1793.034) -- 0:03:12
466000 -- (-1790.403) (-1796.581) (-1805.822) [-1790.651] * (-1800.589) [-1791.690] (-1794.819) (-1798.195) -- 0:03:12
466500 -- (-1795.164) [-1786.202] (-1797.131) (-1800.241) * [-1788.472] (-1793.383) (-1793.633) (-1800.555) -- 0:03:12
467000 -- (-1793.748) (-1795.599) (-1795.299) [-1793.633] * (-1798.029) (-1791.143) (-1796.780) [-1788.900] -- 0:03:11
467500 -- (-1796.039) (-1792.652) (-1796.417) [-1795.763] * (-1790.314) [-1787.254] (-1797.838) (-1795.794) -- 0:03:12
468000 -- (-1798.508) (-1796.054) [-1796.636] (-1798.864) * (-1798.531) (-1794.156) (-1792.989) [-1792.647] -- 0:03:12
468500 -- [-1794.775] (-1800.900) (-1803.799) (-1793.095) * [-1793.485] (-1794.284) (-1787.266) (-1798.798) -- 0:03:11
469000 -- (-1802.985) (-1793.342) [-1789.471] (-1798.394) * (-1796.517) (-1805.907) (-1800.233) [-1796.922] -- 0:03:11
469500 -- (-1792.581) (-1810.989) (-1793.198) [-1790.242] * [-1792.534] (-1789.987) (-1792.975) (-1803.744) -- 0:03:10
470000 -- [-1798.431] (-1795.061) (-1794.367) (-1806.077) * [-1799.018] (-1790.307) (-1800.239) (-1803.120) -- 0:03:11
Average standard deviation of split frequencies: 0.011908
470500 -- [-1793.452] (-1792.775) (-1794.594) (-1798.333) * (-1791.421) [-1789.096] (-1801.132) (-1801.457) -- 0:03:11
471000 -- (-1795.285) (-1804.620) [-1793.829] (-1787.478) * (-1787.758) [-1794.861] (-1799.930) (-1808.689) -- 0:03:10
471500 -- (-1793.190) (-1805.592) [-1789.068] (-1791.563) * (-1796.333) [-1792.919] (-1794.511) (-1803.764) -- 0:03:10
472000 -- [-1798.901] (-1797.501) (-1792.040) (-1799.978) * (-1791.985) [-1793.510] (-1796.082) (-1803.743) -- 0:03:10
472500 -- (-1795.040) (-1791.847) (-1794.194) [-1804.813] * (-1803.241) (-1799.961) [-1790.506] (-1798.230) -- 0:03:10
473000 -- (-1794.432) [-1792.427] (-1789.703) (-1796.745) * (-1805.433) [-1789.478] (-1790.531) (-1799.735) -- 0:03:10
473500 -- (-1790.775) (-1792.500) (-1792.291) [-1788.557] * [-1800.826] (-1796.254) (-1790.499) (-1788.107) -- 0:03:10
474000 -- (-1797.095) (-1795.341) [-1791.205] (-1796.640) * (-1788.927) (-1799.069) (-1798.233) [-1786.970] -- 0:03:09
474500 -- (-1796.071) (-1794.371) (-1799.283) [-1789.798] * (-1789.276) [-1793.020] (-1794.145) (-1794.789) -- 0:03:09
475000 -- (-1793.007) (-1798.541) (-1804.288) [-1789.291] * [-1791.390] (-1803.924) (-1794.444) (-1792.878) -- 0:03:10
Average standard deviation of split frequencies: 0.012764
475500 -- (-1787.777) (-1799.704) (-1797.411) [-1793.589] * (-1791.887) (-1798.133) [-1792.345] (-1792.285) -- 0:03:09
476000 -- (-1794.338) [-1793.464] (-1789.955) (-1799.911) * (-1797.377) (-1801.000) (-1805.893) [-1785.912] -- 0:03:09
476500 -- (-1793.649) (-1794.130) (-1800.799) [-1788.525] * (-1797.080) (-1800.487) [-1799.333] (-1799.109) -- 0:03:08
477000 -- (-1800.890) (-1794.688) (-1793.844) [-1794.846] * (-1791.532) (-1801.020) [-1793.371] (-1795.637) -- 0:03:08
477500 -- [-1799.522] (-1791.655) (-1800.943) (-1789.505) * (-1792.418) (-1796.431) [-1789.916] (-1801.659) -- 0:03:09
478000 -- (-1800.171) [-1792.328] (-1798.229) (-1799.681) * (-1799.930) (-1815.381) [-1795.613] (-1792.071) -- 0:03:08
478500 -- (-1799.061) (-1794.905) [-1794.607] (-1792.316) * (-1792.039) (-1809.806) (-1795.724) [-1790.750] -- 0:03:08
479000 -- (-1798.411) (-1799.955) [-1799.041] (-1804.452) * (-1792.181) (-1796.366) (-1799.256) [-1788.771] -- 0:03:08
479500 -- (-1789.231) (-1800.593) (-1802.883) [-1791.555] * [-1788.663] (-1803.138) (-1801.670) (-1799.547) -- 0:03:07
480000 -- (-1792.188) (-1793.044) (-1800.348) [-1786.158] * [-1792.340] (-1802.147) (-1790.623) (-1785.988) -- 0:03:08
Average standard deviation of split frequencies: 0.012967
480500 -- (-1800.070) (-1792.506) (-1798.124) [-1791.113] * (-1805.927) (-1799.449) (-1795.005) [-1798.015] -- 0:03:08
481000 -- [-1791.369] (-1799.340) (-1796.878) (-1792.773) * (-1808.061) (-1790.454) (-1797.489) [-1786.745] -- 0:03:07
481500 -- [-1794.154] (-1819.178) (-1798.864) (-1786.749) * (-1805.308) [-1793.237] (-1793.181) (-1795.639) -- 0:03:07
482000 -- (-1801.281) (-1797.502) [-1792.960] (-1788.051) * (-1796.815) (-1793.679) (-1790.099) [-1793.815] -- 0:03:06
482500 -- (-1802.943) (-1808.060) (-1795.037) [-1793.327] * (-1799.486) (-1790.909) (-1798.273) [-1789.114] -- 0:03:07
483000 -- (-1806.905) (-1803.814) (-1799.621) [-1788.833] * (-1800.183) (-1788.805) [-1787.339] (-1798.093) -- 0:03:07
483500 -- (-1795.144) (-1792.959) (-1802.529) [-1797.342] * (-1797.933) (-1799.022) [-1799.593] (-1800.501) -- 0:03:06
484000 -- (-1797.092) [-1792.753] (-1803.063) (-1794.137) * (-1794.265) (-1788.033) [-1790.778] (-1792.596) -- 0:03:06
484500 -- (-1790.942) (-1792.894) (-1811.246) [-1793.388] * (-1790.677) [-1793.294] (-1793.162) (-1800.203) -- 0:03:06
485000 -- (-1800.676) (-1801.366) [-1795.247] (-1792.399) * (-1788.431) [-1790.953] (-1799.429) (-1794.107) -- 0:03:06
Average standard deviation of split frequencies: 0.012610
485500 -- (-1790.732) (-1793.393) [-1801.850] (-1797.512) * (-1793.294) (-1795.059) (-1815.710) [-1792.810] -- 0:03:06
486000 -- (-1788.113) [-1791.993] (-1797.334) (-1796.621) * (-1789.568) [-1790.137] (-1804.500) (-1789.038) -- 0:03:06
486500 -- [-1797.637] (-1800.644) (-1803.272) (-1796.133) * [-1790.257] (-1801.667) (-1787.512) (-1795.439) -- 0:03:05
487000 -- (-1798.346) [-1798.391] (-1796.633) (-1796.529) * (-1805.072) [-1792.846] (-1791.975) (-1791.473) -- 0:03:05
487500 -- [-1789.918] (-1798.482) (-1794.497) (-1799.605) * [-1798.262] (-1794.612) (-1794.401) (-1792.940) -- 0:03:06
488000 -- [-1795.294] (-1796.244) (-1803.304) (-1809.425) * (-1789.485) (-1794.287) [-1791.203] (-1796.006) -- 0:03:05
488500 -- (-1794.928) (-1802.808) (-1791.326) [-1794.913] * (-1801.913) (-1792.688) (-1794.486) [-1796.500] -- 0:03:05
489000 -- (-1793.564) (-1793.041) [-1798.638] (-1787.518) * (-1812.544) [-1791.611] (-1799.439) (-1800.349) -- 0:03:04
489500 -- [-1793.599] (-1796.506) (-1799.317) (-1795.426) * (-1804.217) [-1797.106] (-1794.472) (-1798.767) -- 0:03:04
490000 -- (-1798.418) (-1789.323) [-1803.091] (-1797.142) * (-1791.080) [-1798.296] (-1803.984) (-1793.924) -- 0:03:04
Average standard deviation of split frequencies: 0.012596
490500 -- (-1800.684) (-1791.611) (-1797.685) [-1793.354] * (-1797.804) [-1793.158] (-1793.147) (-1788.728) -- 0:03:04
491000 -- [-1791.485] (-1791.953) (-1794.382) (-1803.267) * (-1795.839) (-1798.054) (-1800.068) [-1790.348] -- 0:03:04
491500 -- (-1789.003) [-1791.516] (-1790.511) (-1797.457) * (-1793.684) [-1795.878] (-1788.432) (-1794.801) -- 0:03:04
492000 -- (-1789.577) (-1793.656) (-1799.991) [-1798.759] * [-1791.641] (-1805.002) (-1795.604) (-1794.658) -- 0:03:03
492500 -- (-1795.676) (-1792.512) [-1788.752] (-1798.997) * (-1794.158) (-1800.999) (-1798.872) [-1790.963] -- 0:03:03
493000 -- (-1799.924) [-1791.179] (-1798.332) (-1794.636) * (-1796.887) [-1802.331] (-1799.558) (-1797.131) -- 0:03:04
493500 -- (-1792.006) (-1800.053) (-1800.184) [-1794.994] * (-1798.282) (-1798.779) [-1794.282] (-1797.033) -- 0:03:03
494000 -- [-1797.371] (-1793.050) (-1800.383) (-1799.686) * (-1794.889) (-1793.517) (-1794.381) [-1796.272] -- 0:03:03
494500 -- [-1793.491] (-1795.379) (-1798.719) (-1792.216) * (-1803.139) (-1799.658) (-1794.287) [-1792.445] -- 0:03:02
495000 -- (-1792.566) [-1794.989] (-1788.621) (-1791.621) * [-1792.741] (-1801.050) (-1799.661) (-1806.114) -- 0:03:02
Average standard deviation of split frequencies: 0.013517
495500 -- (-1795.691) (-1795.235) (-1793.607) [-1793.198] * (-1791.390) (-1801.370) [-1790.627] (-1808.204) -- 0:03:02
496000 -- (-1792.625) [-1794.484] (-1789.321) (-1804.107) * (-1789.232) [-1798.759] (-1796.037) (-1800.561) -- 0:03:02
496500 -- (-1800.115) [-1794.100] (-1794.295) (-1793.476) * (-1801.090) (-1796.394) [-1790.702] (-1796.601) -- 0:03:02
497000 -- (-1793.741) (-1789.611) [-1790.669] (-1802.437) * (-1790.363) (-1791.538) [-1794.585] (-1797.763) -- 0:03:02
497500 -- (-1794.149) (-1803.372) [-1798.432] (-1798.607) * (-1796.037) [-1798.770] (-1792.836) (-1804.143) -- 0:03:01
498000 -- [-1788.516] (-1790.877) (-1802.777) (-1791.365) * (-1803.124) (-1795.976) [-1796.360] (-1800.334) -- 0:03:01
498500 -- (-1796.187) (-1794.650) (-1792.705) [-1794.681] * (-1796.190) (-1794.263) (-1803.428) [-1797.710] -- 0:03:02
499000 -- (-1802.146) (-1794.839) (-1801.518) [-1792.541] * (-1794.641) (-1791.731) (-1798.814) [-1793.300] -- 0:03:01
499500 -- (-1790.760) [-1801.021] (-1794.067) (-1795.629) * (-1801.096) (-1795.206) (-1794.707) [-1787.300] -- 0:03:01
500000 -- (-1792.728) (-1798.621) [-1794.631] (-1795.245) * (-1792.985) [-1800.639] (-1800.725) (-1794.035) -- 0:03:01
Average standard deviation of split frequencies: 0.013705
500500 -- (-1799.139) (-1804.215) [-1794.153] (-1792.135) * (-1804.321) (-1790.982) (-1791.136) [-1786.555] -- 0:03:00
501000 -- [-1800.488] (-1794.104) (-1801.821) (-1800.628) * [-1793.873] (-1799.897) (-1795.834) (-1798.650) -- 0:03:00
501500 -- (-1807.260) (-1804.531) (-1789.239) [-1800.510] * (-1796.010) (-1800.806) [-1797.828] (-1796.152) -- 0:03:00
502000 -- (-1800.793) [-1799.723] (-1796.310) (-1794.459) * [-1789.120] (-1799.027) (-1790.227) (-1799.796) -- 0:03:00
502500 -- (-1795.058) (-1806.706) [-1792.526] (-1798.308) * (-1807.940) (-1799.344) (-1802.289) [-1794.337] -- 0:03:00
503000 -- (-1800.148) [-1793.188] (-1788.281) (-1803.883) * [-1791.267] (-1800.977) (-1791.621) (-1798.412) -- 0:02:59
503500 -- (-1797.525) [-1789.789] (-1795.932) (-1809.325) * [-1803.556] (-1796.855) (-1797.521) (-1809.534) -- 0:02:59
504000 -- (-1795.445) [-1795.725] (-1794.234) (-1800.319) * (-1805.609) [-1792.787] (-1795.954) (-1813.404) -- 0:03:00
504500 -- (-1794.651) (-1805.884) [-1792.123] (-1795.669) * (-1801.781) (-1800.647) (-1793.380) [-1791.026] -- 0:02:59
505000 -- (-1794.876) [-1797.484] (-1799.844) (-1795.520) * [-1793.118] (-1792.345) (-1794.993) (-1791.933) -- 0:02:59
Average standard deviation of split frequencies: 0.013974
505500 -- [-1789.654] (-1796.263) (-1797.073) (-1795.689) * [-1793.293] (-1797.964) (-1795.950) (-1794.309) -- 0:02:59
506000 -- (-1796.864) (-1791.481) [-1798.370] (-1797.154) * (-1795.111) (-1795.861) [-1803.395] (-1792.290) -- 0:02:58
506500 -- (-1800.279) (-1793.098) [-1795.441] (-1796.589) * (-1800.652) (-1792.632) (-1794.902) [-1792.679] -- 0:02:58
507000 -- (-1794.901) (-1793.374) (-1799.037) [-1792.878] * (-1805.085) (-1795.596) [-1793.434] (-1792.026) -- 0:02:58
507500 -- [-1794.219] (-1796.696) (-1794.392) (-1792.023) * (-1797.079) (-1794.979) (-1791.603) [-1796.133] -- 0:02:58
508000 -- [-1791.255] (-1803.174) (-1806.461) (-1790.942) * (-1795.791) (-1800.532) [-1789.045] (-1802.534) -- 0:02:58
508500 -- (-1797.905) [-1799.283] (-1794.387) (-1793.164) * (-1791.597) [-1792.531] (-1800.149) (-1791.179) -- 0:02:57
509000 -- (-1791.654) (-1800.202) (-1788.352) [-1790.413] * (-1799.151) [-1789.980] (-1800.175) (-1797.179) -- 0:02:57
509500 -- [-1798.250] (-1799.945) (-1795.502) (-1796.668) * (-1794.736) [-1790.063] (-1796.404) (-1792.998) -- 0:02:58
510000 -- (-1794.674) (-1794.497) [-1796.173] (-1789.464) * (-1796.535) (-1797.034) [-1800.154] (-1788.847) -- 0:02:57
Average standard deviation of split frequencies: 0.013642
510500 -- (-1793.137) (-1792.136) [-1796.674] (-1802.094) * (-1798.948) (-1796.792) [-1799.953] (-1792.427) -- 0:02:57
511000 -- (-1798.746) [-1791.066] (-1794.810) (-1793.487) * (-1804.966) (-1794.073) (-1796.617) [-1793.565] -- 0:02:57
511500 -- (-1799.244) (-1795.811) (-1793.679) [-1792.791] * (-1800.167) (-1797.268) (-1806.697) [-1795.314] -- 0:02:56
512000 -- (-1791.570) (-1798.985) [-1790.521] (-1795.469) * (-1799.883) [-1790.234] (-1800.185) (-1811.057) -- 0:02:56
512500 -- (-1788.368) (-1792.843) [-1792.688] (-1797.577) * (-1798.390) (-1792.573) [-1795.985] (-1792.536) -- 0:02:56
513000 -- [-1792.091] (-1791.526) (-1795.955) (-1790.583) * [-1794.305] (-1793.683) (-1796.735) (-1796.527) -- 0:02:56
513500 -- (-1791.971) [-1787.548] (-1793.177) (-1803.040) * (-1792.343) (-1796.862) [-1789.883] (-1809.882) -- 0:02:56
514000 -- (-1807.443) (-1802.668) (-1791.978) [-1800.476] * (-1792.411) [-1789.020] (-1793.885) (-1795.362) -- 0:02:55
514500 -- (-1800.741) [-1793.492] (-1796.496) (-1799.387) * (-1804.264) (-1796.898) (-1794.251) [-1790.292] -- 0:02:55
515000 -- (-1801.524) [-1801.234] (-1793.236) (-1794.419) * (-1804.871) (-1797.948) [-1786.428] (-1801.612) -- 0:02:55
Average standard deviation of split frequencies: 0.014313
515500 -- [-1789.787] (-1795.373) (-1800.006) (-1796.051) * [-1794.346] (-1800.538) (-1789.751) (-1800.659) -- 0:02:55
516000 -- [-1792.529] (-1802.996) (-1791.356) (-1800.548) * (-1800.671) [-1789.076] (-1793.177) (-1796.994) -- 0:02:55
516500 -- (-1796.317) (-1795.555) [-1787.833] (-1801.298) * (-1792.578) (-1803.315) (-1791.912) [-1797.270] -- 0:02:55
517000 -- (-1802.135) [-1797.209] (-1796.522) (-1797.778) * (-1791.820) (-1805.433) [-1793.088] (-1808.162) -- 0:02:54
517500 -- (-1800.370) (-1790.429) [-1788.877] (-1797.755) * (-1795.972) (-1804.388) [-1793.047] (-1794.548) -- 0:02:54
518000 -- (-1798.793) (-1796.098) (-1815.183) [-1793.007] * (-1800.928) (-1794.744) (-1791.063) [-1799.322] -- 0:02:54
518500 -- (-1797.109) (-1794.031) (-1791.363) [-1797.904] * (-1795.401) [-1791.555] (-1793.141) (-1795.942) -- 0:02:54
519000 -- (-1793.876) [-1792.822] (-1809.865) (-1799.605) * (-1802.460) (-1791.304) (-1790.097) [-1792.441] -- 0:02:54
519500 -- (-1788.365) [-1787.414] (-1799.251) (-1791.029) * [-1791.578] (-1801.276) (-1792.481) (-1793.236) -- 0:02:53
520000 -- (-1788.867) [-1795.804] (-1787.322) (-1788.701) * (-1795.386) [-1795.872] (-1808.971) (-1794.604) -- 0:02:53
Average standard deviation of split frequencies: 0.013883
520500 -- (-1790.408) (-1796.697) (-1800.395) [-1797.958] * (-1792.822) (-1799.598) (-1795.658) [-1789.045] -- 0:02:53
521000 -- (-1799.635) (-1810.665) (-1794.202) [-1793.061] * (-1789.623) [-1794.268] (-1802.405) (-1791.676) -- 0:02:53
521500 -- (-1799.154) (-1795.979) [-1788.761] (-1803.760) * (-1799.800) (-1794.572) [-1792.060] (-1793.898) -- 0:02:53
522000 -- (-1795.818) (-1801.916) [-1787.965] (-1800.588) * (-1812.705) (-1805.810) (-1799.512) [-1787.024] -- 0:02:53
522500 -- (-1806.807) (-1801.694) (-1798.120) [-1792.661] * (-1794.534) (-1794.586) [-1790.799] (-1797.518) -- 0:02:52
523000 -- (-1789.630) (-1801.475) [-1790.612] (-1804.484) * [-1792.764] (-1795.751) (-1796.091) (-1806.092) -- 0:02:52
523500 -- (-1797.144) (-1796.942) [-1798.175] (-1795.340) * (-1798.140) [-1790.255] (-1791.021) (-1802.943) -- 0:02:52
524000 -- (-1793.149) (-1812.716) [-1793.876] (-1796.521) * (-1790.017) (-1796.941) [-1794.903] (-1802.076) -- 0:02:52
524500 -- (-1796.062) (-1790.757) [-1788.568] (-1798.391) * (-1795.083) (-1792.035) (-1802.702) [-1793.218] -- 0:02:52
525000 -- (-1793.474) (-1795.261) (-1799.441) [-1793.652] * (-1797.059) (-1797.384) (-1792.323) [-1792.483] -- 0:02:51
Average standard deviation of split frequencies: 0.013841
525500 -- [-1792.283] (-1789.794) (-1792.835) (-1803.916) * (-1803.201) (-1797.249) [-1794.882] (-1798.288) -- 0:02:51
526000 -- (-1792.963) (-1792.832) [-1787.705] (-1795.232) * (-1799.299) [-1789.935] (-1794.523) (-1795.176) -- 0:02:51
526500 -- (-1789.312) (-1799.610) [-1789.754] (-1790.435) * (-1797.749) [-1793.670] (-1790.345) (-1794.347) -- 0:02:51
527000 -- (-1792.306) [-1798.721] (-1804.186) (-1790.055) * [-1795.567] (-1795.329) (-1793.988) (-1802.764) -- 0:02:51
527500 -- (-1795.025) [-1795.908] (-1794.641) (-1793.504) * (-1793.350) (-1792.527) (-1800.055) [-1790.254] -- 0:02:51
528000 -- (-1792.835) [-1800.139] (-1797.911) (-1797.891) * (-1806.667) [-1795.738] (-1801.349) (-1795.028) -- 0:02:50
528500 -- (-1796.964) [-1798.114] (-1805.196) (-1784.435) * [-1793.250] (-1804.997) (-1801.253) (-1798.542) -- 0:02:50
529000 -- [-1801.890] (-1797.679) (-1800.365) (-1790.062) * (-1796.348) [-1796.315] (-1808.937) (-1795.481) -- 0:02:50
529500 -- [-1797.786] (-1796.324) (-1790.844) (-1799.149) * [-1796.016] (-1796.225) (-1802.672) (-1795.103) -- 0:02:50
530000 -- (-1793.409) (-1802.737) [-1796.782] (-1805.868) * (-1800.203) (-1791.065) [-1795.826] (-1799.349) -- 0:02:50
Average standard deviation of split frequencies: 0.013621
530500 -- (-1802.895) (-1793.116) [-1794.639] (-1798.719) * [-1795.616] (-1797.978) (-1790.415) (-1794.850) -- 0:02:49
531000 -- (-1798.195) [-1791.560] (-1805.623) (-1792.013) * (-1794.844) (-1797.554) [-1786.115] (-1791.176) -- 0:02:49
531500 -- (-1790.094) [-1793.996] (-1803.412) (-1797.742) * [-1792.202] (-1802.972) (-1791.310) (-1795.505) -- 0:02:49
532000 -- [-1796.767] (-1801.476) (-1790.588) (-1805.306) * (-1794.345) (-1797.952) [-1790.780] (-1797.263) -- 0:02:49
532500 -- (-1792.830) (-1804.261) (-1794.882) [-1790.716] * (-1800.493) (-1793.174) [-1790.381] (-1793.282) -- 0:02:49
533000 -- (-1812.119) (-1796.765) [-1792.936] (-1794.437) * [-1786.530] (-1800.905) (-1796.095) (-1794.971) -- 0:02:49
533500 -- (-1801.847) (-1797.445) [-1800.670] (-1795.181) * [-1789.458] (-1805.718) (-1794.477) (-1793.969) -- 0:02:48
534000 -- (-1807.531) (-1799.137) [-1788.923] (-1795.000) * [-1789.052] (-1811.745) (-1798.190) (-1797.310) -- 0:02:48
534500 -- (-1798.411) (-1798.962) [-1799.313] (-1806.926) * [-1788.962] (-1800.703) (-1789.980) (-1789.235) -- 0:02:48
535000 -- (-1792.486) (-1796.434) [-1794.226] (-1797.276) * (-1799.853) (-1803.495) (-1791.751) [-1798.767] -- 0:02:48
Average standard deviation of split frequencies: 0.012997
535500 -- [-1787.298] (-1795.188) (-1799.768) (-1799.623) * (-1793.917) (-1802.306) (-1795.530) [-1789.484] -- 0:02:48
536000 -- [-1791.450] (-1793.671) (-1805.700) (-1791.139) * (-1787.202) (-1804.098) [-1796.874] (-1789.791) -- 0:02:47
536500 -- (-1790.795) (-1790.137) [-1799.185] (-1793.309) * (-1797.334) [-1795.917] (-1797.858) (-1798.562) -- 0:02:47
537000 -- (-1793.061) (-1791.585) [-1795.751] (-1800.430) * (-1791.417) [-1795.097] (-1801.254) (-1795.642) -- 0:02:47
537500 -- (-1804.498) (-1788.348) [-1792.736] (-1794.144) * (-1791.751) (-1800.312) [-1792.746] (-1801.231) -- 0:02:46
538000 -- (-1807.983) (-1802.612) (-1793.638) [-1797.362] * (-1793.937) (-1804.787) (-1799.727) [-1798.352] -- 0:02:47
538500 -- (-1791.182) (-1791.926) (-1801.986) [-1790.137] * (-1798.585) (-1792.547) [-1792.706] (-1794.140) -- 0:02:47
539000 -- (-1794.389) [-1802.143] (-1791.853) (-1800.633) * (-1792.148) (-1799.870) (-1797.406) [-1796.340] -- 0:02:46
539500 -- (-1791.254) (-1789.993) [-1788.542] (-1798.029) * (-1792.791) (-1796.327) (-1801.482) [-1795.492] -- 0:02:46
540000 -- (-1795.459) (-1800.642) [-1806.431] (-1806.118) * (-1792.554) (-1790.760) [-1796.774] (-1790.313) -- 0:02:46
Average standard deviation of split frequencies: 0.012982
540500 -- [-1799.362] (-1794.014) (-1806.317) (-1793.247) * (-1786.728) (-1798.131) [-1792.998] (-1802.029) -- 0:02:46
541000 -- (-1802.762) (-1789.760) [-1793.826] (-1796.639) * (-1808.208) [-1792.678] (-1793.278) (-1802.746) -- 0:02:46
541500 -- (-1798.909) (-1795.083) (-1796.042) [-1797.951] * (-1785.376) [-1796.105] (-1797.643) (-1794.386) -- 0:02:45
542000 -- (-1801.119) (-1794.973) [-1791.878] (-1795.786) * (-1800.992) (-1791.946) (-1796.283) [-1799.011] -- 0:02:45
542500 -- [-1795.961] (-1797.565) (-1790.466) (-1798.072) * (-1802.537) (-1796.514) (-1794.169) [-1796.513] -- 0:02:45
543000 -- [-1803.371] (-1794.409) (-1806.441) (-1796.405) * (-1800.917) (-1796.261) (-1800.068) [-1788.098] -- 0:02:44
543500 -- (-1809.754) [-1795.559] (-1798.704) (-1796.700) * (-1796.708) (-1794.313) (-1797.066) [-1792.526] -- 0:02:45
544000 -- (-1806.860) [-1790.844] (-1804.977) (-1793.321) * (-1787.691) (-1795.677) [-1792.066] (-1796.187) -- 0:02:45
544500 -- (-1791.758) [-1791.519] (-1798.958) (-1797.129) * [-1797.834] (-1794.947) (-1792.155) (-1802.047) -- 0:02:44
545000 -- (-1792.715) [-1792.262] (-1805.535) (-1794.713) * (-1801.402) (-1800.496) [-1796.986] (-1799.376) -- 0:02:44
Average standard deviation of split frequencies: 0.012759
545500 -- [-1791.184] (-1803.994) (-1800.489) (-1794.644) * (-1792.592) (-1800.244) [-1790.667] (-1797.177) -- 0:02:44
546000 -- (-1804.099) (-1792.991) (-1793.491) [-1788.804] * [-1790.318] (-1806.774) (-1801.645) (-1805.215) -- 0:02:44
546500 -- (-1816.970) [-1790.944] (-1794.586) (-1786.852) * (-1794.754) (-1808.640) [-1788.696] (-1795.339) -- 0:02:44
547000 -- (-1801.353) [-1792.102] (-1792.347) (-1803.610) * (-1797.418) (-1812.593) [-1794.710] (-1792.257) -- 0:02:43
547500 -- (-1795.986) (-1794.809) [-1788.935] (-1793.287) * (-1802.559) (-1795.227) [-1794.884] (-1791.905) -- 0:02:43
548000 -- [-1794.361] (-1793.033) (-1791.559) (-1798.539) * (-1809.594) (-1795.405) [-1799.060] (-1804.505) -- 0:02:43
548500 -- [-1794.059] (-1796.791) (-1797.020) (-1798.461) * (-1807.101) [-1794.778] (-1797.685) (-1796.661) -- 0:02:42
549000 -- [-1802.627] (-1792.817) (-1806.022) (-1799.664) * (-1807.986) (-1797.087) (-1788.827) [-1796.503] -- 0:02:43
549500 -- [-1793.561] (-1799.321) (-1798.745) (-1789.543) * (-1800.139) (-1791.713) (-1799.735) [-1785.628] -- 0:02:43
550000 -- (-1795.275) (-1799.971) (-1788.444) [-1794.753] * (-1800.372) (-1794.206) (-1800.888) [-1796.415] -- 0:02:42
Average standard deviation of split frequencies: 0.013221
550500 -- (-1798.399) (-1797.466) [-1790.773] (-1790.380) * [-1793.297] (-1801.498) (-1798.974) (-1793.541) -- 0:02:42
551000 -- [-1791.752] (-1793.399) (-1792.825) (-1795.169) * [-1794.065] (-1800.828) (-1792.240) (-1792.359) -- 0:02:42
551500 -- (-1798.524) (-1796.765) (-1793.753) [-1794.909] * (-1801.112) (-1799.596) [-1791.345] (-1794.199) -- 0:02:42
552000 -- (-1797.121) (-1797.837) (-1797.756) [-1791.059] * (-1796.934) (-1800.349) [-1794.696] (-1791.869) -- 0:02:42
552500 -- (-1799.428) [-1790.399] (-1795.830) (-1800.945) * (-1789.135) [-1799.440] (-1796.593) (-1798.810) -- 0:02:41
553000 -- (-1794.429) [-1799.894] (-1800.936) (-1797.403) * (-1804.268) (-1803.189) [-1790.340] (-1800.107) -- 0:02:41
553500 -- (-1795.303) (-1803.355) (-1792.779) [-1793.818] * (-1798.445) [-1797.381] (-1788.442) (-1797.688) -- 0:02:41
554000 -- (-1798.100) (-1804.015) (-1792.646) [-1788.939] * (-1801.267) (-1801.015) [-1790.774] (-1795.233) -- 0:02:41
554500 -- (-1792.618) (-1805.285) (-1802.840) [-1791.304] * (-1801.772) (-1797.277) (-1800.454) [-1788.915] -- 0:02:41
555000 -- (-1801.355) [-1794.473] (-1791.720) (-1796.126) * [-1796.776] (-1797.493) (-1802.504) (-1785.209) -- 0:02:41
Average standard deviation of split frequencies: 0.013283
555500 -- [-1800.223] (-1789.777) (-1800.170) (-1804.876) * (-1794.213) (-1794.590) [-1794.140] (-1790.943) -- 0:02:40
556000 -- (-1792.082) (-1792.458) [-1792.223] (-1794.709) * [-1790.819] (-1800.631) (-1807.169) (-1789.343) -- 0:02:40
556500 -- (-1795.636) [-1789.118] (-1801.514) (-1803.507) * (-1797.564) [-1792.820] (-1800.258) (-1810.465) -- 0:02:40
557000 -- (-1794.876) (-1795.347) [-1787.735] (-1807.307) * (-1804.485) [-1795.412] (-1797.481) (-1795.864) -- 0:02:39
557500 -- (-1799.372) (-1797.632) [-1790.353] (-1794.720) * (-1795.598) (-1795.089) (-1795.893) [-1790.868] -- 0:02:40
558000 -- [-1794.860] (-1791.147) (-1805.557) (-1790.912) * (-1800.915) (-1796.881) (-1799.055) [-1787.134] -- 0:02:40
558500 -- (-1789.971) [-1789.854] (-1798.482) (-1793.744) * [-1793.915] (-1791.483) (-1808.084) (-1790.259) -- 0:02:39
559000 -- [-1802.134] (-1791.183) (-1793.452) (-1796.094) * (-1802.494) (-1793.732) [-1791.921] (-1799.114) -- 0:02:39
559500 -- (-1804.949) (-1801.527) [-1792.878] (-1800.851) * (-1789.565) (-1798.931) [-1792.348] (-1794.618) -- 0:02:39
560000 -- (-1801.623) (-1787.583) (-1795.075) [-1801.043] * (-1801.370) (-1792.607) [-1795.071] (-1796.662) -- 0:02:39
Average standard deviation of split frequencies: 0.014200
560500 -- (-1801.555) (-1791.748) [-1793.332] (-1792.569) * (-1790.722) (-1790.580) [-1790.577] (-1791.957) -- 0:02:39
561000 -- (-1800.375) (-1795.603) [-1795.113] (-1794.272) * [-1787.190] (-1806.803) (-1798.539) (-1801.068) -- 0:02:38
561500 -- [-1792.949] (-1801.475) (-1791.213) (-1795.304) * (-1794.479) [-1806.449] (-1797.581) (-1797.605) -- 0:02:38
562000 -- (-1796.579) (-1802.420) (-1793.621) [-1792.432] * (-1794.527) (-1798.907) [-1796.083] (-1791.909) -- 0:02:38
562500 -- (-1794.602) [-1801.239] (-1792.275) (-1795.989) * (-1792.619) [-1795.564] (-1793.542) (-1793.348) -- 0:02:37
563000 -- (-1791.127) (-1792.484) [-1793.066] (-1796.674) * (-1788.125) [-1794.348] (-1793.871) (-1803.512) -- 0:02:38
563500 -- (-1797.526) [-1797.567] (-1791.147) (-1799.173) * (-1787.185) (-1794.069) [-1797.313] (-1797.405) -- 0:02:38
564000 -- (-1803.731) (-1791.788) (-1791.603) [-1793.647] * (-1794.870) [-1792.242] (-1795.394) (-1799.532) -- 0:02:37
564500 -- (-1792.997) [-1795.435] (-1796.401) (-1792.479) * (-1797.430) (-1796.001) [-1800.379] (-1796.038) -- 0:02:37
565000 -- (-1793.549) (-1797.357) (-1794.536) [-1792.282] * (-1804.079) (-1798.596) (-1788.264) [-1794.939] -- 0:02:37
Average standard deviation of split frequencies: 0.013789
565500 -- [-1790.251] (-1794.426) (-1787.630) (-1799.618) * (-1798.647) (-1795.030) [-1795.069] (-1790.752) -- 0:02:36
566000 -- (-1800.146) (-1793.845) [-1788.306] (-1795.835) * (-1796.529) (-1800.716) (-1796.276) [-1786.553] -- 0:02:37
566500 -- [-1790.711] (-1791.989) (-1795.724) (-1794.206) * (-1798.908) (-1791.848) (-1798.154) [-1799.396] -- 0:02:36
567000 -- (-1793.683) [-1793.265] (-1792.773) (-1795.696) * (-1789.289) [-1793.800] (-1798.981) (-1799.139) -- 0:02:36
567500 -- [-1801.875] (-1795.049) (-1805.502) (-1795.084) * (-1793.024) [-1796.154] (-1813.446) (-1792.311) -- 0:02:36
568000 -- [-1793.195] (-1798.346) (-1794.672) (-1799.920) * [-1789.706] (-1788.664) (-1791.671) (-1797.706) -- 0:02:35
568500 -- (-1793.383) (-1795.729) (-1788.765) [-1790.450] * (-1792.636) (-1802.982) (-1795.833) [-1798.479] -- 0:02:36
569000 -- (-1805.199) (-1801.689) (-1802.949) [-1784.722] * (-1788.360) (-1801.084) (-1799.010) [-1800.720] -- 0:02:36
569500 -- (-1802.660) (-1802.447) (-1790.261) [-1792.130] * (-1795.178) (-1796.176) [-1790.783] (-1811.060) -- 0:02:35
570000 -- (-1795.406) [-1791.756] (-1791.388) (-1795.607) * (-1794.473) [-1795.107] (-1801.149) (-1792.692) -- 0:02:35
Average standard deviation of split frequencies: 0.013401
570500 -- (-1794.527) [-1789.923] (-1790.617) (-1793.488) * [-1794.300] (-1795.526) (-1797.530) (-1794.503) -- 0:02:35
571000 -- (-1790.742) (-1790.574) (-1792.253) [-1795.437] * [-1789.305] (-1794.284) (-1794.991) (-1802.378) -- 0:02:34
571500 -- (-1796.146) (-1800.039) (-1796.056) [-1791.762] * [-1792.446] (-1799.295) (-1809.998) (-1795.335) -- 0:02:35
572000 -- (-1799.773) (-1794.448) (-1795.004) [-1785.544] * (-1801.636) (-1795.132) [-1792.304] (-1793.240) -- 0:02:34
572500 -- [-1798.428] (-1800.475) (-1793.043) (-1788.257) * (-1801.756) (-1796.510) (-1792.527) [-1795.590] -- 0:02:34
573000 -- (-1791.505) [-1790.629] (-1792.940) (-1792.203) * (-1797.108) (-1794.178) [-1794.882] (-1789.051) -- 0:02:34
573500 -- (-1802.111) [-1790.687] (-1790.981) (-1794.734) * [-1798.520] (-1796.303) (-1794.063) (-1788.855) -- 0:02:33
574000 -- (-1787.845) (-1793.747) [-1789.635] (-1789.382) * (-1800.314) (-1792.689) (-1797.032) [-1794.209] -- 0:02:34
574500 -- (-1799.275) (-1801.275) [-1795.356] (-1796.050) * (-1798.013) (-1799.775) [-1793.440] (-1797.667) -- 0:02:34
575000 -- (-1800.119) (-1793.017) (-1798.113) [-1802.525] * (-1791.393) [-1793.313] (-1799.268) (-1799.657) -- 0:02:33
Average standard deviation of split frequencies: 0.012913
575500 -- (-1795.329) (-1807.597) (-1803.498) [-1796.925] * (-1797.762) (-1785.950) [-1793.295] (-1798.776) -- 0:02:33
576000 -- [-1794.591] (-1812.020) (-1801.246) (-1790.020) * [-1792.586] (-1791.618) (-1797.245) (-1790.080) -- 0:02:33
576500 -- (-1805.964) (-1805.806) [-1795.657] (-1800.578) * [-1797.604] (-1792.504) (-1794.786) (-1790.944) -- 0:02:32
577000 -- (-1804.169) (-1800.822) (-1800.500) [-1795.999] * [-1791.277] (-1792.700) (-1792.983) (-1801.038) -- 0:02:33
577500 -- (-1803.033) (-1795.003) [-1789.688] (-1799.026) * [-1796.606] (-1798.676) (-1799.932) (-1789.486) -- 0:02:32
578000 -- (-1800.903) (-1800.580) [-1793.746] (-1797.465) * (-1797.895) [-1796.716] (-1793.844) (-1804.872) -- 0:02:32
578500 -- (-1797.188) (-1795.218) [-1791.608] (-1800.675) * (-1799.659) [-1793.873] (-1791.810) (-1795.362) -- 0:02:32
579000 -- (-1793.671) (-1794.877) [-1795.010] (-1798.528) * [-1791.022] (-1795.049) (-1800.873) (-1794.704) -- 0:02:31
579500 -- [-1801.380] (-1798.992) (-1793.858) (-1800.459) * [-1791.577] (-1796.669) (-1795.060) (-1791.640) -- 0:02:31
580000 -- (-1793.616) (-1793.178) (-1788.509) [-1797.162] * (-1793.936) (-1796.723) [-1791.459] (-1801.996) -- 0:02:32
Average standard deviation of split frequencies: 0.012899
580500 -- (-1798.096) [-1792.649] (-1800.789) (-1803.696) * (-1796.328) (-1799.002) [-1793.555] (-1795.772) -- 0:02:31
581000 -- (-1802.689) [-1795.219] (-1803.154) (-1800.251) * (-1796.602) (-1787.161) [-1795.146] (-1789.664) -- 0:02:31
581500 -- (-1793.946) [-1793.317] (-1804.366) (-1799.749) * (-1800.111) (-1795.224) [-1792.603] (-1791.424) -- 0:02:31
582000 -- (-1794.562) [-1796.982] (-1797.951) (-1794.467) * (-1793.996) [-1794.681] (-1797.190) (-1797.290) -- 0:02:30
582500 -- (-1800.265) [-1795.305] (-1793.160) (-1799.404) * (-1792.633) (-1810.984) (-1802.916) [-1790.488] -- 0:02:31
583000 -- (-1795.403) (-1789.990) (-1798.723) [-1791.973] * [-1788.980] (-1806.296) (-1793.103) (-1791.519) -- 0:02:30
583500 -- [-1791.534] (-1791.743) (-1802.879) (-1793.460) * [-1789.505] (-1806.314) (-1796.412) (-1789.609) -- 0:02:30
584000 -- (-1797.765) [-1800.022] (-1795.029) (-1799.310) * (-1786.916) (-1803.467) [-1793.152] (-1802.291) -- 0:02:30
584500 -- (-1793.515) (-1794.760) (-1796.120) [-1794.741] * (-1798.417) [-1795.478] (-1809.460) (-1795.064) -- 0:02:29
585000 -- (-1798.066) (-1788.480) (-1794.272) [-1791.327] * (-1792.394) [-1790.629] (-1793.340) (-1800.691) -- 0:02:29
Average standard deviation of split frequencies: 0.012424
585500 -- [-1791.538] (-1794.425) (-1794.834) (-1792.617) * [-1785.956] (-1802.285) (-1793.414) (-1794.782) -- 0:02:30
586000 -- (-1796.797) [-1791.776] (-1794.469) (-1803.114) * (-1793.392) (-1790.796) [-1795.310] (-1802.101) -- 0:02:29
586500 -- (-1795.470) [-1799.101] (-1797.640) (-1792.302) * (-1792.543) [-1795.802] (-1793.286) (-1801.828) -- 0:02:29
587000 -- [-1796.115] (-1793.430) (-1792.611) (-1794.959) * (-1793.937) (-1794.966) (-1796.134) [-1796.407] -- 0:02:29
587500 -- (-1803.590) (-1801.720) [-1793.662] (-1796.670) * (-1788.805) [-1792.553] (-1797.797) (-1793.552) -- 0:02:28
588000 -- (-1800.664) [-1793.322] (-1790.873) (-1798.300) * (-1787.792) (-1799.056) [-1792.229] (-1790.219) -- 0:02:29
588500 -- [-1793.342] (-1790.910) (-1785.151) (-1794.778) * [-1793.098] (-1799.696) (-1792.337) (-1809.875) -- 0:02:28
589000 -- (-1799.550) (-1805.552) (-1791.906) [-1786.633] * (-1789.955) (-1791.481) (-1792.902) [-1789.485] -- 0:02:28
589500 -- (-1795.509) (-1797.534) [-1793.802] (-1796.716) * (-1795.883) [-1795.815] (-1800.043) (-1796.782) -- 0:02:28
590000 -- (-1801.008) [-1792.640] (-1796.017) (-1789.652) * (-1798.985) (-1793.780) [-1800.734] (-1802.644) -- 0:02:28
Average standard deviation of split frequencies: 0.012769
590500 -- (-1800.475) (-1793.208) [-1789.498] (-1791.045) * (-1800.392) (-1790.699) [-1793.629] (-1797.061) -- 0:02:27
591000 -- (-1802.734) (-1795.502) [-1789.682] (-1794.043) * [-1789.513] (-1792.608) (-1788.070) (-1799.921) -- 0:02:28
591500 -- (-1804.835) (-1792.458) [-1792.617] (-1789.808) * (-1794.199) (-1798.860) [-1795.609] (-1799.454) -- 0:02:27
592000 -- (-1798.235) [-1795.843] (-1792.079) (-1811.089) * (-1790.794) [-1793.260] (-1795.042) (-1797.922) -- 0:02:27
592500 -- (-1792.101) (-1790.887) [-1788.067] (-1798.514) * (-1789.940) (-1796.186) [-1795.173] (-1800.976) -- 0:02:27
593000 -- (-1793.747) (-1794.701) (-1804.850) [-1787.787] * [-1791.638] (-1800.433) (-1794.171) (-1802.950) -- 0:02:26
593500 -- (-1793.025) [-1799.674] (-1791.356) (-1802.116) * (-1808.452) (-1798.624) [-1794.040] (-1795.378) -- 0:02:27
594000 -- (-1802.762) (-1816.692) [-1787.287] (-1795.811) * (-1802.441) [-1796.464] (-1801.868) (-1803.805) -- 0:02:26
594500 -- [-1795.008] (-1807.250) (-1798.457) (-1802.345) * (-1800.643) (-1805.645) [-1795.073] (-1808.478) -- 0:02:26
595000 -- [-1795.653] (-1799.676) (-1795.719) (-1800.532) * [-1807.297] (-1794.028) (-1790.371) (-1800.828) -- 0:02:26
Average standard deviation of split frequencies: 0.012392
595500 -- [-1793.690] (-1789.585) (-1811.396) (-1801.161) * (-1797.556) [-1796.535] (-1800.925) (-1797.706) -- 0:02:26
596000 -- [-1794.274] (-1796.097) (-1793.069) (-1800.245) * (-1795.523) [-1800.117] (-1798.100) (-1794.334) -- 0:02:25
596500 -- (-1794.143) (-1802.217) (-1796.500) [-1795.123] * [-1795.396] (-1798.680) (-1802.427) (-1796.819) -- 0:02:26
597000 -- [-1790.417] (-1799.821) (-1798.679) (-1796.501) * (-1795.737) (-1800.825) [-1801.422] (-1793.873) -- 0:02:25
597500 -- (-1803.419) (-1797.224) (-1803.159) [-1798.581] * (-1798.964) [-1800.195] (-1794.007) (-1797.807) -- 0:02:25
598000 -- (-1819.968) [-1792.528] (-1799.739) (-1797.738) * (-1797.389) (-1811.700) [-1790.560] (-1790.952) -- 0:02:25
598500 -- (-1796.950) [-1788.950] (-1794.239) (-1791.365) * (-1793.341) [-1792.852] (-1788.392) (-1800.639) -- 0:02:24
599000 -- (-1790.952) (-1789.930) [-1799.227] (-1798.781) * (-1787.724) (-1795.792) (-1808.011) [-1792.042] -- 0:02:24
599500 -- [-1792.688] (-1790.884) (-1798.871) (-1790.411) * (-1789.925) (-1795.297) (-1796.345) [-1790.389] -- 0:02:24
600000 -- [-1794.241] (-1795.110) (-1797.100) (-1787.468) * (-1791.134) [-1791.558] (-1796.898) (-1800.492) -- 0:02:24
Average standard deviation of split frequencies: 0.011859
600500 -- (-1803.854) (-1794.113) [-1795.426] (-1782.895) * (-1794.533) (-1790.665) [-1796.764] (-1800.147) -- 0:02:24
601000 -- [-1792.675] (-1792.066) (-1793.036) (-1793.048) * [-1795.076] (-1791.966) (-1798.102) (-1789.976) -- 0:02:24
601500 -- (-1799.584) (-1789.748) (-1793.902) [-1790.550] * (-1793.763) [-1786.826] (-1794.174) (-1789.586) -- 0:02:23
602000 -- (-1798.380) [-1799.906] (-1791.706) (-1807.735) * (-1802.035) (-1792.784) (-1802.509) [-1797.260] -- 0:02:24
602500 -- (-1795.148) [-1792.254] (-1796.500) (-1792.634) * (-1795.297) (-1799.436) (-1799.889) [-1794.575] -- 0:02:23
603000 -- [-1795.149] (-1800.662) (-1799.630) (-1791.316) * (-1809.709) [-1799.725] (-1798.875) (-1793.243) -- 0:02:23
603500 -- (-1796.859) (-1800.249) (-1793.194) [-1793.239] * (-1798.806) (-1797.442) [-1797.744] (-1797.149) -- 0:02:23
604000 -- (-1792.253) (-1803.205) (-1792.886) [-1798.361] * [-1790.560] (-1793.353) (-1800.926) (-1797.529) -- 0:02:22
604500 -- (-1796.837) (-1793.340) [-1792.769] (-1793.496) * [-1797.208] (-1804.364) (-1807.127) (-1806.807) -- 0:02:22
605000 -- (-1797.693) (-1794.978) (-1795.182) [-1789.108] * (-1799.817) (-1805.299) [-1796.878] (-1790.920) -- 0:02:22
Average standard deviation of split frequencies: 0.010718
605500 -- [-1792.508] (-1798.967) (-1801.834) (-1789.041) * (-1798.004) (-1794.596) (-1797.037) [-1792.836] -- 0:02:22
606000 -- [-1809.087] (-1789.781) (-1806.472) (-1798.883) * [-1805.669] (-1794.381) (-1804.032) (-1801.465) -- 0:02:22
606500 -- [-1795.922] (-1798.835) (-1792.759) (-1788.517) * (-1792.966) (-1796.575) [-1789.321] (-1799.755) -- 0:02:22
607000 -- [-1789.967] (-1791.879) (-1794.266) (-1795.452) * (-1797.585) [-1794.642] (-1792.413) (-1798.997) -- 0:02:21
607500 -- (-1787.006) [-1792.035] (-1800.498) (-1799.026) * (-1789.300) (-1794.049) [-1787.471] (-1804.304) -- 0:02:22
608000 -- (-1796.485) (-1802.650) [-1793.472] (-1801.993) * (-1798.979) (-1795.804) (-1796.660) [-1795.028] -- 0:02:21
608500 -- [-1787.598] (-1804.139) (-1793.284) (-1803.233) * [-1790.362] (-1792.375) (-1791.626) (-1795.733) -- 0:02:21
609000 -- [-1786.068] (-1793.406) (-1794.322) (-1796.428) * (-1794.518) [-1790.506] (-1797.110) (-1792.429) -- 0:02:21
609500 -- (-1790.512) (-1807.495) (-1803.686) [-1792.650] * (-1798.852) (-1792.873) (-1793.507) [-1789.416] -- 0:02:20
610000 -- [-1789.503] (-1795.437) (-1805.078) (-1802.506) * (-1800.359) (-1793.243) (-1797.612) [-1796.104] -- 0:02:20
Average standard deviation of split frequencies: 0.010979
610500 -- (-1794.072) [-1792.464] (-1791.484) (-1797.721) * (-1793.408) [-1796.070] (-1799.806) (-1798.115) -- 0:02:20
611000 -- (-1794.135) (-1787.704) (-1789.957) [-1797.702] * (-1795.443) (-1797.157) [-1791.546] (-1792.785) -- 0:02:20
611500 -- [-1791.019] (-1794.979) (-1792.295) (-1792.978) * (-1793.780) [-1791.650] (-1793.642) (-1800.017) -- 0:02:20
612000 -- (-1795.695) [-1791.746] (-1788.109) (-1792.239) * [-1798.518] (-1796.487) (-1798.425) (-1792.464) -- 0:02:20
612500 -- (-1798.989) (-1791.207) [-1794.512] (-1791.472) * [-1796.027] (-1793.036) (-1795.964) (-1806.480) -- 0:02:19
613000 -- (-1802.488) [-1791.455] (-1801.581) (-1800.266) * (-1802.172) [-1792.898] (-1784.642) (-1801.390) -- 0:02:19
613500 -- (-1800.619) (-1801.659) [-1795.081] (-1799.298) * (-1790.873) [-1795.294] (-1795.013) (-1800.685) -- 0:02:19
614000 -- (-1797.373) [-1799.952] (-1803.082) (-1796.030) * [-1799.958] (-1798.276) (-1792.638) (-1794.984) -- 0:02:19
614500 -- (-1803.377) (-1802.059) [-1799.371] (-1788.656) * (-1801.719) [-1789.289] (-1798.204) (-1797.771) -- 0:02:19
615000 -- (-1790.692) (-1790.554) (-1799.460) [-1805.067] * (-1797.446) (-1803.145) (-1793.496) [-1790.419] -- 0:02:18
Average standard deviation of split frequencies: 0.010884
615500 -- [-1790.841] (-1792.049) (-1799.787) (-1795.187) * (-1794.986) (-1798.996) (-1803.196) [-1797.251] -- 0:02:18
616000 -- (-1789.801) [-1791.232] (-1800.488) (-1795.437) * (-1793.453) (-1796.316) [-1793.822] (-1796.450) -- 0:02:19
616500 -- (-1796.805) (-1794.488) (-1791.194) [-1796.625] * (-1797.332) (-1795.967) (-1792.196) [-1792.170] -- 0:02:18
617000 -- (-1799.378) [-1792.507] (-1788.618) (-1806.730) * (-1792.574) (-1793.987) [-1787.231] (-1792.452) -- 0:02:18
617500 -- (-1795.330) (-1802.285) [-1788.565] (-1794.066) * (-1791.816) [-1789.371] (-1797.680) (-1799.540) -- 0:02:18
618000 -- (-1801.987) (-1789.328) (-1798.520) [-1791.970] * (-1791.449) (-1790.902) (-1798.646) [-1792.942] -- 0:02:17
618500 -- [-1792.278] (-1792.198) (-1788.330) (-1787.140) * (-1796.007) [-1792.110] (-1794.930) (-1796.814) -- 0:02:17
619000 -- (-1791.675) [-1795.088] (-1799.317) (-1791.916) * (-1793.716) [-1793.276] (-1788.165) (-1799.078) -- 0:02:17
619500 -- [-1795.641] (-1796.161) (-1808.149) (-1793.798) * (-1797.222) [-1796.064] (-1789.719) (-1800.990) -- 0:02:17
620000 -- (-1795.609) [-1799.033] (-1797.967) (-1793.177) * (-1792.555) (-1792.731) [-1789.626] (-1801.471) -- 0:02:17
Average standard deviation of split frequencies: 0.009536
620500 -- (-1801.879) [-1789.475] (-1802.259) (-1797.807) * (-1800.956) (-1796.300) (-1798.544) [-1798.323] -- 0:02:16
621000 -- (-1795.313) (-1796.291) (-1794.864) [-1790.232] * [-1796.958] (-1790.579) (-1796.271) (-1789.969) -- 0:02:16
621500 -- (-1803.837) (-1794.953) [-1791.605] (-1792.538) * [-1792.136] (-1800.925) (-1787.844) (-1802.252) -- 0:02:17
622000 -- (-1797.974) (-1796.716) [-1796.378] (-1794.781) * (-1802.450) [-1801.444] (-1797.255) (-1797.489) -- 0:02:16
622500 -- (-1795.136) (-1800.148) [-1791.707] (-1796.880) * (-1795.432) [-1794.674] (-1794.268) (-1800.023) -- 0:02:16
623000 -- (-1795.011) (-1798.043) [-1790.353] (-1792.222) * [-1793.052] (-1796.505) (-1805.404) (-1803.961) -- 0:02:16
623500 -- [-1795.109] (-1801.124) (-1796.258) (-1792.932) * (-1788.283) [-1798.260] (-1803.044) (-1794.645) -- 0:02:15
624000 -- (-1798.945) (-1803.536) (-1794.013) [-1792.564] * (-1794.545) (-1801.272) [-1796.872] (-1792.418) -- 0:02:15
624500 -- [-1789.241] (-1795.622) (-1793.418) (-1791.122) * (-1794.497) (-1797.233) (-1804.377) [-1795.215] -- 0:02:15
625000 -- (-1789.252) [-1792.826] (-1793.903) (-1796.282) * [-1798.429] (-1792.219) (-1804.340) (-1790.136) -- 0:02:15
Average standard deviation of split frequencies: 0.009204
625500 -- (-1799.434) (-1798.092) (-1791.513) [-1795.136] * (-1794.771) (-1803.828) (-1793.310) [-1796.832] -- 0:02:15
626000 -- [-1795.838] (-1801.740) (-1795.293) (-1791.808) * [-1788.981] (-1797.164) (-1793.356) (-1802.963) -- 0:02:15
626500 -- (-1790.832) [-1792.928] (-1793.830) (-1801.230) * [-1790.127] (-1798.444) (-1799.111) (-1800.717) -- 0:02:14
627000 -- (-1796.616) [-1797.814] (-1789.600) (-1787.857) * (-1799.294) (-1795.578) (-1801.387) [-1797.519] -- 0:02:14
627500 -- (-1801.021) [-1795.124] (-1795.552) (-1789.006) * [-1796.006] (-1792.791) (-1805.945) (-1792.868) -- 0:02:14
628000 -- [-1795.511] (-1800.795) (-1796.696) (-1796.077) * (-1796.471) [-1795.258] (-1800.042) (-1793.959) -- 0:02:14
628500 -- [-1793.326] (-1796.245) (-1795.783) (-1791.846) * (-1790.110) (-1795.942) [-1794.405] (-1800.019) -- 0:02:14
629000 -- [-1790.159] (-1799.583) (-1797.445) (-1802.092) * [-1794.576] (-1800.765) (-1796.744) (-1796.994) -- 0:02:13
629500 -- (-1794.920) [-1799.847] (-1797.538) (-1796.818) * (-1797.545) [-1786.950] (-1795.649) (-1802.048) -- 0:02:13
630000 -- (-1794.395) (-1797.760) (-1797.509) [-1794.009] * [-1801.130] (-1795.798) (-1798.511) (-1792.742) -- 0:02:13
Average standard deviation of split frequencies: 0.008388
630500 -- (-1799.211) (-1796.373) (-1801.706) [-1791.129] * [-1793.760] (-1798.132) (-1797.225) (-1801.288) -- 0:02:13
631000 -- (-1805.855) (-1801.054) [-1795.294] (-1805.282) * (-1794.157) (-1794.677) (-1793.502) [-1792.890] -- 0:02:13
631500 -- (-1793.360) (-1797.442) (-1798.150) [-1791.015] * (-1818.353) [-1795.188] (-1791.001) (-1792.698) -- 0:02:13
632000 -- (-1797.924) [-1799.392] (-1797.766) (-1795.647) * (-1796.913) (-1800.541) (-1797.546) [-1788.082] -- 0:02:12
632500 -- [-1795.263] (-1794.888) (-1798.093) (-1802.423) * (-1793.112) (-1800.335) [-1793.100] (-1796.685) -- 0:02:12
633000 -- (-1794.016) (-1798.423) [-1793.824] (-1794.314) * (-1800.008) (-1801.742) (-1790.451) [-1799.029] -- 0:02:12
633500 -- (-1795.538) (-1795.719) [-1795.919] (-1798.758) * (-1799.499) (-1797.345) [-1793.835] (-1789.758) -- 0:02:12
634000 -- (-1797.725) (-1796.836) [-1800.370] (-1789.509) * (-1794.453) (-1798.385) [-1800.393] (-1794.909) -- 0:02:12
634500 -- (-1800.465) [-1790.754] (-1791.900) (-1794.316) * (-1796.477) (-1788.147) (-1795.848) [-1788.553] -- 0:02:11
635000 -- (-1798.450) [-1791.612] (-1791.398) (-1803.407) * (-1795.430) (-1795.664) [-1797.744] (-1800.857) -- 0:02:11
Average standard deviation of split frequencies: 0.008318
635500 -- (-1798.542) (-1800.092) [-1786.170] (-1798.441) * (-1794.322) [-1791.108] (-1793.450) (-1791.733) -- 0:02:11
636000 -- (-1799.231) (-1798.199) [-1789.342] (-1803.139) * (-1796.149) (-1788.306) [-1791.611] (-1797.198) -- 0:02:11
636500 -- (-1795.026) (-1794.612) (-1792.626) [-1789.281] * (-1796.434) (-1795.621) (-1799.131) [-1795.884] -- 0:02:11
637000 -- [-1799.398] (-1794.973) (-1789.226) (-1804.384) * (-1795.315) (-1799.870) (-1794.252) [-1790.829] -- 0:02:11
637500 -- [-1795.977] (-1789.691) (-1801.595) (-1802.396) * [-1796.046] (-1795.765) (-1799.499) (-1792.345) -- 0:02:10
638000 -- [-1795.389] (-1796.464) (-1792.074) (-1794.102) * (-1797.722) (-1794.600) (-1792.111) [-1795.409] -- 0:02:10
638500 -- (-1801.474) [-1797.227] (-1792.147) (-1796.687) * (-1797.443) (-1784.255) [-1797.892] (-1801.779) -- 0:02:10
639000 -- (-1793.167) (-1796.544) (-1804.838) [-1791.968] * (-1802.380) (-1787.704) (-1801.611) [-1796.827] -- 0:02:10
639500 -- (-1795.435) (-1791.571) [-1796.834] (-1793.726) * (-1793.383) (-1796.971) (-1804.041) [-1794.319] -- 0:02:10
640000 -- (-1801.602) (-1797.588) [-1804.275] (-1789.067) * (-1788.430) [-1795.468] (-1802.644) (-1798.377) -- 0:02:09
Average standard deviation of split frequencies: 0.008012
640500 -- (-1796.024) [-1792.871] (-1800.201) (-1793.457) * (-1786.955) (-1797.475) (-1792.454) [-1804.044] -- 0:02:09
641000 -- (-1797.378) [-1797.476] (-1789.808) (-1799.941) * [-1789.060] (-1797.445) (-1797.784) (-1796.218) -- 0:02:09
641500 -- [-1802.392] (-1795.726) (-1791.304) (-1804.774) * (-1796.251) (-1793.643) (-1794.853) [-1798.039] -- 0:02:09
642000 -- [-1795.060] (-1803.210) (-1793.698) (-1794.256) * (-1791.982) (-1797.772) [-1793.593] (-1799.289) -- 0:02:09
642500 -- (-1798.171) [-1790.348] (-1805.674) (-1798.402) * (-1802.916) (-1792.856) [-1795.591] (-1799.604) -- 0:02:09
643000 -- (-1795.945) [-1797.109] (-1797.996) (-1809.558) * (-1801.609) (-1796.405) (-1796.620) [-1804.472] -- 0:02:08
643500 -- (-1804.169) (-1812.090) [-1797.135] (-1790.395) * (-1790.798) [-1797.949] (-1797.873) (-1801.137) -- 0:02:08
644000 -- (-1798.379) [-1795.553] (-1798.112) (-1796.166) * (-1796.729) (-1799.724) (-1802.707) [-1790.757] -- 0:02:08
644500 -- (-1793.784) (-1799.124) (-1792.281) [-1790.259] * (-1793.614) [-1795.935] (-1805.066) (-1795.030) -- 0:02:08
645000 -- [-1789.402] (-1797.273) (-1788.590) (-1791.779) * (-1807.387) (-1795.784) [-1794.056] (-1799.304) -- 0:02:08
Average standard deviation of split frequencies: 0.007703
645500 -- (-1795.322) (-1801.405) (-1803.286) [-1803.152] * (-1799.752) [-1790.478] (-1804.263) (-1797.214) -- 0:02:07
646000 -- (-1804.440) (-1785.536) [-1800.599] (-1801.435) * (-1793.360) (-1799.276) (-1793.894) [-1789.061] -- 0:02:07
646500 -- (-1795.239) (-1795.283) (-1795.346) [-1795.496] * (-1797.576) (-1791.851) [-1797.866] (-1793.511) -- 0:02:07
647000 -- (-1804.546) [-1793.126] (-1788.363) (-1789.567) * [-1793.575] (-1791.984) (-1797.028) (-1791.804) -- 0:02:07
647500 -- (-1792.857) (-1797.148) [-1792.801] (-1788.890) * (-1794.688) (-1791.375) [-1789.913] (-1791.174) -- 0:02:07
648000 -- (-1801.009) (-1802.585) (-1787.848) [-1802.045] * (-1805.820) [-1794.970] (-1807.886) (-1793.631) -- 0:02:07
648500 -- (-1793.171) [-1790.906] (-1799.469) (-1795.741) * (-1800.026) [-1788.423] (-1797.805) (-1793.282) -- 0:02:06
649000 -- (-1796.060) [-1793.006] (-1798.065) (-1796.782) * [-1786.729] (-1800.247) (-1794.778) (-1795.976) -- 0:02:06
649500 -- [-1788.358] (-1792.880) (-1793.132) (-1788.695) * (-1798.081) (-1793.967) (-1792.097) [-1790.344] -- 0:02:06
650000 -- (-1802.789) (-1796.755) (-1792.671) [-1790.296] * (-1793.842) (-1789.603) (-1793.647) [-1793.180] -- 0:02:06
Average standard deviation of split frequencies: 0.008291
650500 -- (-1797.293) [-1788.534] (-1798.952) (-1799.414) * (-1804.706) (-1797.099) [-1794.077] (-1796.337) -- 0:02:06
651000 -- (-1796.661) (-1787.286) [-1789.123] (-1794.508) * (-1804.819) (-1799.115) [-1793.038] (-1794.141) -- 0:02:05
651500 -- [-1792.941] (-1794.193) (-1800.124) (-1800.205) * (-1799.354) (-1800.551) (-1795.038) [-1795.740] -- 0:02:05
652000 -- (-1790.395) (-1789.876) [-1790.398] (-1789.502) * (-1794.898) (-1792.924) [-1792.614] (-1802.563) -- 0:02:05
652500 -- [-1787.504] (-1792.306) (-1797.027) (-1797.880) * (-1794.955) (-1798.520) [-1790.441] (-1795.696) -- 0:02:05
653000 -- (-1795.711) [-1787.065] (-1792.963) (-1799.957) * [-1801.092] (-1793.459) (-1799.803) (-1789.887) -- 0:02:05
653500 -- [-1796.350] (-1797.461) (-1796.020) (-1793.178) * (-1792.748) [-1795.345] (-1795.303) (-1800.370) -- 0:02:05
654000 -- [-1793.207] (-1797.656) (-1804.040) (-1799.740) * (-1798.717) [-1795.059] (-1791.371) (-1791.847) -- 0:02:04
654500 -- (-1794.710) (-1793.804) [-1791.963] (-1796.869) * (-1798.626) (-1791.923) (-1797.953) [-1801.390] -- 0:02:04
655000 -- [-1790.965] (-1800.481) (-1799.922) (-1793.096) * [-1789.665] (-1791.078) (-1793.993) (-1800.774) -- 0:02:04
Average standard deviation of split frequencies: 0.009502
655500 -- [-1789.626] (-1793.696) (-1795.431) (-1787.891) * (-1789.177) (-1788.497) [-1791.941] (-1802.200) -- 0:02:04
656000 -- (-1791.129) (-1799.861) (-1791.375) [-1798.267] * (-1808.300) (-1794.656) (-1790.083) [-1793.602] -- 0:02:04
656500 -- [-1788.200] (-1795.822) (-1801.402) (-1794.099) * (-1794.436) [-1795.147] (-1795.900) (-1795.070) -- 0:02:04
657000 -- (-1793.655) (-1791.043) [-1793.050] (-1795.555) * (-1793.653) (-1794.840) (-1794.331) [-1796.362] -- 0:02:03
657500 -- (-1795.945) [-1796.132] (-1793.805) (-1787.978) * [-1794.286] (-1789.115) (-1811.680) (-1794.710) -- 0:02:03
658000 -- (-1787.963) [-1793.850] (-1794.686) (-1802.463) * (-1798.537) (-1793.526) (-1797.883) [-1796.586] -- 0:02:03
658500 -- (-1791.369) [-1792.034] (-1799.948) (-1791.786) * (-1806.193) (-1798.251) [-1795.074] (-1801.221) -- 0:02:03
659000 -- (-1787.947) (-1795.867) (-1806.858) [-1796.287] * [-1792.422] (-1805.100) (-1799.114) (-1791.940) -- 0:02:03
659500 -- [-1793.747] (-1790.302) (-1787.308) (-1798.626) * [-1788.767] (-1792.517) (-1797.804) (-1797.309) -- 0:02:02
660000 -- [-1788.295] (-1799.887) (-1792.410) (-1803.882) * (-1791.639) (-1793.746) (-1790.586) [-1802.426] -- 0:02:02
Average standard deviation of split frequencies: 0.009672
660500 -- (-1796.442) (-1795.096) [-1788.872] (-1795.525) * [-1795.053] (-1804.547) (-1793.348) (-1794.386) -- 0:02:02
661000 -- (-1797.044) [-1800.018] (-1796.993) (-1810.847) * [-1793.793] (-1794.237) (-1800.223) (-1802.301) -- 0:02:02
661500 -- (-1796.483) (-1802.342) (-1792.778) [-1788.818] * (-1799.212) [-1800.804] (-1796.249) (-1805.788) -- 0:02:02
662000 -- [-1787.223] (-1793.532) (-1791.990) (-1790.468) * [-1804.307] (-1792.276) (-1793.159) (-1793.498) -- 0:02:02
662500 -- [-1786.551] (-1790.459) (-1803.490) (-1791.934) * (-1804.721) [-1796.445] (-1795.760) (-1793.303) -- 0:02:01
663000 -- (-1799.509) [-1792.241] (-1804.607) (-1793.150) * (-1799.153) (-1797.985) [-1792.491] (-1790.674) -- 0:02:01
663500 -- (-1792.892) [-1796.665] (-1799.652) (-1790.628) * (-1801.488) (-1798.611) [-1793.991] (-1794.931) -- 0:02:01
664000 -- (-1800.478) (-1800.119) (-1792.289) [-1788.716] * [-1792.173] (-1802.476) (-1798.448) (-1797.132) -- 0:02:01
664500 -- (-1795.327) (-1788.174) [-1789.821] (-1794.017) * (-1792.057) (-1803.726) [-1797.690] (-1811.228) -- 0:02:01
665000 -- [-1792.482] (-1793.330) (-1805.127) (-1794.938) * (-1800.299) (-1793.415) [-1789.833] (-1799.233) -- 0:02:00
Average standard deviation of split frequencies: 0.009516
665500 -- (-1785.357) [-1798.813] (-1803.109) (-1792.788) * (-1785.958) [-1792.098] (-1795.055) (-1805.249) -- 0:02:00
666000 -- [-1801.006] (-1808.557) (-1796.437) (-1800.620) * (-1796.575) (-1795.398) (-1799.524) [-1800.813] -- 0:02:00
666500 -- (-1800.300) (-1798.605) (-1791.070) [-1790.828] * (-1796.707) [-1790.690] (-1795.437) (-1795.795) -- 0:02:00
667000 -- (-1797.527) (-1802.906) (-1791.871) [-1797.520] * [-1791.755] (-1797.306) (-1792.184) (-1793.349) -- 0:02:00
667500 -- [-1793.771] (-1814.738) (-1791.219) (-1797.919) * (-1794.318) [-1800.011] (-1797.701) (-1790.134) -- 0:02:00
668000 -- (-1789.389) [-1791.018] (-1800.807) (-1799.231) * (-1792.477) [-1793.006] (-1790.263) (-1796.583) -- 0:01:59
668500 -- (-1800.454) (-1791.950) [-1789.165] (-1800.000) * (-1792.699) (-1801.088) [-1796.845] (-1800.316) -- 0:01:59
669000 -- (-1798.764) (-1787.562) (-1801.150) [-1796.542] * (-1791.172) (-1794.844) (-1790.271) [-1798.041] -- 0:01:59
669500 -- (-1792.855) (-1794.886) [-1795.494] (-1796.722) * (-1799.664) (-1791.068) (-1800.137) [-1790.690] -- 0:01:59
670000 -- [-1793.402] (-1795.939) (-1796.854) (-1798.454) * [-1803.546] (-1797.909) (-1794.227) (-1801.396) -- 0:01:59
Average standard deviation of split frequencies: 0.007966
670500 -- (-1795.414) [-1793.170] (-1800.588) (-1799.368) * (-1795.369) [-1801.388] (-1793.881) (-1799.584) -- 0:01:58
671000 -- [-1793.353] (-1801.655) (-1801.444) (-1798.933) * (-1792.223) (-1795.396) (-1790.294) [-1792.011] -- 0:01:58
671500 -- (-1795.318) [-1800.674] (-1794.117) (-1790.957) * (-1794.035) (-1799.078) [-1790.422] (-1794.350) -- 0:01:58
672000 -- (-1801.696) (-1799.239) (-1791.840) [-1800.342] * [-1793.430] (-1790.493) (-1793.403) (-1798.837) -- 0:01:58
672500 -- (-1795.848) [-1798.322] (-1789.053) (-1800.721) * (-1795.452) [-1797.454] (-1791.027) (-1799.975) -- 0:01:58
673000 -- [-1796.196] (-1792.989) (-1790.203) (-1800.409) * [-1791.097] (-1789.085) (-1797.732) (-1790.843) -- 0:01:58
673500 -- [-1790.109] (-1803.408) (-1794.563) (-1799.536) * (-1789.779) (-1792.726) (-1802.793) [-1798.145] -- 0:01:57
674000 -- (-1797.404) [-1789.284] (-1792.704) (-1797.232) * (-1802.850) (-1792.845) (-1802.744) [-1794.429] -- 0:01:57
674500 -- (-1794.336) (-1790.627) (-1803.015) [-1799.944] * (-1792.122) (-1789.528) (-1798.891) [-1787.668] -- 0:01:57
675000 -- [-1790.820] (-1789.059) (-1792.158) (-1791.341) * [-1793.813] (-1794.382) (-1797.427) (-1802.117) -- 0:01:57
Average standard deviation of split frequencies: 0.007128
675500 -- (-1793.818) (-1795.262) (-1798.943) [-1789.000] * (-1798.341) [-1792.224] (-1789.198) (-1803.015) -- 0:01:57
676000 -- [-1788.840] (-1795.146) (-1795.223) (-1798.979) * [-1790.505] (-1796.614) (-1791.177) (-1795.537) -- 0:01:56
676500 -- [-1789.862] (-1798.499) (-1794.649) (-1800.267) * [-1792.341] (-1799.313) (-1788.140) (-1792.488) -- 0:01:56
677000 -- (-1794.306) (-1793.941) [-1789.609] (-1792.549) * (-1805.266) (-1792.851) [-1789.734] (-1793.222) -- 0:01:56
677500 -- (-1791.521) (-1792.767) [-1795.542] (-1792.757) * (-1797.508) (-1798.666) [-1792.224] (-1794.084) -- 0:01:56
678000 -- [-1795.622] (-1792.574) (-1790.382) (-1794.710) * (-1795.576) (-1792.032) [-1796.912] (-1795.301) -- 0:01:56
678500 -- (-1793.352) (-1804.524) [-1799.644] (-1800.705) * (-1803.141) (-1794.582) (-1800.176) [-1800.644] -- 0:01:56
679000 -- (-1792.900) (-1796.212) (-1796.248) [-1790.912] * (-1800.780) [-1790.198] (-1791.273) (-1802.320) -- 0:01:55
679500 -- (-1791.402) [-1793.776] (-1797.163) (-1785.259) * (-1809.552) (-1809.593) [-1792.191] (-1804.404) -- 0:01:55
680000 -- [-1796.185] (-1797.864) (-1793.585) (-1788.361) * (-1792.653) (-1796.270) [-1794.769] (-1794.273) -- 0:01:55
Average standard deviation of split frequencies: 0.007541
680500 -- [-1799.088] (-1789.467) (-1789.910) (-1806.812) * (-1799.161) (-1797.185) [-1788.479] (-1798.236) -- 0:01:55
681000 -- (-1795.966) (-1793.094) [-1790.129] (-1797.065) * (-1798.672) (-1796.621) [-1791.201] (-1789.842) -- 0:01:55
681500 -- [-1791.301] (-1803.806) (-1789.470) (-1803.112) * (-1796.788) (-1793.450) [-1790.205] (-1790.385) -- 0:01:54
682000 -- (-1794.152) (-1793.752) (-1800.765) [-1799.145] * [-1796.667] (-1802.751) (-1789.386) (-1789.908) -- 0:01:54
682500 -- (-1805.734) (-1795.156) (-1803.813) [-1794.012] * (-1798.821) [-1793.077] (-1797.430) (-1789.048) -- 0:01:54
683000 -- (-1803.653) (-1804.583) [-1799.122] (-1797.989) * (-1789.461) [-1789.209] (-1804.160) (-1792.350) -- 0:01:54
683500 -- (-1800.361) (-1796.123) [-1790.583] (-1797.048) * (-1797.211) [-1795.909] (-1796.333) (-1792.485) -- 0:01:54
684000 -- (-1815.183) (-1804.045) [-1791.134] (-1804.628) * (-1801.111) [-1792.613] (-1795.320) (-1800.300) -- 0:01:54
684500 -- (-1809.213) [-1789.738] (-1797.031) (-1793.594) * [-1800.818] (-1801.328) (-1794.877) (-1796.290) -- 0:01:53
685000 -- (-1803.566) (-1799.614) (-1797.121) [-1788.749] * (-1800.273) (-1809.253) [-1795.087] (-1801.124) -- 0:01:53
Average standard deviation of split frequencies: 0.007406
685500 -- (-1796.613) (-1797.798) [-1793.946] (-1797.995) * [-1800.852] (-1791.729) (-1804.214) (-1798.521) -- 0:01:53
686000 -- (-1801.477) (-1794.766) (-1795.216) [-1795.175] * (-1796.925) (-1794.449) [-1796.008] (-1800.778) -- 0:01:53
686500 -- [-1797.611] (-1796.508) (-1797.101) (-1805.840) * (-1798.480) [-1790.089] (-1798.293) (-1794.949) -- 0:01:53
687000 -- (-1804.499) (-1802.435) [-1795.116] (-1793.842) * [-1801.124] (-1796.485) (-1799.228) (-1792.732) -- 0:01:52
687500 -- [-1789.251] (-1798.302) (-1805.166) (-1793.626) * (-1799.026) (-1794.835) (-1800.378) [-1792.587] -- 0:01:52
688000 -- [-1795.529] (-1802.863) (-1796.703) (-1801.765) * (-1794.391) [-1786.694] (-1795.954) (-1793.842) -- 0:01:52
688500 -- (-1794.143) (-1799.341) (-1791.921) [-1800.083] * (-1788.669) (-1796.363) [-1798.489] (-1798.366) -- 0:01:52
689000 -- [-1792.344] (-1811.938) (-1806.342) (-1796.348) * (-1796.941) (-1792.688) [-1795.062] (-1795.780) -- 0:01:52
689500 -- (-1797.181) (-1796.817) [-1794.159] (-1791.101) * (-1798.935) (-1797.945) [-1788.318] (-1807.423) -- 0:01:52
690000 -- [-1794.601] (-1791.068) (-1792.923) (-1795.129) * [-1790.644] (-1797.672) (-1789.158) (-1794.539) -- 0:01:51
Average standard deviation of split frequencies: 0.007735
690500 -- [-1789.036] (-1792.355) (-1794.695) (-1790.580) * (-1812.974) (-1796.999) (-1791.175) [-1800.843] -- 0:01:51
691000 -- (-1796.440) (-1805.819) [-1797.722] (-1795.484) * (-1793.451) (-1801.193) [-1797.706] (-1798.695) -- 0:01:51
691500 -- [-1806.851] (-1796.660) (-1792.802) (-1802.811) * (-1795.074) (-1787.700) [-1794.788] (-1798.113) -- 0:01:51
692000 -- (-1790.236) (-1796.218) (-1792.469) [-1790.379] * (-1791.050) (-1793.923) (-1803.833) [-1789.917] -- 0:01:51
692500 -- (-1793.686) (-1796.990) (-1798.091) [-1793.548] * (-1786.976) [-1794.759] (-1799.115) (-1808.894) -- 0:01:51
693000 -- (-1793.886) [-1797.394] (-1793.920) (-1797.512) * [-1798.019] (-1795.512) (-1793.507) (-1802.470) -- 0:01:50
693500 -- (-1796.416) (-1795.973) [-1795.527] (-1791.693) * (-1798.865) (-1789.203) (-1797.002) [-1792.600] -- 0:01:50
694000 -- [-1794.546] (-1795.229) (-1801.910) (-1790.368) * (-1797.536) (-1790.042) [-1796.455] (-1796.027) -- 0:01:50
694500 -- (-1792.937) (-1797.462) (-1799.451) [-1790.777] * (-1793.615) [-1800.342] (-1795.743) (-1797.687) -- 0:01:50
695000 -- (-1793.403) (-1798.075) [-1791.162] (-1795.402) * (-1798.088) [-1799.520] (-1793.291) (-1805.745) -- 0:01:50
Average standard deviation of split frequencies: 0.006397
695500 -- [-1792.977] (-1788.146) (-1799.398) (-1791.529) * [-1789.745] (-1794.022) (-1804.084) (-1795.379) -- 0:01:49
696000 -- (-1787.004) (-1797.018) [-1793.381] (-1793.603) * [-1793.554] (-1797.629) (-1801.306) (-1791.945) -- 0:01:49
696500 -- (-1794.712) [-1790.080] (-1796.986) (-1788.136) * [-1792.186] (-1798.582) (-1798.494) (-1788.235) -- 0:01:49
697000 -- [-1795.426] (-1792.196) (-1791.070) (-1795.543) * (-1803.964) (-1800.080) [-1786.300] (-1795.844) -- 0:01:49
697500 -- (-1797.037) [-1785.236] (-1793.263) (-1802.234) * [-1793.521] (-1798.847) (-1797.546) (-1800.784) -- 0:01:49
698000 -- (-1792.768) (-1795.019) [-1800.316] (-1797.040) * [-1795.675] (-1805.999) (-1792.322) (-1801.502) -- 0:01:49
698500 -- (-1797.954) (-1807.952) [-1797.296] (-1788.976) * [-1788.053] (-1804.230) (-1797.286) (-1805.501) -- 0:01:48
699000 -- (-1796.196) [-1790.403] (-1792.255) (-1795.824) * [-1789.224] (-1802.731) (-1803.405) (-1805.243) -- 0:01:48
699500 -- [-1793.058] (-1793.260) (-1791.425) (-1802.585) * (-1795.331) (-1795.890) [-1797.670] (-1804.431) -- 0:01:48
700000 -- (-1789.797) (-1797.142) [-1791.355] (-1808.904) * (-1798.358) (-1796.396) [-1804.287] (-1791.922) -- 0:01:48
Average standard deviation of split frequencies: 0.006205
700500 -- (-1798.018) [-1789.756] (-1791.183) (-1799.476) * [-1795.415] (-1796.494) (-1795.150) (-1794.005) -- 0:01:48
701000 -- [-1794.041] (-1790.777) (-1792.088) (-1793.455) * [-1791.939] (-1798.799) (-1795.127) (-1800.651) -- 0:01:47
701500 -- (-1802.095) (-1798.344) (-1803.784) [-1791.262] * (-1794.443) (-1794.497) [-1790.611] (-1797.772) -- 0:01:47
702000 -- (-1795.200) (-1792.082) [-1789.061] (-1791.904) * (-1799.381) [-1793.773] (-1793.848) (-1795.125) -- 0:01:47
702500 -- (-1797.903) [-1791.266] (-1794.799) (-1796.656) * (-1805.892) (-1798.658) (-1803.490) [-1789.625] -- 0:01:47
703000 -- (-1792.593) (-1792.583) [-1791.950] (-1793.215) * (-1807.289) [-1790.192] (-1800.179) (-1796.824) -- 0:01:47
703500 -- (-1802.740) (-1805.390) [-1795.723] (-1795.224) * (-1792.916) (-1793.993) [-1798.801] (-1797.759) -- 0:01:47
704000 -- (-1794.769) [-1798.615] (-1794.282) (-1795.561) * (-1798.842) [-1792.809] (-1799.781) (-1797.356) -- 0:01:46
704500 -- [-1793.924] (-1795.534) (-1803.927) (-1794.176) * (-1791.384) [-1788.314] (-1812.558) (-1792.689) -- 0:01:46
705000 -- (-1804.172) (-1797.465) [-1794.201] (-1792.969) * (-1795.280) (-1799.213) (-1800.939) [-1796.200] -- 0:01:46
Average standard deviation of split frequencies: 0.006158
705500 -- (-1803.948) [-1797.066] (-1796.234) (-1796.679) * [-1802.739] (-1794.980) (-1796.947) (-1788.870) -- 0:01:46
706000 -- (-1796.931) (-1798.264) (-1803.964) [-1794.568] * (-1806.206) (-1796.913) [-1794.299] (-1796.171) -- 0:01:46
706500 -- (-1801.615) (-1791.506) [-1794.251] (-1792.182) * (-1790.891) (-1795.116) [-1795.085] (-1794.240) -- 0:01:45
707000 -- (-1791.557) (-1802.157) (-1794.391) [-1789.490] * (-1796.492) [-1791.665] (-1794.723) (-1798.495) -- 0:01:45
707500 -- (-1797.309) (-1801.573) (-1795.139) [-1794.843] * (-1787.539) [-1790.791] (-1793.008) (-1802.243) -- 0:01:45
708000 -- [-1792.797] (-1797.640) (-1807.826) (-1790.596) * (-1790.994) (-1795.846) [-1793.167] (-1794.911) -- 0:01:45
708500 -- [-1786.533] (-1791.366) (-1797.270) (-1793.548) * (-1791.737) [-1797.648] (-1800.775) (-1798.692) -- 0:01:44
709000 -- [-1793.147] (-1791.234) (-1794.601) (-1792.802) * (-1795.784) (-1793.658) (-1800.399) [-1786.849] -- 0:01:45
709500 -- (-1799.692) (-1795.060) (-1793.285) [-1799.292] * [-1794.782] (-1801.036) (-1803.368) (-1791.851) -- 0:01:44
710000 -- (-1795.131) (-1800.642) (-1802.130) [-1790.022] * [-1791.573] (-1798.477) (-1793.053) (-1808.392) -- 0:01:44
Average standard deviation of split frequencies: 0.007002
710500 -- (-1803.584) (-1804.112) [-1795.926] (-1797.461) * (-1793.335) (-1799.124) [-1793.783] (-1805.428) -- 0:01:44
711000 -- (-1802.828) (-1785.956) (-1799.161) [-1794.914] * [-1790.312] (-1791.683) (-1802.255) (-1810.759) -- 0:01:44
711500 -- (-1795.680) (-1796.445) (-1806.623) [-1789.870] * [-1793.551] (-1788.399) (-1800.554) (-1795.235) -- 0:01:44
712000 -- (-1799.237) [-1789.829] (-1799.426) (-1795.618) * [-1798.537] (-1790.729) (-1793.877) (-1799.975) -- 0:01:43
712500 -- (-1807.618) (-1794.618) [-1798.972] (-1792.915) * (-1795.398) (-1790.991) (-1797.057) [-1791.451] -- 0:01:43
713000 -- (-1803.198) (-1792.516) (-1797.187) [-1790.570] * (-1792.982) (-1795.429) (-1800.234) [-1792.089] -- 0:01:43
713500 -- (-1793.359) [-1793.931] (-1801.359) (-1792.657) * (-1797.080) (-1790.489) (-1792.102) [-1791.906] -- 0:01:43
714000 -- (-1799.688) (-1792.085) [-1795.561] (-1807.608) * (-1791.302) (-1795.893) [-1794.683] (-1791.986) -- 0:01:42
714500 -- (-1792.814) (-1799.289) [-1803.186] (-1795.415) * [-1794.053] (-1795.318) (-1804.854) (-1791.292) -- 0:01:43
715000 -- (-1805.697) (-1796.427) (-1791.758) [-1796.773] * (-1788.520) (-1795.119) (-1800.581) [-1789.169] -- 0:01:42
Average standard deviation of split frequencies: 0.007242
715500 -- (-1796.321) (-1801.654) [-1786.527] (-1797.063) * (-1793.989) (-1795.761) (-1795.186) [-1797.642] -- 0:01:42
716000 -- (-1794.230) [-1788.562] (-1796.445) (-1791.912) * (-1797.614) (-1795.260) [-1796.667] (-1801.447) -- 0:01:42
716500 -- (-1795.188) (-1793.848) (-1798.711) [-1790.913] * (-1799.552) [-1785.408] (-1797.616) (-1788.782) -- 0:01:42
717000 -- [-1789.891] (-1793.828) (-1797.848) (-1796.908) * (-1790.244) [-1795.913] (-1797.157) (-1793.690) -- 0:01:42
717500 -- (-1793.468) (-1792.739) [-1796.685] (-1796.992) * (-1787.643) [-1796.850] (-1799.165) (-1799.705) -- 0:01:41
718000 -- (-1795.288) (-1793.019) [-1792.196] (-1800.772) * [-1789.238] (-1805.931) (-1793.929) (-1797.262) -- 0:01:41
718500 -- (-1794.551) (-1799.221) (-1798.118) [-1790.352] * (-1790.236) (-1792.680) [-1791.480] (-1798.041) -- 0:01:41
719000 -- (-1794.648) [-1794.724] (-1797.395) (-1790.215) * [-1795.008] (-1802.750) (-1797.317) (-1802.434) -- 0:01:41
719500 -- (-1789.066) (-1792.291) [-1803.944] (-1790.369) * [-1789.924] (-1799.321) (-1809.225) (-1792.854) -- 0:01:40
720000 -- [-1789.593] (-1795.486) (-1793.152) (-1799.512) * (-1793.140) [-1792.849] (-1801.731) (-1799.792) -- 0:01:41
Average standard deviation of split frequencies: 0.007341
720500 -- (-1795.592) [-1802.025] (-1806.077) (-1790.904) * (-1796.565) (-1789.564) [-1798.295] (-1804.862) -- 0:01:40
721000 -- (-1793.543) (-1805.186) [-1798.934] (-1797.437) * (-1796.048) [-1801.341] (-1789.928) (-1800.128) -- 0:01:40
721500 -- (-1792.571) (-1795.906) [-1792.930] (-1791.278) * (-1791.461) (-1792.761) (-1800.399) [-1792.995] -- 0:01:40
722000 -- (-1791.690) (-1792.849) [-1788.749] (-1795.580) * [-1793.508] (-1796.279) (-1796.818) (-1800.849) -- 0:01:40
722500 -- (-1793.173) (-1805.682) (-1795.765) [-1788.617] * (-1799.259) (-1802.172) [-1788.865] (-1796.760) -- 0:01:39
723000 -- (-1801.373) (-1787.522) (-1794.401) [-1803.618] * (-1799.455) [-1798.481] (-1791.934) (-1792.795) -- 0:01:39
723500 -- (-1797.471) [-1791.504] (-1795.257) (-1794.431) * (-1790.240) [-1798.313] (-1798.852) (-1792.169) -- 0:01:39
724000 -- (-1796.288) (-1801.059) [-1787.766] (-1795.020) * (-1791.025) (-1799.451) (-1794.031) [-1787.629] -- 0:01:39
724500 -- (-1792.952) (-1798.612) [-1792.809] (-1789.065) * (-1792.992) [-1794.573] (-1798.481) (-1789.180) -- 0:01:39
725000 -- (-1800.140) (-1793.238) (-1797.574) [-1790.769] * (-1791.172) [-1793.824] (-1794.458) (-1796.950) -- 0:01:39
Average standard deviation of split frequencies: 0.006421
725500 -- (-1794.822) (-1789.060) (-1801.669) [-1794.912] * (-1796.268) [-1794.452] (-1795.913) (-1799.078) -- 0:01:39
726000 -- [-1798.258] (-1793.545) (-1789.840) (-1798.494) * (-1790.999) [-1791.284] (-1791.850) (-1799.826) -- 0:01:38
726500 -- [-1792.524] (-1791.421) (-1788.038) (-1793.610) * [-1798.103] (-1805.792) (-1793.106) (-1801.050) -- 0:01:38
727000 -- (-1797.758) (-1797.473) (-1802.156) [-1795.503] * [-1795.593] (-1792.074) (-1817.383) (-1794.678) -- 0:01:38
727500 -- (-1799.251) [-1798.422] (-1790.695) (-1795.638) * (-1802.818) [-1785.621] (-1799.411) (-1795.342) -- 0:01:38
728000 -- (-1792.688) (-1795.790) [-1790.866] (-1805.459) * (-1793.614) [-1792.069] (-1810.598) (-1806.774) -- 0:01:37
728500 -- (-1805.349) (-1799.610) [-1789.769] (-1797.271) * [-1795.086] (-1791.321) (-1806.025) (-1791.981) -- 0:01:38
729000 -- [-1793.718] (-1792.372) (-1797.718) (-1797.403) * (-1806.588) [-1790.823] (-1803.066) (-1799.531) -- 0:01:37
729500 -- (-1809.956) [-1794.857] (-1793.030) (-1801.480) * (-1800.096) (-1794.898) (-1796.101) [-1795.778] -- 0:01:37
730000 -- (-1795.877) (-1789.909) [-1788.912] (-1798.799) * (-1798.464) (-1797.311) (-1795.245) [-1792.569] -- 0:01:37
Average standard deviation of split frequencies: 0.005233
730500 -- [-1792.765] (-1795.628) (-1794.062) (-1798.430) * [-1794.023] (-1795.825) (-1798.647) (-1799.356) -- 0:01:37
731000 -- [-1789.933] (-1799.762) (-1796.688) (-1787.191) * [-1799.287] (-1798.965) (-1788.735) (-1797.194) -- 0:01:37
731500 -- (-1801.820) (-1797.155) [-1797.306] (-1794.157) * (-1793.106) (-1791.026) [-1789.365] (-1799.146) -- 0:01:36
732000 -- (-1806.071) [-1793.936] (-1806.239) (-1797.715) * (-1800.590) (-1796.940) [-1793.177] (-1794.924) -- 0:01:36
732500 -- (-1803.724) [-1795.537] (-1802.053) (-1791.187) * (-1797.666) (-1795.142) [-1789.839] (-1796.162) -- 0:01:36
733000 -- (-1792.525) [-1789.393] (-1794.546) (-1792.635) * (-1790.799) (-1799.834) (-1790.022) [-1790.587] -- 0:01:36
733500 -- (-1797.174) [-1789.631] (-1786.840) (-1794.791) * [-1795.057] (-1792.802) (-1794.279) (-1799.361) -- 0:01:35
734000 -- (-1796.848) [-1794.695] (-1790.110) (-1805.015) * (-1794.335) [-1791.412] (-1792.053) (-1796.239) -- 0:01:36
734500 -- [-1789.277] (-1803.159) (-1790.221) (-1793.623) * (-1791.097) [-1797.163] (-1796.376) (-1797.268) -- 0:01:35
735000 -- (-1801.071) (-1795.134) [-1793.260] (-1794.611) * (-1790.412) (-1787.407) (-1791.796) [-1790.228] -- 0:01:35
Average standard deviation of split frequencies: 0.005124
735500 -- (-1798.491) (-1800.523) (-1797.693) [-1802.938] * (-1797.584) (-1795.733) [-1791.567] (-1785.246) -- 0:01:35
736000 -- (-1801.565) (-1801.198) (-1804.785) [-1802.990] * (-1797.247) [-1793.009] (-1792.544) (-1791.893) -- 0:01:35
736500 -- (-1792.874) [-1807.490] (-1809.281) (-1798.501) * [-1793.248] (-1790.994) (-1789.274) (-1804.161) -- 0:01:34
737000 -- (-1797.955) (-1792.962) [-1792.703] (-1796.667) * (-1803.825) (-1790.754) [-1797.401] (-1805.862) -- 0:01:34
737500 -- [-1795.567] (-1800.665) (-1799.498) (-1797.000) * [-1794.031] (-1788.920) (-1802.164) (-1803.526) -- 0:01:34
738000 -- (-1802.872) (-1795.842) (-1789.233) [-1793.285] * (-1799.401) (-1792.906) (-1791.850) [-1796.924] -- 0:01:34
738500 -- [-1795.416] (-1787.766) (-1791.423) (-1791.328) * (-1793.433) (-1803.174) (-1793.567) [-1790.651] -- 0:01:34
739000 -- (-1793.070) (-1787.534) [-1792.515] (-1796.323) * (-1805.982) [-1800.675] (-1791.127) (-1796.593) -- 0:01:33
739500 -- (-1795.852) (-1797.237) (-1790.803) [-1796.696] * (-1803.455) [-1795.283] (-1797.434) (-1792.653) -- 0:01:34
740000 -- (-1793.863) (-1800.588) (-1803.004) [-1788.783] * (-1810.522) (-1804.446) (-1791.652) [-1787.776] -- 0:01:33
Average standard deviation of split frequencies: 0.004102
740500 -- (-1799.153) (-1804.335) [-1796.663] (-1791.095) * (-1803.261) [-1794.165] (-1796.448) (-1796.877) -- 0:01:33
741000 -- (-1791.504) (-1787.043) [-1796.187] (-1797.566) * (-1793.779) (-1791.770) [-1790.630] (-1790.329) -- 0:01:33
741500 -- (-1793.494) [-1794.453] (-1791.423) (-1796.772) * [-1796.723] (-1793.729) (-1798.628) (-1796.199) -- 0:01:33
742000 -- [-1796.694] (-1791.798) (-1798.068) (-1790.686) * (-1804.770) (-1789.144) (-1793.039) [-1792.509] -- 0:01:32
742500 -- (-1797.539) [-1790.330] (-1797.852) (-1792.758) * (-1795.647) (-1803.556) [-1796.860] (-1797.678) -- 0:01:32
743000 -- (-1802.066) (-1795.664) (-1806.759) [-1795.362] * (-1796.635) (-1793.080) (-1795.230) [-1794.972] -- 0:01:32
743500 -- (-1802.154) (-1793.876) (-1795.245) [-1792.857] * (-1797.936) (-1791.472) (-1800.283) [-1787.259] -- 0:01:32
744000 -- [-1795.785] (-1801.673) (-1806.902) (-1796.398) * (-1792.447) (-1790.552) (-1791.608) [-1791.202] -- 0:01:32
744500 -- (-1790.835) (-1796.329) [-1793.892] (-1798.360) * (-1801.295) (-1793.010) [-1800.595] (-1815.142) -- 0:01:31
745000 -- (-1795.044) [-1788.942] (-1797.849) (-1798.325) * (-1799.996) [-1794.255] (-1797.856) (-1793.893) -- 0:01:31
Average standard deviation of split frequencies: 0.004072
745500 -- (-1791.899) (-1801.681) [-1796.548] (-1800.664) * [-1799.160] (-1795.230) (-1802.244) (-1788.394) -- 0:01:31
746000 -- (-1797.201) [-1793.006] (-1801.074) (-1793.311) * (-1800.529) (-1797.561) (-1803.006) [-1794.925] -- 0:01:31
746500 -- (-1800.829) (-1795.777) (-1791.795) [-1790.118] * (-1790.770) (-1800.219) (-1791.685) [-1795.578] -- 0:01:31
747000 -- [-1788.284] (-1802.711) (-1789.497) (-1798.644) * (-1803.772) (-1801.777) [-1792.938] (-1792.346) -- 0:01:31
747500 -- (-1784.590) (-1801.918) [-1793.255] (-1796.029) * [-1795.966] (-1790.464) (-1801.894) (-1808.215) -- 0:01:30
748000 -- [-1787.060] (-1792.286) (-1789.949) (-1794.680) * [-1791.272] (-1802.690) (-1796.838) (-1801.959) -- 0:01:30
748500 -- (-1793.560) (-1791.812) [-1791.048] (-1797.393) * (-1797.928) (-1793.286) [-1792.471] (-1797.548) -- 0:01:30
749000 -- (-1799.113) [-1791.243] (-1794.975) (-1796.136) * (-1799.378) (-1790.361) [-1792.091] (-1795.619) -- 0:01:30
749500 -- (-1794.450) (-1798.629) [-1790.307] (-1790.935) * (-1798.758) (-1806.192) [-1788.372] (-1794.121) -- 0:01:30
750000 -- (-1789.417) [-1787.863] (-1800.717) (-1809.576) * [-1792.147] (-1809.476) (-1791.430) (-1809.335) -- 0:01:30
Average standard deviation of split frequencies: 0.004117
750500 -- (-1791.640) (-1796.612) (-1797.914) [-1795.383] * (-1795.218) (-1801.091) (-1787.335) [-1793.579] -- 0:01:29
751000 -- [-1798.715] (-1791.968) (-1801.539) (-1808.364) * (-1798.427) (-1795.403) (-1787.740) [-1796.831] -- 0:01:29
751500 -- (-1793.486) (-1798.114) (-1799.394) [-1800.090] * (-1805.672) (-1792.491) [-1790.372] (-1787.651) -- 0:01:29
752000 -- (-1798.384) (-1789.552) (-1803.681) [-1797.070] * (-1797.435) [-1787.686] (-1793.698) (-1797.954) -- 0:01:29
752500 -- [-1791.073] (-1794.587) (-1795.895) (-1794.409) * [-1804.036] (-1791.309) (-1796.074) (-1794.822) -- 0:01:29
753000 -- (-1796.785) (-1788.442) [-1797.237] (-1787.557) * (-1798.187) (-1801.200) (-1792.673) [-1795.939] -- 0:01:28
753500 -- (-1803.244) [-1794.730] (-1794.531) (-1790.279) * (-1788.933) (-1798.529) [-1794.934] (-1793.352) -- 0:01:28
754000 -- (-1799.321) [-1801.522] (-1798.563) (-1786.866) * (-1789.861) [-1791.302] (-1802.106) (-1797.448) -- 0:01:28
754500 -- (-1794.894) (-1795.887) [-1791.623] (-1790.744) * (-1792.647) (-1812.101) [-1792.655] (-1804.915) -- 0:01:28
755000 -- [-1792.679] (-1799.706) (-1794.980) (-1794.075) * [-1791.906] (-1797.765) (-1788.868) (-1796.936) -- 0:01:28
Average standard deviation of split frequencies: 0.003048
755500 -- (-1799.540) (-1786.230) (-1807.010) [-1793.290] * (-1802.282) (-1783.538) (-1796.091) [-1793.442] -- 0:01:28
756000 -- (-1796.360) [-1790.376] (-1803.542) (-1800.273) * (-1790.660) (-1800.178) (-1787.125) [-1794.274] -- 0:01:27
756500 -- [-1792.819] (-1794.358) (-1795.178) (-1798.567) * (-1793.572) (-1793.414) (-1800.500) [-1794.103] -- 0:01:27
757000 -- [-1792.118] (-1794.494) (-1805.989) (-1803.396) * [-1790.373] (-1796.704) (-1795.909) (-1803.744) -- 0:01:27
757500 -- (-1796.475) [-1788.564] (-1805.692) (-1794.035) * [-1786.367] (-1798.960) (-1796.954) (-1803.441) -- 0:01:27
758000 -- (-1788.739) [-1799.055] (-1798.735) (-1797.273) * [-1789.445] (-1785.899) (-1795.130) (-1795.937) -- 0:01:27
758500 -- [-1793.805] (-1813.266) (-1789.712) (-1798.340) * [-1788.948] (-1792.857) (-1811.808) (-1798.033) -- 0:01:26
759000 -- (-1800.471) (-1796.850) [-1797.745] (-1793.885) * [-1785.113] (-1799.187) (-1804.598) (-1795.352) -- 0:01:26
759500 -- [-1795.145] (-1795.573) (-1801.228) (-1798.359) * (-1799.563) [-1791.990] (-1797.426) (-1799.549) -- 0:01:26
760000 -- [-1796.642] (-1803.552) (-1804.434) (-1794.231) * (-1791.634) [-1786.010] (-1803.859) (-1795.921) -- 0:01:26
Average standard deviation of split frequencies: 0.002617
760500 -- [-1800.991] (-1804.514) (-1803.405) (-1800.904) * [-1791.116] (-1796.000) (-1802.381) (-1794.693) -- 0:01:26
761000 -- (-1790.073) (-1801.663) [-1789.715] (-1798.331) * (-1796.956) (-1799.172) (-1792.849) [-1788.295] -- 0:01:26
761500 -- [-1795.300] (-1791.001) (-1802.983) (-1791.685) * (-1793.560) (-1795.618) (-1796.637) [-1790.983] -- 0:01:25
762000 -- (-1799.707) (-1798.075) (-1805.034) [-1795.143] * [-1791.283] (-1800.651) (-1798.233) (-1798.241) -- 0:01:25
762500 -- (-1798.853) [-1794.579] (-1792.470) (-1793.937) * (-1800.319) [-1789.309] (-1798.898) (-1796.443) -- 0:01:25
763000 -- (-1791.032) (-1794.475) (-1800.730) [-1798.616] * (-1798.951) [-1795.630] (-1797.979) (-1791.984) -- 0:01:25
763500 -- (-1792.723) (-1794.814) (-1806.315) [-1793.948] * (-1801.211) (-1793.859) (-1796.279) [-1791.578] -- 0:01:25
764000 -- (-1800.675) (-1795.995) [-1793.682] (-1790.248) * [-1796.101] (-1800.903) (-1798.295) (-1797.483) -- 0:01:24
764500 -- [-1802.447] (-1800.273) (-1788.901) (-1804.337) * [-1787.562] (-1805.108) (-1797.825) (-1791.382) -- 0:01:24
765000 -- (-1790.311) (-1801.574) (-1790.612) [-1792.198] * (-1794.571) (-1786.738) [-1791.651] (-1800.560) -- 0:01:24
Average standard deviation of split frequencies: 0.002051
765500 -- (-1792.308) (-1803.088) (-1790.774) [-1793.230] * (-1799.827) (-1790.280) (-1804.496) [-1788.053] -- 0:01:24
766000 -- [-1790.306] (-1794.992) (-1788.899) (-1797.316) * (-1794.122) (-1796.197) (-1799.439) [-1793.243] -- 0:01:24
766500 -- (-1790.154) [-1787.300] (-1802.455) (-1795.893) * (-1798.625) [-1797.244] (-1797.378) (-1801.874) -- 0:01:24
767000 -- (-1792.656) [-1788.736] (-1788.955) (-1793.568) * (-1809.452) (-1797.504) [-1795.386] (-1801.101) -- 0:01:23
767500 -- (-1793.017) (-1795.156) (-1790.184) [-1789.531] * (-1797.327) (-1793.393) (-1802.790) [-1789.355] -- 0:01:23
768000 -- (-1797.953) (-1794.994) (-1794.821) [-1793.421] * (-1795.273) [-1792.565] (-1800.519) (-1796.904) -- 0:01:23
768500 -- [-1800.875] (-1799.351) (-1799.464) (-1805.048) * [-1795.477] (-1795.756) (-1801.592) (-1789.522) -- 0:01:23
769000 -- (-1801.133) [-1797.519] (-1793.913) (-1796.703) * (-1801.696) [-1799.644] (-1801.362) (-1789.383) -- 0:01:23
769500 -- (-1805.717) (-1795.836) [-1807.699] (-1802.915) * (-1789.787) [-1794.573] (-1796.766) (-1794.239) -- 0:01:22
770000 -- [-1793.472] (-1795.327) (-1801.212) (-1792.248) * (-1802.648) (-1794.911) (-1800.825) [-1790.499] -- 0:01:22
Average standard deviation of split frequencies: 0.002922
770500 -- (-1799.245) (-1798.527) (-1790.817) [-1797.718] * (-1792.298) [-1800.472] (-1802.664) (-1799.515) -- 0:01:22
771000 -- (-1803.001) (-1793.272) (-1790.559) [-1789.753] * [-1793.007] (-1808.071) (-1793.628) (-1793.335) -- 0:01:22
771500 -- (-1798.752) (-1801.955) (-1796.153) [-1796.356] * [-1794.414] (-1799.345) (-1809.934) (-1791.858) -- 0:01:22
772000 -- (-1799.800) (-1797.635) [-1791.248] (-1796.955) * (-1797.316) [-1800.638] (-1795.259) (-1799.146) -- 0:01:22
772500 -- [-1793.395] (-1792.524) (-1793.911) (-1797.127) * (-1794.890) (-1795.206) [-1788.775] (-1797.985) -- 0:01:21
773000 -- [-1796.244] (-1798.619) (-1792.665) (-1806.212) * (-1789.588) (-1794.163) [-1794.596] (-1801.932) -- 0:01:21
773500 -- [-1802.968] (-1798.188) (-1798.194) (-1797.177) * (-1793.617) (-1800.577) [-1792.622] (-1798.534) -- 0:01:21
774000 -- (-1797.997) (-1799.020) (-1795.553) [-1791.469] * [-1790.947] (-1798.188) (-1793.966) (-1795.627) -- 0:01:21
774500 -- (-1799.885) (-1807.659) [-1793.177] (-1803.021) * [-1794.098] (-1805.435) (-1794.388) (-1792.950) -- 0:01:21
775000 -- (-1796.362) (-1801.931) [-1788.047] (-1802.815) * (-1793.032) [-1790.359] (-1792.508) (-1794.198) -- 0:01:21
Average standard deviation of split frequencies: 0.003577
775500 -- (-1794.515) (-1798.299) (-1800.035) [-1796.741] * (-1804.143) [-1791.741] (-1789.711) (-1795.413) -- 0:01:20
776000 -- (-1800.600) (-1791.168) [-1790.653] (-1797.659) * (-1797.476) (-1789.914) (-1797.056) [-1788.348] -- 0:01:20
776500 -- (-1801.459) [-1792.283] (-1795.765) (-1794.083) * [-1799.305] (-1793.620) (-1791.146) (-1794.792) -- 0:01:20
777000 -- (-1794.064) (-1806.418) (-1788.935) [-1787.706] * [-1793.799] (-1795.463) (-1793.227) (-1795.260) -- 0:01:20
777500 -- (-1794.965) (-1805.203) (-1790.798) [-1792.753] * (-1794.308) (-1804.105) [-1794.282] (-1799.163) -- 0:01:20
778000 -- (-1794.033) (-1794.838) (-1798.413) [-1794.875] * (-1793.958) (-1795.738) (-1799.581) [-1795.256] -- 0:01:19
778500 -- (-1799.484) (-1794.829) [-1792.927] (-1796.508) * (-1796.290) (-1799.682) [-1793.555] (-1796.687) -- 0:01:19
779000 -- (-1800.441) (-1792.946) [-1789.567] (-1799.285) * (-1791.173) [-1798.141] (-1797.519) (-1793.514) -- 0:01:19
779500 -- (-1806.600) (-1795.023) [-1792.840] (-1789.728) * (-1799.887) (-1794.727) (-1792.308) [-1790.676] -- 0:01:19
780000 -- [-1789.732] (-1796.834) (-1792.026) (-1798.665) * (-1789.606) [-1796.278] (-1794.966) (-1799.386) -- 0:01:19
Average standard deviation of split frequencies: 0.002885
780500 -- (-1790.926) [-1792.474] (-1790.891) (-1800.100) * (-1801.969) (-1798.999) [-1793.847] (-1797.968) -- 0:01:19
781000 -- [-1789.265] (-1800.437) (-1800.702) (-1799.483) * (-1798.986) [-1792.777] (-1798.331) (-1794.928) -- 0:01:18
781500 -- (-1794.346) (-1799.957) [-1799.738] (-1791.127) * (-1796.259) (-1794.100) (-1796.652) [-1788.802] -- 0:01:18
782000 -- [-1793.651] (-1794.783) (-1796.383) (-1795.222) * (-1790.418) (-1795.383) (-1796.945) [-1794.580] -- 0:01:18
782500 -- (-1792.732) [-1793.554] (-1805.075) (-1796.396) * (-1794.932) (-1797.934) [-1790.160] (-1797.385) -- 0:01:18
783000 -- (-1794.357) (-1791.914) (-1796.595) [-1793.975] * (-1790.905) [-1792.089] (-1787.931) (-1789.973) -- 0:01:18
783500 -- (-1800.715) (-1790.985) [-1792.933] (-1796.004) * (-1798.493) [-1788.079] (-1797.893) (-1795.886) -- 0:01:17
784000 -- (-1799.544) (-1791.732) (-1801.746) [-1792.432] * (-1798.695) (-1793.531) (-1793.565) [-1802.848] -- 0:01:17
784500 -- [-1799.063] (-1793.799) (-1796.626) (-1807.390) * (-1802.505) (-1794.054) [-1794.809] (-1803.187) -- 0:01:17
785000 -- (-1795.665) [-1790.429] (-1798.126) (-1798.614) * [-1791.332] (-1795.768) (-1790.097) (-1800.461) -- 0:01:17
Average standard deviation of split frequencies: 0.002266
785500 -- (-1794.556) (-1793.514) [-1793.068] (-1800.492) * (-1794.991) (-1792.490) [-1788.526] (-1793.879) -- 0:01:17
786000 -- (-1795.978) [-1792.237] (-1798.720) (-1799.205) * [-1793.341] (-1788.582) (-1802.949) (-1794.495) -- 0:01:17
786500 -- (-1792.503) [-1789.232] (-1795.855) (-1797.253) * (-1792.810) (-1799.997) [-1799.043] (-1795.001) -- 0:01:16
787000 -- (-1796.557) (-1797.161) (-1793.448) [-1796.228] * (-1797.625) [-1790.646] (-1795.467) (-1794.755) -- 0:01:16
787500 -- [-1787.251] (-1792.328) (-1794.458) (-1806.745) * [-1799.760] (-1797.304) (-1794.169) (-1802.113) -- 0:01:16
788000 -- [-1793.331] (-1796.595) (-1799.044) (-1808.859) * (-1792.417) (-1800.321) [-1793.299] (-1798.009) -- 0:01:16
788500 -- (-1793.449) [-1788.951] (-1795.487) (-1793.440) * (-1794.513) [-1794.857] (-1792.663) (-1799.808) -- 0:01:16
789000 -- [-1794.139] (-1794.023) (-1794.998) (-1789.963) * [-1792.105] (-1787.453) (-1798.513) (-1807.503) -- 0:01:15
789500 -- (-1798.449) [-1795.829] (-1798.566) (-1798.037) * (-1796.612) [-1795.882] (-1798.011) (-1796.713) -- 0:01:15
790000 -- (-1805.486) (-1800.924) (-1791.284) [-1791.803] * (-1794.550) (-1788.072) [-1796.503] (-1794.784) -- 0:01:15
Average standard deviation of split frequencies: 0.002451
790500 -- [-1800.537] (-1799.436) (-1796.186) (-1794.546) * (-1792.661) (-1800.405) [-1791.540] (-1801.591) -- 0:01:15
791000 -- (-1791.459) (-1796.437) [-1799.307] (-1795.728) * (-1798.323) [-1791.420] (-1792.354) (-1793.220) -- 0:01:15
791500 -- (-1788.354) [-1796.853] (-1806.288) (-1803.843) * [-1795.496] (-1796.983) (-1795.702) (-1786.663) -- 0:01:15
792000 -- (-1804.359) (-1791.344) (-1801.895) [-1788.707] * (-1789.267) (-1802.400) (-1792.820) [-1790.156] -- 0:01:14
792500 -- [-1792.728] (-1796.739) (-1799.571) (-1788.028) * (-1795.697) (-1793.043) [-1788.549] (-1790.056) -- 0:01:14
793000 -- (-1794.717) (-1793.627) [-1798.902] (-1790.663) * (-1801.698) (-1794.129) [-1789.087] (-1792.098) -- 0:01:14
793500 -- (-1791.803) (-1788.619) [-1790.513] (-1799.907) * (-1798.380) [-1795.531] (-1790.471) (-1795.072) -- 0:01:14
794000 -- (-1795.814) (-1801.636) (-1787.697) [-1795.962] * [-1792.462] (-1806.236) (-1792.293) (-1786.374) -- 0:01:14
794500 -- [-1788.780] (-1790.101) (-1799.118) (-1798.841) * (-1795.138) (-1799.682) [-1789.157] (-1793.694) -- 0:01:13
795000 -- (-1790.928) [-1792.160] (-1796.576) (-1796.086) * [-1792.780] (-1792.816) (-1791.219) (-1789.320) -- 0:01:13
Average standard deviation of split frequencies: 0.003027
795500 -- (-1801.904) (-1797.905) [-1784.474] (-1806.723) * (-1798.290) (-1791.474) [-1787.874] (-1804.676) -- 0:01:13
796000 -- (-1803.000) (-1789.981) [-1797.426] (-1796.571) * (-1793.635) (-1799.739) [-1791.599] (-1806.207) -- 0:01:13
796500 -- (-1794.500) (-1797.454) (-1793.453) [-1797.621] * [-1792.731] (-1796.367) (-1804.554) (-1790.135) -- 0:01:13
797000 -- (-1798.481) (-1799.278) (-1785.770) [-1800.765] * (-1790.423) (-1794.731) [-1788.873] (-1800.408) -- 0:01:13
797500 -- [-1789.135] (-1794.627) (-1804.223) (-1800.658) * (-1789.639) (-1800.739) [-1795.769] (-1793.908) -- 0:01:12
798000 -- [-1793.947] (-1796.156) (-1795.480) (-1789.724) * (-1788.407) (-1800.057) [-1796.661] (-1792.689) -- 0:01:12
798500 -- (-1805.102) (-1793.523) [-1791.728] (-1788.285) * [-1810.102] (-1800.943) (-1796.798) (-1795.124) -- 0:01:12
799000 -- (-1801.472) (-1803.092) (-1786.577) [-1787.482] * (-1803.165) (-1792.990) (-1791.053) [-1790.907] -- 0:01:12
799500 -- (-1795.060) (-1802.576) (-1791.256) [-1795.042] * (-1796.235) (-1796.517) [-1800.012] (-1804.960) -- 0:01:12
800000 -- (-1802.155) (-1789.540) [-1794.047] (-1792.570) * (-1801.832) (-1805.369) [-1795.315] (-1797.044) -- 0:01:12
Average standard deviation of split frequencies: 0.002617
800500 -- (-1804.660) (-1788.949) (-1791.907) [-1790.553] * (-1800.412) (-1790.063) [-1791.605] (-1797.827) -- 0:01:11
801000 -- [-1786.778] (-1793.757) (-1787.996) (-1792.215) * (-1789.302) (-1792.209) [-1790.529] (-1798.720) -- 0:01:11
801500 -- (-1792.403) (-1802.540) [-1793.320] (-1787.245) * [-1795.895] (-1803.009) (-1798.204) (-1795.292) -- 0:01:11
802000 -- [-1790.311] (-1789.900) (-1795.875) (-1792.444) * (-1802.038) (-1798.450) (-1797.434) [-1791.806] -- 0:01:11
802500 -- (-1790.042) [-1793.067] (-1792.201) (-1793.130) * (-1795.349) (-1790.337) [-1790.173] (-1798.929) -- 0:01:11
803000 -- (-1794.710) (-1797.777) (-1791.900) [-1786.580] * (-1795.035) [-1789.769] (-1796.927) (-1795.155) -- 0:01:10
803500 -- (-1791.347) (-1797.691) [-1789.360] (-1794.964) * [-1799.722] (-1795.419) (-1798.390) (-1793.281) -- 0:01:10
804000 -- (-1796.391) [-1795.127] (-1796.118) (-1788.872) * [-1786.127] (-1796.394) (-1795.910) (-1796.867) -- 0:01:10
804500 -- (-1793.231) (-1799.034) [-1788.471] (-1796.235) * [-1793.629] (-1791.507) (-1793.133) (-1799.383) -- 0:01:10
805000 -- (-1794.488) [-1793.566] (-1789.908) (-1798.913) * (-1803.363) [-1796.743] (-1801.974) (-1799.278) -- 0:01:10
Average standard deviation of split frequencies: 0.002794
805500 -- (-1798.063) (-1796.239) [-1787.828] (-1791.458) * (-1796.140) (-1797.228) (-1805.345) [-1791.379] -- 0:01:10
806000 -- (-1794.491) (-1789.430) (-1793.510) [-1793.020] * (-1798.086) (-1788.287) [-1798.574] (-1795.343) -- 0:01:09
806500 -- (-1792.195) [-1787.716] (-1799.851) (-1794.949) * (-1807.732) [-1789.987] (-1794.946) (-1804.567) -- 0:01:09
807000 -- (-1792.562) [-1789.882] (-1796.738) (-1791.377) * (-1793.796) (-1794.332) [-1789.385] (-1792.962) -- 0:01:09
807500 -- (-1797.279) (-1795.462) (-1796.030) [-1790.564] * (-1797.388) (-1799.538) [-1786.590] (-1807.761) -- 0:01:09
808000 -- (-1796.182) (-1794.015) [-1790.547] (-1802.960) * (-1803.309) (-1798.036) (-1795.427) [-1797.850] -- 0:01:09
808500 -- (-1795.134) [-1796.331] (-1803.945) (-1788.284) * (-1794.587) (-1790.623) [-1806.907] (-1801.356) -- 0:01:08
809000 -- (-1795.517) [-1796.953] (-1797.645) (-1800.553) * (-1791.083) (-1787.817) [-1787.603] (-1795.179) -- 0:01:08
809500 -- [-1792.844] (-1798.334) (-1796.369) (-1795.683) * [-1795.773] (-1792.263) (-1791.605) (-1793.892) -- 0:01:08
810000 -- (-1794.419) (-1791.849) [-1792.116] (-1795.912) * (-1806.439) (-1795.162) (-1796.135) [-1792.301] -- 0:01:08
Average standard deviation of split frequencies: 0.003295
810500 -- [-1791.367] (-1792.255) (-1791.185) (-1791.853) * (-1794.233) (-1791.434) [-1803.297] (-1790.205) -- 0:01:08
811000 -- (-1793.814) (-1787.522) [-1793.800] (-1791.878) * (-1793.535) [-1792.200] (-1797.950) (-1798.387) -- 0:01:08
811500 -- (-1795.473) [-1791.631] (-1799.827) (-1790.203) * (-1785.373) (-1790.549) (-1790.890) [-1794.153] -- 0:01:07
812000 -- [-1790.117] (-1792.936) (-1798.755) (-1799.102) * (-1799.674) (-1796.535) (-1796.519) [-1792.803] -- 0:01:07
812500 -- [-1787.456] (-1790.825) (-1794.854) (-1800.158) * (-1798.075) (-1792.230) (-1793.370) [-1797.320] -- 0:01:07
813000 -- [-1799.386] (-1802.607) (-1793.818) (-1796.022) * (-1799.985) (-1791.973) (-1795.260) [-1792.949] -- 0:01:07
813500 -- [-1794.134] (-1799.255) (-1800.713) (-1797.867) * [-1794.655] (-1790.967) (-1792.359) (-1792.266) -- 0:01:07
814000 -- (-1790.372) (-1810.530) (-1790.344) [-1795.838] * (-1794.782) (-1796.546) (-1807.232) [-1791.478] -- 0:01:06
814500 -- (-1789.839) (-1796.779) (-1799.838) [-1797.966] * (-1794.863) (-1792.890) [-1797.930] (-1803.221) -- 0:01:06
815000 -- [-1799.104] (-1808.105) (-1799.978) (-1794.126) * (-1798.636) [-1790.698] (-1796.989) (-1800.729) -- 0:01:06
Average standard deviation of split frequencies: 0.003787
815500 -- (-1795.402) (-1796.264) (-1793.399) [-1789.099] * (-1801.016) (-1796.356) (-1805.835) [-1801.195] -- 0:01:06
816000 -- (-1795.791) [-1791.615] (-1791.554) (-1793.289) * (-1798.251) (-1788.997) [-1793.024] (-1801.313) -- 0:01:06
816500 -- (-1789.672) [-1801.168] (-1798.801) (-1790.842) * (-1791.831) (-1802.620) (-1804.842) [-1788.151] -- 0:01:06
817000 -- [-1795.396] (-1792.472) (-1795.225) (-1801.413) * [-1794.506] (-1794.109) (-1796.492) (-1792.196) -- 0:01:05
817500 -- (-1797.961) [-1794.044] (-1792.647) (-1794.530) * (-1801.556) (-1791.577) (-1796.103) [-1786.538] -- 0:01:05
818000 -- (-1797.060) [-1796.086] (-1799.068) (-1797.750) * (-1811.488) (-1787.494) (-1788.946) [-1791.325] -- 0:01:05
818500 -- (-1789.721) [-1794.883] (-1801.547) (-1801.623) * (-1793.435) [-1791.306] (-1797.379) (-1791.418) -- 0:01:05
819000 -- [-1792.498] (-1802.505) (-1802.965) (-1801.719) * (-1800.604) (-1790.538) [-1795.945] (-1800.843) -- 0:01:05
819500 -- (-1786.428) [-1793.657] (-1796.573) (-1791.040) * (-1799.692) (-1796.825) (-1795.548) [-1789.925] -- 0:01:04
820000 -- (-1796.303) [-1793.250] (-1796.337) (-1798.527) * (-1792.777) (-1797.401) (-1788.206) [-1794.390] -- 0:01:04
Average standard deviation of split frequencies: 0.003957
820500 -- (-1793.179) [-1791.416] (-1795.548) (-1795.021) * (-1800.331) (-1790.214) [-1793.126] (-1800.417) -- 0:01:04
821000 -- [-1797.203] (-1789.881) (-1792.478) (-1798.397) * (-1792.579) [-1798.577] (-1798.489) (-1801.090) -- 0:01:04
821500 -- [-1790.000] (-1796.433) (-1797.324) (-1797.056) * (-1795.766) (-1797.185) [-1795.062] (-1795.071) -- 0:01:04
822000 -- [-1792.792] (-1791.776) (-1797.107) (-1795.551) * (-1801.797) (-1797.093) [-1795.510] (-1802.656) -- 0:01:04
822500 -- (-1795.664) [-1794.412] (-1793.340) (-1793.488) * (-1796.468) (-1795.004) [-1791.559] (-1793.450) -- 0:01:03
823000 -- [-1794.461] (-1809.698) (-1783.346) (-1804.902) * [-1788.173] (-1800.969) (-1795.221) (-1795.406) -- 0:01:03
823500 -- [-1795.798] (-1799.575) (-1802.150) (-1795.848) * (-1791.396) (-1797.481) [-1792.033] (-1799.740) -- 0:01:03
824000 -- (-1798.511) (-1799.796) [-1794.775] (-1801.196) * (-1797.053) (-1805.279) [-1793.053] (-1797.048) -- 0:01:03
824500 -- [-1792.630] (-1795.691) (-1810.348) (-1798.645) * [-1789.403] (-1795.681) (-1798.605) (-1790.787) -- 0:01:03
825000 -- (-1799.914) (-1791.616) (-1791.717) [-1792.739] * (-1796.780) (-1801.083) (-1787.208) [-1792.051] -- 0:01:03
Average standard deviation of split frequencies: 0.004185
825500 -- (-1787.711) (-1793.773) (-1806.503) [-1801.065] * (-1794.034) (-1795.652) (-1795.667) [-1789.826] -- 0:01:02
826000 -- (-1788.835) [-1801.626] (-1794.913) (-1798.551) * [-1791.794] (-1790.535) (-1790.231) (-1789.148) -- 0:01:02
826500 -- (-1796.613) (-1798.880) [-1798.052] (-1793.755) * (-1790.183) (-1797.653) (-1796.648) [-1791.904] -- 0:01:02
827000 -- (-1786.665) (-1808.504) (-1797.096) [-1791.124] * (-1792.804) [-1793.543] (-1800.015) (-1792.041) -- 0:01:02
827500 -- (-1786.564) (-1800.434) [-1794.435] (-1800.148) * (-1802.886) (-1795.140) (-1788.513) [-1794.023] -- 0:01:02
828000 -- (-1799.113) [-1794.536] (-1803.465) (-1794.279) * (-1795.363) (-1799.139) [-1796.284] (-1789.856) -- 0:01:01
828500 -- (-1806.992) (-1797.932) (-1793.886) [-1790.755] * [-1789.436] (-1797.018) (-1793.075) (-1801.022) -- 0:01:01
829000 -- (-1796.804) (-1797.444) [-1799.126] (-1793.511) * (-1796.508) (-1797.021) (-1793.454) [-1801.604] -- 0:01:01
829500 -- (-1796.159) [-1796.160] (-1793.941) (-1793.055) * (-1786.169) (-1795.499) [-1788.398] (-1797.656) -- 0:01:01
830000 -- (-1791.876) (-1793.542) (-1796.588) [-1792.517] * (-1796.282) (-1805.094) (-1797.070) [-1795.446] -- 0:01:01
Average standard deviation of split frequencies: 0.004162
830500 -- (-1791.660) (-1802.213) [-1793.542] (-1788.086) * (-1797.735) (-1792.489) [-1789.681] (-1803.703) -- 0:01:01
831000 -- (-1795.609) (-1801.918) (-1795.496) [-1792.220] * (-1790.969) (-1807.969) [-1800.134] (-1799.020) -- 0:01:00
831500 -- (-1789.200) (-1799.260) [-1790.981] (-1796.006) * (-1790.145) (-1796.996) [-1792.855] (-1799.789) -- 0:01:00
832000 -- (-1796.614) (-1794.897) (-1798.641) [-1788.384] * (-1792.601) (-1810.870) [-1792.843] (-1794.942) -- 0:01:00
832500 -- (-1797.148) [-1795.290] (-1793.878) (-1803.119) * (-1793.262) (-1799.210) (-1795.418) [-1807.164] -- 0:01:00
833000 -- (-1796.126) (-1798.957) (-1792.797) [-1789.581] * (-1799.085) (-1796.819) (-1799.319) [-1791.320] -- 0:01:00
833500 -- (-1796.743) (-1797.999) (-1800.780) [-1789.737] * (-1799.878) (-1798.868) (-1803.088) [-1789.980] -- 0:00:59
834000 -- [-1794.004] (-1791.025) (-1795.349) (-1801.321) * (-1804.615) (-1796.899) (-1792.195) [-1793.911] -- 0:00:59
834500 -- [-1794.848] (-1791.755) (-1791.539) (-1797.691) * (-1798.062) (-1800.613) (-1796.399) [-1792.701] -- 0:00:59
835000 -- (-1791.723) (-1790.901) (-1795.728) [-1790.186] * (-1801.270) (-1802.596) [-1788.440] (-1800.995) -- 0:00:59
Average standard deviation of split frequencies: 0.004010
835500 -- (-1799.736) (-1800.296) (-1792.453) [-1795.268] * (-1803.046) (-1798.930) (-1791.711) [-1793.203] -- 0:00:59
836000 -- [-1793.232] (-1797.970) (-1793.621) (-1803.015) * [-1793.940] (-1798.112) (-1798.019) (-1801.829) -- 0:00:59
836500 -- [-1796.470] (-1806.296) (-1786.245) (-1795.256) * (-1793.908) (-1793.767) (-1791.421) [-1795.075] -- 0:00:58
837000 -- [-1795.750] (-1795.645) (-1794.178) (-1788.997) * [-1788.861] (-1796.862) (-1795.968) (-1795.590) -- 0:00:58
837500 -- (-1788.763) (-1801.101) [-1792.451] (-1793.710) * [-1784.600] (-1800.734) (-1805.942) (-1805.058) -- 0:00:58
838000 -- (-1798.456) (-1796.877) (-1788.937) [-1794.379] * [-1788.749] (-1797.185) (-1791.754) (-1790.732) -- 0:00:58
838500 -- (-1803.619) (-1798.653) (-1800.525) [-1791.235] * (-1795.290) [-1788.567] (-1797.926) (-1795.846) -- 0:00:58
839000 -- (-1795.232) (-1805.228) [-1792.294] (-1802.001) * [-1795.803] (-1789.993) (-1796.440) (-1808.487) -- 0:00:57
839500 -- (-1800.549) (-1800.873) [-1795.328] (-1806.788) * (-1800.071) [-1801.841] (-1792.617) (-1792.497) -- 0:00:57
840000 -- (-1796.656) [-1801.742] (-1807.610) (-1793.144) * [-1791.994] (-1792.478) (-1807.678) (-1795.574) -- 0:00:57
Average standard deviation of split frequencies: 0.002866
840500 -- (-1799.944) (-1802.480) [-1797.983] (-1791.729) * (-1794.447) (-1794.321) [-1797.811] (-1800.547) -- 0:00:57
841000 -- [-1797.391] (-1800.081) (-1793.406) (-1791.529) * (-1786.644) (-1792.282) (-1797.283) [-1801.888] -- 0:00:57
841500 -- [-1794.041] (-1787.932) (-1794.703) (-1802.105) * [-1791.823] (-1804.413) (-1798.926) (-1803.457) -- 0:00:57
842000 -- (-1793.473) (-1793.379) (-1792.032) [-1789.786] * [-1794.463] (-1794.634) (-1800.625) (-1799.461) -- 0:00:56
842500 -- (-1790.283) (-1791.018) (-1798.184) [-1790.217] * (-1787.668) (-1795.024) (-1799.482) [-1794.241] -- 0:00:56
843000 -- [-1801.505] (-1790.144) (-1799.659) (-1798.281) * (-1804.080) (-1805.616) [-1795.533] (-1805.925) -- 0:00:56
843500 -- (-1804.521) (-1793.425) [-1796.461] (-1798.317) * [-1793.021] (-1795.481) (-1791.025) (-1799.464) -- 0:00:56
844000 -- [-1796.512] (-1796.757) (-1793.487) (-1805.605) * [-1791.623] (-1799.006) (-1795.215) (-1794.916) -- 0:00:56
844500 -- (-1796.337) (-1793.294) [-1790.050] (-1792.617) * [-1793.922] (-1808.639) (-1794.444) (-1797.512) -- 0:00:55
845000 -- (-1785.910) (-1787.412) [-1791.243] (-1796.002) * (-1799.243) (-1800.291) (-1792.788) [-1792.902] -- 0:00:55
Average standard deviation of split frequencies: 0.002972
845500 -- (-1789.479) (-1788.796) (-1795.413) [-1793.695] * [-1794.415] (-1804.884) (-1788.537) (-1797.105) -- 0:00:55
846000 -- (-1796.815) [-1792.573] (-1805.899) (-1795.295) * (-1795.233) [-1788.332] (-1800.674) (-1794.204) -- 0:00:55
846500 -- [-1792.789] (-1793.131) (-1807.240) (-1802.995) * (-1799.523) [-1789.095] (-1799.519) (-1800.618) -- 0:00:55
847000 -- (-1807.093) (-1797.699) (-1796.765) [-1802.414] * (-1799.248) [-1792.847] (-1790.554) (-1797.581) -- 0:00:55
847500 -- (-1802.357) [-1801.020] (-1800.956) (-1795.532) * (-1790.245) (-1785.973) [-1794.607] (-1795.423) -- 0:00:54
848000 -- (-1792.103) (-1795.529) [-1789.633] (-1800.395) * (-1790.971) [-1789.923] (-1796.795) (-1794.178) -- 0:00:54
848500 -- [-1793.502] (-1795.460) (-1794.395) (-1795.292) * (-1790.486) (-1793.680) [-1795.820] (-1795.586) -- 0:00:54
849000 -- (-1790.906) (-1792.457) [-1797.278] (-1789.617) * [-1794.082] (-1801.480) (-1796.755) (-1801.991) -- 0:00:54
849500 -- (-1796.842) [-1795.823] (-1791.737) (-1798.261) * (-1799.123) (-1797.251) [-1800.570] (-1799.546) -- 0:00:54
850000 -- (-1792.417) [-1790.154] (-1798.026) (-1796.607) * (-1794.058) (-1795.438) (-1801.807) [-1785.953] -- 0:00:54
Average standard deviation of split frequencies: 0.002832
850500 -- [-1787.560] (-1795.176) (-1798.566) (-1798.678) * (-1799.203) [-1791.020] (-1795.321) (-1789.091) -- 0:00:53
851000 -- (-1796.777) [-1788.114] (-1801.226) (-1799.032) * (-1790.710) (-1797.068) (-1792.642) [-1789.692] -- 0:00:53
851500 -- [-1791.073] (-1790.598) (-1800.259) (-1795.755) * [-1793.570] (-1803.256) (-1797.702) (-1792.972) -- 0:00:53
852000 -- (-1792.918) [-1793.481] (-1791.727) (-1792.590) * (-1803.511) (-1800.387) (-1787.963) [-1789.666] -- 0:00:53
852500 -- (-1796.484) [-1793.604] (-1796.453) (-1792.215) * (-1788.290) [-1794.741] (-1791.864) (-1797.274) -- 0:00:53
853000 -- [-1802.769] (-1789.890) (-1799.527) (-1797.226) * [-1790.659] (-1794.112) (-1794.601) (-1793.909) -- 0:00:52
853500 -- [-1793.416] (-1789.793) (-1801.232) (-1793.233) * [-1792.974] (-1794.872) (-1797.845) (-1793.635) -- 0:00:52
854000 -- (-1793.974) [-1794.150] (-1798.434) (-1798.059) * (-1801.457) (-1793.773) (-1789.468) [-1793.182] -- 0:00:52
854500 -- (-1795.403) (-1787.864) [-1789.480] (-1796.177) * (-1791.941) (-1792.542) (-1794.175) [-1797.803] -- 0:00:52
855000 -- (-1805.384) (-1809.051) [-1800.077] (-1790.756) * (-1791.993) [-1797.256] (-1787.969) (-1803.112) -- 0:00:52
Average standard deviation of split frequencies: 0.002570
855500 -- (-1801.196) (-1791.355) (-1808.280) [-1793.041] * (-1795.626) [-1801.759] (-1793.898) (-1800.372) -- 0:00:52
856000 -- (-1799.018) [-1790.270] (-1795.949) (-1807.142) * (-1789.203) [-1789.857] (-1788.936) (-1793.309) -- 0:00:51
856500 -- (-1784.847) (-1790.926) (-1797.670) [-1792.058] * (-1788.510) [-1791.246] (-1797.569) (-1795.276) -- 0:00:51
857000 -- [-1795.371] (-1795.303) (-1797.425) (-1793.531) * (-1803.377) (-1793.978) [-1789.716] (-1803.400) -- 0:00:51
857500 -- (-1791.095) (-1790.146) (-1802.818) [-1789.036] * (-1792.502) (-1794.625) [-1793.180] (-1798.149) -- 0:00:51
858000 -- (-1796.776) (-1789.463) [-1800.622] (-1794.903) * (-1802.672) (-1795.053) [-1792.955] (-1796.089) -- 0:00:51
858500 -- [-1791.159] (-1794.565) (-1795.853) (-1796.046) * [-1791.990] (-1792.638) (-1795.797) (-1797.673) -- 0:00:50
859000 -- [-1802.108] (-1799.159) (-1797.058) (-1791.803) * (-1799.206) [-1797.483] (-1787.189) (-1798.768) -- 0:00:50
859500 -- (-1803.780) (-1801.473) (-1794.612) [-1786.487] * (-1797.998) [-1790.010] (-1799.077) (-1801.318) -- 0:00:50
860000 -- (-1808.937) (-1796.258) (-1787.055) [-1795.258] * (-1805.580) [-1794.898] (-1798.906) (-1806.956) -- 0:00:50
Average standard deviation of split frequencies: 0.002252
860500 -- [-1791.502] (-1797.715) (-1789.638) (-1803.806) * [-1798.102] (-1794.036) (-1794.026) (-1794.166) -- 0:00:50
861000 -- [-1789.293] (-1802.197) (-1791.408) (-1796.994) * (-1792.985) (-1795.262) [-1789.235] (-1799.089) -- 0:00:50
861500 -- (-1809.772) (-1793.097) (-1795.176) [-1791.440] * (-1793.849) (-1794.129) [-1790.430] (-1792.314) -- 0:00:49
862000 -- (-1811.298) (-1800.540) [-1793.475] (-1792.450) * (-1795.134) (-1792.248) (-1791.122) [-1792.528] -- 0:00:49
862500 -- (-1800.382) (-1792.582) [-1798.445] (-1795.386) * (-1798.847) (-1793.921) [-1789.119] (-1805.809) -- 0:00:49
863000 -- (-1797.819) [-1793.991] (-1794.771) (-1794.886) * (-1792.400) (-1791.284) (-1798.631) [-1791.171] -- 0:00:49
863500 -- (-1795.751) [-1788.569] (-1801.171) (-1797.383) * (-1804.434) [-1792.139] (-1792.325) (-1797.138) -- 0:00:49
864000 -- (-1794.871) [-1794.711] (-1799.103) (-1799.276) * (-1796.109) (-1803.192) [-1794.141] (-1801.030) -- 0:00:48
864500 -- [-1790.715] (-1791.800) (-1798.361) (-1794.596) * [-1793.904] (-1791.647) (-1793.657) (-1799.174) -- 0:00:48
865000 -- (-1792.078) [-1793.010] (-1798.782) (-1799.814) * (-1790.702) (-1795.988) [-1789.809] (-1803.952) -- 0:00:48
Average standard deviation of split frequencies: 0.002056
865500 -- (-1795.915) [-1797.225] (-1794.232) (-1792.459) * [-1791.744] (-1801.486) (-1798.422) (-1800.316) -- 0:00:48
866000 -- (-1793.719) (-1801.934) [-1798.670] (-1797.954) * (-1792.732) (-1799.589) [-1796.718] (-1795.899) -- 0:00:48
866500 -- [-1793.557] (-1801.346) (-1806.044) (-1790.270) * (-1798.266) (-1799.883) [-1794.337] (-1799.660) -- 0:00:48
867000 -- (-1798.938) (-1792.015) [-1802.342] (-1802.772) * (-1791.681) [-1801.288] (-1793.324) (-1797.528) -- 0:00:47
867500 -- (-1797.841) [-1788.907] (-1793.980) (-1796.904) * (-1790.279) [-1794.223] (-1804.633) (-1802.871) -- 0:00:47
868000 -- [-1799.144] (-1792.217) (-1789.686) (-1802.258) * (-1796.771) (-1799.961) [-1792.495] (-1797.449) -- 0:00:47
868500 -- (-1803.648) (-1798.457) (-1794.964) [-1797.006] * (-1792.714) (-1791.552) (-1799.172) [-1801.826] -- 0:00:47
869000 -- (-1797.935) (-1798.911) (-1795.919) [-1792.805] * (-1785.868) (-1791.238) (-1800.272) [-1802.914] -- 0:00:47
869500 -- (-1795.127) [-1797.404] (-1792.970) (-1793.260) * (-1784.994) [-1789.004] (-1796.161) (-1795.321) -- 0:00:46
870000 -- (-1797.902) (-1795.378) (-1794.445) [-1795.695] * (-1793.114) [-1798.407] (-1801.418) (-1798.746) -- 0:00:46
Average standard deviation of split frequencies: 0.002166
870500 -- [-1791.928] (-1791.080) (-1801.727) (-1789.975) * (-1789.735) [-1787.159] (-1796.359) (-1794.984) -- 0:00:46
871000 -- (-1800.008) [-1792.487] (-1789.201) (-1796.885) * (-1792.375) [-1794.831] (-1799.723) (-1801.276) -- 0:00:46
871500 -- (-1794.301) (-1801.974) (-1798.561) [-1789.434] * (-1791.572) (-1792.560) [-1796.084] (-1802.842) -- 0:00:46
872000 -- [-1793.164] (-1791.265) (-1797.793) (-1795.186) * (-1791.721) (-1795.715) (-1802.951) [-1794.915] -- 0:00:46
872500 -- (-1794.836) (-1798.821) [-1790.983] (-1791.741) * (-1799.996) (-1794.380) [-1791.490] (-1799.518) -- 0:00:45
873000 -- (-1789.262) [-1786.671] (-1795.835) (-1788.550) * (-1799.641) (-1799.014) [-1790.550] (-1802.595) -- 0:00:45
873500 -- (-1794.697) [-1787.088] (-1789.835) (-1805.658) * [-1791.070] (-1796.743) (-1792.308) (-1796.135) -- 0:00:45
874000 -- (-1801.933) [-1787.064] (-1793.779) (-1793.888) * (-1795.204) (-1801.368) (-1791.089) [-1790.376] -- 0:00:45
874500 -- (-1793.752) (-1794.396) [-1792.963] (-1794.658) * [-1793.247] (-1792.466) (-1789.393) (-1802.678) -- 0:00:45
875000 -- (-1790.274) (-1795.593) (-1795.255) [-1790.890] * (-1791.900) (-1794.165) (-1801.094) [-1793.486] -- 0:00:45
Average standard deviation of split frequencies: 0.001794
875500 -- [-1792.139] (-1800.845) (-1792.649) (-1801.154) * (-1792.850) (-1792.782) [-1791.581] (-1791.634) -- 0:00:44
876000 -- (-1799.305) (-1807.035) (-1796.942) [-1792.182] * (-1791.687) (-1796.457) (-1799.503) [-1798.468] -- 0:00:44
876500 -- (-1800.300) (-1806.244) [-1791.543] (-1796.969) * (-1801.649) (-1791.371) [-1790.433] (-1798.044) -- 0:00:44
877000 -- (-1797.757) (-1807.351) (-1797.501) [-1792.312] * (-1800.195) [-1788.992] (-1793.189) (-1787.898) -- 0:00:44
877500 -- (-1792.803) [-1800.089] (-1802.750) (-1794.792) * (-1797.475) [-1788.078] (-1799.694) (-1804.731) -- 0:00:44
878000 -- [-1801.480] (-1803.034) (-1796.772) (-1799.393) * (-1813.450) (-1792.691) (-1796.522) [-1796.247] -- 0:00:43
878500 -- [-1788.038] (-1795.478) (-1797.981) (-1801.149) * (-1809.664) [-1796.330] (-1793.539) (-1795.932) -- 0:00:43
879000 -- (-1788.046) (-1798.702) (-1799.830) [-1796.723] * (-1798.834) [-1790.782] (-1795.268) (-1800.170) -- 0:00:43
879500 -- [-1788.741] (-1806.049) (-1792.306) (-1802.161) * (-1796.066) [-1791.797] (-1801.724) (-1796.692) -- 0:00:43
880000 -- (-1801.756) (-1795.355) [-1790.261] (-1800.441) * (-1799.542) (-1793.662) [-1795.303] (-1795.110) -- 0:00:43
Average standard deviation of split frequencies: 0.001368
880500 -- (-1802.810) [-1791.369] (-1791.708) (-1803.898) * (-1795.350) (-1793.375) (-1801.095) [-1793.252] -- 0:00:43
881000 -- (-1789.437) (-1790.080) [-1787.929] (-1793.995) * (-1791.070) [-1791.884] (-1794.761) (-1801.240) -- 0:00:42
881500 -- [-1792.161] (-1800.592) (-1799.732) (-1790.717) * (-1796.357) (-1798.002) (-1785.157) [-1793.085] -- 0:00:42
882000 -- (-1800.313) [-1785.732] (-1797.011) (-1802.675) * [-1797.036] (-1803.393) (-1795.327) (-1799.450) -- 0:00:42
882500 -- [-1800.052] (-1792.703) (-1794.301) (-1793.371) * [-1785.969] (-1797.992) (-1800.371) (-1794.349) -- 0:00:42
883000 -- (-1794.288) (-1797.356) (-1789.128) [-1794.879] * (-1788.768) [-1789.106] (-1801.699) (-1794.256) -- 0:00:42
883500 -- (-1796.899) (-1796.331) (-1796.037) [-1788.652] * (-1792.204) (-1796.462) (-1800.853) [-1794.494] -- 0:00:41
884000 -- (-1799.438) (-1799.357) (-1790.293) [-1794.804] * (-1787.216) (-1801.561) [-1792.677] (-1792.108) -- 0:00:41
884500 -- (-1800.433) (-1801.153) [-1795.896] (-1800.115) * (-1788.361) [-1796.621] (-1795.475) (-1790.381) -- 0:00:41
885000 -- (-1792.512) [-1794.685] (-1793.699) (-1798.144) * [-1796.054] (-1802.853) (-1798.292) (-1803.359) -- 0:00:41
Average standard deviation of split frequencies: 0.000769
885500 -- (-1796.797) (-1801.874) (-1796.882) [-1790.711] * (-1788.174) [-1791.714] (-1802.426) (-1794.117) -- 0:00:41
886000 -- [-1793.064] (-1793.892) (-1801.376) (-1793.116) * (-1796.302) (-1798.031) (-1804.527) [-1796.788] -- 0:00:41
886500 -- [-1796.388] (-1794.294) (-1802.094) (-1794.198) * [-1789.516] (-1792.716) (-1794.980) (-1793.696) -- 0:00:40
887000 -- (-1804.398) (-1791.744) (-1803.738) [-1795.830] * (-1795.295) (-1797.463) [-1793.566] (-1797.418) -- 0:00:40
887500 -- (-1800.441) [-1787.511] (-1794.514) (-1790.364) * (-1797.352) (-1794.216) (-1801.836) [-1792.941] -- 0:00:40
888000 -- (-1808.529) (-1788.988) (-1799.885) [-1791.319] * (-1792.630) [-1791.654] (-1799.544) (-1798.310) -- 0:00:40
888500 -- (-1810.952) (-1799.185) (-1799.739) [-1793.406] * (-1811.052) (-1792.870) [-1795.012] (-1796.361) -- 0:00:40
889000 -- (-1794.088) (-1794.390) (-1797.886) [-1801.088] * (-1790.910) (-1797.938) (-1795.641) [-1800.502] -- 0:00:39
889500 -- (-1796.275) [-1793.123] (-1806.370) (-1794.586) * (-1795.795) (-1800.574) [-1788.727] (-1785.691) -- 0:00:39
890000 -- (-1790.687) [-1791.946] (-1806.173) (-1802.865) * (-1803.968) (-1792.665) [-1790.439] (-1786.873) -- 0:00:39
Average standard deviation of split frequencies: 0.001353
890500 -- (-1791.847) (-1789.934) (-1803.673) [-1794.200] * (-1788.635) (-1795.430) (-1796.156) [-1797.531] -- 0:00:39
891000 -- [-1796.380] (-1802.752) (-1803.932) (-1802.075) * (-1789.741) (-1800.192) [-1801.238] (-1797.748) -- 0:00:39
891500 -- [-1798.831] (-1798.616) (-1806.049) (-1793.465) * [-1789.364] (-1793.831) (-1787.192) (-1801.858) -- 0:00:39
892000 -- (-1800.004) [-1798.261] (-1797.531) (-1796.248) * (-1793.377) (-1799.890) (-1791.832) [-1790.676] -- 0:00:38
892500 -- [-1801.793] (-1799.528) (-1793.047) (-1794.468) * (-1792.403) [-1796.839] (-1801.273) (-1791.429) -- 0:00:38
893000 -- [-1792.331] (-1794.655) (-1798.589) (-1798.765) * [-1791.884] (-1794.392) (-1802.750) (-1806.793) -- 0:00:38
893500 -- [-1789.482] (-1801.230) (-1797.785) (-1787.360) * (-1793.036) (-1796.040) (-1792.094) [-1793.601] -- 0:00:38
894000 -- (-1797.616) (-1790.338) [-1792.689] (-1790.943) * [-1784.037] (-1799.361) (-1801.070) (-1795.340) -- 0:00:38
894500 -- [-1796.397] (-1806.944) (-1792.774) (-1802.051) * [-1793.934] (-1800.696) (-1804.321) (-1798.846) -- 0:00:37
895000 -- [-1795.709] (-1796.253) (-1799.497) (-1794.215) * [-1794.209] (-1803.289) (-1800.872) (-1794.898) -- 0:00:37
Average standard deviation of split frequencies: 0.001169
895500 -- (-1804.602) (-1795.516) (-1795.694) [-1790.744] * [-1801.302] (-1802.683) (-1801.872) (-1800.090) -- 0:00:37
896000 -- [-1792.626] (-1797.405) (-1788.538) (-1790.364) * (-1792.731) (-1791.411) (-1801.424) [-1794.126] -- 0:00:37
896500 -- (-1791.694) (-1793.427) [-1797.278] (-1797.238) * (-1799.562) (-1790.288) (-1803.448) [-1791.344] -- 0:00:37
897000 -- (-1791.658) (-1800.115) [-1790.127] (-1790.648) * (-1799.404) (-1786.564) (-1796.656) [-1797.829] -- 0:00:37
897500 -- (-1795.907) (-1797.733) (-1795.132) [-1798.062] * [-1794.588] (-1790.964) (-1802.107) (-1789.223) -- 0:00:36
898000 -- (-1792.982) (-1793.618) (-1799.272) [-1791.682] * (-1792.463) (-1790.109) (-1801.085) [-1793.196] -- 0:00:36
898500 -- (-1799.085) [-1792.727] (-1798.570) (-1793.578) * [-1793.863] (-1791.357) (-1798.754) (-1794.620) -- 0:00:36
899000 -- (-1790.562) (-1790.513) (-1796.346) [-1792.360] * (-1790.560) (-1788.341) [-1794.008] (-1795.522) -- 0:00:36
899500 -- [-1789.211] (-1789.836) (-1800.085) (-1795.042) * [-1794.141] (-1796.561) (-1797.014) (-1799.173) -- 0:00:36
900000 -- (-1795.439) (-1789.828) (-1786.892) [-1801.965] * (-1794.541) (-1800.504) (-1796.469) [-1787.469] -- 0:00:36
Average standard deviation of split frequencies: 0.001686
900500 -- [-1793.678] (-1803.809) (-1791.334) (-1789.078) * (-1797.206) (-1795.793) (-1804.249) [-1800.319] -- 0:00:35
901000 -- (-1799.817) (-1788.815) [-1788.329] (-1790.444) * (-1793.412) (-1799.027) (-1795.215) [-1794.827] -- 0:00:35
901500 -- (-1793.376) (-1796.325) (-1790.927) [-1796.312] * (-1795.541) (-1795.908) [-1788.611] (-1799.773) -- 0:00:35
902000 -- (-1805.042) [-1786.755] (-1795.368) (-1799.028) * [-1792.451] (-1793.887) (-1793.408) (-1803.675) -- 0:00:35
902500 -- (-1794.919) (-1797.325) [-1794.597] (-1792.250) * [-1791.479] (-1793.149) (-1788.996) (-1797.934) -- 0:00:35
903000 -- (-1795.020) [-1793.903] (-1802.153) (-1795.367) * (-1792.285) (-1801.720) (-1796.365) [-1794.493] -- 0:00:34
903500 -- [-1794.619] (-1788.573) (-1796.271) (-1791.152) * (-1800.469) (-1799.730) (-1798.051) [-1793.657] -- 0:00:34
904000 -- (-1792.096) (-1793.816) (-1793.716) [-1793.609] * (-1789.561) [-1793.060] (-1797.646) (-1803.418) -- 0:00:34
904500 -- (-1801.241) (-1790.593) (-1798.478) [-1792.092] * (-1794.869) (-1803.917) [-1802.631] (-1800.025) -- 0:00:34
905000 -- [-1795.458] (-1805.288) (-1796.575) (-1796.818) * [-1799.301] (-1800.214) (-1796.632) (-1801.200) -- 0:00:34
Average standard deviation of split frequencies: 0.001272
905500 -- (-1792.833) (-1802.144) (-1798.429) [-1788.334] * (-1794.001) (-1799.070) [-1791.776] (-1801.217) -- 0:00:34
906000 -- (-1793.731) (-1796.216) (-1799.236) [-1787.896] * [-1793.987] (-1792.431) (-1790.825) (-1801.786) -- 0:00:33
906500 -- [-1792.236] (-1793.845) (-1793.460) (-1791.220) * [-1795.441] (-1796.230) (-1793.457) (-1798.104) -- 0:00:33
907000 -- [-1797.932] (-1799.074) (-1804.545) (-1802.174) * (-1791.777) [-1791.946] (-1794.414) (-1795.143) -- 0:00:33
907500 -- (-1798.762) (-1799.172) (-1792.370) [-1801.003] * (-1792.307) [-1789.279] (-1802.257) (-1790.535) -- 0:00:33
908000 -- (-1797.318) (-1797.634) [-1791.569] (-1793.586) * (-1787.856) [-1785.857] (-1797.949) (-1795.833) -- 0:00:33
908500 -- (-1811.097) (-1786.968) [-1795.561] (-1800.238) * (-1792.080) (-1798.650) (-1793.787) [-1796.556] -- 0:00:32
909000 -- (-1813.825) [-1792.484] (-1796.663) (-1796.310) * (-1801.660) (-1796.385) (-1790.823) [-1802.361] -- 0:00:32
909500 -- (-1813.335) [-1793.653] (-1799.779) (-1793.603) * (-1791.830) (-1801.109) [-1790.369] (-1791.017) -- 0:00:32
910000 -- (-1792.880) (-1795.320) (-1804.137) [-1797.901] * (-1790.208) (-1800.308) [-1787.288] (-1796.172) -- 0:00:32
Average standard deviation of split frequencies: 0.001035
910500 -- (-1800.313) (-1798.626) [-1793.139] (-1793.123) * (-1803.547) (-1799.171) (-1791.172) [-1795.950] -- 0:00:32
911000 -- (-1790.970) (-1792.313) (-1798.466) [-1790.256] * (-1798.285) (-1804.655) (-1798.794) [-1798.929] -- 0:00:32
911500 -- [-1790.805] (-1799.503) (-1800.928) (-1796.784) * (-1788.600) [-1795.264] (-1802.563) (-1797.214) -- 0:00:31
912000 -- (-1793.194) (-1797.240) [-1798.031] (-1796.235) * [-1800.231] (-1790.688) (-1791.441) (-1796.917) -- 0:00:31
912500 -- (-1792.155) (-1796.232) (-1795.463) [-1802.617] * (-1795.242) [-1799.125] (-1800.999) (-1793.300) -- 0:00:31
913000 -- (-1794.497) [-1797.441] (-1791.647) (-1808.954) * (-1800.967) [-1802.214] (-1812.185) (-1798.550) -- 0:00:31
913500 -- [-1793.706] (-1792.251) (-1791.568) (-1795.011) * [-1787.906] (-1792.005) (-1805.437) (-1797.177) -- 0:00:31
914000 -- (-1790.469) (-1794.553) [-1789.645] (-1795.763) * [-1792.511] (-1793.095) (-1797.855) (-1803.675) -- 0:00:30
914500 -- (-1794.822) [-1791.943] (-1793.004) (-1791.429) * [-1796.690] (-1799.954) (-1799.833) (-1792.031) -- 0:00:30
915000 -- (-1805.389) (-1795.472) [-1803.814] (-1793.221) * [-1793.417] (-1794.292) (-1794.435) (-1805.129) -- 0:00:30
Average standard deviation of split frequencies: 0.000972
915500 -- (-1794.324) (-1796.309) [-1797.998] (-1791.304) * (-1792.269) (-1794.219) (-1794.395) [-1796.925] -- 0:00:30
916000 -- (-1793.864) (-1787.300) (-1791.518) [-1799.638] * [-1792.554] (-1804.071) (-1791.861) (-1789.316) -- 0:00:30
916500 -- (-1794.945) (-1794.038) (-1801.199) [-1793.528] * (-1793.569) [-1799.367] (-1795.348) (-1794.562) -- 0:00:30
917000 -- [-1789.310] (-1798.680) (-1801.011) (-1798.717) * (-1795.940) (-1796.592) (-1804.638) [-1800.403] -- 0:00:29
917500 -- (-1794.896) (-1798.595) [-1795.064] (-1795.170) * [-1800.400] (-1796.452) (-1796.167) (-1795.064) -- 0:00:29
918000 -- [-1788.869] (-1793.066) (-1795.534) (-1795.016) * (-1798.487) [-1789.785] (-1794.579) (-1804.842) -- 0:00:29
918500 -- (-1793.242) (-1795.415) (-1799.094) [-1792.602] * (-1795.185) [-1796.901] (-1795.025) (-1802.759) -- 0:00:29
919000 -- (-1792.882) (-1799.361) [-1796.794] (-1797.560) * (-1794.694) [-1800.567] (-1794.639) (-1801.336) -- 0:00:29
919500 -- (-1803.132) (-1797.453) (-1789.539) [-1791.605] * [-1789.885] (-1800.483) (-1789.921) (-1805.625) -- 0:00:28
920000 -- [-1795.597] (-1801.147) (-1797.314) (-1796.487) * [-1798.456] (-1798.768) (-1800.783) (-1794.382) -- 0:00:28
Average standard deviation of split frequencies: 0.001365
920500 -- [-1791.311] (-1808.650) (-1793.746) (-1792.440) * (-1793.313) (-1797.120) (-1798.612) [-1788.844] -- 0:00:28
921000 -- (-1801.151) (-1795.502) (-1795.412) [-1789.613] * (-1800.588) [-1794.231] (-1800.338) (-1790.514) -- 0:00:28
921500 -- (-1793.870) [-1797.801] (-1796.335) (-1805.067) * (-1798.302) (-1801.247) (-1801.952) [-1794.948] -- 0:00:28
922000 -- (-1788.616) [-1795.365] (-1792.528) (-1792.659) * (-1796.021) (-1799.818) [-1794.646] (-1795.032) -- 0:00:28
922500 -- (-1788.518) (-1800.678) [-1796.228] (-1798.488) * (-1795.565) (-1799.934) [-1789.939] (-1801.604) -- 0:00:27
923000 -- (-1794.409) (-1793.433) [-1795.545] (-1800.808) * (-1795.621) (-1798.070) [-1791.929] (-1796.317) -- 0:00:27
923500 -- (-1789.714) (-1798.553) [-1798.871] (-1796.265) * [-1794.268] (-1806.098) (-1793.210) (-1792.178) -- 0:00:27
924000 -- (-1795.092) (-1796.050) (-1800.854) [-1799.196] * [-1789.931] (-1805.716) (-1794.929) (-1794.010) -- 0:00:27
924500 -- (-1788.153) [-1791.663] (-1794.784) (-1796.131) * (-1787.800) (-1818.410) (-1792.980) [-1793.860] -- 0:00:27
925000 -- (-1792.990) (-1793.865) [-1792.289] (-1796.025) * (-1795.126) (-1803.455) (-1790.644) [-1796.596] -- 0:00:27
Average standard deviation of split frequencies: 0.001980
925500 -- (-1798.483) (-1788.175) (-1796.765) [-1793.494] * (-1790.986) [-1803.592] (-1799.246) (-1790.990) -- 0:00:26
926000 -- (-1791.050) [-1790.698] (-1792.845) (-1792.870) * (-1796.942) (-1799.130) [-1794.317] (-1792.590) -- 0:00:26
926500 -- (-1797.435) [-1790.391] (-1793.470) (-1797.936) * [-1792.640] (-1801.615) (-1793.181) (-1795.293) -- 0:00:26
927000 -- (-1810.272) (-1795.389) (-1791.672) [-1791.367] * (-1790.693) [-1791.950] (-1792.122) (-1801.261) -- 0:00:26
927500 -- (-1803.231) (-1794.126) [-1786.336] (-1790.394) * (-1805.416) (-1792.299) [-1793.874] (-1793.561) -- 0:00:26
928000 -- [-1793.105] (-1795.925) (-1789.323) (-1791.584) * (-1797.565) (-1792.074) (-1793.403) [-1796.084] -- 0:00:25
928500 -- [-1801.508] (-1790.473) (-1787.730) (-1789.856) * [-1791.606] (-1794.087) (-1796.374) (-1795.223) -- 0:00:25
929000 -- [-1808.589] (-1796.185) (-1799.826) (-1791.798) * (-1791.426) (-1789.380) (-1800.446) [-1799.321] -- 0:00:25
929500 -- (-1791.211) (-1794.694) (-1806.043) [-1791.142] * [-1796.742] (-1794.663) (-1791.146) (-1792.614) -- 0:00:25
930000 -- (-1792.894) (-1793.616) [-1808.201] (-1801.520) * [-1795.722] (-1794.358) (-1795.905) (-1793.572) -- 0:00:25
Average standard deviation of split frequencies: 0.002082
930500 -- [-1793.133] (-1802.090) (-1801.398) (-1791.941) * [-1791.821] (-1798.604) (-1794.025) (-1805.923) -- 0:00:25
931000 -- (-1797.826) (-1799.212) [-1790.688] (-1811.208) * (-1796.218) (-1794.246) (-1801.682) [-1795.491] -- 0:00:24
931500 -- (-1788.594) (-1797.407) [-1789.556] (-1796.549) * (-1792.760) [-1797.500] (-1795.882) (-1790.994) -- 0:00:24
932000 -- (-1798.282) (-1791.041) [-1795.211] (-1804.187) * [-1792.031] (-1795.493) (-1791.365) (-1789.557) -- 0:00:24
932500 -- (-1797.212) [-1793.751] (-1797.349) (-1790.303) * [-1790.700] (-1794.910) (-1791.500) (-1792.816) -- 0:00:24
933000 -- (-1796.700) [-1798.099] (-1803.000) (-1802.219) * (-1790.208) [-1793.787] (-1793.513) (-1800.579) -- 0:00:24
933500 -- (-1795.365) [-1793.178] (-1793.727) (-1795.470) * (-1797.463) (-1795.895) [-1792.912] (-1791.462) -- 0:00:23
934000 -- (-1797.318) (-1796.594) (-1787.130) [-1790.027] * (-1796.703) [-1788.987] (-1796.791) (-1798.844) -- 0:00:23
934500 -- [-1802.281] (-1798.039) (-1791.230) (-1796.596) * (-1798.882) [-1797.727] (-1791.086) (-1791.708) -- 0:00:23
935000 -- [-1791.929] (-1789.427) (-1791.885) (-1797.743) * (-1793.846) (-1791.418) [-1793.957] (-1791.670) -- 0:00:23
Average standard deviation of split frequencies: 0.001903
935500 -- (-1803.328) [-1791.277] (-1786.178) (-1795.501) * (-1792.530) (-1802.451) (-1793.391) [-1791.198] -- 0:00:23
936000 -- (-1795.718) [-1789.443] (-1785.337) (-1790.492) * (-1801.402) (-1797.837) [-1791.689] (-1796.165) -- 0:00:23
936500 -- [-1789.447] (-1794.136) (-1791.826) (-1800.888) * (-1794.313) [-1791.213] (-1792.865) (-1793.926) -- 0:00:22
937000 -- (-1800.305) (-1792.573) [-1790.641] (-1793.896) * [-1792.580] (-1787.299) (-1797.930) (-1802.290) -- 0:00:22
937500 -- (-1792.743) [-1790.967] (-1789.514) (-1791.574) * (-1796.439) [-1797.581] (-1786.417) (-1798.804) -- 0:00:22
938000 -- (-1800.827) (-1794.215) (-1792.608) [-1794.170] * (-1801.569) (-1793.810) (-1794.274) [-1793.595] -- 0:00:22
938500 -- [-1794.063] (-1788.368) (-1795.948) (-1792.902) * [-1787.379] (-1792.919) (-1791.793) (-1791.918) -- 0:00:22
939000 -- (-1788.030) (-1801.002) (-1792.579) [-1791.224] * (-1792.215) (-1797.201) (-1802.156) [-1787.594] -- 0:00:21
939500 -- (-1796.461) (-1791.208) (-1799.219) [-1793.331] * [-1792.030] (-1795.891) (-1799.589) (-1788.511) -- 0:00:21
940000 -- (-1791.700) (-1790.862) (-1796.873) [-1794.960] * (-1806.200) (-1801.551) [-1797.936] (-1797.315) -- 0:00:21
Average standard deviation of split frequencies: 0.002116
940500 -- (-1798.019) (-1800.197) (-1795.856) [-1787.872] * (-1796.783) (-1792.873) [-1793.893] (-1802.805) -- 0:00:21
941000 -- (-1794.399) (-1797.012) (-1792.914) [-1789.984] * (-1796.231) [-1803.552] (-1794.059) (-1799.713) -- 0:00:21
941500 -- (-1789.453) (-1791.297) [-1790.809] (-1795.890) * (-1798.829) [-1792.590] (-1794.418) (-1798.491) -- 0:00:21
942000 -- (-1792.439) (-1793.495) (-1794.072) [-1791.966] * [-1800.183] (-1803.257) (-1798.230) (-1798.378) -- 0:00:20
942500 -- [-1791.098] (-1797.467) (-1795.976) (-1796.130) * [-1796.162] (-1795.797) (-1801.817) (-1814.577) -- 0:00:20
943000 -- (-1798.636) (-1804.911) [-1793.617] (-1797.462) * (-1793.470) (-1797.897) [-1793.471] (-1801.396) -- 0:00:20
943500 -- (-1796.112) (-1798.830) [-1792.122] (-1795.120) * (-1804.011) (-1793.892) [-1789.368] (-1802.703) -- 0:00:20
944000 -- (-1793.175) (-1796.919) (-1794.717) [-1797.681] * [-1794.903] (-1796.680) (-1791.737) (-1800.899) -- 0:00:20
944500 -- (-1801.569) (-1797.669) [-1800.107] (-1797.898) * (-1798.044) (-1792.575) [-1789.675] (-1798.817) -- 0:00:19
945000 -- (-1799.663) [-1793.307] (-1794.724) (-1797.152) * (-1798.407) [-1799.325] (-1789.849) (-1795.388) -- 0:00:19
Average standard deviation of split frequencies: 0.002049
945500 -- [-1792.771] (-1797.443) (-1795.878) (-1800.135) * (-1799.315) [-1786.943] (-1800.754) (-1795.605) -- 0:00:19
946000 -- (-1797.247) (-1791.302) [-1791.512] (-1798.494) * [-1797.544] (-1804.867) (-1791.082) (-1791.866) -- 0:00:19
946500 -- (-1800.119) [-1798.941] (-1789.887) (-1789.723) * (-1791.664) (-1801.832) (-1787.222) [-1792.977] -- 0:00:19
947000 -- (-1794.876) (-1791.327) [-1798.692] (-1792.600) * (-1806.644) (-1792.427) (-1799.699) [-1788.332] -- 0:00:19
947500 -- [-1789.438] (-1795.999) (-1803.171) (-1799.902) * [-1792.015] (-1788.174) (-1795.204) (-1796.331) -- 0:00:18
948000 -- (-1800.368) [-1798.831] (-1810.047) (-1807.540) * (-1800.141) (-1792.907) (-1799.125) [-1795.810] -- 0:00:18
948500 -- [-1804.609] (-1797.329) (-1795.237) (-1801.334) * (-1795.520) (-1796.731) (-1793.585) [-1801.918] -- 0:00:18
949000 -- [-1792.921] (-1789.305) (-1800.065) (-1803.217) * (-1797.816) [-1790.406] (-1786.774) (-1799.426) -- 0:00:18
949500 -- (-1788.481) (-1793.784) [-1795.863] (-1801.854) * (-1793.260) (-1798.747) [-1786.998] (-1796.517) -- 0:00:18
950000 -- [-1796.884] (-1795.408) (-1804.830) (-1791.210) * (-1797.688) (-1795.835) [-1790.631] (-1803.145) -- 0:00:18
Average standard deviation of split frequencies: 0.002094
950500 -- (-1802.516) (-1791.581) (-1800.392) [-1787.668] * (-1800.421) (-1793.481) [-1786.857] (-1797.396) -- 0:00:17
951000 -- (-1795.967) (-1793.443) [-1802.891] (-1792.550) * (-1792.905) (-1800.063) (-1792.828) [-1787.963] -- 0:00:17
951500 -- [-1788.415] (-1794.498) (-1796.503) (-1799.590) * (-1796.133) (-1792.508) (-1791.033) [-1788.570] -- 0:00:17
952000 -- (-1794.386) (-1796.771) (-1790.950) [-1792.120] * (-1800.556) [-1793.881] (-1790.465) (-1792.772) -- 0:00:17
952500 -- [-1798.640] (-1803.784) (-1795.254) (-1794.885) * (-1803.951) (-1797.938) (-1796.023) [-1796.040] -- 0:00:17
953000 -- [-1793.436] (-1800.678) (-1802.637) (-1788.862) * [-1788.389] (-1797.954) (-1794.673) (-1798.471) -- 0:00:16
953500 -- (-1800.450) (-1799.775) [-1793.776] (-1797.789) * (-1787.139) (-1804.784) (-1801.351) [-1796.123] -- 0:00:16
954000 -- (-1800.680) (-1793.060) [-1791.335] (-1792.419) * [-1800.165] (-1806.137) (-1797.312) (-1797.518) -- 0:00:16
954500 -- (-1800.062) (-1802.290) (-1790.617) [-1789.799] * (-1800.849) (-1794.987) [-1791.010] (-1801.360) -- 0:00:16
955000 -- (-1800.817) (-1811.910) [-1793.185] (-1792.699) * (-1805.779) (-1798.191) [-1798.196] (-1802.146) -- 0:00:16
Average standard deviation of split frequencies: 0.002082
955500 -- (-1796.931) [-1793.594] (-1790.977) (-1792.247) * [-1788.800] (-1803.000) (-1800.408) (-1787.586) -- 0:00:16
956000 -- (-1789.236) (-1794.004) (-1800.857) [-1791.911] * [-1789.226] (-1793.727) (-1793.065) (-1791.829) -- 0:00:15
956500 -- (-1790.069) (-1800.774) [-1805.787] (-1800.450) * (-1799.543) (-1794.776) (-1789.309) [-1791.937] -- 0:00:15
957000 -- [-1787.506] (-1788.715) (-1796.164) (-1791.052) * (-1791.444) (-1794.011) [-1794.061] (-1798.172) -- 0:00:15
957500 -- (-1796.157) [-1794.232] (-1809.119) (-1788.459) * (-1801.811) (-1796.823) [-1789.225] (-1793.957) -- 0:00:15
958000 -- (-1792.003) (-1794.190) [-1804.106] (-1796.012) * (-1800.150) (-1802.080) [-1791.635] (-1797.740) -- 0:00:15
958500 -- (-1795.310) [-1793.541] (-1797.210) (-1802.005) * (-1799.405) (-1790.272) (-1794.800) [-1795.451] -- 0:00:14
959000 -- [-1792.917] (-1796.173) (-1802.141) (-1807.523) * (-1795.640) [-1796.895] (-1801.544) (-1806.711) -- 0:00:14
959500 -- [-1790.751] (-1802.674) (-1801.948) (-1799.163) * (-1789.320) [-1790.624] (-1799.964) (-1797.827) -- 0:00:14
960000 -- (-1796.151) (-1793.594) (-1795.780) [-1803.621] * (-1793.014) (-1799.934) (-1793.829) [-1797.833] -- 0:00:14
Average standard deviation of split frequencies: 0.002563
960500 -- (-1793.405) (-1797.315) [-1797.476] (-1789.103) * (-1801.480) (-1790.611) (-1796.642) [-1788.615] -- 0:00:14
961000 -- (-1794.141) (-1802.536) (-1794.439) [-1795.108] * (-1795.043) [-1789.105] (-1791.735) (-1798.687) -- 0:00:14
961500 -- [-1795.999] (-1799.677) (-1794.714) (-1798.194) * (-1804.065) (-1797.430) [-1795.485] (-1797.515) -- 0:00:13
962000 -- (-1793.557) [-1795.807] (-1793.020) (-1797.162) * [-1791.111] (-1797.995) (-1799.309) (-1799.336) -- 0:00:13
962500 -- (-1793.033) (-1798.000) (-1796.859) [-1793.797] * (-1795.717) [-1789.155] (-1789.398) (-1802.737) -- 0:00:13
963000 -- (-1794.135) (-1794.179) [-1789.106] (-1798.871) * (-1795.623) (-1792.351) [-1788.620] (-1803.030) -- 0:00:13
963500 -- (-1794.600) (-1791.943) (-1803.893) [-1792.752] * (-1789.900) [-1799.524] (-1793.180) (-1796.905) -- 0:00:13
964000 -- (-1793.071) (-1804.135) [-1796.287] (-1792.789) * [-1796.045] (-1792.347) (-1799.011) (-1791.452) -- 0:00:12
964500 -- (-1795.272) [-1793.359] (-1803.152) (-1798.149) * [-1790.968] (-1798.903) (-1789.508) (-1792.995) -- 0:00:12
965000 -- (-1794.631) (-1802.553) [-1796.952] (-1802.053) * (-1794.690) (-1795.178) (-1803.699) [-1798.400] -- 0:00:12
Average standard deviation of split frequencies: 0.002657
965500 -- [-1790.184] (-1797.720) (-1793.246) (-1801.267) * [-1799.079] (-1797.747) (-1799.263) (-1796.240) -- 0:00:12
966000 -- (-1794.311) [-1789.855] (-1800.858) (-1797.730) * [-1789.378] (-1792.756) (-1794.150) (-1802.552) -- 0:00:12
966500 -- (-1803.341) (-1786.987) (-1790.854) [-1790.647] * [-1795.860] (-1805.515) (-1795.710) (-1799.647) -- 0:00:12
967000 -- (-1800.298) (-1795.503) (-1792.285) [-1795.883] * (-1792.367) [-1790.050] (-1806.306) (-1797.409) -- 0:00:11
967500 -- (-1796.574) [-1795.491] (-1794.029) (-1788.864) * (-1788.472) (-1796.136) [-1785.971] (-1800.851) -- 0:00:11
968000 -- (-1794.072) [-1790.727] (-1792.630) (-1801.716) * (-1791.593) (-1800.486) [-1791.683] (-1801.238) -- 0:00:11
968500 -- (-1786.861) (-1802.563) [-1789.792] (-1797.671) * (-1807.952) [-1790.046] (-1796.222) (-1796.463) -- 0:00:11
969000 -- (-1792.232) (-1799.681) [-1794.328] (-1807.746) * (-1797.670) [-1794.990] (-1793.742) (-1799.677) -- 0:00:11
969500 -- [-1798.646] (-1795.917) (-1803.628) (-1794.923) * (-1794.855) [-1794.467] (-1797.838) (-1806.697) -- 0:00:10
970000 -- (-1797.436) (-1799.423) [-1796.473] (-1794.659) * [-1797.379] (-1792.248) (-1794.027) (-1796.170) -- 0:00:10
Average standard deviation of split frequencies: 0.003022
970500 -- [-1786.251] (-1795.136) (-1789.130) (-1790.832) * (-1792.182) (-1793.217) [-1800.419] (-1798.610) -- 0:00:10
971000 -- [-1790.083] (-1797.411) (-1788.606) (-1792.148) * (-1793.088) [-1794.507] (-1791.796) (-1800.898) -- 0:00:10
971500 -- [-1793.491] (-1802.948) (-1799.922) (-1794.216) * (-1793.401) (-1795.724) [-1791.841] (-1807.853) -- 0:00:10
972000 -- (-1796.846) (-1804.113) (-1793.243) [-1792.163] * (-1792.296) (-1798.924) [-1798.446] (-1794.545) -- 0:00:10
972500 -- [-1798.426] (-1793.116) (-1800.266) (-1793.026) * (-1788.699) (-1800.682) (-1800.929) [-1799.954] -- 0:00:09
973000 -- (-1796.880) [-1794.238] (-1795.720) (-1803.293) * [-1800.353] (-1795.287) (-1793.034) (-1796.803) -- 0:00:09
973500 -- [-1789.586] (-1805.252) (-1797.731) (-1793.642) * (-1790.415) (-1799.347) [-1792.719] (-1795.265) -- 0:00:09
974000 -- (-1791.951) (-1801.444) [-1787.117] (-1800.708) * [-1790.689] (-1792.714) (-1792.743) (-1791.634) -- 0:00:09
974500 -- [-1793.014] (-1802.100) (-1788.632) (-1796.268) * [-1789.351] (-1800.265) (-1796.444) (-1799.651) -- 0:00:09
975000 -- [-1793.274] (-1799.731) (-1799.462) (-1803.795) * (-1794.287) (-1799.996) [-1790.796] (-1797.609) -- 0:00:09
Average standard deviation of split frequencies: 0.003327
975500 -- (-1792.284) (-1797.360) (-1810.045) [-1789.856] * (-1790.981) (-1792.090) [-1801.458] (-1784.606) -- 0:00:08
976000 -- (-1795.678) (-1791.303) [-1799.943] (-1789.910) * (-1803.908) [-1801.001] (-1795.159) (-1797.936) -- 0:00:08
976500 -- (-1793.585) (-1790.249) (-1795.264) [-1795.010] * (-1799.615) [-1799.258] (-1806.278) (-1795.472) -- 0:00:08
977000 -- [-1793.349] (-1793.417) (-1796.789) (-1796.292) * [-1794.994] (-1795.816) (-1794.284) (-1798.133) -- 0:00:08
977500 -- [-1792.128] (-1801.231) (-1790.785) (-1793.862) * (-1802.801) [-1794.147] (-1793.792) (-1795.947) -- 0:00:08
978000 -- (-1807.701) (-1800.350) [-1794.273] (-1791.963) * (-1796.209) (-1791.227) [-1794.170] (-1806.364) -- 0:00:07
978500 -- (-1794.411) [-1801.629] (-1794.133) (-1792.221) * (-1801.552) (-1790.208) [-1799.096] (-1796.158) -- 0:00:07
979000 -- [-1790.301] (-1807.343) (-1802.986) (-1795.187) * (-1801.340) (-1789.045) [-1798.761] (-1790.329) -- 0:00:07
979500 -- (-1801.016) (-1800.951) (-1794.887) [-1793.855] * (-1792.539) (-1790.090) (-1794.840) [-1790.925] -- 0:00:07
980000 -- (-1790.542) (-1802.765) (-1792.606) [-1788.746] * [-1799.535] (-1804.824) (-1791.698) (-1798.571) -- 0:00:07
Average standard deviation of split frequencies: 0.003472
980500 -- (-1803.053) (-1797.696) (-1797.503) [-1787.746] * (-1806.231) (-1794.835) (-1796.062) [-1798.196] -- 0:00:07
981000 -- (-1793.476) [-1787.964] (-1794.695) (-1787.972) * (-1796.826) (-1800.591) (-1797.984) [-1791.976] -- 0:00:06
981500 -- (-1789.080) (-1793.718) [-1792.349] (-1792.245) * (-1793.691) (-1800.013) [-1797.565] (-1789.577) -- 0:00:06
982000 -- (-1793.514) (-1797.544) [-1791.151] (-1790.084) * [-1790.427] (-1794.465) (-1797.949) (-1792.796) -- 0:00:06
982500 -- [-1791.097] (-1796.965) (-1798.684) (-1797.213) * (-1787.760) [-1792.795] (-1796.415) (-1797.470) -- 0:00:06
983000 -- (-1792.616) (-1802.132) [-1795.001] (-1795.641) * (-1797.896) (-1797.312) (-1789.761) [-1800.154] -- 0:00:06
983500 -- (-1789.427) [-1793.122] (-1797.722) (-1802.492) * (-1796.747) (-1809.528) [-1796.938] (-1790.069) -- 0:00:05
984000 -- (-1796.700) (-1791.532) [-1792.097] (-1793.838) * (-1798.737) [-1789.750] (-1795.639) (-1792.394) -- 0:00:05
984500 -- (-1796.705) (-1797.391) (-1801.094) [-1791.894] * (-1804.043) [-1792.788] (-1788.082) (-1798.661) -- 0:00:05
985000 -- (-1796.953) (-1791.971) [-1789.664] (-1797.105) * (-1802.359) (-1794.141) (-1798.003) [-1791.330] -- 0:00:05
Average standard deviation of split frequencies: 0.003719
985500 -- (-1799.098) (-1793.382) [-1797.589] (-1801.789) * (-1796.552) (-1798.624) (-1791.789) [-1797.567] -- 0:00:05
986000 -- (-1796.536) (-1795.073) [-1795.302] (-1797.780) * (-1797.045) (-1797.797) [-1796.713] (-1795.327) -- 0:00:05
986500 -- (-1790.780) (-1799.587) [-1796.626] (-1797.329) * (-1805.421) (-1798.541) [-1794.766] (-1796.478) -- 0:00:04
987000 -- [-1793.390] (-1796.105) (-1790.766) (-1799.506) * (-1801.849) (-1803.197) (-1794.819) [-1800.288] -- 0:00:04
987500 -- [-1794.756] (-1794.985) (-1795.699) (-1803.264) * (-1796.008) (-1793.406) [-1790.977] (-1791.558) -- 0:00:04
988000 -- (-1797.606) (-1810.422) (-1792.203) [-1794.992] * (-1791.227) [-1802.469] (-1804.964) (-1792.654) -- 0:00:04
988500 -- (-1803.024) (-1795.058) [-1790.255] (-1807.109) * (-1797.502) [-1795.571] (-1804.576) (-1797.367) -- 0:00:04
989000 -- (-1798.351) (-1798.893) [-1791.266] (-1792.539) * (-1798.202) (-1790.384) (-1792.584) [-1795.991] -- 0:00:03
989500 -- (-1792.408) [-1792.413] (-1792.658) (-1793.084) * (-1800.906) [-1792.042] (-1794.675) (-1800.384) -- 0:00:03
990000 -- (-1799.066) (-1802.725) [-1804.505] (-1799.061) * (-1799.494) [-1788.507] (-1794.851) (-1794.797) -- 0:00:03
Average standard deviation of split frequencies: 0.003965
990500 -- (-1796.501) [-1791.102] (-1794.586) (-1797.914) * [-1794.578] (-1794.562) (-1798.311) (-1795.410) -- 0:00:03
991000 -- (-1800.427) (-1793.795) (-1797.544) [-1800.049] * (-1796.399) (-1799.528) (-1804.559) [-1796.975] -- 0:00:03
991500 -- (-1794.652) (-1793.963) [-1790.908] (-1794.107) * [-1799.488] (-1795.693) (-1797.581) (-1801.411) -- 0:00:03
992000 -- (-1795.032) (-1796.930) [-1794.255] (-1804.386) * (-1794.249) (-1805.097) (-1796.421) [-1797.417] -- 0:00:02
992500 -- (-1794.325) (-1797.737) (-1793.905) [-1789.391] * (-1791.692) (-1799.236) (-1801.919) [-1804.791] -- 0:00:02
993000 -- (-1800.887) [-1792.845] (-1792.756) (-1801.994) * (-1802.092) (-1802.462) [-1797.767] (-1795.314) -- 0:00:02
993500 -- (-1804.811) (-1798.982) (-1793.967) [-1788.339] * (-1797.531) (-1792.488) [-1799.971] (-1799.567) -- 0:00:02
994000 -- (-1801.448) (-1795.290) [-1794.028] (-1789.466) * (-1797.542) (-1797.797) [-1794.417] (-1793.228) -- 0:00:02
994500 -- [-1795.470] (-1805.741) (-1788.910) (-1799.742) * [-1789.846] (-1799.422) (-1794.996) (-1796.391) -- 0:00:01
995000 -- (-1796.432) [-1793.230] (-1792.020) (-1795.858) * (-1789.484) [-1793.410] (-1795.766) (-1804.997) -- 0:00:01
Average standard deviation of split frequencies: 0.004365
995500 -- (-1796.979) (-1796.225) [-1793.924] (-1791.940) * (-1797.297) (-1794.851) (-1793.168) [-1794.509] -- 0:00:01
996000 -- (-1801.619) (-1791.141) [-1792.188] (-1806.325) * [-1799.550] (-1800.197) (-1790.702) (-1815.754) -- 0:00:01
996500 -- (-1802.966) (-1797.193) [-1796.588] (-1797.116) * (-1806.570) [-1795.480] (-1794.705) (-1797.589) -- 0:00:01
997000 -- [-1800.287] (-1802.490) (-1793.547) (-1798.301) * (-1799.230) (-1796.723) (-1801.437) [-1796.146] -- 0:00:01
997500 -- (-1797.059) (-1792.508) [-1793.421] (-1791.575) * [-1793.925] (-1793.257) (-1795.483) (-1800.332) -- 0:00:00
998000 -- (-1794.716) [-1792.938] (-1787.603) (-1793.566) * (-1803.567) (-1797.934) [-1790.043] (-1795.257) -- 0:00:00
998500 -- (-1801.684) (-1802.675) [-1804.509] (-1795.328) * (-1793.702) (-1793.456) (-1792.252) [-1797.332] -- 0:00:00
999000 -- [-1794.891] (-1797.431) (-1791.025) (-1796.739) * (-1790.829) [-1793.245] (-1787.086) (-1790.389) -- 0:00:00
999500 -- (-1787.430) (-1799.223) (-1802.862) [-1792.783] * (-1795.873) (-1790.654) (-1803.937) [-1790.690] -- 0:00:00
1000000 -- [-1789.479] (-1792.032) (-1793.968) (-1788.977) * (-1799.805) (-1797.185) (-1799.594) [-1787.790] -- 0:00:00
Average standard deviation of split frequencies: 0.004083
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1789.478789 -- 19.055764
Chain 1 -- -1789.478789 -- 19.055764
Chain 2 -- -1792.031854 -- 18.401269
Chain 2 -- -1792.031862 -- 18.401269
Chain 3 -- -1793.967697 -- 17.249568
Chain 3 -- -1793.967703 -- 17.249568
Chain 4 -- -1788.977326 -- 16.606185
Chain 4 -- -1788.977326 -- 16.606185
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1799.805223 -- 16.495436
Chain 1 -- -1799.805211 -- 16.495436
Chain 2 -- -1797.184585 -- 18.771913
Chain 2 -- -1797.184590 -- 18.771913
Chain 3 -- -1799.593933 -- 19.989174
Chain 3 -- -1799.593923 -- 19.989174
Chain 4 -- -1787.789611 -- 19.707739
Chain 4 -- -1787.789626 -- 19.707739
Analysis completed in 6 mins 0 seconds
Analysis used 359.35 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1780.78
Likelihood of best state for "cold" chain of run 2 was -1780.91
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
47.3 % ( 39 %) Dirichlet(Revmat{all})
61.0 % ( 48 %) Slider(Revmat{all})
28.0 % ( 24 %) Dirichlet(Pi{all})
28.8 % ( 28 %) Slider(Pi{all})
33.9 % ( 28 %) Multiplier(Alpha{1,2})
43.5 % ( 25 %) Multiplier(Alpha{3})
58.0 % ( 34 %) Slider(Pinvar{all})
9.2 % ( 14 %) ExtSPR(Tau{all},V{all})
2.1 % ( 2 %) ExtTBR(Tau{all},V{all})
9.3 % ( 13 %) NNI(Tau{all},V{all})
15.4 % ( 8 %) ParsSPR(Tau{all},V{all})
26.3 % ( 32 %) Multiplier(V{all})
36.8 % ( 33 %) Nodeslider(V{all})
25.2 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
47.8 % ( 36 %) Dirichlet(Revmat{all})
61.5 % ( 53 %) Slider(Revmat{all})
27.5 % ( 27 %) Dirichlet(Pi{all})
29.3 % ( 19 %) Slider(Pi{all})
34.5 % ( 33 %) Multiplier(Alpha{1,2})
43.6 % ( 26 %) Multiplier(Alpha{3})
59.5 % ( 45 %) Slider(Pinvar{all})
9.0 % ( 12 %) ExtSPR(Tau{all},V{all})
2.1 % ( 2 %) ExtTBR(Tau{all},V{all})
9.1 % ( 6 %) NNI(Tau{all},V{all})
15.3 % ( 17 %) ParsSPR(Tau{all},V{all})
26.4 % ( 31 %) Multiplier(V{all})
37.0 % ( 38 %) Nodeslider(V{all})
25.7 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.78 0.59 0.43
2 | 166401 0.79 0.62
3 | 166656 166851 0.81
4 | 166165 167313 166614
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.78 0.59 0.43
2 | 166436 0.80 0.62
3 | 166994 166978 0.81
4 | 166263 165938 167391
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1791.44
| 1 2 1 |
| 2 |
| 2 2 2 |
| 2 1 |
| 2 1 1 12 1 1 1 1 2 2 1 |
| 222 1 2 2 2 1 1 1 |
| 1 2 12 * 1 1 2 221 22 1 |
| 1 * 222 2 1 1 222 2 22 2 21 12 |
|1 1 1 2 2 2 22* 1 1 1 1 12 21 2 1|
| 1 * 2 1 * 2 1 1 |
| 1 1 1 11 2 2 11 2 1 |
| 12 1 1 2|
| 2 1 2 |
|2 1 1 |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1796.08
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1789.18 -1805.47
2 -1788.41 -1803.52
--------------------------------------
TOTAL -1788.72 -1804.90
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.812780 0.009808 0.639946 1.022091 0.804760 1350.06 1425.53 1.000
r(A<->C){all} 0.067109 0.000438 0.032360 0.112124 0.065070 831.75 1002.00 1.000
r(A<->G){all} 0.269761 0.002011 0.177680 0.353763 0.267918 777.55 821.06 1.000
r(A<->T){all} 0.102813 0.000794 0.050458 0.156228 0.101164 951.19 983.27 1.001
r(C<->G){all} 0.068227 0.000316 0.034977 0.102103 0.067321 985.04 997.49 1.000
r(C<->T){all} 0.436030 0.002731 0.330122 0.535725 0.434439 772.03 783.20 1.000
r(G<->T){all} 0.056060 0.000375 0.022565 0.095763 0.053828 916.46 943.00 1.000
pi(A){all} 0.255027 0.000326 0.220620 0.291287 0.254799 990.87 1167.67 1.000
pi(C){all} 0.261784 0.000297 0.229700 0.296894 0.260927 1092.43 1151.76 1.000
pi(G){all} 0.292053 0.000339 0.258719 0.329390 0.291770 1055.40 1095.11 1.000
pi(T){all} 0.191136 0.000245 0.160613 0.221824 0.190695 1202.37 1239.43 1.000
alpha{1,2} 0.130919 0.001157 0.062071 0.202198 0.132481 1159.72 1195.31 1.001
alpha{3} 2.651678 0.821332 1.072129 4.397730 2.533001 1015.58 1234.94 1.000
pinvar{all} 0.249232 0.007738 0.073720 0.409747 0.257439 1147.58 1208.10 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
Key to taxon bipartitions (saved to file "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------------
1 -- .*********
2 -- .*........
3 -- ..*.......
4 -- ...*......
5 -- ....*.....
6 -- .....*....
7 -- ......*...
8 -- .......*..
9 -- ........*.
10 -- .........*
11 -- .....*****
12 -- ........**
13 -- ......**..
14 -- .**.......
15 -- ...**.....
16 -- ...*******
17 -- .....*..**
18 -- ......****
19 -- .****.....
----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 3002 1.000000 0.000000 1.000000 1.000000 2
13 3001 0.999667 0.000471 0.999334 1.000000 2
14 2996 0.998001 0.000942 0.997335 0.998668 2
15 2951 0.983011 0.002355 0.981346 0.984677 2
16 2059 0.685876 0.013662 0.676216 0.695536 2
17 1614 0.537642 0.004711 0.534310 0.540973 2
18 1257 0.418721 0.001413 0.417722 0.419720 2
19 902 0.300466 0.013191 0.291139 0.309793 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.037697 0.000169 0.015234 0.063534 0.036220 1.000 2
length{all}[2] 0.012650 0.000041 0.002808 0.026146 0.011643 1.000 2
length{all}[3] 0.005419 0.000020 0.000001 0.013902 0.004336 1.000 2
length{all}[4] 0.029664 0.000130 0.010816 0.053277 0.027840 1.001 2
length{all}[5] 0.046562 0.000191 0.021998 0.074211 0.045111 1.002 2
length{all}[6] 0.087135 0.000550 0.047148 0.136537 0.085358 1.000 2
length{all}[7] 0.074840 0.000410 0.038221 0.114328 0.072391 1.000 2
length{all}[8] 0.052673 0.000284 0.022594 0.085728 0.051117 1.000 2
length{all}[9] 0.094795 0.000618 0.046464 0.141375 0.092593 1.000 2
length{all}[10] 0.079046 0.000498 0.039188 0.123440 0.077042 1.000 2
length{all}[11] 0.098227 0.000676 0.049231 0.147664 0.095400 1.000 2
length{all}[12] 0.085983 0.000719 0.042281 0.142384 0.082541 1.000 2
length{all}[13] 0.040021 0.000264 0.011555 0.072583 0.037811 1.000 2
length{all}[14] 0.016132 0.000067 0.003032 0.032021 0.014791 1.000 2
length{all}[15] 0.020597 0.000119 0.002884 0.042936 0.018918 1.000 2
length{all}[16] 0.016404 0.000092 0.000902 0.035190 0.014682 1.000 2
length{all}[17] 0.018017 0.000136 0.000035 0.039223 0.016135 1.000 2
length{all}[18] 0.016868 0.000130 0.000005 0.040007 0.014546 1.000 2
length{all}[19] 0.010792 0.000048 0.000355 0.023873 0.009322 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004083
Maximum standard deviation of split frequencies = 0.013662
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
| /-------------- C2 (2)
|--------------------------100--------------------------+
| \-------------- C3 (3)
|
+ /-------------- C4 (4)
| /--------------------98-------------------+
| | \-------------- C5 (5)
| |
| | /---------------------------- C6 (6)
\------69-----+ |
| /------54-----+ /-------------- C9 (9)
| | \-----100-----+
| | \-------------- C10 (10)
\-----100-----+
| /-------------- C7 (7)
\------------100------------+
\-------------- C8 (8)
Phylogram (based on average branch lengths):
/--------- C1 (1)
|
| /-- C2 (2)
|---+
| \- C3 (3)
|
+ /------- C4 (4)
| /---+
| | \----------- C5 (5)
| |
| | /--------------------- C6 (6)
\---+ |
| /---+ /---------------------- C9 (9)
| | \-------------------+
| | \------------------ C10 (10)
\---------------------+
| /------------------ C7 (7)
\--------+
\------------- C8 (8)
|----------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (20 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 4 trees
95 % credible set contains 5 trees
99 % credible set contains 10 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 10 ls = 543
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Sequences read..
Counting site patterns.. 0:00
143 patterns at 181 / 181 sites (100.0%), 0:00
Counting codons..
360 bytes for distance
139568 bytes for conP
19448 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), ((4, 5), ((6, (9, 10)), (7, 8)))); MP score: 193
558272 bytes for conP, adjusted
0.061675 0.027593 0.019294 0.003297 0.008538 0.033954 0.045279 0.082054 0.162612 0.001667 0.135256 0.141560 0.141774 0.164004 0.038001 0.125253 0.086977 0.300000 1.300000
ntime & nrate & np: 17 2 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 19
lnL0 = -2039.630844
Iterating by ming2
Initial: fx= 2039.630844
x= 0.06168 0.02759 0.01929 0.00330 0.00854 0.03395 0.04528 0.08205 0.16261 0.00167 0.13526 0.14156 0.14177 0.16400 0.03800 0.12525 0.08698 0.30000 1.30000
1 h-m-p 0.0000 0.0007 1123.5802 +YCYCCC 2027.347054 5 0.0001 33 | 0/19
2 h-m-p 0.0000 0.0001 372.8053 +CYCYYCCC 2013.605176 7 0.0001 68 | 0/19
3 h-m-p 0.0000 0.0000 4570.4350 +CCYCCC 1974.927622 5 0.0000 101 | 0/19
4 h-m-p 0.0000 0.0001 7396.2674 +CYYYCCCC 1925.972756 7 0.0001 135 | 0/19
5 h-m-p 0.0000 0.0000 20409.9988 +YYCCC 1894.001433 4 0.0000 164 | 0/19
6 h-m-p 0.0000 0.0002 3635.2661 +YYCCC 1875.708312 4 0.0001 193 | 0/19
7 h-m-p 0.0001 0.0005 1035.1550 ++ 1823.790506 m 0.0005 215 | 0/19
8 h-m-p 0.0003 0.0016 367.0528 ++ 1743.854426 m 0.0016 237 | 0/19
9 h-m-p 0.0000 0.0000 13004.9340 CYCCCC 1741.562530 5 0.0000 268 | 0/19
10 h-m-p 0.0004 0.0019 48.0836 YCCC 1741.298473 3 0.0002 295 | 0/19
11 h-m-p 0.0003 0.0076 43.4406 CCC 1741.121175 2 0.0003 321 | 0/19
12 h-m-p 0.0004 0.0027 29.2647 YCCC 1740.878081 3 0.0007 348 | 0/19
13 h-m-p 0.0038 0.0365 5.6596 YCCC 1740.250752 3 0.0074 375 | 0/19
14 h-m-p 0.0016 0.0098 25.9994 YCCC 1737.921663 3 0.0039 402 | 0/19
15 h-m-p 0.0005 0.0025 69.5762 +YCCC 1735.607717 3 0.0012 430 | 0/19
16 h-m-p 0.0006 0.0032 53.7590 +YCYCCC 1723.829422 5 0.0028 461 | 0/19
17 h-m-p 0.0008 0.0042 30.1365 CCCC 1723.212181 3 0.0012 489 | 0/19
18 h-m-p 0.0042 0.0247 8.5063 CCC 1723.136287 2 0.0017 515 | 0/19
19 h-m-p 0.0064 0.1440 2.1896 CCC 1722.974683 2 0.0095 541 | 0/19
20 h-m-p 0.0083 0.1618 2.5111 +YCYCCC 1711.490043 5 0.0898 572 | 0/19
21 h-m-p 0.0018 0.0092 32.6900 YYYC 1710.386859 3 0.0018 597 | 0/19
22 h-m-p 0.1416 0.7081 0.3146 YCCCCC 1706.975431 5 0.3160 628 | 0/19
23 h-m-p 0.3380 2.7032 0.2942 +CYCCCC 1690.848009 5 1.6964 679 | 0/19
24 h-m-p 0.2251 1.1254 0.2155 +YCYCCC 1687.555774 5 0.6140 729 | 0/19
25 h-m-p 0.9787 4.8936 0.0975 CCC 1686.200695 2 0.9425 774 | 0/19
26 h-m-p 0.7833 3.9164 0.0284 YCCCC 1684.304110 4 1.6586 822 | 0/19
27 h-m-p 0.5059 2.5295 0.0344 YCCCC 1682.988081 4 1.2505 870 | 0/19
28 h-m-p 0.5331 3.0317 0.0806 +YC 1681.521729 1 1.3435 913 | 0/19
29 h-m-p 1.6000 8.0000 0.0579 CCC 1680.565693 2 1.5696 958 | 0/19
30 h-m-p 0.8009 4.0046 0.0731 YCCC 1679.690544 3 1.9682 1004 | 0/19
31 h-m-p 0.6004 3.8560 0.2398 CYCC 1679.218285 3 0.4962 1050 | 0/19
32 h-m-p 1.1390 5.9740 0.1044 CCC 1678.358370 2 1.6748 1095 | 0/19
33 h-m-p 1.3176 6.5881 0.0478 CYC 1678.004158 2 1.2069 1139 | 0/19
34 h-m-p 1.6000 8.0000 0.0165 CCC 1677.814077 2 1.7329 1184 | 0/19
35 h-m-p 1.2268 8.0000 0.0234 +YCC 1677.628886 2 3.3184 1229 | 0/19
36 h-m-p 1.6000 8.0000 0.0308 YCC 1677.402710 2 3.3134 1273 | 0/19
37 h-m-p 1.0981 5.4903 0.0165 YCCCC 1677.148438 4 2.2894 1321 | 0/19
38 h-m-p 1.6000 8.0000 0.0130 YC 1677.025459 1 2.6412 1363 | 0/19
39 h-m-p 1.6000 8.0000 0.0200 +CCC 1676.680257 2 5.9680 1409 | 0/19
40 h-m-p 1.6000 8.0000 0.0084 YCCC 1676.274357 3 2.8864 1455 | 0/19
41 h-m-p 1.6000 8.0000 0.0116 CC 1676.107925 1 2.0023 1498 | 0/19
42 h-m-p 1.1097 8.0000 0.0209 +YC 1675.962172 1 3.2102 1541 | 0/19
43 h-m-p 1.6000 8.0000 0.0180 YCCC 1675.752715 3 3.5286 1587 | 0/19
44 h-m-p 1.6000 8.0000 0.0092 CCC 1675.606984 2 2.0119 1632 | 0/19
45 h-m-p 1.6000 8.0000 0.0087 YCC 1675.586914 2 1.1432 1676 | 0/19
46 h-m-p 1.6000 8.0000 0.0030 YC 1675.584175 1 1.0370 1718 | 0/19
47 h-m-p 1.6000 8.0000 0.0004 C 1675.583940 0 1.3565 1759 | 0/19
48 h-m-p 1.0389 8.0000 0.0005 Y 1675.583907 0 2.0885 1800 | 0/19
49 h-m-p 1.6000 8.0000 0.0001 +Y 1675.583851 0 4.4607 1842 | 0/19
50 h-m-p 1.0721 8.0000 0.0003 Y 1675.583801 0 2.3376 1883 | 0/19
51 h-m-p 1.6000 8.0000 0.0001 Y 1675.583797 0 1.1234 1924 | 0/19
52 h-m-p 1.2510 8.0000 0.0001 C 1675.583797 0 1.1114 1965 | 0/19
53 h-m-p 1.6000 8.0000 0.0000 Y 1675.583797 0 1.1530 2006 | 0/19
54 h-m-p 1.6000 8.0000 0.0000 --Y 1675.583797 0 0.0457 2049 | 0/19
55 h-m-p 0.0466 8.0000 0.0000 C 1675.583797 0 0.0589 2090 | 0/19
56 h-m-p 0.0560 8.0000 0.0000 -------------Y 1675.583797 0 0.0000 2144
Out..
lnL = -1675.583797
2145 lfun, 2145 eigenQcodon, 36465 P(t)
Time used: 0:14
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), ((4, 5), ((6, (9, 10)), (7, 8)))); MP score: 193
0.061675 0.027593 0.019294 0.003297 0.008538 0.033954 0.045279 0.082054 0.162612 0.001667 0.135256 0.141560 0.141774 0.164004 0.038001 0.125253 0.086977 2.167183 0.718247 0.265678
ntime & nrate & np: 17 2 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.982238
np = 20
lnL0 = -1760.498667
Iterating by ming2
Initial: fx= 1760.498667
x= 0.06168 0.02759 0.01929 0.00330 0.00854 0.03395 0.04528 0.08205 0.16261 0.00167 0.13526 0.14156 0.14177 0.16400 0.03800 0.12525 0.08698 2.16718 0.71825 0.26568
1 h-m-p 0.0000 0.0013 822.6177 ++CYCCC 1749.325823 4 0.0001 34 | 0/20
2 h-m-p 0.0000 0.0002 308.5827 ++ 1733.106874 m 0.0002 57 | 0/20
3 h-m-p 0.0000 0.0000 4529.5522
h-m-p: 3.37289275e-21 1.68644637e-20 4.52955219e+03 1733.106874
.. | 0/20
4 h-m-p 0.0000 0.0007 3098.1907 CCYYYC 1730.739918 5 0.0000 107 | 0/20
5 h-m-p 0.0000 0.0007 300.5890 ++CCYCCC 1680.978310 5 0.0006 142 | 0/20
6 h-m-p 0.0002 0.0011 154.5451 +YCCCC 1674.338056 4 0.0006 173 | 0/20
7 h-m-p 0.0001 0.0005 154.4940 YCCCC 1672.560858 4 0.0002 203 | 0/20
8 h-m-p 0.0001 0.0007 66.7840 CYCCC 1672.215649 4 0.0002 233 | 0/20
9 h-m-p 0.0004 0.0019 33.5547 CC 1672.057240 1 0.0004 258 | 0/20
10 h-m-p 0.0003 0.0017 23.7399 YYC 1672.008467 2 0.0003 283 | 0/20
11 h-m-p 0.0007 0.0122 8.9876 CC 1671.988378 1 0.0006 308 | 0/20
12 h-m-p 0.0009 0.0379 5.8907 CC 1671.977456 1 0.0007 333 | 0/20
13 h-m-p 0.0007 0.0229 6.3702 CC 1671.962297 1 0.0010 358 | 0/20
14 h-m-p 0.0007 0.0625 8.8281 +YC 1671.856865 1 0.0048 383 | 0/20
15 h-m-p 0.0010 0.0076 42.7528 CCC 1671.734572 2 0.0011 410 | 0/20
16 h-m-p 0.0006 0.0091 82.5375 YCC 1671.652499 2 0.0004 436 | 0/20
17 h-m-p 0.0008 0.0177 41.0162 CC 1671.551354 1 0.0010 461 | 0/20
18 h-m-p 0.0050 0.0394 8.4971 CC 1671.533779 1 0.0010 486 | 0/20
19 h-m-p 0.0059 0.0828 1.4475 CC 1671.529217 1 0.0020 511 | 0/20
20 h-m-p 0.0019 0.2330 1.5119 +CC 1671.504736 1 0.0071 537 | 0/20
21 h-m-p 0.0015 0.1343 7.1627 ++YYC 1671.086421 2 0.0211 564 | 0/20
22 h-m-p 0.0050 0.0252 29.0150 CCC 1670.968792 2 0.0016 591 | 0/20
23 h-m-p 0.0437 0.3188 1.0526 --YC 1670.968045 1 0.0013 617 | 0/20
24 h-m-p 0.0195 5.3712 0.0707 +YC 1670.966412 1 0.0626 642 | 0/20
25 h-m-p 0.0018 0.2622 2.5056 +YC 1670.952104 1 0.0140 687 | 0/20
26 h-m-p 1.2117 8.0000 0.0289 YC 1670.938207 1 0.6299 711 | 0/20
27 h-m-p 1.6000 8.0000 0.0099 YC 1670.911902 1 3.1885 755 | 0/20
28 h-m-p 1.6000 8.0000 0.0106 CCCC 1670.858799 3 2.6452 804 | 0/20
29 h-m-p 1.6000 8.0000 0.0024 YC 1670.849864 1 1.1974 848 | 0/20
30 h-m-p 1.6000 8.0000 0.0017 YC 1670.849501 1 1.2359 892 | 0/20
31 h-m-p 1.6000 8.0000 0.0001 Y 1670.849490 0 0.9343 935 | 0/20
32 h-m-p 0.7776 8.0000 0.0001 C 1670.849490 0 0.9339 978 | 0/20
33 h-m-p 1.6000 8.0000 0.0000 Y 1670.849490 0 1.1187 1021 | 0/20
34 h-m-p 1.6000 8.0000 0.0000 --C 1670.849490 0 0.0250 1066
Out..
lnL = -1670.849490
1067 lfun, 3201 eigenQcodon, 36278 P(t)
Time used: 0:29
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), ((4, 5), ((6, (9, 10)), (7, 8)))); MP score: 193
initial w for M2:NSpselection reset.
0.061675 0.027593 0.019294 0.003297 0.008538 0.033954 0.045279 0.082054 0.162612 0.001667 0.135256 0.141560 0.141774 0.164004 0.038001 0.125253 0.086977 2.184230 1.659473 0.574115 0.238709 2.403915
ntime & nrate & np: 17 3 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.476453
np = 22
lnL0 = -1777.888416
Iterating by ming2
Initial: fx= 1777.888416
x= 0.06168 0.02759 0.01929 0.00330 0.00854 0.03395 0.04528 0.08205 0.16261 0.00167 0.13526 0.14156 0.14177 0.16400 0.03800 0.12525 0.08698 2.18423 1.65947 0.57412 0.23871 2.40392
1 h-m-p 0.0000 0.0014 894.0904 ++CYCCC 1765.599810 4 0.0001 36 | 0/22
2 h-m-p 0.0001 0.0003 248.2988 ++ 1750.379235 m 0.0003 61 | 0/22
3 h-m-p 0.0000 0.0000 3393.3749
h-m-p: 6.36669220e-20 3.18334610e-19 3.39337487e+03 1750.379235
.. | 0/22
4 h-m-p 0.0000 0.0008 2990.1255 CYCYCYC 1747.867427 6 0.0000 117 | 0/22
5 h-m-p 0.0000 0.0007 232.0638 ++YYYCCC 1717.399950 5 0.0007 151 | 0/22
6 h-m-p 0.0006 0.0032 106.5610 +CYC 1706.091744 2 0.0024 180 | 0/22
7 h-m-p 0.0005 0.0025 112.0001 YCCC 1702.539875 3 0.0012 210 | 0/22
8 h-m-p 0.0012 0.0059 72.7673 CCC 1700.561128 2 0.0016 239 | 0/22
9 h-m-p 0.0008 0.0048 137.6064 +YCCCC 1694.657877 4 0.0023 272 | 0/22
10 h-m-p 0.0003 0.0017 206.0008 +YCYCCC 1690.831245 5 0.0010 306 | 0/22
11 h-m-p 0.0005 0.0027 300.2926 +YCCC 1684.701534 3 0.0014 337 | 0/22
12 h-m-p 0.0004 0.0021 329.7477 YCYC 1681.590119 3 0.0007 366 | 0/22
13 h-m-p 0.0003 0.0017 103.9234 +YCCCC 1680.189357 4 0.0010 399 | 0/22
14 h-m-p 0.0018 0.0088 45.1553 YYCC 1679.487402 3 0.0016 428 | 0/22
15 h-m-p 0.0075 0.0373 8.6789 CCC 1679.391599 2 0.0023 457 | 0/22
16 h-m-p 0.0069 0.0540 2.8872 CCCC 1679.225478 3 0.0094 488 | 0/22
17 h-m-p 0.0007 0.0067 36.4846 YCCC 1678.831469 3 0.0016 518 | 0/22
18 h-m-p 0.0014 0.0134 41.2933 +YCCC 1677.619532 3 0.0040 549 | 0/22
19 h-m-p 0.0018 0.0088 38.2842 YYCC 1677.244269 3 0.0016 578 | 0/22
20 h-m-p 0.0123 0.0703 4.8296 CC 1677.210280 1 0.0028 605 | 0/22
21 h-m-p 0.0016 0.1392 8.5189 +YCCC 1676.932516 3 0.0151 636 | 0/22
22 h-m-p 0.0016 0.0266 78.8373 +YYYY 1675.779190 3 0.0065 665 | 0/22
23 h-m-p 0.0096 0.0478 14.3779 YC 1675.739261 1 0.0014 691 | 0/22
24 h-m-p 0.0110 1.6855 1.8737 ++CCC 1674.979840 2 0.1642 722 | 0/22
25 h-m-p 0.0051 0.0256 45.7879 YCC 1674.753574 2 0.0020 750 | 0/22
26 h-m-p 0.0397 0.7113 2.3398 +CCCCC 1673.467992 4 0.2209 784 | 0/22
27 h-m-p 0.5735 2.8675 0.2973 CCCC 1672.718664 3 0.8324 815 | 0/22
28 h-m-p 0.4482 5.3492 0.5521 CYC 1672.197742 2 0.4609 865 | 0/22
29 h-m-p 0.5318 5.0181 0.4786 CCCC 1671.723522 3 0.8876 918 | 0/22
30 h-m-p 1.1058 5.5289 0.3657 YCC 1671.549112 2 0.7754 968 | 0/22
31 h-m-p 0.7145 4.8116 0.3969 CCC 1671.371721 2 0.7422 1019 | 0/22
32 h-m-p 0.4601 3.5714 0.6402 CCC 1671.184715 2 0.6634 1070 | 0/22
33 h-m-p 0.4566 2.2829 0.4846 YC 1671.044327 1 1.0700 1118 | 0/22
34 h-m-p 0.3469 1.7345 0.2986 +CC 1670.952519 1 1.3556 1168 | 0/22
35 h-m-p 0.0845 0.4225 0.2740 ++ 1670.904077 m 0.4225 1215 | 1/22
36 h-m-p 0.4013 8.0000 0.1776 YC 1670.854266 1 0.8320 1263 | 1/22
37 h-m-p 1.6000 8.0000 0.0519 YC 1670.850171 1 0.8056 1310 | 1/22
38 h-m-p 1.4964 8.0000 0.0279 YC 1670.849591 1 0.8920 1357 | 1/22
39 h-m-p 1.6000 8.0000 0.0123 Y 1670.849524 0 0.7313 1403 | 1/22
40 h-m-p 1.5697 8.0000 0.0057 Y 1670.849500 0 0.9595 1449 | 1/22
41 h-m-p 1.6000 8.0000 0.0030 C 1670.849492 0 1.2824 1495 | 1/22
42 h-m-p 1.6000 8.0000 0.0011 Y 1670.849490 0 0.7917 1541 | 1/22
43 h-m-p 1.6000 8.0000 0.0002 Y 1670.849490 0 0.6450 1587 | 1/22
44 h-m-p 1.6000 8.0000 0.0000 Y 1670.849490 0 0.7366 1633 | 1/22
45 h-m-p 1.6000 8.0000 0.0000 Y 1670.849490 0 0.9758 1679 | 1/22
46 h-m-p 1.6000 8.0000 0.0000 Y 1670.849490 0 1.0662 1725 | 1/22
47 h-m-p 1.6000 8.0000 0.0000 ---------------Y 1670.849490 0 0.0000 1786
Out..
lnL = -1670.849490
1787 lfun, 7148 eigenQcodon, 91137 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1683.452192 S = -1625.209738 -49.605172
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 143 patterns 1:06
did 20 / 143 patterns 1:06
did 30 / 143 patterns 1:06
did 40 / 143 patterns 1:06
did 50 / 143 patterns 1:06
did 60 / 143 patterns 1:06
did 70 / 143 patterns 1:06
did 80 / 143 patterns 1:06
did 90 / 143 patterns 1:06
did 100 / 143 patterns 1:06
did 110 / 143 patterns 1:06
did 120 / 143 patterns 1:06
did 130 / 143 patterns 1:07
did 140 / 143 patterns 1:07
did 143 / 143 patterns 1:07
Time used: 1:07
Model 3: discrete
TREE # 1
(1, (2, 3), ((4, 5), ((6, (9, 10)), (7, 8)))); MP score: 193
0.061675 0.027593 0.019294 0.003297 0.008538 0.033954 0.045279 0.082054 0.162612 0.001667 0.135256 0.141560 0.141774 0.164004 0.038001 0.125253 0.086977 2.184229 0.339697 0.499728 0.027304 0.057409 0.111715
ntime & nrate & np: 17 4 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 15.266512
np = 23
lnL0 = -1679.410093
Iterating by ming2
Initial: fx= 1679.410093
x= 0.06168 0.02759 0.01929 0.00330 0.00854 0.03395 0.04528 0.08205 0.16261 0.00167 0.13526 0.14156 0.14177 0.16400 0.03800 0.12525 0.08698 2.18423 0.33970 0.49973 0.02730 0.05741 0.11172
1 h-m-p 0.0000 0.0004 697.9205 +YYCCC 1674.462708 4 0.0001 35 | 0/23
2 h-m-p 0.0001 0.0004 105.4169 ++ 1672.081051 m 0.0004 61 | 1/23
3 h-m-p 0.0002 0.0010 114.2427 YYCC 1671.888033 3 0.0001 91 | 1/23
4 h-m-p 0.0001 0.0009 121.7129 +CCC 1670.928777 2 0.0004 122 | 1/23
5 h-m-p 0.0002 0.0008 102.8180 CYCCC 1670.366344 4 0.0003 155 | 1/23
6 h-m-p 0.0003 0.0014 39.6236 CCCC 1670.220373 3 0.0003 187 | 1/23
7 h-m-p 0.0005 0.0024 23.6193 YCC 1670.166040 2 0.0003 216 | 0/23
8 h-m-p 0.0004 0.0156 21.2593 CCC 1670.121864 2 0.0003 246 | 0/23
9 h-m-p 0.0002 0.0011 20.7326 ++ 1669.985970 m 0.0011 272 | 0/23
10 h-m-p -0.0000 -0.0000 16.3630
h-m-p: -6.26560476e-20 -3.13280238e-19 1.63630317e+01 1669.985970
.. | 0/23
11 h-m-p 0.0000 0.0004 43.5304 ++YYC 1669.844323 2 0.0001 325 | 0/23
12 h-m-p 0.0001 0.0005 101.9885 CCC 1669.752699 2 0.0001 355 | 0/23
13 h-m-p 0.0001 0.0004 21.8449 +YC 1669.718780 1 0.0002 383 | 0/23
14 h-m-p 0.0001 0.0007 9.7707 YC 1669.708204 1 0.0003 410 | 0/23
15 h-m-p 0.0003 0.0165 8.8640 CC 1669.699155 1 0.0004 438 | 0/23
16 h-m-p 0.0002 0.0012 8.7645 YC 1669.692197 1 0.0004 465 | 0/23
17 h-m-p 0.0007 0.0304 5.1535 CC 1669.688270 1 0.0006 493 | 0/23
18 h-m-p 0.0007 0.0165 4.4683 YC 1669.686886 1 0.0003 520 | 0/23
19 h-m-p 0.0010 0.0256 1.3684 C 1669.686244 0 0.0009 546 | 0/23
20 h-m-p 0.0005 0.0108 2.6229 YC 1669.685380 1 0.0008 573 | 0/23
21 h-m-p 0.0004 0.0051 4.7917 CC 1669.684291 1 0.0006 601 | 0/23
22 h-m-p 0.0007 0.0054 3.9191 YC 1669.682512 1 0.0013 628 | 0/23
23 h-m-p 0.0012 0.0058 3.0523 YC 1669.681608 1 0.0009 655 | 0/23
24 h-m-p 0.0027 0.0227 1.0866 C 1669.681390 0 0.0009 681 | 0/23
25 h-m-p 0.0018 0.8787 0.5649 +YC 1669.680923 1 0.0052 709 | 0/23
26 h-m-p 0.0020 0.9850 4.0766 +CC 1669.676411 1 0.0073 761 | 0/23
27 h-m-p 0.0015 0.2167 20.0164 +YC 1669.662475 1 0.0046 789 | 0/23
28 h-m-p 0.0175 0.2289 5.2309 -CC 1669.661271 1 0.0016 818 | 0/23
29 h-m-p 0.0079 1.9452 1.0385 +C 1669.656856 0 0.0330 845 | 0/23
30 h-m-p 0.0018 0.8770 25.5050 ++YCCC 1669.583244 3 0.0203 878 | 0/23
31 h-m-p 0.0128 0.1919 40.4493 -CC 1669.577004 1 0.0012 907 | 0/23
32 h-m-p 0.0791 0.6313 0.6247 --YC 1669.576834 1 0.0022 936 | 0/23
33 h-m-p 0.0047 2.3243 0.2957 +++++ 1669.517612 m 2.3243 988 | 1/23
34 h-m-p 0.0613 1.0573 11.2107 -CC 1669.513854 1 0.0056 1040 | 1/23
35 h-m-p 0.1028 8.0000 0.6088 +YCCC 1669.476048 3 0.9957 1072 | 1/23
36 h-m-p 1.6000 8.0000 0.2978 CCC 1669.465596 2 1.4448 1124 | 1/23
37 h-m-p 1.0198 8.0000 0.4219 -------------C 1669.465596 0 0.0000 1185 | 1/23
38 h-m-p 0.0160 8.0000 0.1961 ++C 1669.465535 0 0.2309 1235 | 1/23
39 h-m-p 1.6000 8.0000 0.0104 ++ 1669.459207 m 8.0000 1283 | 1/23
40 h-m-p 1.3791 8.0000 0.0601 +CCC 1669.403831 2 5.3254 1336 | 1/23
41 h-m-p 0.1507 8.0000 2.1229 +YYCC 1669.322409 3 0.5250 1389 | 1/23
42 h-m-p 1.6000 8.0000 0.2794 CCC 1669.298660 2 0.4609 1419 | 0/23
43 h-m-p 0.0009 0.0396 151.1568 YYC 1669.295349 2 0.0007 1469 | 0/23
44 h-m-p 0.0979 0.4897 0.5529 ++ 1669.281597 m 0.4897 1495 | 1/23
45 h-m-p 1.6000 8.0000 0.0640 YC 1669.272476 1 1.1045 1545 | 1/23
46 h-m-p 0.2227 8.0000 0.3175 CY 1669.265913 1 0.2017 1595 | 1/23
47 h-m-p 0.5237 8.0000 0.1223 +CC 1669.249683 1 2.7856 1646 | 0/23
48 h-m-p 0.0172 2.6225 19.8069 ---Y 1669.249654 0 0.0001 1697 | 0/23
49 h-m-p 0.0358 0.2681 0.0597 ++ 1669.248463 m 0.2681 1723 | 1/23
50 h-m-p 0.3068 8.0000 0.0522 YC 1669.244503 1 0.6876 1773 | 1/23
51 h-m-p 0.7984 8.0000 0.0450 +CC 1669.238185 1 2.7302 1824 | 0/23
52 h-m-p 0.0017 0.2667 72.4843 -YC 1669.238072 1 0.0002 1874 | 0/23
53 h-m-p 0.3994 2.3926 0.0376 ++ 1669.232643 m 2.3926 1900 | 1/23
54 h-m-p 1.6000 8.0000 0.0265 YC 1669.231994 1 0.8589 1950 | 1/23
55 h-m-p 0.3992 8.0000 0.0570 +YC 1669.231280 1 1.1029 2000 | 1/23
56 h-m-p 1.6000 8.0000 0.0084 ++ 1669.227286 m 8.0000 2048 | 1/23
57 h-m-p 1.6000 8.0000 0.0072 ++ 1669.206183 m 8.0000 2096 | 1/23
58 h-m-p 0.1469 8.0000 0.3947 +YCC 1669.182913 2 1.1429 2148 | 1/23
59 h-m-p 1.6000 8.0000 0.1288 YCC 1669.174865 2 1.2870 2199 | 1/23
60 h-m-p 1.6000 8.0000 0.0169 YC 1669.173683 1 1.1860 2248 | 1/23
61 h-m-p 1.6000 8.0000 0.0103 Y 1669.173666 0 1.0624 2296 | 1/23
62 h-m-p 1.6000 8.0000 0.0006 Y 1669.173666 0 1.0881 2344 | 1/23
63 h-m-p 1.6000 8.0000 0.0001 Y 1669.173666 0 1.0605 2392 | 1/23
64 h-m-p 1.6000 8.0000 0.0000 C 1669.173666 0 1.6000 2440 | 1/23
65 h-m-p 1.6000 8.0000 0.0000 -------Y 1669.173666 0 0.0000 2495
Out..
lnL = -1669.173666
2496 lfun, 9984 eigenQcodon, 127296 P(t)
Time used: 1:57
Model 7: beta
TREE # 1
(1, (2, 3), ((4, 5), ((6, (9, 10)), (7, 8)))); MP score: 193
0.061675 0.027593 0.019294 0.003297 0.008538 0.033954 0.045279 0.082054 0.162612 0.001667 0.135256 0.141560 0.141774 0.164004 0.038001 0.125253 0.086977 2.151837 0.309823 1.349954
ntime & nrate & np: 17 1 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 11.336434
np = 20
lnL0 = -1693.030391
Iterating by ming2
Initial: fx= 1693.030391
x= 0.06168 0.02759 0.01929 0.00330 0.00854 0.03395 0.04528 0.08205 0.16261 0.00167 0.13526 0.14156 0.14177 0.16400 0.03800 0.12525 0.08698 2.15184 0.30982 1.34995
1 h-m-p 0.0000 0.0025 659.3410 +YCYCCC 1686.191235 5 0.0001 34 | 0/20
2 h-m-p 0.0000 0.0002 141.6820 +YCCCC 1683.977537 4 0.0002 65 | 0/20
3 h-m-p 0.0000 0.0002 827.4926 +CYCCC 1675.900775 4 0.0001 96 | 0/20
4 h-m-p 0.0001 0.0006 350.3303 CCCC 1673.899334 3 0.0001 125 | 0/20
5 h-m-p 0.0004 0.0018 87.8640 CCCCC 1672.636202 4 0.0004 156 | 0/20
6 h-m-p 0.0012 0.0079 33.4733 CCC 1672.519123 2 0.0003 183 | 0/20
7 h-m-p 0.0006 0.0158 15.5800 CC 1672.438914 1 0.0008 208 | 0/20
8 h-m-p 0.0004 0.0022 24.2930 YCCC 1672.403986 3 0.0003 236 | 0/20
9 h-m-p 0.0003 0.0055 26.2419 +YCC 1672.318207 2 0.0008 263 | 0/20
10 h-m-p 0.0006 0.0147 33.1857 +CCCC 1671.975030 3 0.0027 293 | 0/20
11 h-m-p 0.0009 0.0103 100.7384 +YYCC 1670.769224 3 0.0032 321 | 0/20
12 h-m-p 0.0015 0.0077 83.0979 YC 1670.570068 1 0.0007 345 | 0/20
13 h-m-p 0.0025 0.0151 23.3526 CC 1670.514197 1 0.0008 370 | 0/20
14 h-m-p 0.0044 0.0596 4.2105 YC 1670.508821 1 0.0008 394 | 0/20
15 h-m-p 0.0035 0.1628 0.9761 YC 1670.507514 1 0.0020 418 | 0/20
16 h-m-p 0.0015 0.7554 2.7536 ++CCC 1670.449092 2 0.0333 467 | 0/20
17 h-m-p 0.0027 0.0708 34.5895 C 1670.392467 0 0.0027 490 | 0/20
18 h-m-p 0.0519 0.3056 1.7686 -YC 1670.390528 1 0.0017 515 | 0/20
19 h-m-p 0.0075 2.5050 0.3997 ++CCC 1670.299399 2 0.1506 544 | 0/20
20 h-m-p 0.0015 0.0403 40.1475 +CCC 1669.948429 2 0.0059 592 | 0/20
21 h-m-p 0.0164 0.0818 4.9035 -CC 1669.939324 1 0.0016 618 | 0/20
22 h-m-p 0.0348 6.5784 0.2293 +++YYC 1669.655168 2 1.7954 646 | 0/20
23 h-m-p 1.6000 8.0000 0.0782 CC 1669.568884 1 1.6170 691 | 0/20
24 h-m-p 1.6000 8.0000 0.0281 YC 1669.544823 1 1.2594 735 | 0/20
25 h-m-p 0.7174 8.0000 0.0493 +YC 1669.522733 1 2.4096 780 | 0/20
26 h-m-p 0.9272 8.0000 0.1282 +YC 1669.491873 1 2.4819 825 | 0/20
27 h-m-p 1.6000 8.0000 0.0711 CC 1669.484966 1 1.4843 870 | 0/20
28 h-m-p 1.6000 8.0000 0.0303 CC 1669.483672 1 1.2949 915 | 0/20
29 h-m-p 1.6000 8.0000 0.0057 C 1669.483409 0 1.4412 958 | 0/20
30 h-m-p 1.6000 8.0000 0.0019 C 1669.483315 0 1.8470 1001 | 0/20
31 h-m-p 1.6000 8.0000 0.0005 Y 1669.483312 0 1.0727 1044 | 0/20
32 h-m-p 1.6000 8.0000 0.0003 Y 1669.483312 0 1.1172 1087 | 0/20
33 h-m-p 1.6000 8.0000 0.0001 Y 1669.483312 0 0.8851 1130 | 0/20
34 h-m-p 1.6000 8.0000 0.0000 C 1669.483312 0 0.4000 1173 | 0/20
35 h-m-p 0.6663 8.0000 0.0000 -Y 1669.483312 0 0.0416 1217 | 0/20
36 h-m-p 0.0429 8.0000 0.0000 -Y 1669.483312 0 0.0027 1261
Out..
lnL = -1669.483312
1262 lfun, 13882 eigenQcodon, 214540 P(t)
Time used: 3:19
Model 8: beta&w>1
TREE # 1
(1, (2, 3), ((4, 5), ((6, (9, 10)), (7, 8)))); MP score: 193
initial w for M8:NSbetaw>1 reset.
0.061675 0.027593 0.019294 0.003297 0.008538 0.033954 0.045279 0.082054 0.162612 0.001667 0.135256 0.141560 0.141774 0.164004 0.038001 0.125253 0.086977 2.160846 0.900000 0.966220 1.075304 2.140227
ntime & nrate & np: 17 2 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.726848
np = 22
lnL0 = -1780.226216
Iterating by ming2
Initial: fx= 1780.226216
x= 0.06168 0.02759 0.01929 0.00330 0.00854 0.03395 0.04528 0.08205 0.16261 0.00167 0.13526 0.14156 0.14177 0.16400 0.03800 0.12525 0.08698 2.16085 0.90000 0.96622 1.07530 2.14023
1 h-m-p 0.0000 0.0005 878.9882 ++YCYCCC 1769.230040 5 0.0001 37 | 0/22
2 h-m-p 0.0000 0.0002 227.7039 +YYCYCCC 1760.719559 6 0.0002 73 | 0/22
3 h-m-p 0.0000 0.0000 1677.9766 ++ 1752.827724 m 0.0000 98 | 1/22
4 h-m-p 0.0002 0.0009 165.0954 +YYCYCCC 1745.355256 6 0.0007 133 | 1/22
5 h-m-p 0.0000 0.0001 1944.1247 +YYYC 1739.441821 3 0.0001 162 | 1/22
6 h-m-p 0.0000 0.0001 5244.8810 +YYYYYYCCCC 1717.599288 9 0.0001 200 | 1/22
7 h-m-p 0.0000 0.0001 6293.9941 +YYCYCCC 1694.367018 6 0.0001 235 | 1/22
8 h-m-p 0.0000 0.0001 2026.5287 YCCCC 1692.275625 4 0.0000 267 | 1/22
9 h-m-p 0.0002 0.0009 198.0247 YCYC 1691.587915 3 0.0001 296 | 1/22
10 h-m-p 0.0004 0.0122 57.4332 +CYC 1689.961271 2 0.0015 325 | 1/22
11 h-m-p 0.0002 0.0011 195.5005 YCYCCC 1687.751197 5 0.0006 358 | 1/22
12 h-m-p 0.0002 0.0014 523.8866 YCCC 1684.770212 3 0.0003 388 | 1/22
13 h-m-p 0.0005 0.0026 204.3995 YCCCC 1681.573977 4 0.0010 420 | 1/22
14 h-m-p 0.0056 0.0289 35.7697 YCCC 1680.351579 3 0.0027 450 | 1/22
15 h-m-p 0.0019 0.0160 49.0567 YCCC 1678.465381 3 0.0030 480 | 1/22
16 h-m-p 0.0041 0.0205 22.6626 CYC 1678.300063 2 0.0009 508 | 1/22
17 h-m-p 0.0070 0.0920 2.8952 YC 1678.277677 1 0.0032 534 | 1/22
18 h-m-p 0.0028 0.4812 3.3314 ++YCCC 1677.542117 3 0.0790 566 | 1/22
19 h-m-p 0.0024 0.0208 109.9985 CCCC 1676.717137 3 0.0026 597 | 1/22
20 h-m-p 0.0074 0.0369 8.2518 C 1676.672470 0 0.0018 622 | 1/22
21 h-m-p 0.0117 0.8275 1.2986 +YC 1675.724441 1 0.1165 649 | 1/22
22 h-m-p 0.0024 0.0229 62.1010 YC 1673.859651 1 0.0048 675 | 1/22
23 h-m-p 0.7797 3.8986 0.3288 +CCC 1671.204538 2 2.9252 705 | 0/22
24 h-m-p 0.0081 0.0405 7.8321 -C 1671.204194 0 0.0005 752 | 0/22
25 h-m-p 0.0030 0.2257 1.1690 ++++ 1670.633449 m 0.2257 779 | 1/22
26 h-m-p 0.3783 1.8914 0.1714 YCCC 1669.897857 3 0.9445 809 | 1/22
27 h-m-p 0.4108 2.0542 0.0422 +CYC 1669.691300 2 1.5169 859 | 1/22
28 h-m-p 1.2282 6.1412 0.0350 CCC 1669.586412 2 1.4005 909 | 1/22
29 h-m-p 1.6000 8.0000 0.0104 CC 1669.535715 1 1.5800 957 | 1/22
30 h-m-p 0.3697 8.0000 0.0443 +YC 1669.472946 1 2.5524 1005 | 1/22
31 h-m-p 1.6000 8.0000 0.0382 YC 1669.432648 1 2.8223 1052 | 1/22
32 h-m-p 1.6000 8.0000 0.0371 CC 1669.413134 1 1.9310 1100 | 1/22
33 h-m-p 1.6000 8.0000 0.0134 CC 1669.409444 1 1.9119 1148 | 1/22
34 h-m-p 1.6000 8.0000 0.0072 YC 1669.406650 1 2.8368 1195 | 1/22
35 h-m-p 1.6000 8.0000 0.0094 YC 1669.404184 1 3.9732 1242 | 1/22
36 h-m-p 1.6000 8.0000 0.0180 +CC 1669.398680 1 5.6872 1291 | 1/22
37 h-m-p 1.6000 8.0000 0.0533 ++ 1669.376029 m 8.0000 1337 | 1/22
38 h-m-p 1.6000 8.0000 0.2492 YCC 1669.346357 2 2.9965 1386 | 1/22
39 h-m-p 1.6000 8.0000 0.0838 CC 1669.340341 1 1.9645 1434 | 1/22
40 h-m-p 1.6000 8.0000 0.0977 +YC 1669.333128 1 4.0139 1482 | 1/22
41 h-m-p 1.6000 8.0000 0.0123 C 1669.330525 0 1.5583 1528 | 1/22
42 h-m-p 0.6007 8.0000 0.0320 +YC 1669.329918 1 1.6492 1576 | 1/22
43 h-m-p 1.6000 8.0000 0.0036 C 1669.329825 0 1.3160 1622 | 1/22
44 h-m-p 0.6730 8.0000 0.0071 Y 1669.329819 0 1.1372 1668 | 1/22
45 h-m-p 1.6000 8.0000 0.0014 C 1669.329818 0 1.4217 1714 | 1/22
46 h-m-p 1.6000 8.0000 0.0003 C 1669.329818 0 1.2860 1760 | 1/22
47 h-m-p 1.6000 8.0000 0.0000 C 1669.329818 0 1.5077 1806 | 1/22
48 h-m-p 1.3117 8.0000 0.0000 Y 1669.329818 0 0.8558 1852 | 1/22
49 h-m-p 0.8753 8.0000 0.0000 Y 1669.329818 0 0.8753 1898 | 1/22
50 h-m-p 1.6000 8.0000 0.0000 ---C 1669.329818 0 0.0063 1947
Out..
lnL = -1669.329818
1948 lfun, 23376 eigenQcodon, 364276 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1686.728194 S = -1625.568969 -52.868118
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 143 patterns 5:40
did 20 / 143 patterns 5:40
did 30 / 143 patterns 5:40
did 40 / 143 patterns 5:41
did 50 / 143 patterns 5:41
did 60 / 143 patterns 5:41
did 70 / 143 patterns 5:41
did 80 / 143 patterns 5:41
did 90 / 143 patterns 5:42
did 100 / 143 patterns 5:42
did 110 / 143 patterns 5:42
did 120 / 143 patterns 5:42
did 130 / 143 patterns 5:42
did 140 / 143 patterns 5:43
did 143 / 143 patterns 5:43
Time used: 5:43
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=181
D_melanogaster_CG44001-PB MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
D_sechellia_CG44001-PB MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
D_simulans_CG44001-PB MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
D_yakuba_CG44001-PB MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
D_erecta_CG44001-PB MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
D_takahashii_CG44001-PB MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
D_biarmipes_CG44001-PB MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
D_suzukii_CG44001-PB MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
D_rhopaloa_CG44001-PB MDHHNADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNELERVREFIKKG
D_elegans_CG44001-PB MDHHNADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG
** *.**********************************:**********
D_melanogaster_CG44001-PB QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
D_sechellia_CG44001-PB QSMDRDGCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
D_simulans_CG44001-PB QSMDRDGCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
D_yakuba_CG44001-PB QSMARDDCDYTALHYAARNGNEPICKLLLVEGKADVNAVTKAGATALHRA
D_erecta_CG44001-PB QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA
D_takahashii_CG44001-PB QAMARDGCDYTALHYAARNGNVPICKLLLDEGKVDVNAVTKAGATSLHRA
D_biarmipes_CG44001-PB QSMARDDCDYTALHYAARNGNEPICKLLLEEGKADVNAVTKAGATSLHRA
D_suzukii_CG44001-PB QSMARDDCDYTALHYAARNGNEPICKLLLEEGKADVNAVTKAGASSLHRS
D_rhopaloa_CG44001-PB QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATSLHRA
D_elegans_CG44001-PB QSMARDDCDYTALHYAARNGNEPICKLLLDEGKVDVNAVTKAGATSLHRA
*:* **.************** ******* ***.**********::***:
D_melanogaster_CG44001-PB AMMGHLEIVKLLVEHKANLLLQDESGQTALHRAVMRGHLEVCRILLAKEP
D_sechellia_CG44001-PB AMMGHLEIVKLLVEHKANLLLQDECGQTALHRAVMRGHLEVCRILLAKEP
D_simulans_CG44001-PB AMMGHLEIVKLLVEHKANLLLQDECGQTALHRAVMRGHLEVCRILLAKEP
D_yakuba_CG44001-PB AMMGHLEIVKVLFEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLAKEP
D_erecta_CG44001-PB AMMGHLEIVKVLVEHKADLLLQDECGQTALHRAAMRGHLEVCRFLLAKEP
D_takahashii_CG44001-PB AMMGHLEIVKLLAEHKANLLLQDECGQSALHRAAMRGHLEVCRLLLQKEP
D_biarmipes_CG44001-PB AMMGHLEIVKLLAEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLQKEP
D_suzukii_CG44001-PB AMMGHLDIVKLLAEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLQKEP
D_rhopaloa_CG44001-PB AMMGHLEIVKLLSGHKANLLLQDECGQSALHRAAMRGHLEVCRFLLQQEP
D_elegans_CG44001-PB AMMGHLEIVKLLVEHKANLLLQDECGQSALHRAAMRGHLEVCRFLLQQEP
******:***:* ***:******.**:*****.*********:** :**
D_melanogaster_CG44001-PB TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
D_sechellia_CG44001-PB TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
D_simulans_CG44001-PB TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
D_yakuba_CG44001-PB TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
D_erecta_CG44001-PB TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
D_takahashii_CG44001-PB TLKLVKDKKDKIAFEYIMENANDDFKLLLKP
D_biarmipes_CG44001-PB TLKLVQDKKEKIAFEYITENANDDFKLLLKP
D_suzukii_CG44001-PB TLKLVKDKKDKIAFEYITENANDDFKLLLKP
D_rhopaloa_CG44001-PB ALKLVKDNKNKIAFEYIMENANDDFKLLLKP
D_elegans_CG44001-PB ALKLIKDNKNKIAFEYIMENANDDFKLLLKP
:***::*:*:******* *************
>D_melanogaster_CG44001-PB ATGGATCCACATAGTGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC GGCACAGCAGACGTTAAGCGACATGGACTTCGATCGAGGCATTTGGAATG CAGCTATCTATAACGAAGTGGAGCGTGTAAGAGAGTTTATCAAGAAGGGC CAGTCGATGGCTCGCGATGACTGCGACTATACGGCTCTGCACTATGCGGC CCGCAATGGGAACGAGCCCATCTGCAAGCTGCTTCTCGACGAGGGCAAGG CAGACGTGAATGCTGTGACCAAAGCAGGAGCCACCGCGCTGCATCGTGCA GCCATGATGGGCCACTTGGAAATCGTGAAGCTACTGGTCGAGCACAAGGC TAATCTTCTGCTGCAGGACGAGAGCGGACAGACCGCTTTGCATCGAGCAG TGATGCGGGGCCACCTGGAGGTGTGTCGCATTCTGCTGGCAAAGGAGCCA ACACTTAAGCTGGTCAAGGATAAAAAGGACAAAATTGCATTTGAGTACAT CATGGAGAACGCCAATGATGATTTTAAGCTGCTGCTGAAGCCC >D_sechellia_CG44001-PB ATGGATCCACATAGTGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC GGCACAGCAGACGTTAAGCGACATGGACTTCGATCGAGGCATCTGGAATG CAGCTATCTATAACGAAGTGGAGCGTGTAAGGGAGTTTATCAAGAAGGGC CAGTCAATGGATCGCGATGGCTGCGACTATACCGCTCTGCACTATGCGGC CCGCAATGGGAACGAGCCGATCTGCAAGCTGCTTCTCGACGAGGGCAAGG CAGACGTAAATGCAGTGACCAAGGCAGGAGCCACCGCGCTGCATCGTGCA GCCATGATGGGCCACTTGGAGATCGTGAAGCTACTGGTCGAGCACAAGGC TAATCTTCTGCTGCAGGACGAGTGCGGACAGACTGCTTTGCATCGAGCAG TGATGCGGGGCCACCTGGAGGTGTGTCGCATTCTGCTGGCGAAGGAGCCG ACTCTTAAGCTGGTCAAAGATAAAAAGGACAAAATTGCATTTGAGTACAT CATGGAGAACGCCAATGATGACTTTAAGCTGCTGCTGAAGCCC >D_simulans_CG44001-PB ATGGATCCACATAGTGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC GGCACAGCAGACGTTAAGCGACATGGACTTCGATCGAGGCATCTGGAATG CAGCTATCTATAACGAAGTGGAGCGTGTAAGGGAGTTTATCAAGAAGGGC CAGTCAATGGATCGCGATGGCTGCGACTATACCGCTCTGCACTATGCGGC CCGCAATGGGAACGAGCCCATCTGCAAGCTGCTTCTCGACGAGGGCAAGG CAGACGTGAATGCTGTGACCAAGGCAGGAGCCACCGCGCTGCATCGTGCA GCCATGATGGGCCACTTGGAGATCGTGAAGCTACTGGTCGAGCACAAGGC TAATCTTCTGCTGCAGGACGAGTGCGGACAGACTGCTTTGCATCGAGCAG TGATGCGAGGCCACCTGGAGGTGTGTCGCATTCTGCTGGCGAAGGAGCCG ACTCTTAAGCTGGTCAAAGATAAAAAGGACAAAATTGCATTTGAGTACAT CATGGAGAACGCCAATGATGACTTTAAGCTGCTGCTGAAGCCC >D_yakuba_CG44001-PB ATGGATCCACATAGTGCGGACAACTGTAAGTGCCACAAGCAGACGCAGCC GGCACAGCAGACGTTAAGCGACATGGACTTCGATCGAGGCATCTGGAATG CAGCTATCTATAACGAAGTGGAGCGTGTTAGGGAGTTTATCAAGAAGGGT CAGTCGATGGCTCGGGATGACTGCGACTACACCGCTCTGCACTATGCGGC CCGCAATGGGAACGAGCCCATCTGCAAGCTGCTCCTCGTCGAGGGCAAGG CAGACGTGAATGCTGTGACCAAGGCAGGAGCCACCGCGCTTCATCGTGCA GCCATGATGGGCCACTTGGAGATTGTGAAGGTACTGTTCGAGCACAAGGC TAATCTTCTGCTGCAGGACGAGTGCGGACAGACTGCTTTGCATCGAGCAG CGATGCGAGGCCACCTGGAGGTGTGTCGCTTTCTGCTGGCGAAGGAGCCG ACTCTTAAACTGGTCAAGGATAAAAAGGACAAAATTGCATTTGAGTACAT CATGGAGAACGCCAATGATGACTTTAAGCTGCTGCTAAAGCCC >D_erecta_CG44001-PB ATGGATCCACATAGTGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC GGCACAGCAGACGTTAAGTGACATGGACTTCGATCGAGGCATCTGGAATG CAGCTATCTATAACGAAGTGGAGCGTGTAAGGGAGTTTATCAAGAAGGGT CAGTCGATGGCTCGGGACGACTGCGACTACACCGCTCTGCACTATGCGGC CCGCAATGGGAACGAGCCCATCTGCAAGCTGCTTCTCGACGAGGGCAAGG CAGACGTGAATGCTGTGACCAAGGCTGGAGCTACCGCGCTGCATCGTGCA GCCATGATGGGCCACTTGGAAATTGTGAAGGTACTGGTCGAGCACAAGGC TGATCTCCTTCTGCAGGACGAGTGCGGGCAGACTGCATTGCATCGGGCAG CGATGCGGGGCCACCTGGAGGTGTGTCGCTTTCTGCTGGCAAAGGAGCCG ACTCTTAAACTGGTTAAGGATAAAAAGGACAAAATTGCATTTGAGTACAT CATGGAGAACGCCAATGATGACTTTAAGCTGCTGCTGAAGCCC >D_takahashii_CG44001-PB ATGGATCCACATAGCGCGGACAACTGCAAGTGCCACAAGCAAACGCAGCC GGCACAGCAGACGCTCAGCGACATGGACTTCGATCGAGGCATCTGGAATG CAGCTATCTACAACGAGGTGGAGCGTGTGAGGGAGTTCATCAAGAAGGGC CAGGCCATGGCTCGCGATGGCTGCGACTATACGGCTCTGCACTATGCGGC CCGTAATGGCAACGTGCCCATCTGCAAGCTGCTTCTCGACGAGGGCAAAG TGGATGTAAATGCTGTGACCAAGGCGGGAGCCACCTCCCTGCATCGCGCA GCTATGATGGGCCACTTGGAGATTGTTAAGCTGCTGGCCGAGCACAAGGC GAATCTGCTGCTGCAGGACGAGTGCGGACAGAGTGCTTTGCATCGGGCAG CCATGCGTGGCCACCTGGAGGTGTGTCGCCTGCTGCTGCAAAAGGAGCCG ACACTCAAGCTGGTCAAGGATAAAAAGGATAAAATCGCATTTGAGTACAT CATGGAGAACGCCAATGATGACTTTAAGCTATTGCTGAAGCCC >D_biarmipes_CG44001-PB ATGGATCCCCACAGCGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC GGCCCAGCAGACACTTAGCGACATGGACTTCGATCGCGGCATCTGGAATG CTGCTATCTACAACGAAGTGGAGCGCGTCAGGGAGTTCATTAAGAAGGGC CAGTCCATGGCTCGGGATGACTGCGACTATACGGCTCTGCACTATGCAGC CCGCAATGGCAATGAGCCCATCTGCAAGCTGCTCCTCGAAGAGGGCAAGG CAGATGTGAATGCTGTGACCAAGGCAGGAGCCACCTCCCTGCATCGCGCC GCCATGATGGGCCACTTGGAGATCGTCAAGCTGCTGGCCGAGCACAAGGC GAATCTTCTGCTGCAGGACGAGTGCGGGCAGACTGCTTTGCACCGGGCAG CAATGCGGGGCCACCTCGAGGTGTGCCGCTTTCTGCTGCAGAAGGAACCG ACACTCAAGCTGGTCCAGGATAAAAAGGAAAAAATTGCATTTGAGTACAT CACGGAGAACGCCAATGACGACTTTAAGCTACTGCTGAAGCCC >D_suzukii_CG44001-PB ATGGATCCCCATAGCGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC GGCTCAGCAGACGCTCAGCGACATGGACTTCGATCGGGGCATCTGGAATG CTGCTATTTATAACGAAGTGGAACGCGTCAGGGAGTTCATCAAGAAGGGC CAGTCTATGGCTCGGGATGACTGCGACTATACGGCTCTGCACTATGCGGC CCGCAATGGCAACGAGCCCATCTGCAAGCTGCTTCTCGAAGAAGGCAAGG CAGATGTGAATGCTGTGACCAAGGCAGGAGCCAGCTCCCTGCATCGCTCA GCTATGATGGGCCACTTGGACATTGTGAAGCTACTGGCCGAGCACAAGGC GAATCTTCTGCTGCAGGATGAGTGCGGACAGACTGCCTTGCATCGGGCTG CAATGCGGGGCCACCTCGAGGTGTGTCGCTTTCTGCTGCAGAAGGAACCG ACACTCAAACTGGTCAAGGATAAGAAGGATAAAATTGCATTTGAGTACAT CACGGAGAACGCCAATGATGACTTTAAGCTACTGCTGAAGCCC >D_rhopaloa_CG44001-PB ATGGATCACCATAACGCCGACAACTGCAAATGCCACAAGCAGACGCAGCC GGCACAGCAGACGCTCAGCGACATGGACTTTGACCGGGGCATTTGGAATG CAGCTATCTATAACGAACTGGAACGTGTAAGGGAGTTCATCAAGAAGGGC CAGTCCATGGCTCGGGATGACTGCGACTATACGGCTTTGCACTATGCAGC CCGCAATGGCAACGAGCCAATCTGCAAGCTACTCCTCGACGAGGGCAAAG CAGATGTAAATGCTGTGACCAAAGCAGGAGCCACATCACTGCACCGAGCA GCCATGATGGGCCATTTGGAGATTGTTAAGCTACTGTCGGGACACAAGGC TAATCTTCTGCTCCAGGACGAGTGCGGACAGAGTGCTTTGCATCGGGCAG CGATGCGTGGGCATCTGGAGGTGTGTCGTTTCCTGCTGCAGCAGGAACCG GCACTCAAGCTGGTCAAGGATAACAAGAACAAAATTGCATTTGAATACAT CATGGAAAACGCCAATGATGACTTTAAGCTATTGCTGAAGCCC >D_elegans_CG44001-PB ATGGATCACCACAACGCGGACAACTGCAAGTGCCACAAGCAGACGCAGCC GGCACAGCAGACGCTCAGCGACATGGACTTTGATCGGGGCATCTGGAATG CGGCTATCTATAACGAAGTGGAACGTGTGAGGGAGTTCATCAAGAAGGGC CAGTCCATGGCTCGGGATGACTGCGATTATACGGCTTTGCACTATGCGGC CCGCAATGGCAATGAACCAATTTGTAAGCTACTTCTCGATGAGGGCAAAG TAGATGTGAATGCTGTGACCAAGGCAGGAGCCACCTCCCTGCACCGAGCA GCCATGATGGGACATTTGGAGATTGTTAAGCTACTGGTGGAGCACAAGGC GAATCTTCTGCTGCAGGACGAGTGCGGGCAGAGTGCCTTGCATCGGGCTG CGATGCGTGGCCATCTGGAGGTGTGTCGCTTTCTGCTGCAGCAGGAACCC GCACTCAAGCTGATTAAGGATAACAAGAATAAAATTGCATTTGAATACAT CATGGAGAACGCCAACGACGACTTCAAGCTACTGCTGAAACCC
>D_melanogaster_CG44001-PB MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA AMMGHLEIVKLLVEHKANLLLQDESGQTALHRAVMRGHLEVCRILLAKEP TLKLVKDKKDKIAFEYIMENANDDFKLLLKP >D_sechellia_CG44001-PB MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG QSMDRDGCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA AMMGHLEIVKLLVEHKANLLLQDECGQTALHRAVMRGHLEVCRILLAKEP TLKLVKDKKDKIAFEYIMENANDDFKLLLKP >D_simulans_CG44001-PB MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG QSMDRDGCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA AMMGHLEIVKLLVEHKANLLLQDECGQTALHRAVMRGHLEVCRILLAKEP TLKLVKDKKDKIAFEYIMENANDDFKLLLKP >D_yakuba_CG44001-PB MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG QSMARDDCDYTALHYAARNGNEPICKLLLVEGKADVNAVTKAGATALHRA AMMGHLEIVKVLFEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLAKEP TLKLVKDKKDKIAFEYIMENANDDFKLLLKP >D_erecta_CG44001-PB MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATALHRA AMMGHLEIVKVLVEHKADLLLQDECGQTALHRAAMRGHLEVCRFLLAKEP TLKLVKDKKDKIAFEYIMENANDDFKLLLKP >D_takahashii_CG44001-PB MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG QAMARDGCDYTALHYAARNGNVPICKLLLDEGKVDVNAVTKAGATSLHRA AMMGHLEIVKLLAEHKANLLLQDECGQSALHRAAMRGHLEVCRLLLQKEP TLKLVKDKKDKIAFEYIMENANDDFKLLLKP >D_biarmipes_CG44001-PB MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG QSMARDDCDYTALHYAARNGNEPICKLLLEEGKADVNAVTKAGATSLHRA AMMGHLEIVKLLAEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLQKEP TLKLVQDKKEKIAFEYITENANDDFKLLLKP >D_suzukii_CG44001-PB MDPHSADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG QSMARDDCDYTALHYAARNGNEPICKLLLEEGKADVNAVTKAGASSLHRS AMMGHLDIVKLLAEHKANLLLQDECGQTALHRAAMRGHLEVCRFLLQKEP TLKLVKDKKDKIAFEYITENANDDFKLLLKP >D_rhopaloa_CG44001-PB MDHHNADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNELERVREFIKKG QSMARDDCDYTALHYAARNGNEPICKLLLDEGKADVNAVTKAGATSLHRA AMMGHLEIVKLLSGHKANLLLQDECGQSALHRAAMRGHLEVCRFLLQQEP ALKLVKDNKNKIAFEYIMENANDDFKLLLKP >D_elegans_CG44001-PB MDHHNADNCKCHKQTQPAQQTLSDMDFDRGIWNAAIYNEVERVREFIKKG QSMARDDCDYTALHYAARNGNEPICKLLLDEGKVDVNAVTKAGATSLHRA AMMGHLEIVKLLVEHKANLLLQDECGQSALHRAAMRGHLEVCRFLLQQEP ALKLIKDNKNKIAFEYIMENANDDFKLLLKP
#NEXUS
[ID: 6504523351]
begin taxa;
dimensions ntax=10;
taxlabels
D_melanogaster_CG44001-PB
D_sechellia_CG44001-PB
D_simulans_CG44001-PB
D_yakuba_CG44001-PB
D_erecta_CG44001-PB
D_takahashii_CG44001-PB
D_biarmipes_CG44001-PB
D_suzukii_CG44001-PB
D_rhopaloa_CG44001-PB
D_elegans_CG44001-PB
;
end;
begin trees;
translate
1 D_melanogaster_CG44001-PB,
2 D_sechellia_CG44001-PB,
3 D_simulans_CG44001-PB,
4 D_yakuba_CG44001-PB,
5 D_erecta_CG44001-PB,
6 D_takahashii_CG44001-PB,
7 D_biarmipes_CG44001-PB,
8 D_suzukii_CG44001-PB,
9 D_rhopaloa_CG44001-PB,
10 D_elegans_CG44001-PB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.03622015,(2:0.01164349,3:0.004335757)0.998:0.01479104,((4:0.02784014,5:0.04511051)0.983:0.01891781,((6:0.08535791,(9:0.09259341,10:0.07704203)1.000:0.08254115)0.538:0.01613549,(7:0.07239059,8:0.05111748)1.000:0.03781102)1.000:0.09540013)0.686:0.01468159);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.03622015,(2:0.01164349,3:0.004335757):0.01479104,((4:0.02784014,5:0.04511051):0.01891781,((6:0.08535791,(9:0.09259341,10:0.07704203):0.08254115):0.01613549,(7:0.07239059,8:0.05111748):0.03781102):0.09540013):0.01468159);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1789.18 -1805.47
2 -1788.41 -1803.52
--------------------------------------
TOTAL -1788.72 -1804.90
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/155/CG44001-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.812780 0.009808 0.639946 1.022091 0.804760 1350.06 1425.53 1.000
r(A<->C){all} 0.067109 0.000438 0.032360 0.112124 0.065070 831.75 1002.00 1.000
r(A<->G){all} 0.269761 0.002011 0.177680 0.353763 0.267918 777.55 821.06 1.000
r(A<->T){all} 0.102813 0.000794 0.050458 0.156228 0.101164 951.19 983.27 1.001
r(C<->G){all} 0.068227 0.000316 0.034977 0.102103 0.067321 985.04 997.49 1.000
r(C<->T){all} 0.436030 0.002731 0.330122 0.535725 0.434439 772.03 783.20 1.000
r(G<->T){all} 0.056060 0.000375 0.022565 0.095763 0.053828 916.46 943.00 1.000
pi(A){all} 0.255027 0.000326 0.220620 0.291287 0.254799 990.87 1167.67 1.000
pi(C){all} 0.261784 0.000297 0.229700 0.296894 0.260927 1092.43 1151.76 1.000
pi(G){all} 0.292053 0.000339 0.258719 0.329390 0.291770 1055.40 1095.11 1.000
pi(T){all} 0.191136 0.000245 0.160613 0.221824 0.190695 1202.37 1239.43 1.000
alpha{1,2} 0.130919 0.001157 0.062071 0.202198 0.132481 1159.72 1195.31 1.001
alpha{3} 2.651678 0.821332 1.072129 4.397730 2.533001 1015.58 1234.94 1.000
pinvar{all} 0.249232 0.007738 0.073720 0.409747 0.257439 1147.58 1208.10 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/155/CG44001-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 10 ls = 181
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 4 4 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 2 2 2 | Cys TGT 1 1 1 2 1 1
TTC 1 1 1 2 1 2 | TCC 0 0 0 0 0 1 | TAC 1 1 1 2 2 2 | TGC 4 5 5 4 5 5
Leu TTA 1 1 1 1 1 0 | TCA 0 1 1 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 3 | TCG 1 0 0 1 1 0 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 1 | Pro CCT 0 0 0 0 0 0 | His CAT 3 3 3 3 3 3 | Arg CGT 2 2 2 2 2 3
CTC 1 1 1 2 2 3 | CCC 2 1 2 2 2 2 | CAC 5 5 5 5 5 5 | CGC 3 3 3 2 2 3
CTA 1 1 1 1 0 1 | CCA 2 1 1 1 1 1 | Gln CAA 0 0 0 0 0 2 | CGA 2 2 3 3 1 1
CTG 13 13 13 11 12 14 | CCG 1 3 2 2 2 2 | CAG 7 7 7 7 7 6 | CGG 1 1 0 1 3 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 2 2 2 2 1 | Thr ACT 0 2 2 2 2 0 | Asn AAT 5 5 5 5 4 5 | Ser AGT 1 1 1 1 2 1
ATC 5 6 6 5 5 6 | ACC 3 3 3 3 3 2 | AAC 4 4 4 4 4 4 | AGC 2 1 1 1 0 2
ATA 0 0 0 0 0 0 | ACA 1 0 0 0 0 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 1 0 0 0 0 0
Met ATG 7 7 7 7 7 7 | ACG 3 2 2 2 2 3 | AAG 14 14 14 14 14 14 | AGG 0 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 1 1 1 | Ala GCT 6 4 5 6 7 6 | Asp GAT 6 6 6 5 5 7 | Gly GGT 0 0 0 1 1 0
GTC 2 2 2 2 1 1 | GCC 4 4 4 4 3 6 | GAC 9 9 9 9 11 7 | GGC 5 6 6 4 4 7
GTA 1 2 1 1 2 1 | GCA 8 8 7 7 8 5 | Glu GAA 2 1 1 1 2 0 | GGA 2 2 2 2 1 2
GTG 6 5 6 5 5 6 | GCG 3 4 4 5 4 4 | GAG 10 11 11 11 10 11 | GGG 1 1 1 1 2 0
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 | Ser TCT 0 1 0 0 | Tyr TAT 2 3 3 3 | Cys TGT 0 1 1 2
TTC 2 2 2 2 | TCC 2 1 1 2 | TAC 2 1 1 1 | TGC 6 5 5 4
Leu TTA 0 0 0 0 | TCA 0 1 1 0 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 2 2 4 3 | TCG 0 0 1 0 | TAG 0 0 0 0 | Trp TGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Leu CTT 2 2 1 2 | Pro CCT 0 0 0 0 | His CAT 1 3 4 3 | Arg CGT 0 0 3 2
CTC 4 4 5 3 | CCC 3 3 1 2 | CAC 7 5 5 6 | CGC 5 4 1 2
CTA 1 2 3 3 | CCA 0 0 1 1 | Gln CAA 0 0 0 0 | CGA 0 0 1 1
CTG 12 11 9 10 | CCG 2 2 2 1 | CAG 9 8 9 9 | CGG 3 4 3 3
------------------------------------------------------------------------------------------------------
Ile ATT 2 3 3 4 | Thr ACT 1 1 0 0 | Asn AAT 6 5 5 6 | Ser AGT 0 0 1 1
ATC 5 4 4 4 | ACC 2 1 1 2 | AAC 3 4 7 6 | AGC 2 3 1 1
ATA 0 0 0 0 | ACA 2 1 1 0 | Lys AAA 2 2 4 3 | Arg AGA 0 0 0 0
Met ATG 6 6 7 7 | ACG 3 4 3 3 | AAG 14 15 11 12 | AGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Val GTT 0 0 1 1 | Ala GCT 6 8 6 5 | Asp GAT 5 8 5 7 | Gly GGT 0 0 0 0
GTC 3 2 1 0 | GCC 7 5 5 5 | GAC 8 7 9 7 | GGC 6 6 5 5
GTA 0 0 2 1 | GCA 6 4 9 5 | Glu GAA 4 5 5 5 | GGA 1 2 3 2
GTG 4 5 2 6 | GCG 2 3 1 5 | GAG 10 7 6 7 | GGG 1 0 1 1
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG44001-PB
position 1: T:0.09945 C:0.25414 A:0.28729 G:0.35912
position 2: T:0.27072 C:0.18785 A:0.39779 G:0.14365
position 3: T:0.19890 C:0.28177 A:0.13260 G:0.38674
Average T:0.18969 C:0.24125 A:0.27256 G:0.29650
#2: D_sechellia_CG44001-PB
position 1: T:0.10497 C:0.25414 A:0.28177 G:0.35912
position 2: T:0.27072 C:0.18232 A:0.39779 G:0.14917
position 3: T:0.19337 C:0.28729 A:0.12155 G:0.39779
Average T:0.18969 C:0.24125 A:0.26703 G:0.30203
#3: D_simulans_CG44001-PB
position 1: T:0.10497 C:0.25414 A:0.28177 G:0.35912
position 2: T:0.27072 C:0.18232 A:0.39779 G:0.14917
position 3: T:0.19890 C:0.29282 A:0.11602 G:0.39227
Average T:0.19153 C:0.24309 A:0.26519 G:0.30018
#4: D_yakuba_CG44001-PB
position 1: T:0.11602 C:0.24862 A:0.27624 G:0.35912
position 2: T:0.27072 C:0.19337 A:0.39227 G:0.14365
position 3: T:0.21547 C:0.28177 A:0.11050 G:0.39227
Average T:0.20074 C:0.24125 A:0.25967 G:0.29834
#5: D_erecta_CG44001-PB
position 1: T:0.11050 C:0.24862 A:0.27072 G:0.37017
position 2: T:0.26519 C:0.19337 A:0.39779 G:0.14365
position 3: T:0.21547 C:0.27624 A:0.10497 G:0.40331
Average T:0.19705 C:0.23941 A:0.25783 G:0.30571
#6: D_takahashii_CG44001-PB
position 1: T:0.10497 C:0.26519 A:0.27624 G:0.35359
position 2: T:0.27072 C:0.18232 A:0.39227 G:0.15470
position 3: T:0.18232 C:0.32044 A:0.09392 G:0.40331
Average T:0.18600 C:0.25599 A:0.25414 G:0.30387
#7: D_biarmipes_CG44001-PB
position 1: T:0.11050 C:0.27072 A:0.27072 G:0.34807
position 2: T:0.25414 C:0.19890 A:0.40331 G:0.14365
position 3: T:0.15470 C:0.37017 A:0.08840 G:0.38674
Average T:0.17311 C:0.27993 A:0.25414 G:0.29282
#8: D_suzukii_CG44001-PB
position 1: T:0.11602 C:0.26519 A:0.27624 G:0.34254
position 2: T:0.25414 C:0.19337 A:0.40331 G:0.14917
position 3: T:0.20994 C:0.31492 A:0.09392 G:0.38122
Average T:0.19337 C:0.25783 A:0.25783 G:0.29098
#9: D_rhopaloa_CG44001-PB
position 1: T:0.12707 C:0.26519 A:0.27072 G:0.33702
position 2: T:0.25967 C:0.18232 A:0.40884 G:0.14917
position 3: T:0.19890 C:0.29834 A:0.16575 G:0.33702
Average T:0.19521 C:0.24862 A:0.28177 G:0.27440
#10: D_elegans_CG44001-PB
position 1: T:0.11602 C:0.26519 A:0.27624 G:0.34254
position 2: T:0.27072 C:0.17127 A:0.41436 G:0.14365
position 3: T:0.21547 C:0.28729 A:0.11602 G:0.38122
Average T:0.20074 C:0.24125 A:0.26888 G:0.28913
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 31 | Ser S TCT 1 | Tyr Y TAT 26 | Cys C TGT 11
TTC 16 | TCC 7 | TAC 14 | TGC 48
Leu L TTA 5 | TCA 4 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 4 | TAG 0 | Trp W TGG 10
------------------------------------------------------------------------------
Leu L CTT 23 | Pro P CCT 0 | His H CAT 29 | Arg R CGT 18
CTC 26 | CCC 20 | CAC 53 | CGC 28
CTA 14 | CCA 9 | Gln Q CAA 2 | CGA 14
CTG 118 | CCG 19 | CAG 76 | CGG 20
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 10 | Asn N AAT 51 | Ser S AGT 9
ATC 50 | ACC 23 | AAC 44 | AGC 14
ATA 0 | ACA 6 | Lys K AAA 29 | Arg R AGA 1
Met M ATG 68 | ACG 27 | AAG 136 | AGG 9
------------------------------------------------------------------------------
Val V GTT 5 | Ala A GCT 59 | Asp D GAT 60 | Gly G GGT 2
GTC 16 | GCC 47 | GAC 85 | GGC 54
GTA 11 | GCA 67 | Glu E GAA 26 | GGA 19
GTG 50 | GCG 35 | GAG 94 | GGG 9
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11105 C:0.25912 A:0.27680 G:0.35304
position 2: T:0.26575 C:0.18674 A:0.40055 G:0.14696
position 3: T:0.19834 C:0.30110 A:0.11436 G:0.38619
Average T:0.19171 C:0.24899 A:0.26390 G:0.29540
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG44001-PB
D_sechellia_CG44001-PB 0.0541 (0.0072 0.1327)
D_simulans_CG44001-PB 0.0633 (0.0072 0.1136)-1.0000 (0.0000 0.0331)
D_yakuba_CG44001-PB 0.0744 (0.0144 0.1938) 0.1180 (0.0169 0.1428) 0.1614 (0.0169 0.1045)
D_erecta_CG44001-PB 0.0557 (0.0120 0.2154) 0.0705 (0.0144 0.2045) 0.0786 (0.0144 0.1834) 0.0439 (0.0072 0.1635)
D_takahashii_CG44001-PB 0.0815 (0.0329 0.4036) 0.0808 (0.0304 0.3762) 0.0838 (0.0304 0.3628) 0.0749 (0.0341 0.4555) 0.0650 (0.0316 0.4866)
D_biarmipes_CG44001-PB 0.0601 (0.0291 0.4852) 0.0696 (0.0316 0.4546) 0.0744 (0.0316 0.4252) 0.0564 (0.0279 0.4947) 0.0467 (0.0266 0.5699) 0.0609 (0.0242 0.3972)
D_suzukii_CG44001-PB 0.0742 (0.0316 0.4262) 0.0828 (0.0341 0.4118) 0.0888 (0.0341 0.3840) 0.0722 (0.0303 0.4205) 0.0636 (0.0291 0.4576) 0.0746 (0.0267 0.3575) 0.0442 (0.0120 0.2715)
D_rhopaloa_CG44001-PB 0.0812 (0.0457 0.5627) 0.0885 (0.0483 0.5453) 0.0885 (0.0483 0.5450) 0.0698 (0.0415 0.5945) 0.0581 (0.0432 0.7421) 0.0707 (0.0353 0.4987) 0.0574 (0.0340 0.5930) 0.0730 (0.0377 0.5166)
D_elegans_CG44001-PB 0.0557 (0.0402 0.7229) 0.0628 (0.0427 0.6807) 0.0667 (0.0427 0.6408) 0.0580 (0.0415 0.7152) 0.0503 (0.0377 0.7492) 0.0550 (0.0303 0.5502) 0.0689 (0.0340 0.4936) 0.0871 (0.0365 0.4188) 0.0351 (0.0143 0.4087)
Model 0: one-ratio
TREE # 1: (1, (2, 3), ((4, 5), ((6, (9, 10)), (7, 8)))); MP score: 193
lnL(ntime: 17 np: 19): -1675.583797 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..5 13..15 15..16 16..6 16..17 17..9 17..10 15..18 18..7 18..8
0.064087 0.025760 0.018012 0.004970 0.026811 0.022146 0.049667 0.078356 0.160312 0.024879 0.151787 0.132372 0.135530 0.145398 0.060129 0.132802 0.084159 2.167183 0.054609
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.31718
(1: 0.064087, (2: 0.018012, 3: 0.004970): 0.025760, ((4: 0.049667, 5: 0.078356): 0.022146, ((6: 0.151787, (9: 0.135530, 10: 0.145398): 0.132372): 0.024879, (7: 0.132802, 8: 0.084159): 0.060129): 0.160312): 0.026811);
(D_melanogaster_CG44001-PB: 0.064087, (D_sechellia_CG44001-PB: 0.018012, D_simulans_CG44001-PB: 0.004970): 0.025760, ((D_yakuba_CG44001-PB: 0.049667, D_erecta_CG44001-PB: 0.078356): 0.022146, ((D_takahashii_CG44001-PB: 0.151787, (D_rhopaloa_CG44001-PB: 0.135530, D_elegans_CG44001-PB: 0.145398): 0.132372): 0.024879, (D_biarmipes_CG44001-PB: 0.132802, D_suzukii_CG44001-PB: 0.084159): 0.060129): 0.160312): 0.026811);
Detailed output identifying parameters
kappa (ts/tv) = 2.16718
omega (dN/dS) = 0.05461
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.064 423.0 120.0 0.0546 0.0044 0.0811 1.9 9.7
11..12 0.026 423.0 120.0 0.0546 0.0018 0.0326 0.8 3.9
12..2 0.018 423.0 120.0 0.0546 0.0012 0.0228 0.5 2.7
12..3 0.005 423.0 120.0 0.0546 0.0003 0.0063 0.1 0.8
11..13 0.027 423.0 120.0 0.0546 0.0019 0.0339 0.8 4.1
13..14 0.022 423.0 120.0 0.0546 0.0015 0.0280 0.6 3.4
14..4 0.050 423.0 120.0 0.0546 0.0034 0.0628 1.5 7.5
14..5 0.078 423.0 120.0 0.0546 0.0054 0.0991 2.3 11.9
13..15 0.160 423.0 120.0 0.0546 0.0111 0.2028 4.7 24.3
15..16 0.025 423.0 120.0 0.0546 0.0017 0.0315 0.7 3.8
16..6 0.152 423.0 120.0 0.0546 0.0105 0.1920 4.4 23.0
16..17 0.132 423.0 120.0 0.0546 0.0091 0.1674 3.9 20.1
17..9 0.136 423.0 120.0 0.0546 0.0094 0.1714 4.0 20.6
17..10 0.145 423.0 120.0 0.0546 0.0100 0.1839 4.2 22.1
15..18 0.060 423.0 120.0 0.0546 0.0042 0.0760 1.8 9.1
18..7 0.133 423.0 120.0 0.0546 0.0092 0.1680 3.9 20.2
18..8 0.084 423.0 120.0 0.0546 0.0058 0.1064 2.5 12.8
tree length for dN: 0.0910
tree length for dS: 1.6659
Time used: 0:14
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), ((4, 5), ((6, (9, 10)), (7, 8)))); MP score: 193
lnL(ntime: 17 np: 20): -1670.849490 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..5 13..15 15..16 16..6 16..17 17..9 17..10 15..18 18..7 18..8
0.065187 0.026135 0.018245 0.005063 0.027208 0.022820 0.050767 0.079895 0.163638 0.025567 0.153788 0.135675 0.139875 0.146823 0.061500 0.135273 0.086004 2.184230 0.975949 0.042494
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.34346
(1: 0.065187, (2: 0.018245, 3: 0.005063): 0.026135, ((4: 0.050767, 5: 0.079895): 0.022820, ((6: 0.153788, (9: 0.139875, 10: 0.146823): 0.135675): 0.025567, (7: 0.135273, 8: 0.086004): 0.061500): 0.163638): 0.027208);
(D_melanogaster_CG44001-PB: 0.065187, (D_sechellia_CG44001-PB: 0.018245, D_simulans_CG44001-PB: 0.005063): 0.026135, ((D_yakuba_CG44001-PB: 0.050767, D_erecta_CG44001-PB: 0.079895): 0.022820, ((D_takahashii_CG44001-PB: 0.153788, (D_rhopaloa_CG44001-PB: 0.139875, D_elegans_CG44001-PB: 0.146823): 0.135675): 0.025567, (D_biarmipes_CG44001-PB: 0.135273, D_suzukii_CG44001-PB: 0.086004): 0.061500): 0.163638): 0.027208);
Detailed output identifying parameters
kappa (ts/tv) = 2.18423
dN/dS (w) for site classes (K=2)
p: 0.97595 0.02405
w: 0.04249 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.065 422.8 120.2 0.0655 0.0052 0.0798 2.2 9.6
11..12 0.026 422.8 120.2 0.0655 0.0021 0.0320 0.9 3.8
12..2 0.018 422.8 120.2 0.0655 0.0015 0.0223 0.6 2.7
12..3 0.005 422.8 120.2 0.0655 0.0004 0.0062 0.2 0.7
11..13 0.027 422.8 120.2 0.0655 0.0022 0.0333 0.9 4.0
13..14 0.023 422.8 120.2 0.0655 0.0018 0.0279 0.8 3.4
14..4 0.051 422.8 120.2 0.0655 0.0041 0.0621 1.7 7.5
14..5 0.080 422.8 120.2 0.0655 0.0064 0.0978 2.7 11.8
13..15 0.164 422.8 120.2 0.0655 0.0131 0.2002 5.5 24.1
15..16 0.026 422.8 120.2 0.0655 0.0020 0.0313 0.9 3.8
16..6 0.154 422.8 120.2 0.0655 0.0123 0.1882 5.2 22.6
16..17 0.136 422.8 120.2 0.0655 0.0109 0.1660 4.6 20.0
17..9 0.140 422.8 120.2 0.0655 0.0112 0.1712 4.7 20.6
17..10 0.147 422.8 120.2 0.0655 0.0118 0.1797 5.0 21.6
15..18 0.062 422.8 120.2 0.0655 0.0049 0.0753 2.1 9.0
18..7 0.135 422.8 120.2 0.0655 0.0108 0.1655 4.6 19.9
18..8 0.086 422.8 120.2 0.0655 0.0069 0.1052 2.9 12.7
Time used: 0:29
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), ((4, 5), ((6, (9, 10)), (7, 8)))); MP score: 193
lnL(ntime: 17 np: 22): -1670.849490 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..5 13..15 15..16 16..6 16..17 17..9 17..10 15..18 18..7 18..8
0.065187 0.026135 0.018245 0.005063 0.027208 0.022820 0.050767 0.079895 0.163638 0.025567 0.153788 0.135675 0.139875 0.146823 0.061500 0.135273 0.086004 2.184229 0.975949 0.021564 0.042494 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.34346
(1: 0.065187, (2: 0.018245, 3: 0.005063): 0.026135, ((4: 0.050767, 5: 0.079895): 0.022820, ((6: 0.153788, (9: 0.139875, 10: 0.146823): 0.135675): 0.025567, (7: 0.135273, 8: 0.086004): 0.061500): 0.163638): 0.027208);
(D_melanogaster_CG44001-PB: 0.065187, (D_sechellia_CG44001-PB: 0.018245, D_simulans_CG44001-PB: 0.005063): 0.026135, ((D_yakuba_CG44001-PB: 0.050767, D_erecta_CG44001-PB: 0.079895): 0.022820, ((D_takahashii_CG44001-PB: 0.153788, (D_rhopaloa_CG44001-PB: 0.139875, D_elegans_CG44001-PB: 0.146823): 0.135675): 0.025567, (D_biarmipes_CG44001-PB: 0.135273, D_suzukii_CG44001-PB: 0.086004): 0.061500): 0.163638): 0.027208);
Detailed output identifying parameters
kappa (ts/tv) = 2.18423
dN/dS (w) for site classes (K=3)
p: 0.97595 0.02156 0.00249
w: 0.04249 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.065 422.8 120.2 0.0655 0.0052 0.0798 2.2 9.6
11..12 0.026 422.8 120.2 0.0655 0.0021 0.0320 0.9 3.8
12..2 0.018 422.8 120.2 0.0655 0.0015 0.0223 0.6 2.7
12..3 0.005 422.8 120.2 0.0655 0.0004 0.0062 0.2 0.7
11..13 0.027 422.8 120.2 0.0655 0.0022 0.0333 0.9 4.0
13..14 0.023 422.8 120.2 0.0655 0.0018 0.0279 0.8 3.4
14..4 0.051 422.8 120.2 0.0655 0.0041 0.0621 1.7 7.5
14..5 0.080 422.8 120.2 0.0655 0.0064 0.0978 2.7 11.8
13..15 0.164 422.8 120.2 0.0655 0.0131 0.2002 5.5 24.1
15..16 0.026 422.8 120.2 0.0655 0.0020 0.0313 0.9 3.8
16..6 0.154 422.8 120.2 0.0655 0.0123 0.1882 5.2 22.6
16..17 0.136 422.8 120.2 0.0655 0.0109 0.1660 4.6 20.0
17..9 0.140 422.8 120.2 0.0655 0.0112 0.1712 4.7 20.6
17..10 0.147 422.8 120.2 0.0655 0.0118 0.1797 5.0 21.6
15..18 0.062 422.8 120.2 0.0655 0.0049 0.0753 2.1 9.0
18..7 0.135 422.8 120.2 0.0655 0.0108 0.1655 4.6 19.9
18..8 0.086 422.8 120.2 0.0655 0.0069 0.1052 2.9 12.7
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG44001-PB)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.564 0.131 0.060 0.043 0.037 0.034 0.033 0.033 0.033 0.033
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 1:07
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), ((4, 5), ((6, (9, 10)), (7, 8)))); MP score: 193
lnL(ntime: 17 np: 23): -1669.173666 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..5 13..15 15..16 16..6 16..17 17..9 17..10 15..18 18..7 18..8
0.065009 0.026165 0.018246 0.005048 0.027085 0.022705 0.050581 0.079579 0.163241 0.025327 0.153878 0.135306 0.139031 0.146871 0.061342 0.135364 0.085904 2.151837 0.594770 0.387787 0.000001 0.120613 0.795897
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.34068
(1: 0.065009, (2: 0.018246, 3: 0.005048): 0.026165, ((4: 0.050581, 5: 0.079579): 0.022705, ((6: 0.153878, (9: 0.139031, 10: 0.146871): 0.135306): 0.025327, (7: 0.135364, 8: 0.085904): 0.061342): 0.163241): 0.027085);
(D_melanogaster_CG44001-PB: 0.065009, (D_sechellia_CG44001-PB: 0.018246, D_simulans_CG44001-PB: 0.005048): 0.026165, ((D_yakuba_CG44001-PB: 0.050581, D_erecta_CG44001-PB: 0.079579): 0.022705, ((D_takahashii_CG44001-PB: 0.153878, (D_rhopaloa_CG44001-PB: 0.139031, D_elegans_CG44001-PB: 0.146871): 0.135306): 0.025327, (D_biarmipes_CG44001-PB: 0.135364, D_suzukii_CG44001-PB: 0.085904): 0.061342): 0.163241): 0.027085);
Detailed output identifying parameters
kappa (ts/tv) = 2.15184
dN/dS (w) for site classes (K=3)
p: 0.59477 0.38779 0.01744
w: 0.00000 0.12061 0.79590
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.065 423.2 119.8 0.0607 0.0049 0.0809 2.1 9.7
11..12 0.026 423.2 119.8 0.0607 0.0020 0.0325 0.8 3.9
12..2 0.018 423.2 119.8 0.0607 0.0014 0.0227 0.6 2.7
12..3 0.005 423.2 119.8 0.0607 0.0004 0.0063 0.2 0.8
11..13 0.027 423.2 119.8 0.0607 0.0020 0.0337 0.9 4.0
13..14 0.023 423.2 119.8 0.0607 0.0017 0.0282 0.7 3.4
14..4 0.051 423.2 119.8 0.0607 0.0038 0.0629 1.6 7.5
14..5 0.080 423.2 119.8 0.0607 0.0060 0.0990 2.5 11.9
13..15 0.163 423.2 119.8 0.0607 0.0123 0.2031 5.2 24.3
15..16 0.025 423.2 119.8 0.0607 0.0019 0.0315 0.8 3.8
16..6 0.154 423.2 119.8 0.0607 0.0116 0.1914 4.9 22.9
16..17 0.135 423.2 119.8 0.0607 0.0102 0.1683 4.3 20.2
17..9 0.139 423.2 119.8 0.0607 0.0105 0.1729 4.4 20.7
17..10 0.147 423.2 119.8 0.0607 0.0111 0.1827 4.7 21.9
15..18 0.061 423.2 119.8 0.0607 0.0046 0.0763 2.0 9.1
18..7 0.135 423.2 119.8 0.0607 0.0102 0.1684 4.3 20.2
18..8 0.086 423.2 119.8 0.0607 0.0065 0.1069 2.7 12.8
Naive Empirical Bayes (NEB) analysis
Time used: 1:57
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), ((4, 5), ((6, (9, 10)), (7, 8)))); MP score: 193
lnL(ntime: 17 np: 20): -1669.483312 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..5 13..15 15..16 16..6 16..17 17..9 17..10 15..18 18..7 18..8
0.064940 0.026106 0.018228 0.005042 0.027058 0.022591 0.050434 0.079355 0.163141 0.025349 0.153753 0.134561 0.138213 0.147122 0.061111 0.135327 0.085855 2.160846 0.234377 3.410069
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.33819
(1: 0.064940, (2: 0.018228, 3: 0.005042): 0.026106, ((4: 0.050434, 5: 0.079355): 0.022591, ((6: 0.153753, (9: 0.138213, 10: 0.147122): 0.134561): 0.025349, (7: 0.135327, 8: 0.085855): 0.061111): 0.163141): 0.027058);
(D_melanogaster_CG44001-PB: 0.064940, (D_sechellia_CG44001-PB: 0.018228, D_simulans_CG44001-PB: 0.005042): 0.026106, ((D_yakuba_CG44001-PB: 0.050434, D_erecta_CG44001-PB: 0.079355): 0.022591, ((D_takahashii_CG44001-PB: 0.153753, (D_rhopaloa_CG44001-PB: 0.138213, D_elegans_CG44001-PB: 0.147122): 0.134561): 0.025349, (D_biarmipes_CG44001-PB: 0.135327, D_suzukii_CG44001-PB: 0.085855): 0.061111): 0.163141): 0.027058);
Detailed output identifying parameters
kappa (ts/tv) = 2.16085
Parameters in M7 (beta):
p = 0.23438 q = 3.41007
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00007 0.00059 0.00250 0.00739 0.01775 0.03761 0.07431 0.14467 0.31533
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.065 423.1 119.9 0.0600 0.0049 0.0809 2.1 9.7
11..12 0.026 423.1 119.9 0.0600 0.0020 0.0325 0.8 3.9
12..2 0.018 423.1 119.9 0.0600 0.0014 0.0227 0.6 2.7
12..3 0.005 423.1 119.9 0.0600 0.0004 0.0063 0.2 0.8
11..13 0.027 423.1 119.9 0.0600 0.0020 0.0337 0.9 4.0
13..14 0.023 423.1 119.9 0.0600 0.0017 0.0281 0.7 3.4
14..4 0.050 423.1 119.9 0.0600 0.0038 0.0628 1.6 7.5
14..5 0.079 423.1 119.9 0.0600 0.0059 0.0988 2.5 11.9
13..15 0.163 423.1 119.9 0.0600 0.0122 0.2032 5.2 24.4
15..16 0.025 423.1 119.9 0.0600 0.0019 0.0316 0.8 3.8
16..6 0.154 423.1 119.9 0.0600 0.0115 0.1915 4.9 23.0
16..17 0.135 423.1 119.9 0.0600 0.0101 0.1676 4.3 20.1
17..9 0.138 423.1 119.9 0.0600 0.0103 0.1721 4.4 20.6
17..10 0.147 423.1 119.9 0.0600 0.0110 0.1832 4.7 22.0
15..18 0.061 423.1 119.9 0.0600 0.0046 0.0761 1.9 9.1
18..7 0.135 423.1 119.9 0.0600 0.0101 0.1685 4.3 20.2
18..8 0.086 423.1 119.9 0.0600 0.0064 0.1069 2.7 12.8
Time used: 3:19
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), ((4, 5), ((6, (9, 10)), (7, 8)))); MP score: 193
lnL(ntime: 17 np: 22): -1669.329818 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..5 13..15 15..16 16..6 16..17 17..9 17..10 15..18 18..7 18..8
0.065029 0.026135 0.018242 0.005050 0.027109 0.022711 0.050583 0.079594 0.163234 0.025375 0.153879 0.135283 0.139104 0.146833 0.061334 0.135375 0.085937 2.158164 0.989724 0.331259 5.705572 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.34081
(1: 0.065029, (2: 0.018242, 3: 0.005050): 0.026135, ((4: 0.050583, 5: 0.079594): 0.022711, ((6: 0.153879, (9: 0.139104, 10: 0.146833): 0.135283): 0.025375, (7: 0.135375, 8: 0.085937): 0.061334): 0.163234): 0.027109);
(D_melanogaster_CG44001-PB: 0.065029, (D_sechellia_CG44001-PB: 0.018242, D_simulans_CG44001-PB: 0.005050): 0.026135, ((D_yakuba_CG44001-PB: 0.050583, D_erecta_CG44001-PB: 0.079594): 0.022711, ((D_takahashii_CG44001-PB: 0.153879, (D_rhopaloa_CG44001-PB: 0.139104, D_elegans_CG44001-PB: 0.146833): 0.135283): 0.025375, (D_biarmipes_CG44001-PB: 0.135375, D_suzukii_CG44001-PB: 0.085937): 0.061334): 0.163234): 0.027109);
Detailed output identifying parameters
kappa (ts/tv) = 2.15816
Parameters in M8 (beta&w>1):
p0 = 0.98972 p = 0.33126 q = 5.70557
(p1 = 0.01028) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.09897 0.09897 0.09897 0.09897 0.09897 0.09897 0.09897 0.09897 0.09897 0.09897 0.01028
w: 0.00002 0.00043 0.00203 0.00567 0.01240 0.02363 0.04161 0.07062 0.12116 0.23846 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.065 423.1 119.9 0.0613 0.0050 0.0807 2.1 9.7
11..12 0.026 423.1 119.9 0.0613 0.0020 0.0324 0.8 3.9
12..2 0.018 423.1 119.9 0.0613 0.0014 0.0226 0.6 2.7
12..3 0.005 423.1 119.9 0.0613 0.0004 0.0063 0.2 0.8
11..13 0.027 423.1 119.9 0.0613 0.0021 0.0336 0.9 4.0
13..14 0.023 423.1 119.9 0.0613 0.0017 0.0282 0.7 3.4
14..4 0.051 423.1 119.9 0.0613 0.0039 0.0628 1.6 7.5
14..5 0.080 423.1 119.9 0.0613 0.0061 0.0988 2.6 11.8
13..15 0.163 423.1 119.9 0.0613 0.0124 0.2026 5.3 24.3
15..16 0.025 423.1 119.9 0.0613 0.0019 0.0315 0.8 3.8
16..6 0.154 423.1 119.9 0.0613 0.0117 0.1909 5.0 22.9
16..17 0.135 423.1 119.9 0.0613 0.0103 0.1679 4.4 20.1
17..9 0.139 423.1 119.9 0.0613 0.0106 0.1726 4.5 20.7
17..10 0.147 423.1 119.9 0.0613 0.0112 0.1822 4.7 21.8
15..18 0.061 423.1 119.9 0.0613 0.0047 0.0761 2.0 9.1
18..7 0.135 423.1 119.9 0.0613 0.0103 0.1680 4.4 20.1
18..8 0.086 423.1 119.9 0.0613 0.0065 0.1066 2.8 12.8
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG44001-PB)
Pr(w>1) post mean +- SE for w
113 V 0.585 1.250 +- 0.759
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.001 0.007 0.036 0.116 0.282 0.558
ws: 0.690 0.121 0.044 0.027 0.022 0.020 0.019 0.019 0.019 0.018
Time used: 5:43
Model 1: NearlyNeutral -1670.84949 Model 2: PositiveSelection -1670.84949 Model 0: one-ratio -1675.583797 Model 3: discrete -1669.173666 Model 7: beta -1669.483312 Model 8: beta&w>1 -1669.329818 Model 0 vs 1 9.468613999999889 Model 2 vs 1 0.0 Model 8 vs 7 0.30698800000027404
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
