--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:12:14 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/2res/ffh/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/2res/ffh/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ffh/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/ffh/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2119.36 -2122.22 2 -2119.29 -2124.67 -------------------------------------- TOTAL -2119.33 -2124.06 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/ffh/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ffh/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/ffh/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.889545 0.091103 0.378947 1.507999 0.857637 1008.10 1127.99 1.000 r(A<->C){all} 0.158733 0.019238 0.000116 0.445234 0.121430 139.85 147.88 1.000 r(A<->G){all} 0.172513 0.021404 0.000010 0.466319 0.133081 118.17 125.12 1.006 r(A<->T){all} 0.177858 0.020356 0.000045 0.450475 0.141604 295.39 369.36 1.006 r(C<->G){all} 0.157035 0.018934 0.000007 0.447583 0.119883 196.06 200.26 1.007 r(C<->T){all} 0.165428 0.019458 0.000096 0.449790 0.128841 109.51 126.82 1.005 r(G<->T){all} 0.168434 0.020872 0.000033 0.456761 0.127792 244.75 269.02 1.000 pi(A){all} 0.194624 0.000101 0.174468 0.213388 0.194449 1335.07 1335.22 1.000 pi(C){all} 0.296953 0.000137 0.275008 0.320609 0.297054 1229.52 1264.46 1.000 pi(G){all} 0.325703 0.000142 0.302595 0.348003 0.326092 1087.74 1192.50 1.000 pi(T){all} 0.182721 0.000097 0.164705 0.202743 0.182846 1030.84 1084.95 1.000 alpha{1,2} 0.421251 0.240673 0.000138 1.419029 0.243489 1101.82 1166.73 1.000 alpha{3} 0.446916 0.229821 0.000224 1.417754 0.282898 1106.11 1159.95 1.002 pinvar{all} 0.999041 0.000001 0.996857 0.999999 0.999395 1248.64 1278.79 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2034.009801 Model 2: PositiveSelection -2034.009801 Model 0: one-ratio -2034.009802 Model 7: beta -2034.009863 Model 8: beta&w>1 -2034.010518 Model 0 vs 1 2.000000222324161E-6 Model 2 vs 1 0.0 Model 8 vs 7 0.001310000000103173
>C1 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL NELPPGLAAFDLSKLKFPGKT >C2 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL NELPPGLAAFDLSKLKFPGKT >C3 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL NELPPGLAAFDLSKLKFPGKT >C4 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL NELPPGLAAFDLSKLKFPGKT >C5 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL NELPPGLAAFDLSKLKFPGKT >C6 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL NELPPGLAAFDLSKLKFPGKT CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=521 C1 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA C2 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA C3 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA C4 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA C5 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA C6 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA ************************************************** C1 FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP C2 FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP C3 FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP C4 FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP C5 FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP C6 FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP ************************************************** C1 TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV C2 TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV C3 TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV C4 TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV C5 TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV C6 TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV ************************************************** C1 GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR C2 GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR C3 GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR C4 GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR C5 GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR C6 GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR ************************************************** C1 LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG C2 LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG C3 LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG C4 LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG C5 LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG C6 LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG ************************************************** C1 VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI C2 VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI C3 VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI C4 VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI C5 VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI C6 VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI ************************************************** C1 LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG C2 LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG C3 LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG C4 LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG C5 LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG C6 LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG ************************************************** C1 LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA C2 LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA C3 LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA C4 LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA C5 LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA C6 LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA ************************************************** C1 SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR C2 SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR C3 SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR C4 SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR C5 SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR C6 SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR ************************************************** C1 KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL C2 KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL C3 KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL C4 KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL C5 KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL C6 KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL ************************************************** C1 NELPPGLAAFDLSKLKFPGKT C2 NELPPGLAAFDLSKLKFPGKT C3 NELPPGLAAFDLSKLKFPGKT C4 NELPPGLAAFDLSKLKFPGKT C5 NELPPGLAAFDLSKLKFPGKT C6 NELPPGLAAFDLSKLKFPGKT ********************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15630] Library Relaxation: Multi_proc [96] Relaxation Summary: [15630]--->[15630] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.545 Mb, Max= 31.104 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA C2 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA C3 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA C4 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA C5 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA C6 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA ************************************************** C1 FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP C2 FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP C3 FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP C4 FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP C5 FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP C6 FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP ************************************************** C1 TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV C2 TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV C3 TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV C4 TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV C5 TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV C6 TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV ************************************************** C1 GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR C2 GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR C3 GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR C4 GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR C5 GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR C6 GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR ************************************************** C1 LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG C2 LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG C3 LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG C4 LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG C5 LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG C6 LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG ************************************************** C1 VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI C2 VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI C3 VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI C4 VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI C5 VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI C6 VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI ************************************************** C1 LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG C2 LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG C3 LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG C4 LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG C5 LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG C6 LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG ************************************************** C1 LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA C2 LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA C3 LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA C4 LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA C5 LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA C6 LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA ************************************************** C1 SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR C2 SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR C3 SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR C4 SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR C5 SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR C6 SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR ************************************************** C1 KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL C2 KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL C3 KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL C4 KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL C5 KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL C6 KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL ************************************************** C1 NELPPGLAAFDLSKLKFPGKT C2 NELPPGLAAFDLSKLKFPGKT C3 NELPPGLAAFDLSKLKFPGKT C4 NELPPGLAAFDLSKLKFPGKT C5 NELPPGLAAFDLSKLKFPGKT C6 NELPPGLAAFDLSKLKFPGKT ********************* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGTTTGAATCGCTCTCTAACCGGTTGACTGGCGTCATACAGGGGTTGCG C2 GTGTTTGAATCGCTCTCTAACCGGTTGACTGGCGTCATACAGGGGTTGCG C3 GTGTTTGAATCGCTCTCTAACCGGTTGACTGGCGTCATACAGGGGTTGCG C4 GTGTTTGAATCGCTCTCTAACCGGTTGACTGGCGTCATACAGGGGTTGCG C5 GTGTTTGAATCGCTCTCTAACCGGTTGACTGGCGTCATACAGGGGTTGCG C6 GTGTTTGAATCGCTCTCTAACCGGTTGACTGGCGTCATACAGGGGTTGCG ************************************************** C1 TGGCAAAGGCCGGCTGACCGACGCCGATATCGAGGCCACCACCCGCGAAA C2 TGGCAAAGGCCGGCTGACCGACGCCGATATCGAGGCCACCACCCGCGAAA C3 TGGCAAAGGCCGGCTGACCGACGCCGATATCGAGGCCACCACCCGCGAAA C4 TGGCAAAGGCCGGCTGACCGACGCCGATATCGAGGCCACCACCCGCGAAA C5 TGGCAAAGGCCGGCTGACCGACGCCGATATCGAGGCCACCACCCGCGAAA C6 TGGCAAAGGCCGGCTGACCGACGCCGATATCGAGGCCACCACCCGCGAAA ************************************************** C1 TCCGGTTGGCGCTGTTTGAAGCCGACGTTTCACTACCTGTGGTGCGGGCG C2 TCCGGTTGGCGCTGTTTGAAGCCGACGTTTCACTACCTGTGGTGCGGGCG C3 TCCGGTTGGCGCTGTTTGAAGCCGACGTTTCACTACCTGTGGTGCGGGCG C4 TCCGGTTGGCGCTGTTTGAAGCCGACGTTTCACTACCTGTGGTGCGGGCG C5 TCCGGTTGGCGCTGTTTGAAGCCGACGTTTCACTACCTGTGGTGCGGGCG C6 TCCGGTTGGCGCTGTTTGAAGCCGACGTTTCACTACCTGTGGTGCGGGCG ************************************************** C1 TTTGTGCATCGGATCAAAGAACGCGCTCGGGGCACCGAAGTGTCTGCTGC C2 TTTGTGCATCGGATCAAAGAACGCGCTCGGGGCACCGAAGTGTCTGCTGC C3 TTTGTGCATCGGATCAAAGAACGCGCTCGGGGCACCGAAGTGTCTGCTGC C4 TTTGTGCATCGGATCAAAGAACGCGCTCGGGGCACCGAAGTGTCTGCTGC C5 TTTGTGCATCGGATCAAAGAACGCGCTCGGGGCACCGAAGTGTCTGCTGC C6 TTTGTGCATCGGATCAAAGAACGCGCTCGGGGCACCGAAGTGTCTGCTGC ************************************************** C1 TCTCAACCCGGCGCAACAGATTGTCAAGATCGTCAACGAAGAACTGATCG C2 TCTCAACCCGGCGCAACAGATTGTCAAGATCGTCAACGAAGAACTGATCG C3 TCTCAACCCGGCGCAACAGATTGTCAAGATCGTCAACGAAGAACTGATCG C4 TCTCAACCCGGCGCAACAGATTGTCAAGATCGTCAACGAAGAACTGATCG C5 TCTCAACCCGGCGCAACAGATTGTCAAGATCGTCAACGAAGAACTGATCG C6 TCTCAACCCGGCGCAACAGATTGTCAAGATCGTCAACGAAGAACTGATCG ************************************************** C1 GCATCCTCGGTGGCGAGACCCGCCAGCTGGCGTTCGCTAAGACACCGCCG C2 GCATCCTCGGTGGCGAGACCCGCCAGCTGGCGTTCGCTAAGACACCGCCG C3 GCATCCTCGGTGGCGAGACCCGCCAGCTGGCGTTCGCTAAGACACCGCCG C4 GCATCCTCGGTGGCGAGACCCGCCAGCTGGCGTTCGCTAAGACACCGCCG C5 GCATCCTCGGTGGCGAGACCCGCCAGCTGGCGTTCGCTAAGACACCGCCG C6 GCATCCTCGGTGGCGAGACCCGCCAGCTGGCGTTCGCTAAGACACCGCCG ************************************************** C1 ACGGTAGTGATGCTGGCCGGCCTGCAGGGATCCGGCAAGACAACGCTGGC C2 ACGGTAGTGATGCTGGCCGGCCTGCAGGGATCCGGCAAGACAACGCTGGC C3 ACGGTAGTGATGCTGGCCGGCCTGCAGGGATCCGGCAAGACAACGCTGGC C4 ACGGTAGTGATGCTGGCCGGCCTGCAGGGATCCGGCAAGACAACGCTGGC C5 ACGGTAGTGATGCTGGCCGGCCTGCAGGGATCCGGCAAGACAACGCTGGC C6 ACGGTAGTGATGCTGGCCGGCCTGCAGGGATCCGGCAAGACAACGCTGGC ************************************************** C1 TGGCAAATTGGCAGTACGCCTTCGCAGGCAAGGACACACACCGCTTCTGG C2 TGGCAAATTGGCAGTACGCCTTCGCAGGCAAGGACACACACCGCTTCTGG C3 TGGCAAATTGGCAGTACGCCTTCGCAGGCAAGGACACACACCGCTTCTGG C4 TGGCAAATTGGCAGTACGCCTTCGCAGGCAAGGACACACACCGCTTCTGG C5 TGGCAAATTGGCAGTACGCCTTCGCAGGCAAGGACACACACCGCTTCTGG C6 TGGCAAATTGGCAGTACGCCTTCGCAGGCAAGGACACACACCGCTTCTGG ************************************************** C1 TGGCCTGTGACCTTCAGCGGCCGGCGGCAGTCAACCAGCTGCAAGTTGTC C2 TGGCCTGTGACCTTCAGCGGCCGGCGGCAGTCAACCAGCTGCAAGTTGTC C3 TGGCCTGTGACCTTCAGCGGCCGGCGGCAGTCAACCAGCTGCAAGTTGTC C4 TGGCCTGTGACCTTCAGCGGCCGGCGGCAGTCAACCAGCTGCAAGTTGTC C5 TGGCCTGTGACCTTCAGCGGCCGGCGGCAGTCAACCAGCTGCAAGTTGTC C6 TGGCCTGTGACCTTCAGCGGCCGGCGGCAGTCAACCAGCTGCAAGTTGTC ************************************************** C1 GGCGAGCGTGCCGGGGTGCCGGTATTCGCCCCGCATCCTGGGGCCTCGCC C2 GGCGAGCGTGCCGGGGTGCCGGTATTCGCCCCGCATCCTGGGGCCTCGCC C3 GGCGAGCGTGCCGGGGTGCCGGTATTCGCCCCGCATCCTGGGGCCTCGCC C4 GGCGAGCGTGCCGGGGTGCCGGTATTCGCCCCGCATCCTGGGGCCTCGCC C5 GGCGAGCGTGCCGGGGTGCCGGTATTCGCCCCGCATCCTGGGGCCTCGCC C6 GGCGAGCGTGCCGGGGTGCCGGTATTCGCCCCGCATCCTGGGGCCTCGCC ************************************************** C1 CGATTCAGGTCCCGGTGATCCGGTCGCTGTCGCGTCGGCAGGGCTGGTCG C2 CGATTCAGGTCCCGGTGATCCGGTCGCTGTCGCGTCGGCAGGGCTGGTCG C3 CGATTCAGGTCCCGGTGATCCGGTCGCTGTCGCGTCGGCAGGGCTGGTCG C4 CGATTCAGGTCCCGGTGATCCGGTCGCTGTCGCGTCGGCAGGGCTGGTCG C5 CGATTCAGGTCCCGGTGATCCGGTCGCTGTCGCGTCGGCAGGGCTGGTCG C6 CGATTCAGGTCCCGGTGATCCGGTCGCTGTCGCGTCGGCAGGGCTGGTCG ************************************************** C1 AAGCCCGGGCCAAACACTTCGACGTCGTGATCGTCGACACCGCCGGGCGA C2 AAGCCCGGGCCAAACACTTCGACGTCGTGATCGTCGACACCGCCGGGCGA C3 AAGCCCGGGCCAAACACTTCGACGTCGTGATCGTCGACACCGCCGGGCGA C4 AAGCCCGGGCCAAACACTTCGACGTCGTGATCGTCGACACCGCCGGGCGA C5 AAGCCCGGGCCAAACACTTCGACGTCGTGATCGTCGACACCGCCGGGCGA C6 AAGCCCGGGCCAAACACTTCGACGTCGTGATCGTCGACACCGCCGGGCGA ************************************************** C1 CTGGGCATCGACGACGAGTTGATGGCCCAGGCCGGGGCAATCCGGGAGGC C2 CTGGGCATCGACGACGAGTTGATGGCCCAGGCCGGGGCAATCCGGGAGGC C3 CTGGGCATCGACGACGAGTTGATGGCCCAGGCCGGGGCAATCCGGGAGGC C4 CTGGGCATCGACGACGAGTTGATGGCCCAGGCCGGGGCAATCCGGGAGGC C5 CTGGGCATCGACGACGAGTTGATGGCCCAGGCCGGGGCAATCCGGGAGGC C6 CTGGGCATCGACGACGAGTTGATGGCCCAGGCCGGGGCAATCCGGGAGGC ************************************************** C1 CATCAACCCCGACGAGGTGTTGTTCGTCCTCGACGCGATGATCGGCCAGG C2 CATCAACCCCGACGAGGTGTTGTTCGTCCTCGACGCGATGATCGGCCAGG C3 CATCAACCCCGACGAGGTGTTGTTCGTCCTCGACGCGATGATCGGCCAGG C4 CATCAACCCCGACGAGGTGTTGTTCGTCCTCGACGCGATGATCGGCCAGG C5 CATCAACCCCGACGAGGTGTTGTTCGTCCTCGACGCGATGATCGGCCAGG C6 CATCAACCCCGACGAGGTGTTGTTCGTCCTCGACGCGATGATCGGCCAGG ************************************************** C1 ACGCTGTCACCACCGCTGCGGCATTCGGTGCTGGAGTCGGCTTCACCGGT C2 ACGCTGTCACCACCGCTGCGGCATTCGGTGCTGGAGTCGGCTTCACCGGT C3 ACGCTGTCACCACCGCTGCGGCATTCGGTGCTGGAGTCGGCTTCACCGGT C4 ACGCTGTCACCACCGCTGCGGCATTCGGTGCTGGAGTCGGCTTCACCGGT C5 ACGCTGTCACCACCGCTGCGGCATTCGGTGCTGGAGTCGGCTTCACCGGT C6 ACGCTGTCACCACCGCTGCGGCATTCGGTGCTGGAGTCGGCTTCACCGGT ************************************************** C1 GTGGTTCTGACCAAGCTCGATGGTGACGCCCGCGGTGGAGCCGCTTTGTC C2 GTGGTTCTGACCAAGCTCGATGGTGACGCCCGCGGTGGAGCCGCTTTGTC C3 GTGGTTCTGACCAAGCTCGATGGTGACGCCCGCGGTGGAGCCGCTTTGTC C4 GTGGTTCTGACCAAGCTCGATGGTGACGCCCGCGGTGGAGCCGCTTTGTC C5 GTGGTTCTGACCAAGCTCGATGGTGACGCCCGCGGTGGAGCCGCTTTGTC C6 GTGGTTCTGACCAAGCTCGATGGTGACGCCCGCGGTGGAGCCGCTTTGTC ************************************************** C1 GGTCCGCGAGGTGACAGGTGTGCCAATCCTTTTTGCCACCACCGGTGAGA C2 GGTCCGCGAGGTGACAGGTGTGCCAATCCTTTTTGCCACCACCGGTGAGA C3 GGTCCGCGAGGTGACAGGTGTGCCAATCCTTTTTGCCACCACCGGTGAGA C4 GGTCCGCGAGGTGACAGGTGTGCCAATCCTTTTTGCCACCACCGGTGAGA C5 GGTCCGCGAGGTGACAGGTGTGCCAATCCTTTTTGCCACCACCGGTGAGA C6 GGTCCGCGAGGTGACAGGTGTGCCAATCCTTTTTGCCACCACCGGTGAGA ************************************************** C1 AGTTGGACGACTTCGACGTCTTTCACCCTGATCGGATGGCCAGCCGCATC C2 AGTTGGACGACTTCGACGTCTTTCACCCTGATCGGATGGCCAGCCGCATC C3 AGTTGGACGACTTCGACGTCTTTCACCCTGATCGGATGGCCAGCCGCATC C4 AGTTGGACGACTTCGACGTCTTTCACCCTGATCGGATGGCCAGCCGCATC C5 AGTTGGACGACTTCGACGTCTTTCACCCTGATCGGATGGCCAGCCGCATC C6 AGTTGGACGACTTCGACGTCTTTCACCCTGATCGGATGGCCAGCCGCATC ************************************************** C1 CTGGGCATGGGAGATGTGCTGAGCTTGATCGAACAAGCCGAGCAGGTCTT C2 CTGGGCATGGGAGATGTGCTGAGCTTGATCGAACAAGCCGAGCAGGTCTT C3 CTGGGCATGGGAGATGTGCTGAGCTTGATCGAACAAGCCGAGCAGGTCTT C4 CTGGGCATGGGAGATGTGCTGAGCTTGATCGAACAAGCCGAGCAGGTCTT C5 CTGGGCATGGGAGATGTGCTGAGCTTGATCGAACAAGCCGAGCAGGTCTT C6 CTGGGCATGGGAGATGTGCTGAGCTTGATCGAACAAGCCGAGCAGGTCTT ************************************************** C1 TGACGCCGAACAGGCCGAGGCAGCCGCTGCGAAGATCGTCGCCGGTGAAC C2 TGACGCCGAACAGGCCGAGGCAGCCGCTGCGAAGATCGTCGCCGGTGAAC C3 TGACGCCGAACAGGCCGAGGCAGCCGCTGCGAAGATCGTCGCCGGTGAAC C4 TGACGCCGAACAGGCCGAGGCAGCCGCTGCGAAGATCGTCGCCGGTGAAC C5 TGACGCCGAACAGGCCGAGGCAGCCGCTGCGAAGATCGTCGCCGGTGAAC C6 TGACGCCGAACAGGCCGAGGCAGCCGCTGCGAAGATCGTCGCCGGTGAAC ************************************************** C1 TGACGCTAGAGGATTTCCTCGAGCAGATGCTTGCGGTACGCAAGATGGGT C2 TGACGCTAGAGGATTTCCTCGAGCAGATGCTTGCGGTACGCAAGATGGGT C3 TGACGCTAGAGGATTTCCTCGAGCAGATGCTTGCGGTACGCAAGATGGGT C4 TGACGCTAGAGGATTTCCTCGAGCAGATGCTTGCGGTACGCAAGATGGGT C5 TGACGCTAGAGGATTTCCTCGAGCAGATGCTTGCGGTACGCAAGATGGGT C6 TGACGCTAGAGGATTTCCTCGAGCAGATGCTTGCGGTACGCAAGATGGGT ************************************************** C1 CTAATCGGCAACCTGTTGGGCATGCTACCCGGCGCGGGTCAGGTGAAGGA C2 CTAATCGGCAACCTGTTGGGCATGCTACCCGGCGCGGGTCAGGTGAAGGA C3 CTAATCGGCAACCTGTTGGGCATGCTACCCGGCGCGGGTCAGGTGAAGGA C4 CTAATCGGCAACCTGTTGGGCATGCTACCCGGCGCGGGTCAGGTGAAGGA C5 CTAATCGGCAACCTGTTGGGCATGCTACCCGGCGCGGGTCAGGTGAAGGA C6 CTAATCGGCAACCTGTTGGGCATGCTACCCGGCGCGGGTCAGGTGAAGGA ************************************************** C1 GGTACTGGAACAAGTCGATGACAAACAGCTCGACCGGTTGCAGGCCATCA C2 GGTACTGGAACAAGTCGATGACAAACAGCTCGACCGGTTGCAGGCCATCA C3 GGTACTGGAACAAGTCGATGACAAACAGCTCGACCGGTTGCAGGCCATCA C4 GGTACTGGAACAAGTCGATGACAAACAGCTCGACCGGTTGCAGGCCATCA C5 GGTACTGGAACAAGTCGATGACAAACAGCTCGACCGGTTGCAGGCCATCA C6 GGTACTGGAACAAGTCGATGACAAACAGCTCGACCGGTTGCAGGCCATCA ************************************************** C1 TCCGCGGAATGACGCCACAGGAGCGGGCCGACCCCAAGATCATCAACGCG C2 TCCGCGGAATGACGCCACAGGAGCGGGCCGACCCCAAGATCATCAACGCG C3 TCCGCGGAATGACGCCACAGGAGCGGGCCGACCCCAAGATCATCAACGCG C4 TCCGCGGAATGACGCCACAGGAGCGGGCCGACCCCAAGATCATCAACGCG C5 TCCGCGGAATGACGCCACAGGAGCGGGCCGACCCCAAGATCATCAACGCG C6 TCCGCGGAATGACGCCACAGGAGCGGGCCGACCCCAAGATCATCAACGCG ************************************************** C1 TCCCGGCGACTGCGTATCGCCAACGGCTCCGGGGTGACGGTGTCTGAGGT C2 TCCCGGCGACTGCGTATCGCCAACGGCTCCGGGGTGACGGTGTCTGAGGT C3 TCCCGGCGACTGCGTATCGCCAACGGCTCCGGGGTGACGGTGTCTGAGGT C4 TCCCGGCGACTGCGTATCGCCAACGGCTCCGGGGTGACGGTGTCTGAGGT C5 TCCCGGCGACTGCGTATCGCCAACGGCTCCGGGGTGACGGTGTCTGAGGT C6 TCCCGGCGACTGCGTATCGCCAACGGCTCCGGGGTGACGGTGTCTGAGGT ************************************************** C1 CAACCAACTGGTCGACCGGTTCTTCGAAGCCCGTAAGATGATGTCCTCCG C2 CAACCAACTGGTCGACCGGTTCTTCGAAGCCCGTAAGATGATGTCCTCCG C3 CAACCAACTGGTCGACCGGTTCTTCGAAGCCCGTAAGATGATGTCCTCCG C4 CAACCAACTGGTCGACCGGTTCTTCGAAGCCCGTAAGATGATGTCCTCCG C5 CAACCAACTGGTCGACCGGTTCTTCGAAGCCCGTAAGATGATGTCCTCCG C6 CAACCAACTGGTCGACCGGTTCTTCGAAGCCCGTAAGATGATGTCCTCCG ************************************************** C1 TGCTCGGCGGCATGGGTATACCCGGTATGGGACGCAAGTCTGCCACACGA C2 TGCTCGGCGGCATGGGTATACCCGGTATGGGACGCAAGTCTGCCACACGA C3 TGCTCGGCGGCATGGGTATACCCGGTATGGGACGCAAGTCTGCCACACGA C4 TGCTCGGCGGCATGGGTATACCCGGTATGGGACGCAAGTCTGCCACACGA C5 TGCTCGGCGGCATGGGTATACCCGGTATGGGACGCAAGTCTGCCACACGA C6 TGCTCGGCGGCATGGGTATACCCGGTATGGGACGCAAGTCTGCCACACGA ************************************************** C1 AAGTCCAAGGGAGGCAAAGGCAAGAAAAGGGCACGCGGTCCGACGTCACC C2 AAGTCCAAGGGAGGCAAAGGCAAGAAAAGGGCACGCGGTCCGACGTCACC C3 AAGTCCAAGGGAGGCAAAGGCAAGAAAAGGGCACGCGGTCCGACGTCACC C4 AAGTCCAAGGGAGGCAAAGGCAAGAAAAGGGCACGCGGTCCGACGTCACC C5 AAGTCCAAGGGAGGCAAAGGCAAGAAAAGGGCACGCGGTCCGACGTCACC C6 AAGTCCAAGGGAGGCAAAGGCAAGAAAAGGGCACGCGGTCCGACGTCACC ************************************************** C1 GAAGGTCAGGAGTCCTTTCGGGCCTGCCAGGCCCGGAATGCCGGACATGA C2 GAAGGTCAGGAGTCCTTTCGGGCCTGCCAGGCCCGGAATGCCGGACATGA C3 GAAGGTCAGGAGTCCTTTCGGGCCTGCCAGGCCCGGAATGCCGGACATGA C4 GAAGGTCAGGAGTCCTTTCGGGCCTGCCAGGCCCGGAATGCCGGACATGA C5 GAAGGTCAGGAGTCCTTTCGGGCCTGCCAGGCCCGGAATGCCGGACATGA C6 GAAGGTCAGGAGTCCTTTCGGGCCTGCCAGGCCCGGAATGCCGGACATGA ************************************************** C1 TGAACATGCCGCCAAGCTTCCCGGATCTGTCGCAGATGCCAGACGGTCTC C2 TGAACATGCCGCCAAGCTTCCCGGATCTGTCGCAGATGCCAGACGGTCTC C3 TGAACATGCCGCCAAGCTTCCCGGATCTGTCGCAGATGCCAGACGGTCTC C4 TGAACATGCCGCCAAGCTTCCCGGATCTGTCGCAGATGCCAGACGGTCTC C5 TGAACATGCCGCCAAGCTTCCCGGATCTGTCGCAGATGCCAGACGGTCTC C6 TGAACATGCCGCCAAGCTTCCCGGATCTGTCGCAGATGCCAGACGGTCTC ************************************************** C1 AACGAGCTGCCGCCTGGGCTGGCCGCTTTCGACTTGTCCAAACTGAAGTT C2 AACGAGCTGCCGCCTGGGCTGGCCGCTTTCGACTTGTCCAAACTGAAGTT C3 AACGAGCTGCCGCCTGGGCTGGCCGCTTTCGACTTGTCCAAACTGAAGTT C4 AACGAGCTGCCGCCTGGGCTGGCCGCTTTCGACTTGTCCAAACTGAAGTT C5 AACGAGCTGCCGCCTGGGCTGGCCGCTTTCGACTTGTCCAAACTGAAGTT C6 AACGAGCTGCCGCCTGGGCTGGCCGCTTTCGACTTGTCCAAACTGAAGTT ************************************************** C1 CCCAGGCAAGACG C2 CCCAGGCAAGACG C3 CCCAGGCAAGACG C4 CCCAGGCAAGACG C5 CCCAGGCAAGACG C6 CCCAGGCAAGACG ************* >C1 GTGTTTGAATCGCTCTCTAACCGGTTGACTGGCGTCATACAGGGGTTGCG TGGCAAAGGCCGGCTGACCGACGCCGATATCGAGGCCACCACCCGCGAAA TCCGGTTGGCGCTGTTTGAAGCCGACGTTTCACTACCTGTGGTGCGGGCG TTTGTGCATCGGATCAAAGAACGCGCTCGGGGCACCGAAGTGTCTGCTGC TCTCAACCCGGCGCAACAGATTGTCAAGATCGTCAACGAAGAACTGATCG GCATCCTCGGTGGCGAGACCCGCCAGCTGGCGTTCGCTAAGACACCGCCG ACGGTAGTGATGCTGGCCGGCCTGCAGGGATCCGGCAAGACAACGCTGGC TGGCAAATTGGCAGTACGCCTTCGCAGGCAAGGACACACACCGCTTCTGG TGGCCTGTGACCTTCAGCGGCCGGCGGCAGTCAACCAGCTGCAAGTTGTC GGCGAGCGTGCCGGGGTGCCGGTATTCGCCCCGCATCCTGGGGCCTCGCC CGATTCAGGTCCCGGTGATCCGGTCGCTGTCGCGTCGGCAGGGCTGGTCG AAGCCCGGGCCAAACACTTCGACGTCGTGATCGTCGACACCGCCGGGCGA CTGGGCATCGACGACGAGTTGATGGCCCAGGCCGGGGCAATCCGGGAGGC CATCAACCCCGACGAGGTGTTGTTCGTCCTCGACGCGATGATCGGCCAGG ACGCTGTCACCACCGCTGCGGCATTCGGTGCTGGAGTCGGCTTCACCGGT GTGGTTCTGACCAAGCTCGATGGTGACGCCCGCGGTGGAGCCGCTTTGTC GGTCCGCGAGGTGACAGGTGTGCCAATCCTTTTTGCCACCACCGGTGAGA AGTTGGACGACTTCGACGTCTTTCACCCTGATCGGATGGCCAGCCGCATC CTGGGCATGGGAGATGTGCTGAGCTTGATCGAACAAGCCGAGCAGGTCTT TGACGCCGAACAGGCCGAGGCAGCCGCTGCGAAGATCGTCGCCGGTGAAC TGACGCTAGAGGATTTCCTCGAGCAGATGCTTGCGGTACGCAAGATGGGT CTAATCGGCAACCTGTTGGGCATGCTACCCGGCGCGGGTCAGGTGAAGGA GGTACTGGAACAAGTCGATGACAAACAGCTCGACCGGTTGCAGGCCATCA TCCGCGGAATGACGCCACAGGAGCGGGCCGACCCCAAGATCATCAACGCG TCCCGGCGACTGCGTATCGCCAACGGCTCCGGGGTGACGGTGTCTGAGGT CAACCAACTGGTCGACCGGTTCTTCGAAGCCCGTAAGATGATGTCCTCCG TGCTCGGCGGCATGGGTATACCCGGTATGGGACGCAAGTCTGCCACACGA AAGTCCAAGGGAGGCAAAGGCAAGAAAAGGGCACGCGGTCCGACGTCACC GAAGGTCAGGAGTCCTTTCGGGCCTGCCAGGCCCGGAATGCCGGACATGA TGAACATGCCGCCAAGCTTCCCGGATCTGTCGCAGATGCCAGACGGTCTC AACGAGCTGCCGCCTGGGCTGGCCGCTTTCGACTTGTCCAAACTGAAGTT CCCAGGCAAGACG >C2 GTGTTTGAATCGCTCTCTAACCGGTTGACTGGCGTCATACAGGGGTTGCG TGGCAAAGGCCGGCTGACCGACGCCGATATCGAGGCCACCACCCGCGAAA TCCGGTTGGCGCTGTTTGAAGCCGACGTTTCACTACCTGTGGTGCGGGCG TTTGTGCATCGGATCAAAGAACGCGCTCGGGGCACCGAAGTGTCTGCTGC TCTCAACCCGGCGCAACAGATTGTCAAGATCGTCAACGAAGAACTGATCG GCATCCTCGGTGGCGAGACCCGCCAGCTGGCGTTCGCTAAGACACCGCCG ACGGTAGTGATGCTGGCCGGCCTGCAGGGATCCGGCAAGACAACGCTGGC TGGCAAATTGGCAGTACGCCTTCGCAGGCAAGGACACACACCGCTTCTGG TGGCCTGTGACCTTCAGCGGCCGGCGGCAGTCAACCAGCTGCAAGTTGTC GGCGAGCGTGCCGGGGTGCCGGTATTCGCCCCGCATCCTGGGGCCTCGCC CGATTCAGGTCCCGGTGATCCGGTCGCTGTCGCGTCGGCAGGGCTGGTCG AAGCCCGGGCCAAACACTTCGACGTCGTGATCGTCGACACCGCCGGGCGA CTGGGCATCGACGACGAGTTGATGGCCCAGGCCGGGGCAATCCGGGAGGC CATCAACCCCGACGAGGTGTTGTTCGTCCTCGACGCGATGATCGGCCAGG ACGCTGTCACCACCGCTGCGGCATTCGGTGCTGGAGTCGGCTTCACCGGT GTGGTTCTGACCAAGCTCGATGGTGACGCCCGCGGTGGAGCCGCTTTGTC GGTCCGCGAGGTGACAGGTGTGCCAATCCTTTTTGCCACCACCGGTGAGA AGTTGGACGACTTCGACGTCTTTCACCCTGATCGGATGGCCAGCCGCATC CTGGGCATGGGAGATGTGCTGAGCTTGATCGAACAAGCCGAGCAGGTCTT TGACGCCGAACAGGCCGAGGCAGCCGCTGCGAAGATCGTCGCCGGTGAAC TGACGCTAGAGGATTTCCTCGAGCAGATGCTTGCGGTACGCAAGATGGGT CTAATCGGCAACCTGTTGGGCATGCTACCCGGCGCGGGTCAGGTGAAGGA GGTACTGGAACAAGTCGATGACAAACAGCTCGACCGGTTGCAGGCCATCA TCCGCGGAATGACGCCACAGGAGCGGGCCGACCCCAAGATCATCAACGCG TCCCGGCGACTGCGTATCGCCAACGGCTCCGGGGTGACGGTGTCTGAGGT CAACCAACTGGTCGACCGGTTCTTCGAAGCCCGTAAGATGATGTCCTCCG TGCTCGGCGGCATGGGTATACCCGGTATGGGACGCAAGTCTGCCACACGA AAGTCCAAGGGAGGCAAAGGCAAGAAAAGGGCACGCGGTCCGACGTCACC GAAGGTCAGGAGTCCTTTCGGGCCTGCCAGGCCCGGAATGCCGGACATGA TGAACATGCCGCCAAGCTTCCCGGATCTGTCGCAGATGCCAGACGGTCTC AACGAGCTGCCGCCTGGGCTGGCCGCTTTCGACTTGTCCAAACTGAAGTT CCCAGGCAAGACG >C3 GTGTTTGAATCGCTCTCTAACCGGTTGACTGGCGTCATACAGGGGTTGCG TGGCAAAGGCCGGCTGACCGACGCCGATATCGAGGCCACCACCCGCGAAA TCCGGTTGGCGCTGTTTGAAGCCGACGTTTCACTACCTGTGGTGCGGGCG TTTGTGCATCGGATCAAAGAACGCGCTCGGGGCACCGAAGTGTCTGCTGC TCTCAACCCGGCGCAACAGATTGTCAAGATCGTCAACGAAGAACTGATCG GCATCCTCGGTGGCGAGACCCGCCAGCTGGCGTTCGCTAAGACACCGCCG ACGGTAGTGATGCTGGCCGGCCTGCAGGGATCCGGCAAGACAACGCTGGC TGGCAAATTGGCAGTACGCCTTCGCAGGCAAGGACACACACCGCTTCTGG TGGCCTGTGACCTTCAGCGGCCGGCGGCAGTCAACCAGCTGCAAGTTGTC GGCGAGCGTGCCGGGGTGCCGGTATTCGCCCCGCATCCTGGGGCCTCGCC CGATTCAGGTCCCGGTGATCCGGTCGCTGTCGCGTCGGCAGGGCTGGTCG AAGCCCGGGCCAAACACTTCGACGTCGTGATCGTCGACACCGCCGGGCGA CTGGGCATCGACGACGAGTTGATGGCCCAGGCCGGGGCAATCCGGGAGGC CATCAACCCCGACGAGGTGTTGTTCGTCCTCGACGCGATGATCGGCCAGG ACGCTGTCACCACCGCTGCGGCATTCGGTGCTGGAGTCGGCTTCACCGGT GTGGTTCTGACCAAGCTCGATGGTGACGCCCGCGGTGGAGCCGCTTTGTC GGTCCGCGAGGTGACAGGTGTGCCAATCCTTTTTGCCACCACCGGTGAGA AGTTGGACGACTTCGACGTCTTTCACCCTGATCGGATGGCCAGCCGCATC CTGGGCATGGGAGATGTGCTGAGCTTGATCGAACAAGCCGAGCAGGTCTT TGACGCCGAACAGGCCGAGGCAGCCGCTGCGAAGATCGTCGCCGGTGAAC TGACGCTAGAGGATTTCCTCGAGCAGATGCTTGCGGTACGCAAGATGGGT CTAATCGGCAACCTGTTGGGCATGCTACCCGGCGCGGGTCAGGTGAAGGA GGTACTGGAACAAGTCGATGACAAACAGCTCGACCGGTTGCAGGCCATCA TCCGCGGAATGACGCCACAGGAGCGGGCCGACCCCAAGATCATCAACGCG TCCCGGCGACTGCGTATCGCCAACGGCTCCGGGGTGACGGTGTCTGAGGT CAACCAACTGGTCGACCGGTTCTTCGAAGCCCGTAAGATGATGTCCTCCG TGCTCGGCGGCATGGGTATACCCGGTATGGGACGCAAGTCTGCCACACGA AAGTCCAAGGGAGGCAAAGGCAAGAAAAGGGCACGCGGTCCGACGTCACC GAAGGTCAGGAGTCCTTTCGGGCCTGCCAGGCCCGGAATGCCGGACATGA TGAACATGCCGCCAAGCTTCCCGGATCTGTCGCAGATGCCAGACGGTCTC AACGAGCTGCCGCCTGGGCTGGCCGCTTTCGACTTGTCCAAACTGAAGTT CCCAGGCAAGACG >C4 GTGTTTGAATCGCTCTCTAACCGGTTGACTGGCGTCATACAGGGGTTGCG TGGCAAAGGCCGGCTGACCGACGCCGATATCGAGGCCACCACCCGCGAAA TCCGGTTGGCGCTGTTTGAAGCCGACGTTTCACTACCTGTGGTGCGGGCG TTTGTGCATCGGATCAAAGAACGCGCTCGGGGCACCGAAGTGTCTGCTGC TCTCAACCCGGCGCAACAGATTGTCAAGATCGTCAACGAAGAACTGATCG GCATCCTCGGTGGCGAGACCCGCCAGCTGGCGTTCGCTAAGACACCGCCG ACGGTAGTGATGCTGGCCGGCCTGCAGGGATCCGGCAAGACAACGCTGGC TGGCAAATTGGCAGTACGCCTTCGCAGGCAAGGACACACACCGCTTCTGG TGGCCTGTGACCTTCAGCGGCCGGCGGCAGTCAACCAGCTGCAAGTTGTC GGCGAGCGTGCCGGGGTGCCGGTATTCGCCCCGCATCCTGGGGCCTCGCC CGATTCAGGTCCCGGTGATCCGGTCGCTGTCGCGTCGGCAGGGCTGGTCG AAGCCCGGGCCAAACACTTCGACGTCGTGATCGTCGACACCGCCGGGCGA CTGGGCATCGACGACGAGTTGATGGCCCAGGCCGGGGCAATCCGGGAGGC CATCAACCCCGACGAGGTGTTGTTCGTCCTCGACGCGATGATCGGCCAGG ACGCTGTCACCACCGCTGCGGCATTCGGTGCTGGAGTCGGCTTCACCGGT GTGGTTCTGACCAAGCTCGATGGTGACGCCCGCGGTGGAGCCGCTTTGTC GGTCCGCGAGGTGACAGGTGTGCCAATCCTTTTTGCCACCACCGGTGAGA AGTTGGACGACTTCGACGTCTTTCACCCTGATCGGATGGCCAGCCGCATC CTGGGCATGGGAGATGTGCTGAGCTTGATCGAACAAGCCGAGCAGGTCTT TGACGCCGAACAGGCCGAGGCAGCCGCTGCGAAGATCGTCGCCGGTGAAC TGACGCTAGAGGATTTCCTCGAGCAGATGCTTGCGGTACGCAAGATGGGT CTAATCGGCAACCTGTTGGGCATGCTACCCGGCGCGGGTCAGGTGAAGGA GGTACTGGAACAAGTCGATGACAAACAGCTCGACCGGTTGCAGGCCATCA TCCGCGGAATGACGCCACAGGAGCGGGCCGACCCCAAGATCATCAACGCG TCCCGGCGACTGCGTATCGCCAACGGCTCCGGGGTGACGGTGTCTGAGGT CAACCAACTGGTCGACCGGTTCTTCGAAGCCCGTAAGATGATGTCCTCCG TGCTCGGCGGCATGGGTATACCCGGTATGGGACGCAAGTCTGCCACACGA AAGTCCAAGGGAGGCAAAGGCAAGAAAAGGGCACGCGGTCCGACGTCACC GAAGGTCAGGAGTCCTTTCGGGCCTGCCAGGCCCGGAATGCCGGACATGA TGAACATGCCGCCAAGCTTCCCGGATCTGTCGCAGATGCCAGACGGTCTC AACGAGCTGCCGCCTGGGCTGGCCGCTTTCGACTTGTCCAAACTGAAGTT CCCAGGCAAGACG >C5 GTGTTTGAATCGCTCTCTAACCGGTTGACTGGCGTCATACAGGGGTTGCG TGGCAAAGGCCGGCTGACCGACGCCGATATCGAGGCCACCACCCGCGAAA TCCGGTTGGCGCTGTTTGAAGCCGACGTTTCACTACCTGTGGTGCGGGCG TTTGTGCATCGGATCAAAGAACGCGCTCGGGGCACCGAAGTGTCTGCTGC TCTCAACCCGGCGCAACAGATTGTCAAGATCGTCAACGAAGAACTGATCG GCATCCTCGGTGGCGAGACCCGCCAGCTGGCGTTCGCTAAGACACCGCCG ACGGTAGTGATGCTGGCCGGCCTGCAGGGATCCGGCAAGACAACGCTGGC TGGCAAATTGGCAGTACGCCTTCGCAGGCAAGGACACACACCGCTTCTGG TGGCCTGTGACCTTCAGCGGCCGGCGGCAGTCAACCAGCTGCAAGTTGTC GGCGAGCGTGCCGGGGTGCCGGTATTCGCCCCGCATCCTGGGGCCTCGCC CGATTCAGGTCCCGGTGATCCGGTCGCTGTCGCGTCGGCAGGGCTGGTCG AAGCCCGGGCCAAACACTTCGACGTCGTGATCGTCGACACCGCCGGGCGA CTGGGCATCGACGACGAGTTGATGGCCCAGGCCGGGGCAATCCGGGAGGC CATCAACCCCGACGAGGTGTTGTTCGTCCTCGACGCGATGATCGGCCAGG ACGCTGTCACCACCGCTGCGGCATTCGGTGCTGGAGTCGGCTTCACCGGT GTGGTTCTGACCAAGCTCGATGGTGACGCCCGCGGTGGAGCCGCTTTGTC GGTCCGCGAGGTGACAGGTGTGCCAATCCTTTTTGCCACCACCGGTGAGA AGTTGGACGACTTCGACGTCTTTCACCCTGATCGGATGGCCAGCCGCATC CTGGGCATGGGAGATGTGCTGAGCTTGATCGAACAAGCCGAGCAGGTCTT TGACGCCGAACAGGCCGAGGCAGCCGCTGCGAAGATCGTCGCCGGTGAAC TGACGCTAGAGGATTTCCTCGAGCAGATGCTTGCGGTACGCAAGATGGGT CTAATCGGCAACCTGTTGGGCATGCTACCCGGCGCGGGTCAGGTGAAGGA GGTACTGGAACAAGTCGATGACAAACAGCTCGACCGGTTGCAGGCCATCA TCCGCGGAATGACGCCACAGGAGCGGGCCGACCCCAAGATCATCAACGCG TCCCGGCGACTGCGTATCGCCAACGGCTCCGGGGTGACGGTGTCTGAGGT CAACCAACTGGTCGACCGGTTCTTCGAAGCCCGTAAGATGATGTCCTCCG TGCTCGGCGGCATGGGTATACCCGGTATGGGACGCAAGTCTGCCACACGA AAGTCCAAGGGAGGCAAAGGCAAGAAAAGGGCACGCGGTCCGACGTCACC GAAGGTCAGGAGTCCTTTCGGGCCTGCCAGGCCCGGAATGCCGGACATGA TGAACATGCCGCCAAGCTTCCCGGATCTGTCGCAGATGCCAGACGGTCTC AACGAGCTGCCGCCTGGGCTGGCCGCTTTCGACTTGTCCAAACTGAAGTT CCCAGGCAAGACG >C6 GTGTTTGAATCGCTCTCTAACCGGTTGACTGGCGTCATACAGGGGTTGCG TGGCAAAGGCCGGCTGACCGACGCCGATATCGAGGCCACCACCCGCGAAA TCCGGTTGGCGCTGTTTGAAGCCGACGTTTCACTACCTGTGGTGCGGGCG TTTGTGCATCGGATCAAAGAACGCGCTCGGGGCACCGAAGTGTCTGCTGC TCTCAACCCGGCGCAACAGATTGTCAAGATCGTCAACGAAGAACTGATCG GCATCCTCGGTGGCGAGACCCGCCAGCTGGCGTTCGCTAAGACACCGCCG ACGGTAGTGATGCTGGCCGGCCTGCAGGGATCCGGCAAGACAACGCTGGC TGGCAAATTGGCAGTACGCCTTCGCAGGCAAGGACACACACCGCTTCTGG TGGCCTGTGACCTTCAGCGGCCGGCGGCAGTCAACCAGCTGCAAGTTGTC GGCGAGCGTGCCGGGGTGCCGGTATTCGCCCCGCATCCTGGGGCCTCGCC CGATTCAGGTCCCGGTGATCCGGTCGCTGTCGCGTCGGCAGGGCTGGTCG AAGCCCGGGCCAAACACTTCGACGTCGTGATCGTCGACACCGCCGGGCGA CTGGGCATCGACGACGAGTTGATGGCCCAGGCCGGGGCAATCCGGGAGGC CATCAACCCCGACGAGGTGTTGTTCGTCCTCGACGCGATGATCGGCCAGG ACGCTGTCACCACCGCTGCGGCATTCGGTGCTGGAGTCGGCTTCACCGGT GTGGTTCTGACCAAGCTCGATGGTGACGCCCGCGGTGGAGCCGCTTTGTC GGTCCGCGAGGTGACAGGTGTGCCAATCCTTTTTGCCACCACCGGTGAGA AGTTGGACGACTTCGACGTCTTTCACCCTGATCGGATGGCCAGCCGCATC CTGGGCATGGGAGATGTGCTGAGCTTGATCGAACAAGCCGAGCAGGTCTT TGACGCCGAACAGGCCGAGGCAGCCGCTGCGAAGATCGTCGCCGGTGAAC TGACGCTAGAGGATTTCCTCGAGCAGATGCTTGCGGTACGCAAGATGGGT CTAATCGGCAACCTGTTGGGCATGCTACCCGGCGCGGGTCAGGTGAAGGA GGTACTGGAACAAGTCGATGACAAACAGCTCGACCGGTTGCAGGCCATCA TCCGCGGAATGACGCCACAGGAGCGGGCCGACCCCAAGATCATCAACGCG TCCCGGCGACTGCGTATCGCCAACGGCTCCGGGGTGACGGTGTCTGAGGT CAACCAACTGGTCGACCGGTTCTTCGAAGCCCGTAAGATGATGTCCTCCG TGCTCGGCGGCATGGGTATACCCGGTATGGGACGCAAGTCTGCCACACGA AAGTCCAAGGGAGGCAAAGGCAAGAAAAGGGCACGCGGTCCGACGTCACC GAAGGTCAGGAGTCCTTTCGGGCCTGCCAGGCCCGGAATGCCGGACATGA TGAACATGCCGCCAAGCTTCCCGGATCTGTCGCAGATGCCAGACGGTCTC AACGAGCTGCCGCCTGGGCTGGCCGCTTTCGACTTGTCCAAACTGAAGTT CCCAGGCAAGACG >C1 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL NELPPGLAAFDLSKLKFPGKT >C2 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL NELPPGLAAFDLSKLKFPGKT >C3 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL NELPPGLAAFDLSKLKFPGKT >C4 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL NELPPGLAAFDLSKLKFPGKT >C5 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL NELPPGLAAFDLSKLKFPGKT >C6 VFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRA FVHRIKERARGTEVSAALNPAQQIVKIVNEELIGILGGETRQLAFAKTPP TVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPAAVNQLQVV GERAGVPVFAPHPGASPDSGPGDPVAVASAGLVEARAKHFDVVIVDTAGR LGIDDELMAQAGAIREAINPDEVLFVLDAMIGQDAVTTAAAFGAGVGFTG VVLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFDVFHPDRMASRI LGMGDVLSLIEQAEQVFDAEQAEAAAAKIVAGELTLEDFLEQMLAVRKMG LIGNLLGMLPGAGQVKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINA SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSVLGGMGIPGMGRKSATR KSKGGKGKKRARGPTSPKVRSPFGPARPGMPDMMNMPPSFPDLSQMPDGL NELPPGLAAFDLSKLKFPGKT MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/2res/ffh/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1563 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579788656 Setting output file names to "/data/2res/ffh/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1072490699 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0544960608 Seed = 1819192359 Swapseed = 1579788656 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3498.068730 -- -24.965149 Chain 2 -- -3498.068932 -- -24.965149 Chain 3 -- -3498.068932 -- -24.965149 Chain 4 -- -3498.068932 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3498.068730 -- -24.965149 Chain 2 -- -3498.068730 -- -24.965149 Chain 3 -- -3498.068932 -- -24.965149 Chain 4 -- -3498.068932 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3498.069] (-3498.069) (-3498.069) (-3498.069) * [-3498.069] (-3498.069) (-3498.069) (-3498.069) 500 -- (-2145.399) [-2133.796] (-2143.937) (-2162.696) * (-2133.824) [-2128.546] (-2139.247) (-2152.232) -- 0:00:00 1000 -- [-2126.939] (-2131.687) (-2127.291) (-2173.267) * (-2131.505) [-2132.458] (-2129.685) (-2140.820) -- 0:00:00 1500 -- (-2134.986) [-2127.408] (-2126.028) (-2136.519) * (-2127.211) [-2133.343] (-2131.915) (-2140.937) -- 0:00:00 2000 -- [-2128.179] (-2126.722) (-2131.480) (-2133.403) * [-2128.681] (-2129.029) (-2131.001) (-2129.539) -- 0:00:00 2500 -- [-2131.791] (-2133.552) (-2125.297) (-2130.206) * (-2126.152) [-2128.074] (-2129.107) (-2133.600) -- 0:00:00 3000 -- (-2131.195) (-2128.412) [-2126.546] (-2131.861) * (-2128.800) [-2124.029] (-2142.420) (-2130.429) -- 0:00:00 3500 -- (-2134.019) [-2127.395] (-2131.298) (-2124.451) * (-2132.638) (-2132.241) (-2130.656) [-2130.067] -- 0:00:00 4000 -- (-2132.596) (-2124.151) (-2130.302) [-2127.608] * [-2126.242] (-2133.217) (-2132.940) (-2133.381) -- 0:00:00 4500 -- (-2127.685) (-2127.122) (-2134.478) [-2128.827] * (-2147.005) [-2129.431] (-2127.412) (-2124.999) -- 0:00:00 5000 -- [-2129.142] (-2130.792) (-2128.024) (-2130.979) * (-2128.343) (-2125.102) (-2130.265) [-2123.981] -- 0:00:00 Average standard deviation of split frequencies: 0.075425 5500 -- (-2132.243) [-2130.888] (-2132.524) (-2122.958) * [-2132.858] (-2125.874) (-2126.396) (-2131.265) -- 0:00:00 6000 -- (-2135.755) [-2127.915] (-2133.050) (-2125.768) * [-2128.989] (-2129.277) (-2127.827) (-2134.874) -- 0:00:00 6500 -- (-2127.345) (-2125.242) (-2128.214) [-2133.684] * [-2123.591] (-2128.851) (-2130.156) (-2130.401) -- 0:00:00 7000 -- (-2132.435) (-2126.870) [-2128.714] (-2133.860) * (-2130.136) (-2125.758) (-2130.553) [-2132.613] -- 0:00:00 7500 -- (-2133.923) [-2125.799] (-2133.299) (-2135.901) * (-2128.447) (-2127.574) (-2129.945) [-2133.040] -- 0:02:12 8000 -- [-2130.730] (-2131.804) (-2132.783) (-2131.296) * (-2127.854) (-2131.993) [-2129.406] (-2133.007) -- 0:02:04 8500 -- [-2127.892] (-2136.098) (-2122.363) (-2129.477) * (-2130.004) [-2121.195] (-2129.674) (-2126.981) -- 0:01:56 9000 -- (-2129.610) (-2130.705) [-2123.317] (-2129.255) * (-2138.202) (-2125.907) [-2131.089] (-2122.880) -- 0:01:50 9500 -- (-2122.106) (-2127.910) [-2124.796] (-2132.488) * [-2136.527] (-2126.457) (-2129.646) (-2132.612) -- 0:01:44 10000 -- (-2127.655) (-2135.736) [-2123.878] (-2130.811) * (-2132.195) (-2132.940) (-2133.145) [-2136.446] -- 0:01:39 Average standard deviation of split frequencies: 0.061872 10500 -- (-2131.596) (-2128.248) (-2128.742) [-2130.621] * (-2129.006) [-2127.411] (-2128.319) (-2132.700) -- 0:01:34 11000 -- [-2128.146] (-2129.341) (-2135.370) (-2131.348) * (-2127.367) (-2131.465) [-2125.945] (-2127.252) -- 0:01:29 11500 -- (-2129.352) [-2136.086] (-2126.943) (-2128.102) * (-2132.132) [-2126.235] (-2126.880) (-2127.009) -- 0:01:25 12000 -- (-2133.825) (-2128.807) (-2132.561) [-2138.309] * (-2137.085) [-2128.995] (-2129.387) (-2129.705) -- 0:01:22 12500 -- [-2126.688] (-2129.929) (-2129.476) (-2125.334) * (-2126.484) [-2128.624] (-2126.496) (-2128.472) -- 0:01:19 13000 -- (-2130.969) (-2135.206) [-2136.111] (-2128.249) * (-2125.359) [-2131.141] (-2128.199) (-2125.084) -- 0:01:15 13500 -- (-2136.751) (-2130.118) (-2125.048) [-2128.073] * [-2125.590] (-2130.316) (-2126.000) (-2125.546) -- 0:01:13 14000 -- (-2135.105) (-2130.663) (-2129.747) [-2124.064] * (-2124.967) [-2128.718] (-2129.757) (-2128.785) -- 0:01:10 14500 -- (-2134.379) (-2129.555) (-2127.554) [-2126.263] * [-2127.511] (-2126.408) (-2129.316) (-2140.095) -- 0:01:07 15000 -- (-2132.283) [-2125.031] (-2136.889) (-2132.278) * [-2129.548] (-2130.901) (-2131.517) (-2138.729) -- 0:01:05 Average standard deviation of split frequencies: 0.053569 15500 -- (-2126.548) (-2126.875) [-2130.335] (-2128.158) * [-2130.598] (-2140.850) (-2129.776) (-2128.239) -- 0:01:03 16000 -- (-2126.627) (-2129.301) (-2138.125) [-2127.749] * (-2127.413) (-2127.799) (-2128.301) [-2129.391] -- 0:01:01 16500 -- (-2128.171) [-2124.210] (-2129.131) (-2133.884) * (-2131.393) (-2119.187) [-2128.751] (-2135.602) -- 0:00:59 17000 -- [-2123.256] (-2128.157) (-2132.347) (-2131.414) * [-2130.217] (-2118.954) (-2126.893) (-2129.071) -- 0:00:57 17500 -- (-2134.590) (-2125.696) (-2126.753) [-2131.630] * (-2131.368) (-2118.987) (-2122.258) [-2126.601] -- 0:00:56 18000 -- (-2127.326) [-2133.380] (-2128.264) (-2128.770) * (-2132.705) [-2118.149] (-2126.769) (-2126.892) -- 0:00:54 18500 -- (-2132.105) (-2132.042) [-2126.375] (-2131.768) * (-2130.056) [-2119.567] (-2130.567) (-2131.768) -- 0:00:53 19000 -- [-2126.906] (-2128.420) (-2128.964) (-2130.502) * (-2130.036) (-2118.366) (-2127.786) [-2127.815] -- 0:00:51 19500 -- (-2128.099) (-2128.107) (-2131.162) [-2125.297] * (-2128.861) (-2122.834) (-2129.225) [-2126.653] -- 0:00:50 20000 -- [-2132.909] (-2125.301) (-2132.893) (-2130.258) * (-2133.348) (-2122.531) (-2127.708) [-2125.965] -- 0:00:49 Average standard deviation of split frequencies: 0.050182 20500 -- (-2137.086) [-2133.401] (-2127.258) (-2124.968) * (-2130.377) (-2119.616) (-2136.425) [-2126.563] -- 0:01:35 21000 -- (-2146.109) [-2125.455] (-2127.106) (-2127.869) * (-2130.948) (-2118.859) (-2135.453) [-2132.716] -- 0:01:33 21500 -- (-2127.937) [-2127.596] (-2124.266) (-2127.885) * (-2129.205) [-2120.363] (-2127.573) (-2129.295) -- 0:01:31 22000 -- [-2129.450] (-2127.133) (-2129.761) (-2127.027) * [-2131.310] (-2119.055) (-2128.346) (-2125.223) -- 0:01:28 22500 -- (-2123.455) [-2125.689] (-2126.060) (-2126.464) * (-2124.330) [-2118.445] (-2133.700) (-2136.046) -- 0:01:26 23000 -- (-2128.784) [-2128.801] (-2130.201) (-2124.768) * (-2127.986) [-2118.973] (-2125.793) (-2136.754) -- 0:01:24 23500 -- (-2129.917) [-2123.915] (-2126.037) (-2128.156) * [-2128.375] (-2120.112) (-2137.588) (-2130.668) -- 0:01:23 24000 -- (-2134.899) (-2127.344) [-2127.406] (-2126.904) * (-2123.686) (-2119.529) [-2128.434] (-2127.411) -- 0:01:21 24500 -- (-2125.015) (-2133.226) [-2132.825] (-2130.499) * (-2126.568) (-2118.721) [-2128.460] (-2135.728) -- 0:01:19 25000 -- (-2129.655) [-2127.302] (-2126.169) (-2135.089) * (-2127.384) [-2118.775] (-2128.335) (-2124.281) -- 0:01:18 Average standard deviation of split frequencies: 0.041780 25500 -- (-2124.629) (-2125.960) (-2123.351) [-2126.934] * [-2134.514] (-2118.750) (-2124.107) (-2131.383) -- 0:01:16 26000 -- [-2125.264] (-2139.051) (-2126.793) (-2129.972) * (-2130.895) (-2119.291) (-2130.297) [-2126.299] -- 0:01:14 26500 -- [-2125.364] (-2130.456) (-2131.504) (-2129.547) * (-2135.134) (-2118.961) (-2132.486) [-2129.679] -- 0:01:13 27000 -- (-2131.660) (-2122.626) [-2123.740] (-2128.140) * (-2140.475) [-2119.509] (-2130.408) (-2132.000) -- 0:01:12 27500 -- (-2129.117) [-2129.915] (-2132.873) (-2136.869) * (-2134.571) (-2119.189) (-2135.165) [-2130.811] -- 0:01:10 28000 -- (-2125.615) (-2131.270) [-2122.368] (-2128.397) * (-2130.104) (-2120.869) [-2124.997] (-2138.488) -- 0:01:09 28500 -- (-2123.521) [-2127.677] (-2128.449) (-2131.533) * [-2129.046] (-2118.472) (-2127.725) (-2130.011) -- 0:01:08 29000 -- (-2124.830) (-2128.077) (-2129.443) [-2130.244] * (-2123.944) (-2118.945) [-2135.713] (-2138.704) -- 0:01:06 29500 -- (-2124.776) (-2134.012) (-2127.751) [-2126.998] * (-2128.658) (-2122.642) [-2127.171] (-2135.028) -- 0:01:05 30000 -- [-2127.133] (-2132.093) (-2130.630) (-2128.663) * (-2134.685) (-2120.507) [-2126.896] (-2131.007) -- 0:01:04 Average standard deviation of split frequencies: 0.038430 30500 -- (-2125.310) (-2133.947) [-2127.233] (-2134.571) * [-2128.116] (-2120.507) (-2124.091) (-2128.324) -- 0:01:03 31000 -- (-2136.582) (-2129.248) [-2126.725] (-2124.606) * [-2129.363] (-2119.790) (-2127.260) (-2124.243) -- 0:01:02 31500 -- (-2129.913) (-2128.541) (-2132.957) [-2126.095] * (-2132.115) [-2119.790] (-2127.257) (-2127.787) -- 0:01:01 32000 -- (-2129.637) (-2134.319) [-2124.009] (-2123.561) * (-2129.027) (-2119.379) (-2136.405) [-2133.695] -- 0:01:00 32500 -- (-2127.126) (-2127.024) [-2133.615] (-2134.523) * (-2123.347) (-2120.780) (-2126.199) [-2138.690] -- 0:00:59 33000 -- (-2128.148) (-2126.938) [-2128.305] (-2147.964) * (-2127.268) (-2119.845) [-2126.433] (-2129.660) -- 0:00:58 33500 -- [-2126.215] (-2129.539) (-2134.192) (-2134.050) * (-2127.194) (-2121.818) [-2132.118] (-2124.366) -- 0:01:26 34000 -- [-2125.724] (-2134.513) (-2132.589) (-2130.683) * (-2130.860) (-2120.861) [-2133.173] (-2132.709) -- 0:01:25 34500 -- (-2127.483) [-2129.834] (-2127.189) (-2140.384) * (-2129.360) (-2120.554) [-2133.289] (-2129.192) -- 0:01:23 35000 -- (-2131.914) (-2143.787) [-2123.963] (-2129.950) * (-2131.548) [-2120.783] (-2131.489) (-2129.000) -- 0:01:22 Average standard deviation of split frequencies: 0.036527 35500 -- (-2126.920) (-2136.156) (-2130.555) [-2126.921] * (-2132.114) (-2122.326) (-2135.588) [-2126.553] -- 0:01:21 36000 -- (-2133.127) (-2130.941) [-2129.298] (-2129.522) * (-2122.597) [-2122.417] (-2131.956) (-2125.891) -- 0:01:20 36500 -- [-2126.176] (-2136.097) (-2125.817) (-2129.989) * (-2131.390) (-2119.649) (-2131.965) [-2129.343] -- 0:01:19 37000 -- [-2129.525] (-2130.536) (-2124.146) (-2134.653) * [-2133.448] (-2118.543) (-2128.888) (-2125.488) -- 0:01:18 37500 -- (-2123.497) (-2131.334) (-2132.495) [-2129.766] * [-2137.236] (-2119.803) (-2129.743) (-2127.692) -- 0:01:17 38000 -- [-2125.054] (-2128.059) (-2128.458) (-2132.336) * (-2126.440) [-2119.834] (-2131.785) (-2129.047) -- 0:01:15 38500 -- [-2128.457] (-2126.084) (-2126.390) (-2132.046) * (-2130.136) [-2119.639] (-2126.287) (-2126.374) -- 0:01:14 39000 -- [-2123.717] (-2127.503) (-2126.749) (-2129.385) * [-2128.565] (-2120.647) (-2131.843) (-2139.815) -- 0:01:13 39500 -- [-2123.550] (-2130.245) (-2136.072) (-2132.648) * (-2134.771) (-2121.648) [-2127.834] (-2134.239) -- 0:01:12 40000 -- (-2129.784) (-2128.598) (-2131.766) [-2130.017] * [-2127.878] (-2122.587) (-2136.048) (-2132.443) -- 0:01:12 Average standard deviation of split frequencies: 0.035458 40500 -- (-2130.664) (-2129.957) (-2130.154) [-2128.424] * (-2131.872) (-2122.537) (-2125.099) [-2127.836] -- 0:01:11 41000 -- [-2129.185] (-2127.235) (-2133.478) (-2124.618) * (-2138.416) (-2119.866) [-2130.870] (-2125.721) -- 0:01:10 41500 -- (-2126.995) (-2125.369) (-2124.321) [-2127.676] * (-2130.354) (-2119.799) [-2128.994] (-2130.982) -- 0:01:09 42000 -- (-2129.701) (-2129.909) [-2124.589] (-2128.387) * (-2118.762) (-2119.384) [-2129.052] (-2126.842) -- 0:01:08 42500 -- (-2131.513) (-2121.499) [-2119.110] (-2135.454) * (-2119.269) (-2121.775) [-2127.908] (-2132.768) -- 0:01:07 43000 -- [-2126.994] (-2119.959) (-2119.250) (-2124.491) * (-2120.449) (-2124.484) [-2129.909] (-2128.620) -- 0:01:06 43500 -- [-2124.589] (-2117.883) (-2119.340) (-2131.284) * (-2119.952) (-2123.908) (-2134.099) [-2129.662] -- 0:01:05 44000 -- [-2129.379] (-2117.823) (-2121.029) (-2122.675) * [-2119.762] (-2125.849) (-2129.749) (-2128.162) -- 0:01:05 44500 -- (-2141.271) (-2119.316) (-2122.971) [-2122.098] * (-2120.432) (-2117.956) (-2139.290) [-2127.440] -- 0:01:04 45000 -- (-2130.170) (-2119.838) [-2124.625] (-2120.002) * [-2120.789] (-2119.828) (-2130.531) (-2127.534) -- 0:01:03 Average standard deviation of split frequencies: 0.024400 45500 -- (-2123.528) (-2119.321) (-2124.262) [-2120.394] * (-2120.263) (-2118.867) (-2129.096) [-2126.354] -- 0:01:02 46000 -- [-2129.761] (-2122.221) (-2119.935) (-2119.777) * [-2119.199] (-2119.874) (-2130.458) (-2129.343) -- 0:01:02 46500 -- (-2132.189) (-2121.528) (-2120.555) [-2118.260] * (-2119.045) (-2118.988) [-2125.043] (-2127.221) -- 0:01:01 47000 -- (-2126.854) (-2120.237) (-2119.814) [-2118.551] * (-2118.898) (-2119.330) (-2126.499) [-2125.825] -- 0:01:00 47500 -- [-2128.967] (-2120.959) (-2120.250) (-2120.732) * (-2118.809) [-2121.787] (-2134.401) (-2134.902) -- 0:01:20 48000 -- (-2125.092) (-2118.680) [-2120.098] (-2121.315) * (-2120.346) (-2118.975) [-2130.280] (-2131.783) -- 0:01:19 48500 -- (-2129.329) (-2118.805) [-2119.784] (-2124.230) * (-2120.385) (-2122.372) (-2141.676) [-2131.558] -- 0:01:18 49000 -- [-2127.723] (-2120.427) (-2119.715) (-2122.116) * (-2123.996) [-2118.969] (-2136.837) (-2128.616) -- 0:01:17 49500 -- (-2131.637) [-2120.128] (-2120.322) (-2122.082) * (-2119.022) (-2120.193) [-2125.200] (-2132.957) -- 0:01:16 50000 -- [-2137.908] (-2127.200) (-2120.143) (-2123.418) * [-2118.779] (-2121.925) (-2133.317) (-2130.457) -- 0:01:16 Average standard deviation of split frequencies: 0.019538 50500 -- (-2136.186) (-2121.606) (-2120.293) [-2122.503] * (-2120.790) (-2120.421) [-2131.692] (-2120.804) -- 0:01:15 51000 -- (-2126.184) (-2118.875) [-2119.814] (-2121.849) * [-2122.756] (-2119.232) (-2130.776) (-2121.708) -- 0:01:14 51500 -- [-2133.382] (-2119.805) (-2120.528) (-2121.297) * (-2120.747) [-2119.031] (-2135.521) (-2121.010) -- 0:01:13 52000 -- (-2127.810) (-2121.195) [-2119.728] (-2120.145) * [-2118.735] (-2120.195) (-2134.074) (-2120.168) -- 0:01:12 52500 -- (-2131.866) (-2122.823) (-2118.862) [-2119.335] * (-2118.849) (-2119.564) (-2132.689) [-2121.220] -- 0:01:12 53000 -- (-2129.289) [-2122.021] (-2122.116) (-2119.040) * (-2120.991) (-2120.061) (-2128.987) [-2123.504] -- 0:01:11 53500 -- (-2134.605) [-2119.835] (-2122.004) (-2121.150) * (-2119.962) (-2120.051) [-2127.024] (-2124.303) -- 0:01:10 54000 -- (-2137.208) (-2120.943) [-2119.558] (-2119.597) * (-2118.088) (-2121.976) [-2124.637] (-2124.227) -- 0:01:10 54500 -- (-2123.060) (-2121.900) (-2120.026) [-2120.781] * (-2122.465) (-2123.728) (-2127.813) [-2123.275] -- 0:01:09 55000 -- [-2121.820] (-2124.712) (-2119.929) (-2119.816) * (-2120.889) [-2120.690] (-2126.362) (-2122.958) -- 0:01:08 Average standard deviation of split frequencies: 0.020203 55500 -- (-2120.074) (-2124.631) (-2121.764) [-2119.989] * [-2120.146] (-2119.538) (-2129.859) (-2124.123) -- 0:01:08 56000 -- (-2120.349) (-2120.182) (-2120.618) [-2122.251] * (-2120.694) [-2119.403] (-2125.609) (-2121.512) -- 0:01:07 56500 -- [-2120.551] (-2120.902) (-2121.450) (-2125.281) * (-2117.852) [-2123.495] (-2127.563) (-2121.407) -- 0:01:06 57000 -- (-2122.171) (-2122.707) (-2119.185) [-2120.042] * [-2118.491] (-2123.520) (-2132.100) (-2119.691) -- 0:01:06 57500 -- (-2119.173) (-2124.913) (-2119.132) [-2120.022] * (-2118.199) (-2121.508) (-2130.541) [-2119.987] -- 0:01:05 58000 -- [-2119.979] (-2121.724) (-2119.710) (-2125.076) * (-2119.945) [-2121.705] (-2129.124) (-2121.278) -- 0:01:04 58500 -- (-2119.255) (-2123.296) (-2120.476) [-2121.497] * [-2121.099] (-2121.606) (-2128.733) (-2125.814) -- 0:01:04 59000 -- [-2122.201] (-2123.361) (-2119.976) (-2118.625) * (-2120.704) (-2119.204) (-2134.541) [-2123.862] -- 0:01:03 59500 -- [-2121.031] (-2120.168) (-2121.700) (-2118.884) * [-2124.401] (-2118.772) (-2126.165) (-2123.570) -- 0:01:03 60000 -- (-2118.968) (-2122.257) [-2120.657] (-2118.661) * (-2122.709) [-2123.492] (-2134.620) (-2122.732) -- 0:01:02 Average standard deviation of split frequencies: 0.024947 60500 -- (-2120.501) [-2121.638] (-2121.989) (-2120.204) * [-2123.863] (-2118.840) (-2132.743) (-2122.897) -- 0:01:02 61000 -- (-2119.324) (-2119.851) [-2123.702] (-2118.671) * (-2120.693) (-2118.748) (-2129.507) [-2121.222] -- 0:01:01 61500 -- (-2123.096) [-2121.292] (-2121.391) (-2119.289) * (-2118.478) (-2118.851) (-2133.455) [-2118.632] -- 0:01:01 62000 -- [-2121.990] (-2119.650) (-2121.715) (-2118.389) * (-2118.223) (-2119.813) (-2133.703) [-2119.073] -- 0:01:15 62500 -- (-2119.108) [-2118.787] (-2122.773) (-2118.384) * [-2119.583] (-2119.467) (-2132.106) (-2120.134) -- 0:01:15 63000 -- (-2119.300) (-2121.000) (-2119.621) [-2118.663] * [-2120.672] (-2118.436) (-2132.659) (-2119.511) -- 0:01:14 63500 -- (-2119.690) [-2119.582] (-2119.828) (-2120.465) * (-2121.527) (-2118.489) (-2125.336) [-2120.373] -- 0:01:13 64000 -- (-2121.577) (-2119.768) [-2119.369] (-2119.503) * (-2122.877) (-2119.896) [-2127.952] (-2119.295) -- 0:01:13 64500 -- (-2119.726) (-2120.012) (-2119.443) [-2120.161] * (-2124.410) [-2119.982] (-2127.961) (-2119.681) -- 0:01:12 65000 -- (-2119.702) (-2118.532) (-2120.370) [-2119.558] * [-2118.653] (-2123.612) (-2132.500) (-2120.331) -- 0:01:11 Average standard deviation of split frequencies: 0.020676 65500 -- [-2120.753] (-2118.641) (-2119.552) (-2119.603) * (-2119.756) [-2124.710] (-2136.376) (-2120.376) -- 0:01:11 66000 -- (-2121.299) [-2120.252] (-2121.120) (-2121.070) * [-2119.977] (-2118.524) (-2133.436) (-2121.173) -- 0:01:10 66500 -- (-2120.407) (-2119.741) (-2120.530) [-2119.629] * (-2119.165) (-2118.652) [-2131.012] (-2122.611) -- 0:01:10 67000 -- (-2121.721) (-2118.766) [-2118.566] (-2120.007) * [-2120.570] (-2119.825) (-2134.232) (-2118.206) -- 0:01:09 67500 -- (-2121.576) (-2120.261) [-2118.638] (-2119.268) * (-2122.413) (-2118.569) [-2125.693] (-2118.390) -- 0:01:09 68000 -- (-2121.418) [-2121.011] (-2119.665) (-2120.213) * (-2120.871) [-2119.501] (-2132.561) (-2118.517) -- 0:01:08 68500 -- (-2119.420) [-2119.647] (-2120.421) (-2121.508) * (-2122.410) (-2119.839) [-2134.102] (-2121.218) -- 0:01:07 69000 -- [-2119.472] (-2119.656) (-2120.156) (-2119.836) * [-2119.453] (-2120.738) (-2130.603) (-2119.569) -- 0:01:07 69500 -- (-2119.892) [-2118.897] (-2123.356) (-2120.179) * [-2118.434] (-2119.557) (-2137.016) (-2119.508) -- 0:01:06 70000 -- (-2119.580) (-2119.202) (-2124.381) [-2122.637] * (-2121.256) (-2118.479) (-2132.541) [-2118.503] -- 0:01:06 Average standard deviation of split frequencies: 0.018530 70500 -- (-2120.172) [-2118.729] (-2119.989) (-2124.563) * [-2119.204] (-2119.978) (-2135.785) (-2118.506) -- 0:01:05 71000 -- (-2122.795) [-2119.822] (-2122.056) (-2123.009) * (-2119.717) [-2119.450] (-2130.358) (-2118.305) -- 0:01:05 71500 -- (-2120.411) (-2120.743) (-2120.371) [-2122.841] * [-2118.424] (-2119.627) (-2129.018) (-2119.070) -- 0:01:04 72000 -- (-2121.355) (-2120.927) (-2120.366) [-2118.166] * (-2119.934) (-2119.233) (-2126.376) [-2118.488] -- 0:01:04 72500 -- (-2121.690) (-2119.483) (-2122.568) [-2119.184] * [-2120.734] (-2122.919) (-2130.688) (-2119.171) -- 0:01:03 73000 -- (-2120.927) (-2119.344) [-2120.245] (-2120.012) * (-2118.971) (-2121.157) (-2132.569) [-2121.187] -- 0:01:03 73500 -- [-2121.887] (-2120.515) (-2119.495) (-2121.717) * (-2118.421) [-2120.337] (-2128.381) (-2121.196) -- 0:01:03 74000 -- [-2121.916] (-2119.475) (-2120.011) (-2120.880) * (-2118.816) [-2121.341] (-2133.723) (-2120.923) -- 0:01:02 74500 -- (-2121.728) (-2118.757) (-2118.650) [-2120.197] * (-2121.379) (-2120.539) [-2125.555] (-2121.360) -- 0:01:02 75000 -- (-2124.215) (-2118.737) [-2118.651] (-2121.418) * (-2119.775) (-2118.627) (-2133.075) [-2118.934] -- 0:01:01 Average standard deviation of split frequencies: 0.018953 75500 -- (-2121.733) (-2119.629) [-2118.358] (-2119.895) * (-2119.588) [-2118.787] (-2127.970) (-2119.630) -- 0:01:01 76000 -- [-2120.875] (-2119.722) (-2117.826) (-2119.572) * (-2119.110) (-2121.293) (-2127.975) [-2119.221] -- 0:01:00 76500 -- (-2120.736) [-2119.646] (-2117.824) (-2118.663) * [-2118.937] (-2122.065) (-2134.126) (-2120.626) -- 0:01:00 77000 -- (-2121.378) [-2121.631] (-2117.933) (-2119.167) * (-2119.390) (-2119.320) [-2130.491] (-2120.532) -- 0:00:59 77500 -- (-2120.316) (-2119.261) [-2120.421] (-2119.165) * (-2120.586) [-2118.744] (-2137.708) (-2120.704) -- 0:01:11 78000 -- (-2119.704) [-2121.965] (-2120.748) (-2119.120) * (-2119.002) (-2118.187) (-2123.762) [-2120.143] -- 0:01:10 78500 -- [-2119.570] (-2122.356) (-2120.503) (-2119.927) * [-2119.002] (-2120.426) (-2124.078) (-2117.842) -- 0:01:10 79000 -- (-2118.740) [-2120.329] (-2121.288) (-2120.067) * (-2118.540) [-2118.686] (-2122.379) (-2118.124) -- 0:01:09 79500 -- [-2118.427] (-2125.777) (-2121.118) (-2120.213) * (-2118.650) (-2119.445) (-2120.926) [-2121.199] -- 0:01:09 80000 -- (-2118.518) (-2124.883) [-2120.817] (-2119.903) * (-2118.568) (-2119.572) [-2120.882] (-2122.098) -- 0:01:09 Average standard deviation of split frequencies: 0.022077 80500 -- (-2118.942) (-2121.977) [-2119.382] (-2119.742) * (-2118.179) [-2118.022] (-2123.226) (-2120.523) -- 0:01:08 81000 -- (-2124.959) (-2120.563) [-2118.856] (-2119.783) * [-2118.480] (-2117.956) (-2121.567) (-2122.005) -- 0:01:08 81500 -- (-2119.021) (-2120.187) (-2120.365) [-2122.722] * (-2118.090) [-2120.617] (-2124.523) (-2119.898) -- 0:01:07 82000 -- (-2119.949) [-2119.489] (-2118.947) (-2120.872) * (-2118.279) [-2121.885] (-2123.292) (-2120.030) -- 0:01:07 82500 -- (-2119.529) (-2120.532) [-2120.091] (-2120.398) * [-2122.118] (-2122.079) (-2123.687) (-2121.408) -- 0:01:06 83000 -- (-2119.572) [-2118.215] (-2122.586) (-2121.283) * (-2122.131) (-2121.759) (-2120.026) [-2122.399] -- 0:01:06 83500 -- (-2119.542) (-2120.210) [-2120.930] (-2117.891) * (-2123.803) (-2123.330) (-2122.874) [-2122.296] -- 0:01:05 84000 -- [-2120.042] (-2120.359) (-2122.188) (-2117.891) * (-2127.933) (-2123.270) [-2119.367] (-2119.626) -- 0:01:05 84500 -- (-2119.252) (-2120.888) (-2120.517) [-2118.090] * (-2126.532) (-2119.898) [-2119.482] (-2119.884) -- 0:01:05 85000 -- (-2119.100) [-2123.823] (-2119.574) (-2120.597) * (-2128.037) (-2121.118) [-2119.812] (-2119.773) -- 0:01:04 Average standard deviation of split frequencies: 0.021652 85500 -- [-2118.874] (-2118.516) (-2121.489) (-2121.906) * (-2119.838) (-2120.059) (-2121.605) [-2119.058] -- 0:01:04 86000 -- (-2119.293) [-2118.252] (-2121.378) (-2121.764) * (-2121.795) [-2118.707] (-2118.572) (-2117.941) -- 0:01:03 86500 -- [-2120.178] (-2119.230) (-2118.532) (-2122.022) * [-2118.801] (-2119.508) (-2118.376) (-2121.444) -- 0:01:03 87000 -- (-2121.323) (-2121.011) (-2118.424) [-2120.306] * (-2120.958) [-2119.206] (-2118.485) (-2117.966) -- 0:01:02 87500 -- (-2118.173) (-2120.573) (-2118.425) [-2120.237] * [-2119.836] (-2118.734) (-2118.014) (-2122.897) -- 0:01:02 88000 -- (-2118.270) (-2120.930) [-2117.848] (-2120.579) * [-2119.597] (-2118.557) (-2119.042) (-2122.483) -- 0:01:02 88500 -- (-2118.886) (-2120.643) [-2117.880] (-2120.022) * [-2118.800] (-2123.612) (-2121.126) (-2121.818) -- 0:01:01 89000 -- [-2118.125] (-2121.360) (-2118.941) (-2120.019) * (-2119.597) (-2119.214) (-2120.127) [-2119.980] -- 0:01:01 89500 -- (-2118.125) [-2119.483] (-2121.239) (-2120.420) * (-2119.213) (-2118.748) [-2118.445] (-2119.018) -- 0:01:01 90000 -- (-2119.388) (-2120.643) [-2121.500] (-2118.112) * [-2119.017] (-2119.393) (-2118.852) (-2119.066) -- 0:01:00 Average standard deviation of split frequencies: 0.018977 90500 -- (-2120.298) (-2120.069) [-2118.911] (-2117.704) * (-2119.060) [-2118.638] (-2118.792) (-2121.605) -- 0:01:00 91000 -- [-2118.421] (-2122.042) (-2120.715) (-2118.087) * (-2118.136) (-2118.000) [-2119.293] (-2122.517) -- 0:00:59 91500 -- (-2119.244) [-2118.293] (-2121.328) (-2117.664) * (-2119.062) [-2119.791] (-2120.134) (-2121.459) -- 0:00:59 92000 -- (-2120.824) (-2118.436) (-2120.757) [-2117.664] * (-2124.184) (-2118.474) [-2117.872] (-2119.360) -- 0:00:59 92500 -- (-2122.606) (-2117.993) [-2121.256] (-2117.783) * [-2119.955] (-2119.501) (-2118.417) (-2120.472) -- 0:01:08 93000 -- [-2120.636] (-2119.230) (-2122.583) (-2120.727) * (-2123.401) [-2117.788] (-2118.802) (-2121.376) -- 0:01:08 93500 -- [-2121.819] (-2120.014) (-2121.911) (-2119.038) * [-2118.782] (-2118.043) (-2120.847) (-2120.240) -- 0:01:07 94000 -- (-2119.275) (-2122.129) [-2122.414] (-2119.037) * (-2118.782) (-2120.140) (-2118.920) [-2121.423] -- 0:01:07 94500 -- (-2121.183) (-2120.174) (-2118.611) [-2121.779] * (-2123.819) [-2118.654] (-2119.437) (-2119.404) -- 0:01:07 95000 -- (-2117.940) (-2120.179) [-2118.940] (-2121.724) * (-2124.576) (-2118.304) [-2120.525] (-2119.428) -- 0:01:06 Average standard deviation of split frequencies: 0.022588 95500 -- (-2119.124) (-2120.457) (-2118.828) [-2120.276] * (-2121.460) (-2118.303) (-2124.597) [-2118.883] -- 0:01:06 96000 -- (-2120.088) (-2119.237) [-2119.007] (-2120.274) * (-2122.048) (-2118.270) (-2123.807) [-2118.804] -- 0:01:05 96500 -- (-2120.107) (-2119.648) (-2118.870) [-2119.646] * [-2117.910] (-2119.973) (-2122.176) (-2120.351) -- 0:01:05 97000 -- [-2119.895] (-2121.440) (-2119.006) (-2120.010) * (-2118.292) (-2120.268) [-2121.058] (-2118.463) -- 0:01:05 97500 -- (-2118.933) [-2122.708] (-2120.035) (-2122.986) * (-2119.197) [-2119.111] (-2122.883) (-2121.046) -- 0:01:04 98000 -- (-2120.472) (-2124.049) (-2118.352) [-2120.132] * [-2121.727] (-2118.037) (-2125.171) (-2126.736) -- 0:01:04 98500 -- (-2121.297) (-2124.638) [-2119.196] (-2119.029) * (-2125.763) [-2118.564] (-2127.087) (-2121.899) -- 0:01:04 99000 -- [-2119.191] (-2120.090) (-2119.856) (-2119.890) * (-2121.355) (-2119.644) (-2123.508) [-2120.176] -- 0:01:03 99500 -- [-2119.369] (-2120.455) (-2119.743) (-2119.703) * [-2121.358] (-2122.056) (-2122.385) (-2120.260) -- 0:01:03 100000 -- (-2120.127) [-2120.313] (-2118.697) (-2119.651) * (-2125.839) (-2120.970) [-2121.640] (-2120.131) -- 0:01:02 Average standard deviation of split frequencies: 0.018211 100500 -- [-2118.976] (-2123.420) (-2120.813) (-2119.558) * (-2123.306) [-2120.964] (-2121.035) (-2119.745) -- 0:01:02 101000 -- [-2119.319] (-2125.157) (-2119.690) (-2119.288) * [-2119.569] (-2122.835) (-2120.299) (-2119.117) -- 0:01:02 101500 -- (-2120.376) (-2120.730) (-2119.015) [-2117.827] * (-2119.545) (-2127.163) (-2120.477) [-2119.285] -- 0:01:01 102000 -- (-2119.642) [-2119.583] (-2119.196) (-2121.140) * (-2119.766) (-2122.940) (-2120.395) [-2119.134] -- 0:01:01 102500 -- (-2124.321) [-2119.811] (-2119.307) (-2118.328) * (-2123.388) (-2123.464) (-2123.285) [-2120.308] -- 0:01:01 103000 -- (-2117.707) [-2122.882] (-2119.586) (-2118.312) * (-2121.605) [-2122.120] (-2125.454) (-2118.405) -- 0:01:00 103500 -- [-2118.446] (-2125.647) (-2120.679) (-2120.581) * (-2120.032) [-2120.900] (-2129.166) (-2118.594) -- 0:01:00 104000 -- [-2118.599] (-2118.946) (-2121.578) (-2120.708) * (-2120.813) (-2121.093) [-2125.001] (-2118.445) -- 0:01:00 104500 -- (-2118.585) [-2121.200] (-2119.063) (-2119.313) * (-2119.397) [-2121.126] (-2119.624) (-2123.265) -- 0:00:59 105000 -- (-2119.838) (-2122.644) (-2121.067) [-2120.160] * (-2121.358) (-2119.300) (-2118.745) [-2125.012] -- 0:00:59 Average standard deviation of split frequencies: 0.018424 105500 -- (-2120.436) (-2122.571) (-2119.177) [-2122.459] * (-2122.132) (-2118.209) [-2118.534] (-2121.849) -- 0:00:59 106000 -- (-2121.987) [-2121.971] (-2119.123) (-2118.947) * (-2118.917) (-2120.444) [-2121.935] (-2120.584) -- 0:00:59 106500 -- (-2123.770) (-2121.009) (-2118.831) [-2120.166] * (-2121.638) (-2119.195) [-2120.328] (-2121.774) -- 0:00:58 107000 -- (-2122.061) [-2119.022] (-2119.758) (-2123.183) * (-2121.850) (-2118.939) (-2120.649) [-2120.388] -- 0:00:58 107500 -- (-2121.339) [-2118.530] (-2120.776) (-2122.519) * (-2124.260) (-2121.098) (-2121.095) [-2121.067] -- 0:00:58 108000 -- (-2121.741) (-2120.985) [-2122.275] (-2122.371) * (-2122.666) (-2123.337) (-2122.672) [-2119.108] -- 0:01:06 108500 -- (-2122.142) (-2120.823) (-2121.905) [-2121.133] * (-2120.986) (-2121.226) (-2122.262) [-2119.960] -- 0:01:05 109000 -- (-2120.289) [-2122.575] (-2120.821) (-2119.625) * (-2122.933) (-2120.010) (-2117.877) [-2121.795] -- 0:01:05 109500 -- (-2119.009) [-2122.384] (-2121.548) (-2119.175) * (-2118.943) (-2122.078) (-2127.992) [-2120.863] -- 0:01:05 110000 -- (-2119.757) (-2122.369) [-2121.477] (-2120.075) * [-2119.600] (-2120.060) (-2125.366) (-2118.881) -- 0:01:04 Average standard deviation of split frequencies: 0.016613 110500 -- (-2123.088) (-2120.906) (-2121.075) [-2122.805] * (-2119.905) (-2123.040) [-2121.032] (-2120.257) -- 0:01:04 111000 -- (-2120.400) (-2121.535) [-2119.326] (-2122.665) * (-2119.905) [-2120.050] (-2120.077) (-2119.983) -- 0:01:04 111500 -- [-2118.658] (-2119.740) (-2119.653) (-2122.814) * (-2119.549) [-2120.015] (-2119.509) (-2120.380) -- 0:01:03 112000 -- [-2119.764] (-2119.087) (-2118.767) (-2121.923) * (-2119.353) (-2120.382) [-2122.843] (-2119.731) -- 0:01:03 112500 -- [-2120.445] (-2119.705) (-2119.350) (-2125.689) * [-2121.254] (-2120.178) (-2119.579) (-2118.738) -- 0:01:03 113000 -- [-2120.177] (-2122.080) (-2120.212) (-2123.131) * [-2119.431] (-2120.317) (-2121.731) (-2118.804) -- 0:01:02 113500 -- (-2120.686) (-2119.858) (-2119.880) [-2121.647] * [-2120.244] (-2123.449) (-2122.236) (-2119.912) -- 0:01:02 114000 -- (-2122.633) [-2119.858] (-2120.905) (-2122.223) * (-2125.758) (-2125.857) (-2124.693) [-2118.894] -- 0:01:02 114500 -- (-2119.457) (-2119.498) (-2119.377) [-2120.862] * (-2122.257) (-2122.793) [-2121.813] (-2118.894) -- 0:01:01 115000 -- (-2123.755) (-2119.617) [-2118.524] (-2119.845) * (-2120.247) (-2123.569) (-2124.427) [-2122.093] -- 0:01:01 Average standard deviation of split frequencies: 0.019100 115500 -- (-2125.031) (-2124.437) (-2118.524) [-2120.887] * [-2120.141] (-2122.550) (-2123.497) (-2123.735) -- 0:01:01 116000 -- (-2120.673) (-2122.528) [-2120.909] (-2120.054) * [-2119.198] (-2124.149) (-2123.833) (-2121.007) -- 0:01:00 116500 -- (-2119.146) [-2120.045] (-2118.409) (-2119.658) * (-2121.708) (-2123.522) (-2123.762) [-2119.072] -- 0:01:00 117000 -- (-2120.473) (-2119.987) (-2120.780) [-2120.114] * (-2120.917) (-2122.277) [-2119.582] (-2119.417) -- 0:01:00 117500 -- (-2117.914) (-2121.336) (-2121.049) [-2120.185] * (-2118.510) (-2120.742) [-2118.312] (-2119.250) -- 0:01:00 118000 -- (-2121.192) [-2120.288] (-2119.568) (-2118.967) * (-2124.436) (-2124.801) [-2122.847] (-2120.062) -- 0:00:59 118500 -- (-2124.507) (-2120.475) [-2120.440] (-2119.472) * [-2121.483] (-2121.877) (-2118.530) (-2119.997) -- 0:00:59 119000 -- (-2125.254) [-2120.367] (-2121.041) (-2119.721) * (-2118.239) (-2122.856) (-2119.175) [-2119.986] -- 0:00:59 119500 -- (-2123.343) (-2120.315) (-2124.570) [-2119.586] * (-2121.839) (-2123.515) [-2119.901] (-2120.488) -- 0:00:58 120000 -- (-2123.493) (-2120.731) (-2123.528) [-2119.892] * [-2118.933] (-2121.942) (-2120.483) (-2119.925) -- 0:00:58 Average standard deviation of split frequencies: 0.016244 120500 -- (-2121.403) (-2119.646) (-2126.138) [-2120.733] * (-2119.469) [-2121.020] (-2120.182) (-2118.579) -- 0:00:58 121000 -- (-2120.492) (-2121.854) (-2123.419) [-2120.691] * (-2119.086) [-2120.867] (-2119.532) (-2118.492) -- 0:00:58 121500 -- [-2119.475] (-2119.901) (-2122.666) (-2122.189) * [-2121.491] (-2119.654) (-2118.807) (-2121.149) -- 0:00:57 122000 -- (-2119.456) [-2120.070] (-2123.413) (-2121.683) * (-2121.563) (-2119.200) [-2118.426] (-2121.871) -- 0:00:57 122500 -- [-2119.624] (-2122.798) (-2124.957) (-2122.318) * (-2121.749) [-2118.917] (-2118.732) (-2120.776) -- 0:00:57 123000 -- (-2121.347) [-2120.551] (-2124.488) (-2124.549) * (-2120.843) [-2119.032] (-2118.900) (-2120.542) -- 0:01:04 123500 -- [-2120.415] (-2122.651) (-2123.428) (-2123.596) * (-2122.312) [-2119.864] (-2125.233) (-2122.237) -- 0:01:03 124000 -- (-2120.792) (-2118.073) [-2121.457] (-2122.717) * (-2119.239) (-2117.684) (-2124.960) [-2119.056] -- 0:01:03 124500 -- (-2123.001) [-2119.867] (-2120.040) (-2121.866) * [-2120.549] (-2117.677) (-2126.231) (-2121.228) -- 0:01:03 125000 -- (-2119.434) [-2122.595] (-2120.385) (-2126.466) * [-2120.053] (-2119.261) (-2126.622) (-2120.416) -- 0:01:03 Average standard deviation of split frequencies: 0.011847 125500 -- (-2119.018) (-2121.814) (-2124.545) [-2122.411] * (-2122.230) (-2120.207) (-2127.126) [-2121.495] -- 0:01:02 126000 -- (-2119.762) [-2119.875] (-2122.620) (-2121.368) * (-2123.649) (-2121.630) (-2122.942) [-2121.553] -- 0:01:02 126500 -- (-2120.834) [-2118.541] (-2121.080) (-2118.338) * (-2122.610) (-2119.607) [-2124.050] (-2120.922) -- 0:01:02 127000 -- [-2121.908] (-2121.408) (-2120.386) (-2119.942) * [-2120.766] (-2121.420) (-2122.232) (-2121.161) -- 0:01:01 127500 -- (-2120.054) (-2122.356) (-2118.640) [-2124.369] * (-2120.245) (-2119.555) (-2121.838) [-2121.183] -- 0:01:01 128000 -- (-2120.002) (-2120.026) [-2118.447] (-2119.486) * (-2121.125) (-2119.504) [-2121.310] (-2124.444) -- 0:01:01 128500 -- [-2121.567] (-2121.754) (-2119.073) (-2119.847) * (-2124.911) (-2119.523) [-2121.126] (-2121.634) -- 0:01:01 129000 -- (-2121.561) (-2124.288) (-2118.191) [-2120.577] * (-2122.761) [-2119.523] (-2121.845) (-2120.515) -- 0:01:00 129500 -- (-2118.663) (-2124.288) [-2117.852] (-2122.491) * [-2122.032] (-2117.921) (-2119.179) (-2119.975) -- 0:01:00 130000 -- (-2119.996) (-2122.136) [-2118.269] (-2122.365) * (-2126.715) (-2118.149) [-2118.063] (-2120.006) -- 0:01:00 Average standard deviation of split frequencies: 0.012912 130500 -- (-2117.972) (-2120.250) (-2120.089) [-2120.007] * [-2120.457] (-2118.842) (-2118.754) (-2121.077) -- 0:00:59 131000 -- (-2119.223) (-2119.319) [-2121.457] (-2120.007) * (-2120.527) (-2119.452) [-2118.971] (-2124.856) -- 0:00:59 131500 -- [-2118.078] (-2120.010) (-2120.092) (-2119.998) * (-2118.848) (-2120.093) [-2118.921] (-2119.145) -- 0:00:59 132000 -- [-2118.837] (-2119.401) (-2120.403) (-2120.301) * (-2118.094) (-2120.257) [-2120.278] (-2119.316) -- 0:00:59 132500 -- (-2120.282) (-2120.224) (-2124.390) [-2119.742] * (-2118.094) (-2123.139) [-2120.910] (-2119.707) -- 0:00:58 133000 -- (-2117.899) [-2119.862] (-2120.505) (-2119.767) * (-2118.746) [-2123.964] (-2123.299) (-2118.509) -- 0:00:58 133500 -- (-2118.286) (-2123.401) (-2119.548) [-2120.621] * (-2119.227) (-2123.580) (-2122.091) [-2118.505] -- 0:00:58 134000 -- (-2123.046) (-2120.526) [-2118.657] (-2126.167) * (-2119.895) [-2124.947] (-2127.773) (-2120.997) -- 0:00:58 134500 -- [-2121.463] (-2119.206) (-2118.388) (-2120.796) * (-2118.940) [-2120.357] (-2126.697) (-2120.713) -- 0:00:57 135000 -- (-2119.051) (-2118.832) [-2119.748] (-2124.383) * [-2119.424] (-2120.186) (-2123.227) (-2120.744) -- 0:00:57 Average standard deviation of split frequencies: 0.011128 135500 -- (-2120.297) [-2118.653] (-2118.690) (-2121.468) * (-2119.004) (-2120.646) (-2118.797) [-2119.104] -- 0:00:57 136000 -- (-2120.175) [-2118.695] (-2120.198) (-2119.042) * [-2119.265] (-2121.305) (-2120.189) (-2119.522) -- 0:00:57 136500 -- (-2120.523) [-2118.240] (-2118.626) (-2119.106) * (-2122.606) (-2119.645) (-2119.224) [-2118.438] -- 0:00:56 137000 -- (-2121.254) (-2121.643) (-2118.713) [-2120.126] * (-2125.100) (-2118.316) (-2125.297) [-2118.876] -- 0:00:56 137500 -- (-2119.345) (-2118.668) (-2118.812) [-2122.017] * (-2120.129) (-2117.982) (-2117.859) [-2118.918] -- 0:00:56 138000 -- (-2119.851) (-2122.816) [-2119.488] (-2123.577) * [-2120.880] (-2117.950) (-2117.995) (-2119.345) -- 0:01:02 138500 -- (-2124.861) [-2121.316] (-2121.599) (-2121.946) * [-2120.527] (-2118.929) (-2118.943) (-2119.697) -- 0:01:02 139000 -- (-2124.444) [-2121.502] (-2119.594) (-2121.668) * (-2120.255) [-2117.827] (-2118.871) (-2123.815) -- 0:01:01 139500 -- (-2124.077) (-2118.311) [-2118.529] (-2120.171) * (-2120.304) [-2119.208] (-2119.382) (-2120.483) -- 0:01:01 140000 -- (-2120.979) (-2118.264) [-2119.662] (-2120.627) * (-2119.055) (-2119.799) [-2119.856] (-2120.248) -- 0:01:01 Average standard deviation of split frequencies: 0.012102 140500 -- (-2120.979) [-2122.257] (-2120.828) (-2118.998) * (-2119.157) (-2121.385) [-2118.404] (-2120.215) -- 0:01:01 141000 -- (-2118.867) [-2122.984] (-2119.757) (-2118.417) * (-2121.562) (-2117.986) [-2118.802] (-2118.919) -- 0:01:00 141500 -- (-2119.040) (-2122.589) (-2120.573) [-2118.950] * (-2125.856) [-2119.329] (-2118.909) (-2119.590) -- 0:01:00 142000 -- [-2119.040] (-2125.050) (-2119.341) (-2124.558) * (-2126.073) (-2124.385) (-2119.239) [-2119.232] -- 0:01:00 142500 -- [-2120.317] (-2121.480) (-2119.009) (-2123.778) * (-2124.430) [-2117.988] (-2119.239) (-2118.831) -- 0:01:00 143000 -- (-2118.821) (-2122.081) [-2119.581] (-2121.229) * (-2121.518) [-2118.096] (-2119.220) (-2121.256) -- 0:00:59 143500 -- (-2119.994) (-2121.361) (-2127.921) [-2118.937] * (-2121.582) (-2120.898) (-2118.945) [-2120.385] -- 0:00:59 144000 -- [-2119.764] (-2120.817) (-2125.213) (-2120.029) * (-2122.720) (-2121.037) (-2118.934) [-2122.710] -- 0:00:59 144500 -- (-2118.567) [-2121.993] (-2121.776) (-2118.582) * (-2123.176) (-2120.598) [-2130.194] (-2119.086) -- 0:00:59 145000 -- [-2121.529] (-2119.689) (-2121.565) (-2121.392) * [-2120.070] (-2118.356) (-2126.963) (-2121.969) -- 0:00:58 Average standard deviation of split frequencies: 0.014784 145500 -- (-2119.310) (-2119.757) [-2121.321] (-2121.798) * [-2119.935] (-2118.050) (-2125.135) (-2119.765) -- 0:00:58 146000 -- [-2120.660] (-2119.629) (-2118.638) (-2122.337) * (-2120.084) (-2119.342) (-2123.849) [-2120.399] -- 0:00:58 146500 -- [-2121.124] (-2119.125) (-2119.352) (-2119.984) * [-2120.207] (-2120.462) (-2119.422) (-2119.862) -- 0:00:58 147000 -- (-2120.986) (-2119.166) [-2118.446] (-2118.700) * [-2120.370] (-2120.140) (-2120.208) (-2121.062) -- 0:00:58 147500 -- (-2118.462) (-2119.607) [-2119.628] (-2118.946) * [-2124.658] (-2118.780) (-2118.478) (-2121.858) -- 0:00:57 148000 -- (-2118.499) [-2119.777] (-2118.323) (-2119.401) * (-2125.975) [-2119.086] (-2119.744) (-2120.447) -- 0:00:57 148500 -- (-2118.762) [-2121.748] (-2119.767) (-2120.090) * (-2127.424) (-2119.762) [-2119.742] (-2124.357) -- 0:00:57 149000 -- (-2121.838) [-2120.179] (-2121.379) (-2120.195) * (-2121.227) (-2119.667) (-2121.897) [-2123.432] -- 0:00:57 149500 -- (-2120.020) (-2119.809) (-2118.682) [-2119.892] * (-2118.393) [-2119.473] (-2121.909) (-2121.860) -- 0:00:56 150000 -- [-2119.628] (-2119.912) (-2119.260) (-2119.980) * (-2120.827) (-2120.129) [-2123.475] (-2118.274) -- 0:00:56 Average standard deviation of split frequencies: 0.013037 150500 -- [-2119.338] (-2123.924) (-2119.744) (-2120.315) * (-2119.673) (-2120.032) (-2126.473) [-2119.361] -- 0:00:56 151000 -- (-2124.255) [-2120.717] (-2122.446) (-2121.160) * [-2119.049] (-2126.446) (-2119.977) (-2118.446) -- 0:00:56 151500 -- (-2123.106) (-2120.307) [-2122.260] (-2120.887) * (-2119.170) [-2120.944] (-2119.329) (-2118.185) -- 0:00:56 152000 -- (-2121.624) (-2120.200) (-2121.792) [-2120.755] * (-2118.417) (-2118.425) [-2118.954] (-2119.024) -- 0:00:55 152500 -- [-2121.628] (-2120.200) (-2126.356) (-2128.239) * [-2118.229] (-2118.656) (-2120.613) (-2123.429) -- 0:00:55 153000 -- (-2118.760) [-2120.049] (-2120.108) (-2120.438) * (-2118.267) (-2120.006) (-2121.858) [-2121.964] -- 0:01:00 153500 -- (-2118.949) (-2123.430) [-2121.831] (-2122.302) * (-2119.553) [-2120.289] (-2123.437) (-2126.923) -- 0:01:00 154000 -- (-2119.813) (-2122.075) (-2119.525) [-2121.805] * (-2120.017) (-2121.133) (-2119.046) [-2124.771] -- 0:01:00 154500 -- (-2122.658) (-2120.648) [-2118.594] (-2121.477) * (-2121.935) (-2124.169) (-2119.209) [-2123.549] -- 0:01:00 155000 -- (-2119.609) (-2120.191) [-2120.049] (-2122.699) * (-2123.629) (-2121.455) (-2119.929) [-2123.411] -- 0:00:59 Average standard deviation of split frequencies: 0.013201 155500 -- (-2119.671) (-2125.859) [-2119.189] (-2119.638) * [-2122.875] (-2121.000) (-2120.215) (-2124.398) -- 0:00:59 156000 -- (-2120.704) (-2121.007) (-2119.017) [-2119.560] * (-2118.458) (-2122.032) (-2119.838) [-2123.090] -- 0:00:59 156500 -- [-2121.178] (-2119.411) (-2121.735) (-2118.412) * [-2119.659] (-2122.592) (-2120.242) (-2120.760) -- 0:00:59 157000 -- (-2118.866) (-2119.146) [-2118.515] (-2118.448) * (-2119.773) (-2121.656) (-2124.057) [-2120.760] -- 0:00:59 157500 -- (-2118.344) (-2118.704) (-2121.386) [-2120.416] * (-2119.750) (-2120.385) [-2120.994] (-2119.102) -- 0:00:58 158000 -- (-2118.716) [-2119.689] (-2119.896) (-2119.020) * [-2119.570] (-2118.060) (-2120.955) (-2121.281) -- 0:00:58 158500 -- (-2118.758) (-2120.339) [-2121.703] (-2118.724) * (-2120.849) [-2119.355] (-2121.521) (-2118.772) -- 0:00:58 159000 -- (-2118.467) (-2120.225) (-2119.059) [-2119.188] * (-2118.242) (-2118.275) [-2120.423] (-2118.378) -- 0:00:58 159500 -- [-2117.847] (-2121.897) (-2119.948) (-2121.146) * (-2119.386) (-2118.241) [-2120.430] (-2118.219) -- 0:00:57 160000 -- (-2124.272) (-2120.581) (-2119.148) [-2119.575] * (-2120.242) (-2119.693) [-2119.283] (-2120.666) -- 0:00:57 Average standard deviation of split frequencies: 0.012508 160500 -- (-2118.800) (-2119.762) (-2117.883) [-2118.780] * (-2118.108) (-2120.286) (-2118.988) [-2120.961] -- 0:00:57 161000 -- [-2118.558] (-2121.492) (-2118.732) (-2120.132) * (-2117.779) (-2124.400) (-2121.877) [-2119.043] -- 0:00:57 161500 -- (-2122.043) (-2120.869) (-2119.961) [-2118.910] * (-2117.779) (-2122.478) (-2118.662) [-2119.271] -- 0:00:57 162000 -- (-2119.441) (-2121.204) [-2119.499] (-2118.923) * [-2121.120] (-2122.588) (-2118.836) (-2118.569) -- 0:00:56 162500 -- (-2122.450) (-2123.596) (-2119.738) [-2119.547] * (-2125.051) (-2121.401) (-2121.581) [-2118.512] -- 0:00:56 163000 -- (-2122.816) (-2119.771) [-2119.232] (-2121.614) * [-2121.287] (-2121.116) (-2120.623) (-2120.262) -- 0:00:56 163500 -- [-2120.918] (-2121.197) (-2119.232) (-2120.322) * [-2120.936] (-2120.313) (-2120.339) (-2118.924) -- 0:00:56 164000 -- [-2119.638] (-2118.890) (-2118.314) (-2119.290) * (-2120.824) (-2120.557) (-2124.658) [-2118.735] -- 0:00:56 164500 -- [-2122.313] (-2121.569) (-2119.407) (-2120.519) * (-2120.825) (-2119.107) (-2121.186) [-2119.204] -- 0:00:55 165000 -- [-2122.877] (-2119.587) (-2118.357) (-2120.372) * [-2122.787] (-2118.523) (-2121.471) (-2119.308) -- 0:00:55 Average standard deviation of split frequencies: 0.012211 165500 -- [-2127.505] (-2121.047) (-2123.065) (-2118.964) * (-2123.859) (-2119.040) (-2119.471) [-2118.023] -- 0:00:55 166000 -- [-2121.205] (-2118.482) (-2122.645) (-2122.571) * (-2121.193) (-2121.968) (-2119.895) [-2118.294] -- 0:00:55 166500 -- (-2119.428) (-2121.182) [-2121.184] (-2120.105) * (-2119.963) (-2120.987) [-2120.972] (-2119.264) -- 0:00:55 167000 -- (-2118.926) (-2121.210) (-2120.663) [-2118.263] * (-2119.447) (-2126.531) (-2120.749) [-2119.678] -- 0:00:54 167500 -- (-2120.557) [-2119.463] (-2119.648) (-2118.183) * (-2119.167) (-2123.474) (-2122.034) [-2118.504] -- 0:00:54 168000 -- (-2118.654) (-2119.970) [-2121.463] (-2119.194) * (-2119.601) (-2119.694) [-2123.783] (-2119.068) -- 0:00:54 168500 -- (-2118.570) (-2118.485) [-2120.297] (-2121.340) * (-2121.040) [-2118.705] (-2121.897) (-2120.170) -- 0:00:59 169000 -- (-2118.570) (-2118.818) (-2121.005) [-2118.778] * (-2122.532) (-2119.958) [-2119.360] (-2119.929) -- 0:00:59 169500 -- (-2118.852) (-2117.995) [-2118.885] (-2118.569) * (-2120.799) (-2120.166) [-2121.380] (-2121.165) -- 0:00:58 170000 -- [-2121.204] (-2119.219) (-2118.212) (-2119.658) * (-2120.377) (-2121.824) [-2122.453] (-2121.893) -- 0:00:58 Average standard deviation of split frequencies: 0.010281 170500 -- (-2121.032) [-2119.676] (-2118.205) (-2118.246) * (-2121.611) (-2120.939) (-2123.988) [-2122.848] -- 0:00:58 171000 -- (-2119.301) [-2121.553] (-2117.794) (-2118.382) * [-2122.236] (-2119.977) (-2122.352) (-2122.858) -- 0:00:58 171500 -- (-2119.302) (-2120.066) (-2118.050) [-2119.109] * (-2120.360) [-2118.657] (-2126.056) (-2121.848) -- 0:00:57 172000 -- (-2118.833) [-2118.325] (-2124.183) (-2120.570) * [-2119.748] (-2118.189) (-2129.285) (-2125.374) -- 0:00:57 172500 -- (-2119.063) [-2120.174] (-2123.426) (-2119.151) * (-2119.321) (-2118.405) (-2127.916) [-2122.607] -- 0:00:57 173000 -- (-2122.319) (-2122.185) [-2118.346] (-2119.526) * [-2119.218] (-2118.523) (-2120.608) (-2121.111) -- 0:00:57 173500 -- (-2120.273) (-2121.741) (-2118.200) [-2121.015] * (-2122.709) (-2119.257) (-2122.579) [-2118.377] -- 0:00:57 174000 -- (-2118.723) [-2118.637] (-2118.567) (-2121.529) * (-2124.011) (-2120.080) (-2120.996) [-2118.323] -- 0:00:56 174500 -- [-2124.156] (-2118.907) (-2118.567) (-2122.205) * (-2123.563) (-2121.860) [-2118.675] (-2118.299) -- 0:00:56 175000 -- (-2126.352) (-2122.100) (-2118.567) [-2120.301] * (-2125.408) (-2121.634) [-2120.590] (-2119.404) -- 0:00:56 Average standard deviation of split frequencies: 0.011137 175500 -- (-2121.026) (-2118.642) (-2119.055) [-2119.445] * [-2120.251] (-2119.430) (-2118.633) (-2119.349) -- 0:00:56 176000 -- (-2119.263) [-2117.902] (-2120.807) (-2119.569) * [-2119.051] (-2119.349) (-2122.959) (-2121.896) -- 0:00:56 176500 -- (-2119.640) [-2119.111] (-2121.148) (-2122.733) * (-2120.157) [-2118.636] (-2124.357) (-2121.910) -- 0:00:55 177000 -- [-2120.198] (-2119.949) (-2124.794) (-2119.033) * [-2121.629] (-2118.636) (-2127.074) (-2119.308) -- 0:00:55 177500 -- (-2121.059) (-2119.986) (-2119.454) [-2121.613] * (-2124.961) (-2120.786) (-2127.905) [-2119.395] -- 0:00:55 178000 -- (-2121.647) [-2117.964] (-2119.454) (-2118.621) * (-2123.480) (-2120.891) (-2124.260) [-2121.639] -- 0:00:55 178500 -- (-2120.392) [-2117.958] (-2119.726) (-2118.657) * [-2119.819] (-2119.105) (-2125.337) (-2120.471) -- 0:00:55 179000 -- (-2120.018) [-2118.741] (-2120.568) (-2119.755) * (-2122.877) (-2118.333) [-2119.447] (-2120.430) -- 0:00:55 179500 -- [-2119.004] (-2119.465) (-2119.453) (-2119.712) * (-2126.310) [-2119.238] (-2120.677) (-2120.178) -- 0:00:54 180000 -- (-2119.093) (-2119.828) [-2122.575] (-2121.413) * (-2122.100) [-2119.836] (-2127.573) (-2121.809) -- 0:00:54 Average standard deviation of split frequencies: 0.010849 180500 -- (-2121.634) [-2119.863] (-2121.771) (-2119.599) * (-2120.647) (-2121.386) [-2125.360] (-2118.181) -- 0:00:54 181000 -- (-2118.973) (-2120.864) (-2119.344) [-2118.301] * (-2121.646) [-2119.608] (-2119.098) (-2118.335) -- 0:00:54 181500 -- (-2118.889) (-2119.421) (-2119.852) [-2120.092] * (-2123.661) (-2124.141) (-2118.564) [-2118.319] -- 0:00:54 182000 -- [-2119.494] (-2119.994) (-2117.948) (-2121.315) * (-2122.787) (-2120.211) (-2119.233) [-2118.668] -- 0:00:53 182500 -- (-2121.582) [-2120.041] (-2118.275) (-2122.016) * [-2119.095] (-2121.799) (-2119.210) (-2118.655) -- 0:00:53 183000 -- (-2120.434) (-2124.054) (-2119.771) [-2120.128] * (-2119.121) [-2123.802] (-2120.456) (-2121.629) -- 0:00:53 183500 -- (-2118.613) (-2120.972) (-2120.000) [-2120.004] * [-2123.365] (-2125.251) (-2120.148) (-2121.329) -- 0:00:57 184000 -- (-2122.482) [-2123.798] (-2120.655) (-2119.475) * (-2122.416) (-2120.733) (-2121.627) [-2119.284] -- 0:00:57 184500 -- (-2119.642) (-2121.724) [-2118.998] (-2119.252) * [-2122.346] (-2118.476) (-2120.626) (-2118.193) -- 0:00:57 185000 -- (-2118.186) [-2119.517] (-2121.656) (-2122.021) * (-2122.794) [-2118.506] (-2119.467) (-2118.331) -- 0:00:57 Average standard deviation of split frequencies: 0.008490 185500 -- (-2118.206) (-2119.287) [-2119.410] (-2120.745) * [-2120.977] (-2118.378) (-2119.250) (-2118.349) -- 0:00:57 186000 -- (-2120.187) (-2119.487) [-2119.119] (-2118.647) * (-2123.627) (-2118.479) [-2120.160] (-2119.755) -- 0:00:56 186500 -- (-2118.247) (-2119.139) (-2120.374) [-2118.636] * (-2122.488) (-2120.917) [-2119.050] (-2121.048) -- 0:00:56 187000 -- (-2120.547) [-2120.532] (-2120.250) (-2119.012) * [-2119.878] (-2119.254) (-2121.977) (-2121.977) -- 0:00:56 187500 -- [-2120.104] (-2121.941) (-2119.704) (-2119.742) * (-2119.087) (-2120.032) (-2120.348) [-2121.145] -- 0:00:56 188000 -- (-2121.564) (-2121.721) (-2120.711) [-2119.530] * (-2119.478) [-2120.637] (-2119.546) (-2121.801) -- 0:00:56 188500 -- (-2117.888) (-2119.955) [-2119.699] (-2120.198) * [-2119.127] (-2118.826) (-2121.140) (-2120.300) -- 0:00:55 189000 -- [-2121.371] (-2122.263) (-2119.094) (-2122.318) * (-2118.866) [-2118.892] (-2120.169) (-2119.708) -- 0:00:55 189500 -- (-2119.193) (-2123.333) (-2118.795) [-2119.948] * [-2119.002] (-2118.431) (-2123.080) (-2119.681) -- 0:00:55 190000 -- [-2119.032] (-2120.788) (-2119.443) (-2119.507) * (-2119.537) (-2118.118) (-2123.836) [-2118.456] -- 0:00:55 Average standard deviation of split frequencies: 0.010931 190500 -- [-2119.712] (-2119.666) (-2121.265) (-2120.612) * (-2119.509) [-2118.131] (-2120.997) (-2125.302) -- 0:00:55 191000 -- (-2119.770) (-2118.348) (-2119.087) [-2118.928] * [-2118.436] (-2121.570) (-2121.423) (-2119.388) -- 0:00:55 191500 -- [-2121.611] (-2121.014) (-2118.759) (-2122.664) * [-2121.803] (-2120.123) (-2119.637) (-2119.732) -- 0:00:54 192000 -- (-2119.908) (-2123.177) (-2120.151) [-2119.789] * (-2125.741) [-2118.614] (-2120.064) (-2120.254) -- 0:00:54 192500 -- (-2119.849) [-2122.870] (-2119.660) (-2123.298) * [-2121.275] (-2118.953) (-2121.964) (-2124.391) -- 0:00:54 193000 -- (-2118.442) [-2120.957] (-2119.090) (-2120.845) * (-2119.401) [-2118.358] (-2120.615) (-2126.317) -- 0:00:54 193500 -- (-2119.003) (-2119.875) (-2118.890) [-2119.226] * (-2118.832) [-2118.424] (-2119.978) (-2124.584) -- 0:00:54 194000 -- [-2120.387] (-2118.662) (-2119.361) (-2120.775) * [-2120.630] (-2118.438) (-2118.812) (-2124.172) -- 0:00:54 194500 -- (-2119.040) [-2118.426] (-2121.396) (-2122.011) * (-2118.850) (-2121.430) (-2119.318) [-2119.865] -- 0:00:53 195000 -- (-2118.577) [-2120.059] (-2121.843) (-2120.407) * [-2120.030] (-2122.142) (-2120.126) (-2118.876) -- 0:00:53 Average standard deviation of split frequencies: 0.010823 195500 -- (-2118.630) [-2120.199] (-2119.958) (-2120.998) * (-2118.917) (-2118.082) (-2120.135) [-2118.108] -- 0:00:53 196000 -- (-2118.538) [-2118.272] (-2119.751) (-2121.813) * [-2120.249] (-2120.700) (-2119.982) (-2119.293) -- 0:00:53 196500 -- (-2121.204) (-2120.996) (-2119.265) [-2119.810] * (-2119.413) (-2120.975) (-2119.382) [-2119.364] -- 0:00:53 197000 -- [-2118.728] (-2119.026) (-2118.462) (-2121.779) * (-2119.420) (-2118.157) (-2120.855) [-2119.675] -- 0:00:52 197500 -- (-2119.146) (-2119.268) (-2118.966) [-2120.122] * (-2118.711) (-2117.817) (-2119.324) [-2118.062] -- 0:00:52 198000 -- (-2118.839) (-2118.378) [-2118.966] (-2119.701) * (-2118.582) [-2118.296] (-2118.635) (-2118.773) -- 0:00:52 198500 -- (-2118.958) [-2119.274] (-2118.593) (-2119.713) * (-2118.745) (-2120.047) (-2119.690) [-2119.716] -- 0:00:56 199000 -- (-2121.898) (-2117.659) [-2119.471] (-2121.481) * (-2118.895) (-2118.868) [-2121.361] (-2120.942) -- 0:00:56 199500 -- (-2125.614) [-2118.158] (-2120.394) (-2120.285) * (-2119.099) (-2122.516) [-2119.377] (-2122.048) -- 0:00:56 200000 -- (-2124.178) (-2121.071) (-2119.267) [-2118.402] * (-2119.177) [-2120.386] (-2118.102) (-2119.612) -- 0:00:55 Average standard deviation of split frequencies: 0.012137 200500 -- (-2120.562) (-2121.827) [-2119.345] (-2118.161) * (-2119.174) (-2119.329) [-2119.992] (-2120.141) -- 0:00:55 201000 -- (-2120.710) (-2119.326) [-2118.739] (-2120.391) * (-2121.932) [-2120.024] (-2119.981) (-2119.693) -- 0:00:55 201500 -- (-2121.162) [-2118.043] (-2120.844) (-2124.778) * (-2120.535) (-2120.243) (-2118.865) [-2120.976] -- 0:00:55 202000 -- (-2121.219) (-2118.343) [-2120.087] (-2119.363) * (-2121.465) (-2119.739) (-2121.156) [-2122.333] -- 0:00:55 202500 -- [-2122.933] (-2119.995) (-2118.439) (-2119.476) * (-2119.877) [-2118.873] (-2117.901) (-2120.609) -- 0:00:55 203000 -- (-2120.919) [-2117.838] (-2119.494) (-2118.571) * (-2120.061) (-2119.707) [-2118.546] (-2119.646) -- 0:00:54 203500 -- (-2122.709) (-2119.238) (-2119.845) [-2120.363] * (-2121.513) (-2119.571) (-2119.534) [-2121.867] -- 0:00:54 204000 -- [-2120.943] (-2118.569) (-2119.395) (-2121.585) * (-2119.506) (-2120.515) (-2118.521) [-2122.625] -- 0:00:54 204500 -- (-2120.662) (-2117.997) (-2120.094) [-2119.725] * (-2119.357) (-2121.100) [-2119.534] (-2121.824) -- 0:00:54 205000 -- (-2118.498) (-2118.064) (-2118.692) [-2118.196] * (-2119.472) [-2119.709] (-2120.929) (-2121.059) -- 0:00:54 Average standard deviation of split frequencies: 0.010679 205500 -- [-2120.500] (-2121.982) (-2120.727) (-2122.095) * [-2119.087] (-2120.543) (-2119.759) (-2120.895) -- 0:00:54 206000 -- (-2120.606) (-2120.160) (-2119.325) [-2121.007] * [-2118.918] (-2121.167) (-2117.988) (-2121.403) -- 0:00:53 206500 -- (-2118.926) (-2118.909) [-2119.505] (-2118.315) * (-2119.454) (-2119.150) [-2117.963] (-2121.369) -- 0:00:53 207000 -- [-2118.926] (-2119.798) (-2118.904) (-2120.830) * [-2122.166] (-2119.704) (-2117.987) (-2119.912) -- 0:00:53 207500 -- (-2120.859) (-2119.273) [-2122.467] (-2120.972) * [-2120.026] (-2119.821) (-2119.833) (-2119.270) -- 0:00:53 208000 -- (-2119.405) [-2120.041] (-2120.476) (-2120.608) * [-2120.960] (-2122.513) (-2119.030) (-2119.008) -- 0:00:53 208500 -- (-2119.789) (-2119.531) (-2118.501) [-2120.066] * (-2126.626) [-2120.113] (-2118.082) (-2118.817) -- 0:00:53 209000 -- (-2119.245) (-2118.292) (-2120.835) [-2122.655] * (-2121.587) [-2121.409] (-2121.604) (-2120.060) -- 0:00:52 209500 -- (-2120.158) (-2120.007) [-2128.564] (-2119.892) * (-2121.203) (-2120.202) (-2118.919) [-2121.594] -- 0:00:52 210000 -- (-2120.576) (-2120.024) (-2128.221) [-2119.597] * (-2122.428) (-2121.426) (-2118.606) [-2118.172] -- 0:00:52 Average standard deviation of split frequencies: 0.010853 210500 -- (-2123.029) [-2121.246] (-2122.433) (-2119.434) * (-2121.477) (-2120.126) (-2120.905) [-2118.137] -- 0:00:52 211000 -- (-2119.659) (-2120.256) [-2120.496] (-2119.368) * (-2119.720) (-2120.647) (-2125.354) [-2118.147] -- 0:00:52 211500 -- [-2119.011] (-2119.819) (-2119.483) (-2121.270) * (-2121.829) (-2122.019) (-2120.757) [-2118.118] -- 0:00:52 212000 -- (-2120.463) (-2121.718) [-2119.391] (-2122.182) * (-2123.154) [-2119.552] (-2121.493) (-2117.722) -- 0:00:52 212500 -- (-2123.590) (-2118.938) [-2124.012] (-2122.335) * [-2121.162] (-2119.404) (-2120.908) (-2121.358) -- 0:00:51 213000 -- [-2119.509] (-2121.280) (-2120.076) (-2120.769) * [-2119.036] (-2121.017) (-2121.535) (-2119.214) -- 0:00:51 213500 -- [-2119.057] (-2122.427) (-2121.092) (-2123.492) * (-2119.944) (-2121.299) [-2120.497] (-2119.976) -- 0:00:55 214000 -- (-2118.764) (-2118.904) [-2122.151] (-2124.016) * [-2124.786] (-2121.659) (-2119.100) (-2123.766) -- 0:00:55 214500 -- (-2118.367) (-2119.843) [-2122.150] (-2124.137) * (-2122.750) (-2119.752) [-2118.439] (-2121.063) -- 0:00:54 215000 -- (-2123.239) (-2119.723) (-2121.612) [-2123.195] * [-2122.734] (-2122.663) (-2118.056) (-2120.893) -- 0:00:54 Average standard deviation of split frequencies: 0.011155 215500 -- (-2123.114) [-2122.028] (-2122.284) (-2119.599) * [-2117.897] (-2120.009) (-2118.805) (-2118.511) -- 0:00:54 216000 -- [-2120.553] (-2123.585) (-2121.860) (-2122.318) * (-2118.268) [-2119.836] (-2120.531) (-2118.770) -- 0:00:54 216500 -- (-2120.338) (-2124.662) (-2119.615) [-2125.670] * (-2118.729) (-2121.557) [-2121.341] (-2119.424) -- 0:00:54 217000 -- (-2121.123) (-2121.990) [-2122.956] (-2126.949) * [-2118.364] (-2120.267) (-2118.722) (-2121.878) -- 0:00:54 217500 -- (-2119.151) (-2118.874) (-2121.108) [-2126.342] * (-2120.384) [-2120.259] (-2120.095) (-2119.087) -- 0:00:53 218000 -- (-2118.551) (-2120.237) [-2121.889] (-2122.910) * (-2120.258) (-2117.998) (-2119.517) [-2120.740] -- 0:00:53 218500 -- [-2119.191] (-2120.684) (-2121.170) (-2125.632) * (-2121.457) [-2118.136] (-2119.339) (-2119.361) -- 0:00:53 219000 -- (-2119.002) (-2120.323) [-2122.863] (-2119.450) * (-2122.776) (-2118.167) (-2121.154) [-2119.619] -- 0:00:53 219500 -- (-2119.538) [-2119.535] (-2123.531) (-2119.450) * (-2126.120) [-2118.181] (-2124.515) (-2121.658) -- 0:00:53 220000 -- (-2124.703) (-2118.974) (-2122.496) [-2122.247] * (-2119.991) [-2118.686] (-2121.758) (-2121.309) -- 0:00:53 Average standard deviation of split frequencies: 0.011058 220500 -- (-2123.564) [-2121.483] (-2121.225) (-2120.549) * (-2119.069) [-2118.499] (-2123.069) (-2122.793) -- 0:00:53 221000 -- (-2120.891) [-2121.990] (-2120.953) (-2118.432) * (-2120.188) [-2118.485] (-2119.593) (-2119.631) -- 0:00:52 221500 -- (-2120.668) [-2121.574] (-2118.501) (-2119.802) * (-2120.519) [-2118.027] (-2120.489) (-2125.638) -- 0:00:52 222000 -- [-2118.791] (-2124.566) (-2121.532) (-2119.429) * [-2118.912] (-2119.051) (-2119.855) (-2123.030) -- 0:00:52 222500 -- (-2119.204) [-2120.813] (-2121.894) (-2119.429) * (-2124.927) (-2119.488) (-2119.566) [-2119.781] -- 0:00:52 223000 -- (-2122.513) [-2122.064] (-2122.702) (-2118.953) * (-2120.278) [-2118.361] (-2117.962) (-2121.690) -- 0:00:52 223500 -- (-2121.447) (-2118.096) (-2122.372) [-2118.755] * (-2122.485) [-2118.639] (-2117.937) (-2121.918) -- 0:00:52 224000 -- (-2122.288) [-2118.587] (-2121.359) (-2118.271) * (-2119.273) [-2122.669] (-2117.970) (-2120.445) -- 0:00:51 224500 -- (-2122.029) [-2118.269] (-2121.290) (-2120.165) * [-2118.823] (-2119.557) (-2118.904) (-2120.274) -- 0:00:51 225000 -- (-2121.890) (-2119.613) [-2120.821] (-2119.554) * [-2118.952] (-2120.957) (-2120.161) (-2123.778) -- 0:00:51 Average standard deviation of split frequencies: 0.011936 225500 -- [-2118.687] (-2118.803) (-2122.049) (-2120.575) * (-2122.451) (-2120.229) [-2118.588] (-2122.725) -- 0:00:51 226000 -- [-2120.216] (-2119.118) (-2121.695) (-2119.143) * (-2124.387) (-2118.888) [-2119.177] (-2121.700) -- 0:00:51 226500 -- [-2118.122] (-2119.607) (-2118.909) (-2119.317) * (-2119.684) (-2118.878) [-2120.887] (-2119.661) -- 0:00:51 227000 -- (-2119.525) (-2120.039) (-2118.487) [-2119.123] * [-2119.684] (-2119.063) (-2120.918) (-2118.618) -- 0:00:51 227500 -- (-2118.984) [-2120.560] (-2120.462) (-2121.500) * [-2120.914] (-2119.850) (-2121.062) (-2120.989) -- 0:00:50 228000 -- (-2119.822) [-2120.788] (-2124.336) (-2119.319) * [-2120.352] (-2121.288) (-2120.266) (-2121.682) -- 0:00:50 228500 -- (-2121.396) [-2119.948] (-2122.977) (-2124.403) * [-2120.377] (-2121.148) (-2120.531) (-2122.270) -- 0:00:50 229000 -- (-2119.937) (-2121.880) (-2121.964) [-2119.208] * [-2122.039] (-2120.386) (-2120.872) (-2122.152) -- 0:00:53 229500 -- (-2120.051) (-2120.869) (-2120.954) [-2121.052] * (-2119.656) (-2119.929) [-2119.923] (-2120.356) -- 0:00:53 230000 -- (-2120.803) (-2122.530) (-2122.364) [-2118.882] * (-2119.496) (-2121.497) [-2119.851] (-2120.443) -- 0:00:53 Average standard deviation of split frequencies: 0.011300 230500 -- (-2121.904) (-2119.646) [-2122.129] (-2118.956) * (-2120.245) [-2122.532] (-2120.398) (-2120.473) -- 0:00:53 231000 -- (-2125.364) (-2118.990) (-2122.465) [-2121.343] * (-2118.925) (-2123.259) [-2119.546] (-2118.908) -- 0:00:53 231500 -- (-2126.279) (-2121.061) (-2121.385) [-2119.025] * (-2118.998) (-2122.008) (-2119.471) [-2119.583] -- 0:00:53 232000 -- (-2120.246) [-2119.528] (-2120.135) (-2120.311) * (-2119.321) (-2118.570) [-2119.687] (-2119.403) -- 0:00:52 232500 -- (-2121.469) [-2119.683] (-2121.768) (-2121.024) * (-2121.704) (-2118.439) [-2119.842] (-2119.866) -- 0:00:52 233000 -- (-2122.273) (-2118.512) [-2118.697] (-2121.333) * (-2121.008) [-2117.951] (-2120.174) (-2121.452) -- 0:00:52 233500 -- (-2120.393) [-2120.145] (-2118.820) (-2119.426) * (-2127.332) (-2120.834) [-2118.515] (-2120.299) -- 0:00:52 234000 -- (-2119.332) (-2120.125) [-2121.863] (-2119.709) * (-2120.161) [-2118.857] (-2120.050) (-2122.291) -- 0:00:52 234500 -- (-2119.252) [-2127.034] (-2123.510) (-2119.215) * (-2118.651) [-2120.591] (-2118.968) (-2119.822) -- 0:00:52 235000 -- (-2118.755) (-2121.953) (-2125.206) [-2119.776] * (-2118.651) (-2118.407) [-2120.013] (-2123.703) -- 0:00:52 Average standard deviation of split frequencies: 0.010692 235500 -- (-2118.772) [-2119.377] (-2121.197) (-2118.826) * (-2120.045) (-2119.529) (-2117.946) [-2121.103] -- 0:00:51 236000 -- (-2117.667) (-2119.757) (-2122.588) [-2118.769] * (-2120.038) [-2121.719] (-2117.864) (-2123.749) -- 0:00:51 236500 -- (-2117.667) (-2122.121) (-2121.959) [-2122.241] * (-2123.160) (-2118.596) [-2117.803] (-2120.548) -- 0:00:51 237000 -- (-2119.672) (-2124.425) [-2121.295] (-2120.249) * (-2122.608) (-2118.787) [-2121.223] (-2121.873) -- 0:00:51 237500 -- (-2120.336) (-2119.333) (-2121.476) [-2119.303] * (-2124.602) (-2119.613) [-2119.777] (-2119.227) -- 0:00:51 238000 -- (-2120.276) [-2119.547] (-2120.661) (-2122.755) * (-2121.277) [-2119.926] (-2120.772) (-2120.182) -- 0:00:51 238500 -- (-2119.914) [-2119.304] (-2124.485) (-2119.307) * [-2118.567] (-2118.799) (-2119.080) (-2120.252) -- 0:00:51 239000 -- (-2121.024) (-2122.533) (-2131.693) [-2118.702] * (-2118.557) (-2119.112) (-2120.755) [-2119.822] -- 0:00:50 239500 -- (-2120.690) (-2121.357) (-2124.952) [-2118.384] * (-2120.096) (-2119.115) [-2119.975] (-2121.475) -- 0:00:50 240000 -- (-2120.602) (-2120.029) (-2122.230) [-2120.027] * (-2119.988) (-2118.846) (-2124.384) [-2119.090] -- 0:00:50 Average standard deviation of split frequencies: 0.009794 240500 -- (-2119.226) (-2119.455) [-2120.671] (-2119.064) * [-2118.616] (-2119.960) (-2120.430) (-2121.015) -- 0:00:50 241000 -- (-2120.633) [-2121.042] (-2121.732) (-2126.573) * [-2120.069] (-2121.129) (-2119.378) (-2120.909) -- 0:00:50 241500 -- (-2120.834) (-2119.346) (-2119.617) [-2122.557] * [-2119.802] (-2119.317) (-2119.358) (-2119.239) -- 0:00:50 242000 -- [-2118.794] (-2120.595) (-2119.194) (-2118.907) * (-2119.651) [-2118.788] (-2119.224) (-2122.502) -- 0:00:50 242500 -- (-2122.804) (-2121.535) (-2118.989) [-2119.346] * (-2119.684) (-2119.487) (-2119.351) [-2123.710] -- 0:00:49 243000 -- (-2120.063) (-2119.120) [-2120.236] (-2119.871) * [-2118.380] (-2119.674) (-2118.183) (-2123.432) -- 0:00:49 243500 -- [-2118.275] (-2120.245) (-2121.656) (-2119.031) * (-2118.352) [-2118.561] (-2118.144) (-2120.375) -- 0:00:49 244000 -- (-2118.172) [-2119.731] (-2118.898) (-2120.198) * [-2119.819] (-2118.561) (-2117.959) (-2119.828) -- 0:00:52 244500 -- (-2119.445) (-2118.744) [-2120.309] (-2122.245) * (-2118.883) (-2121.014) [-2118.338] (-2119.757) -- 0:00:52 245000 -- (-2120.566) (-2123.413) (-2118.772) [-2119.557] * (-2124.505) (-2122.098) (-2118.597) [-2119.010] -- 0:00:52 Average standard deviation of split frequencies: 0.010032 245500 -- [-2123.184] (-2125.204) (-2121.580) (-2118.427) * (-2119.756) (-2121.019) [-2119.927] (-2123.658) -- 0:00:52 246000 -- [-2121.761] (-2119.962) (-2121.584) (-2118.519) * (-2119.249) [-2121.210] (-2118.794) (-2123.905) -- 0:00:52 246500 -- (-2120.912) [-2119.907] (-2120.173) (-2118.256) * [-2121.538] (-2121.170) (-2118.657) (-2123.972) -- 0:00:51 247000 -- [-2119.506] (-2120.945) (-2118.834) (-2118.453) * [-2122.175] (-2123.834) (-2118.504) (-2120.741) -- 0:00:51 247500 -- (-2120.954) (-2120.619) (-2120.169) [-2123.524] * [-2121.610] (-2120.734) (-2118.504) (-2118.670) -- 0:00:51 248000 -- (-2119.409) (-2119.513) (-2117.983) [-2119.946] * (-2118.543) [-2120.551] (-2118.232) (-2119.135) -- 0:00:51 248500 -- (-2119.863) [-2119.534] (-2122.000) (-2119.528) * (-2118.533) [-2120.342] (-2122.716) (-2119.427) -- 0:00:51 249000 -- (-2118.370) (-2120.150) [-2122.893] (-2118.519) * [-2118.506] (-2119.587) (-2122.039) (-2120.457) -- 0:00:51 249500 -- (-2117.890) [-2119.816] (-2122.896) (-2123.052) * (-2119.659) (-2121.160) (-2121.148) [-2117.995] -- 0:00:51 250000 -- (-2117.878) [-2119.363] (-2119.851) (-2122.668) * (-2123.034) [-2118.755] (-2121.560) (-2118.569) -- 0:00:51 Average standard deviation of split frequencies: 0.011062 250500 -- (-2117.887) (-2119.373) (-2118.377) [-2119.744] * (-2124.273) (-2119.187) (-2123.665) [-2122.756] -- 0:00:50 251000 -- [-2117.884] (-2122.913) (-2119.197) (-2120.891) * (-2123.116) (-2119.489) (-2126.645) [-2123.179] -- 0:00:50 251500 -- [-2117.866] (-2120.100) (-2122.100) (-2121.460) * (-2119.929) [-2119.525] (-2124.291) (-2119.325) -- 0:00:50 252000 -- (-2118.075) (-2120.529) [-2122.058] (-2119.239) * (-2119.671) (-2118.916) (-2123.525) [-2122.553] -- 0:00:50 252500 -- [-2119.004] (-2118.885) (-2121.195) (-2119.205) * (-2119.931) [-2118.166] (-2123.594) (-2121.437) -- 0:00:50 253000 -- (-2120.955) (-2118.395) [-2121.183] (-2119.814) * [-2119.907] (-2118.667) (-2127.792) (-2119.419) -- 0:00:50 253500 -- [-2120.945] (-2118.544) (-2120.254) (-2118.262) * (-2122.505) (-2118.721) [-2125.964] (-2118.038) -- 0:00:50 254000 -- (-2119.960) [-2121.880] (-2120.515) (-2119.691) * (-2120.111) [-2119.101] (-2123.236) (-2118.844) -- 0:00:49 254500 -- (-2120.175) (-2119.945) (-2120.025) [-2119.276] * (-2121.066) [-2120.335] (-2124.474) (-2119.794) -- 0:00:49 255000 -- (-2119.782) [-2120.676] (-2120.027) (-2120.846) * (-2121.327) (-2120.563) [-2122.483] (-2119.142) -- 0:00:49 Average standard deviation of split frequencies: 0.010399 255500 -- (-2122.628) (-2120.682) (-2118.196) [-2120.443] * (-2119.539) (-2119.928) [-2120.158] (-2119.069) -- 0:00:49 256000 -- (-2119.543) (-2119.872) (-2123.470) [-2119.944] * (-2119.243) (-2119.212) [-2120.888] (-2119.137) -- 0:00:49 256500 -- (-2119.366) (-2119.653) (-2121.589) [-2120.046] * (-2118.783) (-2120.712) [-2120.467] (-2119.571) -- 0:00:49 257000 -- (-2120.797) [-2120.531] (-2121.679) (-2120.579) * [-2118.871] (-2119.286) (-2119.406) (-2122.065) -- 0:00:49 257500 -- (-2120.736) [-2120.161] (-2120.491) (-2120.056) * (-2120.239) [-2118.275] (-2121.855) (-2121.586) -- 0:00:49 258000 -- (-2122.471) [-2119.181] (-2123.415) (-2121.396) * (-2119.919) [-2117.919] (-2120.841) (-2121.500) -- 0:00:48 258500 -- [-2120.904] (-2119.638) (-2122.072) (-2122.868) * (-2119.596) (-2118.809) (-2120.049) [-2121.596] -- 0:00:48 259000 -- (-2119.459) [-2119.720] (-2120.065) (-2118.878) * (-2119.365) [-2118.825] (-2119.033) (-2123.493) -- 0:00:51 259500 -- (-2123.346) [-2119.987] (-2122.175) (-2119.679) * (-2120.486) (-2120.086) (-2118.574) [-2125.118] -- 0:00:51 260000 -- (-2119.252) [-2118.606] (-2121.283) (-2119.926) * (-2122.817) (-2118.704) [-2120.430] (-2120.696) -- 0:00:51 Average standard deviation of split frequencies: 0.011489 260500 -- (-2121.912) [-2118.946] (-2119.728) (-2119.429) * (-2121.915) (-2118.421) [-2119.209] (-2122.649) -- 0:00:51 261000 -- [-2121.079] (-2122.365) (-2118.876) (-2118.364) * (-2121.798) (-2119.338) (-2119.298) [-2122.649] -- 0:00:50 261500 -- (-2122.796) [-2122.832] (-2121.533) (-2118.810) * [-2124.397] (-2119.370) (-2118.657) (-2119.478) -- 0:00:50 262000 -- (-2119.523) (-2121.788) (-2119.001) [-2119.042] * (-2123.211) (-2119.482) (-2118.695) [-2121.352] -- 0:00:50 262500 -- (-2119.592) (-2122.818) [-2118.811] (-2119.210) * (-2120.437) [-2119.641] (-2120.466) (-2118.517) -- 0:00:50 263000 -- (-2119.326) (-2120.460) [-2118.619] (-2118.829) * (-2118.393) [-2121.846] (-2122.050) (-2118.533) -- 0:00:50 263500 -- (-2119.820) (-2119.677) [-2118.872] (-2118.468) * [-2119.575] (-2127.036) (-2118.339) (-2118.633) -- 0:00:50 264000 -- (-2119.323) (-2121.430) [-2118.867] (-2121.653) * (-2119.646) [-2120.649] (-2121.784) (-2119.310) -- 0:00:50 264500 -- (-2120.611) (-2121.043) [-2119.043] (-2120.204) * (-2118.862) (-2121.564) (-2121.199) [-2120.434] -- 0:00:50 265000 -- (-2118.876) (-2119.871) [-2122.334] (-2122.891) * (-2119.403) (-2120.684) (-2119.999) [-2120.622] -- 0:00:49 Average standard deviation of split frequencies: 0.010112 265500 -- (-2119.550) (-2123.902) [-2123.120] (-2121.450) * (-2128.602) (-2118.326) (-2120.299) [-2119.565] -- 0:00:49 266000 -- [-2119.134] (-2122.441) (-2123.120) (-2120.986) * (-2119.334) (-2118.523) [-2123.516] (-2119.178) -- 0:00:49 266500 -- [-2118.989] (-2121.705) (-2125.139) (-2122.568) * (-2119.054) (-2120.971) [-2121.388] (-2118.474) -- 0:00:49 267000 -- [-2118.989] (-2122.998) (-2123.542) (-2124.033) * (-2117.941) [-2119.649] (-2124.267) (-2122.968) -- 0:00:49 267500 -- (-2121.400) (-2120.739) (-2120.897) [-2120.470] * (-2121.551) [-2121.592] (-2122.759) (-2121.913) -- 0:00:49 268000 -- (-2126.450) (-2119.694) (-2120.014) [-2119.663] * [-2122.303] (-2124.204) (-2119.599) (-2119.894) -- 0:00:49 268500 -- (-2121.799) (-2121.461) (-2119.994) [-2119.767] * (-2123.563) (-2119.026) (-2124.002) [-2118.442] -- 0:00:49 269000 -- (-2121.003) (-2122.215) [-2119.440] (-2119.732) * (-2122.060) (-2119.358) (-2120.831) [-2118.320] -- 0:00:48 269500 -- (-2123.014) [-2123.920] (-2118.196) (-2118.609) * [-2122.280] (-2122.976) (-2122.745) (-2118.937) -- 0:00:48 270000 -- (-2123.240) [-2120.817] (-2119.913) (-2121.252) * [-2121.718] (-2122.436) (-2124.755) (-2120.824) -- 0:00:48 Average standard deviation of split frequencies: 0.010347 270500 -- (-2119.661) [-2119.590] (-2119.113) (-2124.869) * (-2118.347) (-2122.645) (-2120.560) [-2119.470] -- 0:00:48 271000 -- (-2120.500) [-2120.229] (-2120.070) (-2121.490) * (-2122.536) (-2119.651) (-2119.073) [-2118.479] -- 0:00:48 271500 -- (-2120.207) (-2120.624) (-2122.015) [-2121.425] * (-2122.125) (-2118.787) [-2118.953] (-2119.450) -- 0:00:48 272000 -- (-2120.332) [-2121.664] (-2122.201) (-2121.801) * (-2122.444) (-2118.852) (-2118.324) [-2118.200] -- 0:00:48 272500 -- (-2119.290) [-2119.876] (-2121.544) (-2120.677) * [-2121.686] (-2118.963) (-2118.117) (-2118.112) -- 0:00:48 273000 -- (-2120.213) [-2120.686] (-2119.091) (-2119.490) * (-2121.576) [-2118.963] (-2120.157) (-2119.716) -- 0:00:47 273500 -- (-2118.765) (-2119.650) [-2118.772] (-2122.416) * [-2121.290] (-2119.523) (-2118.229) (-2119.687) -- 0:00:47 274000 -- [-2118.765] (-2118.997) (-2118.704) (-2123.536) * (-2119.732) [-2119.863] (-2122.959) (-2121.067) -- 0:00:50 274500 -- (-2119.144) [-2118.728] (-2119.989) (-2121.502) * [-2119.990] (-2120.752) (-2121.147) (-2123.593) -- 0:00:50 275000 -- (-2120.481) [-2118.912] (-2120.323) (-2121.789) * (-2125.401) (-2123.627) (-2118.127) [-2120.978] -- 0:00:50 Average standard deviation of split frequencies: 0.011655 275500 -- (-2119.344) (-2119.735) (-2120.825) [-2119.799] * (-2124.567) (-2122.300) [-2119.169] (-2120.106) -- 0:00:49 276000 -- [-2120.207] (-2119.281) (-2119.161) (-2121.590) * [-2121.509] (-2123.765) (-2119.149) (-2118.948) -- 0:00:49 276500 -- (-2118.537) (-2118.905) (-2119.595) [-2121.343] * [-2119.932] (-2120.514) (-2118.459) (-2120.167) -- 0:00:49 277000 -- (-2123.280) (-2118.146) (-2119.452) [-2121.192] * [-2121.243] (-2120.870) (-2118.053) (-2119.765) -- 0:00:49 277500 -- (-2121.962) (-2118.662) [-2119.617] (-2121.067) * (-2120.844) (-2122.221) (-2119.323) [-2120.274] -- 0:00:49 278000 -- (-2121.700) [-2120.161] (-2119.574) (-2118.823) * (-2120.981) [-2123.947] (-2118.799) (-2119.910) -- 0:00:49 278500 -- [-2119.140] (-2121.798) (-2123.268) (-2120.727) * (-2120.145) (-2118.441) (-2120.142) [-2118.779] -- 0:00:49 279000 -- [-2119.598] (-2122.472) (-2118.870) (-2120.674) * (-2118.864) (-2119.617) (-2123.249) [-2118.587] -- 0:00:49 279500 -- (-2119.299) [-2119.154] (-2121.308) (-2118.393) * (-2118.226) [-2119.314] (-2118.394) (-2118.846) -- 0:00:48 280000 -- (-2123.281) (-2119.949) (-2118.733) [-2119.050] * [-2118.737] (-2119.916) (-2124.831) (-2120.978) -- 0:00:48 Average standard deviation of split frequencies: 0.011856 280500 -- (-2121.755) (-2120.228) [-2119.696] (-2118.964) * (-2119.917) (-2120.134) (-2121.668) [-2120.584] -- 0:00:48 281000 -- (-2119.364) (-2120.128) (-2119.616) [-2118.291] * (-2122.642) (-2118.516) [-2119.573] (-2122.254) -- 0:00:48 281500 -- (-2121.382) (-2120.711) [-2120.815] (-2123.879) * (-2118.515) [-2118.922] (-2120.376) (-2122.866) -- 0:00:48 282000 -- (-2118.423) (-2120.863) (-2120.352) [-2118.648] * [-2118.090] (-2122.885) (-2123.619) (-2122.330) -- 0:00:48 282500 -- (-2118.005) (-2120.622) [-2120.248] (-2118.526) * (-2119.038) (-2119.463) (-2119.002) [-2120.573] -- 0:00:48 283000 -- (-2121.000) (-2118.182) (-2119.964) [-2118.934] * (-2120.404) (-2119.549) (-2119.159) [-2122.444] -- 0:00:48 283500 -- (-2118.869) [-2119.080] (-2120.739) (-2118.627) * (-2119.092) (-2123.200) [-2119.007] (-2119.664) -- 0:00:48 284000 -- [-2118.586] (-2119.004) (-2119.651) (-2121.394) * (-2118.147) (-2120.763) (-2120.309) [-2123.580] -- 0:00:47 284500 -- (-2123.834) (-2121.045) (-2119.568) [-2118.874] * (-2119.599) (-2123.494) [-2119.712] (-2122.449) -- 0:00:47 285000 -- (-2117.960) (-2121.473) (-2119.008) [-2119.501] * [-2122.516] (-2120.547) (-2120.579) (-2125.071) -- 0:00:47 Average standard deviation of split frequencies: 0.012410 285500 -- (-2121.378) (-2119.610) (-2118.833) [-2119.272] * (-2118.762) [-2119.594] (-2120.581) (-2121.020) -- 0:00:47 286000 -- (-2121.108) (-2118.221) (-2121.229) [-2118.569] * (-2120.050) (-2120.085) [-2121.623] (-2121.002) -- 0:00:47 286500 -- (-2118.523) (-2121.447) [-2119.655] (-2119.707) * (-2119.109) (-2118.165) [-2120.135] (-2120.365) -- 0:00:47 287000 -- (-2118.477) (-2123.852) [-2119.428] (-2119.281) * (-2119.840) [-2119.863] (-2117.944) (-2119.563) -- 0:00:47 287500 -- (-2118.955) (-2123.913) [-2123.711] (-2121.751) * (-2119.503) [-2119.435] (-2120.723) (-2118.857) -- 0:00:47 288000 -- [-2119.506] (-2122.981) (-2126.700) (-2120.678) * [-2118.432] (-2120.898) (-2122.073) (-2120.937) -- 0:00:46 288500 -- (-2119.651) (-2120.756) [-2126.105] (-2121.015) * (-2118.336) (-2118.891) (-2120.534) [-2118.565] -- 0:00:46 289000 -- [-2118.977] (-2123.848) (-2123.559) (-2120.071) * [-2119.318] (-2119.251) (-2118.930) (-2118.002) -- 0:00:49 289500 -- (-2119.596) (-2122.136) (-2118.089) [-2121.449] * (-2119.362) (-2123.487) [-2118.333] (-2118.971) -- 0:00:49 290000 -- (-2124.499) (-2118.656) [-2118.457] (-2123.404) * [-2119.565] (-2121.148) (-2119.248) (-2118.793) -- 0:00:48 Average standard deviation of split frequencies: 0.012307 290500 -- (-2122.297) (-2119.546) (-2120.141) [-2123.473] * (-2120.553) [-2120.972] (-2118.876) (-2121.479) -- 0:00:48 291000 -- (-2121.054) (-2123.685) [-2124.142] (-2119.824) * [-2123.277] (-2118.527) (-2118.265) (-2122.376) -- 0:00:48 291500 -- (-2119.268) (-2120.331) (-2121.700) [-2121.352] * (-2118.968) [-2121.833] (-2119.945) (-2122.739) -- 0:00:48 292000 -- (-2118.457) [-2119.154] (-2121.993) (-2118.329) * (-2119.818) [-2119.096] (-2121.088) (-2120.782) -- 0:00:48 292500 -- [-2119.049] (-2121.471) (-2122.022) (-2118.813) * (-2119.763) [-2119.290] (-2119.000) (-2120.429) -- 0:00:48 293000 -- (-2118.206) [-2118.610] (-2118.702) (-2126.067) * (-2121.549) [-2119.072] (-2121.844) (-2119.007) -- 0:00:48 293500 -- [-2120.256] (-2119.805) (-2118.002) (-2124.229) * (-2121.414) (-2119.100) (-2121.572) [-2119.009] -- 0:00:48 294000 -- (-2122.949) (-2122.032) [-2117.985] (-2120.149) * (-2118.640) (-2118.546) (-2120.911) [-2118.837] -- 0:00:48 294500 -- (-2122.323) (-2121.696) [-2118.324] (-2120.135) * (-2119.291) [-2118.617] (-2118.903) (-2118.546) -- 0:00:47 295000 -- [-2119.249] (-2125.725) (-2119.555) (-2118.176) * (-2119.317) (-2119.051) [-2118.889] (-2118.306) -- 0:00:47 Average standard deviation of split frequencies: 0.012647 295500 -- (-2118.596) (-2121.426) [-2118.670] (-2119.086) * (-2118.204) (-2119.949) [-2120.694] (-2118.997) -- 0:00:47 296000 -- (-2118.372) [-2120.714] (-2119.059) (-2117.850) * (-2120.774) [-2119.783] (-2120.664) (-2118.276) -- 0:00:47 296500 -- (-2118.987) [-2120.546] (-2118.901) (-2122.210) * (-2120.342) (-2122.426) (-2117.749) [-2119.151] -- 0:00:47 297000 -- (-2120.624) (-2119.688) [-2118.937] (-2122.122) * [-2119.116] (-2119.612) (-2117.768) (-2120.729) -- 0:00:47 297500 -- [-2118.166] (-2120.057) (-2118.354) (-2122.177) * (-2121.654) (-2117.869) [-2117.855] (-2120.409) -- 0:00:47 298000 -- (-2119.424) (-2120.544) [-2119.852] (-2121.747) * (-2118.373) [-2118.310] (-2124.615) (-2120.560) -- 0:00:47 298500 -- (-2121.359) (-2121.977) (-2119.852) [-2118.954] * (-2120.503) [-2118.637] (-2125.613) (-2120.089) -- 0:00:47 299000 -- (-2123.657) (-2119.737) [-2119.983] (-2120.245) * (-2117.981) (-2118.774) (-2119.025) [-2119.121] -- 0:00:46 299500 -- (-2120.500) (-2119.340) (-2121.493) [-2118.588] * [-2121.902] (-2118.721) (-2118.874) (-2118.828) -- 0:00:46 300000 -- (-2121.442) (-2120.448) [-2120.182] (-2124.066) * (-2118.507) [-2120.777] (-2119.290) (-2120.879) -- 0:00:46 Average standard deviation of split frequencies: 0.012358 300500 -- (-2118.382) [-2119.564] (-2120.002) (-2119.188) * (-2119.754) (-2119.355) (-2125.869) [-2119.580] -- 0:00:46 301000 -- (-2118.230) [-2121.169] (-2121.446) (-2119.390) * (-2118.846) (-2120.794) [-2122.761] (-2120.436) -- 0:00:46 301500 -- (-2121.870) (-2119.776) (-2120.393) [-2118.392] * (-2118.247) [-2122.568] (-2122.918) (-2120.490) -- 0:00:46 302000 -- (-2120.250) (-2118.796) [-2119.364] (-2121.777) * (-2118.177) (-2120.357) (-2119.299) [-2121.237] -- 0:00:46 302500 -- [-2118.585] (-2118.535) (-2120.256) (-2120.175) * [-2118.137] (-2120.975) (-2118.651) (-2119.831) -- 0:00:46 303000 -- (-2118.715) (-2118.542) [-2119.039] (-2123.189) * [-2118.395] (-2119.121) (-2119.452) (-2119.889) -- 0:00:46 303500 -- [-2118.372] (-2118.195) (-2121.315) (-2122.297) * [-2118.869] (-2121.493) (-2119.973) (-2125.873) -- 0:00:45 304000 -- [-2123.569] (-2119.033) (-2122.753) (-2120.629) * (-2119.938) (-2119.351) [-2120.132] (-2119.965) -- 0:00:45 304500 -- (-2119.483) (-2120.124) [-2118.703] (-2119.777) * (-2119.107) (-2122.206) [-2119.483] (-2120.133) -- 0:00:47 305000 -- (-2120.808) (-2119.874) (-2123.566) [-2120.007] * [-2119.341] (-2122.118) (-2121.004) (-2120.241) -- 0:00:47 Average standard deviation of split frequencies: 0.011781 305500 -- (-2119.360) (-2120.327) (-2121.051) [-2119.057] * [-2121.405] (-2119.958) (-2120.820) (-2118.609) -- 0:00:47 306000 -- (-2118.636) (-2121.228) [-2122.011] (-2120.097) * [-2118.372] (-2126.831) (-2118.870) (-2120.761) -- 0:00:47 306500 -- (-2119.948) [-2119.613] (-2120.191) (-2121.352) * [-2118.674] (-2124.227) (-2118.310) (-2120.563) -- 0:00:47 307000 -- (-2124.129) (-2119.042) [-2119.521] (-2119.228) * (-2119.368) [-2122.443] (-2118.477) (-2118.229) -- 0:00:47 307500 -- (-2124.273) [-2119.867] (-2123.599) (-2119.044) * (-2119.155) (-2120.382) [-2119.953] (-2118.559) -- 0:00:47 308000 -- (-2124.213) [-2121.265] (-2120.708) (-2121.316) * (-2123.153) (-2121.524) [-2118.349] (-2122.741) -- 0:00:47 308500 -- (-2121.214) (-2120.986) (-2121.190) [-2118.894] * (-2119.822) (-2121.417) (-2118.393) [-2118.639] -- 0:00:47 309000 -- (-2120.945) (-2119.361) (-2125.718) [-2121.082] * (-2121.787) [-2121.013] (-2127.601) (-2118.913) -- 0:00:46 309500 -- (-2120.536) (-2119.718) [-2121.758] (-2121.119) * (-2126.840) (-2119.074) (-2125.654) [-2118.686] -- 0:00:46 310000 -- [-2119.254] (-2120.930) (-2121.024) (-2124.477) * [-2120.693] (-2119.636) (-2120.725) (-2120.623) -- 0:00:46 Average standard deviation of split frequencies: 0.012050 310500 -- (-2118.015) [-2121.320] (-2118.904) (-2122.606) * [-2121.602] (-2119.666) (-2120.725) (-2120.868) -- 0:00:46 311000 -- (-2119.725) [-2120.382] (-2118.606) (-2120.300) * (-2121.349) (-2119.767) [-2121.749] (-2122.596) -- 0:00:46 311500 -- (-2119.597) [-2120.126] (-2120.239) (-2124.915) * (-2120.796) (-2119.234) (-2122.599) [-2120.092] -- 0:00:46 312000 -- [-2119.869] (-2120.554) (-2119.663) (-2125.675) * (-2122.044) (-2123.645) [-2122.120] (-2121.700) -- 0:00:46 312500 -- (-2122.627) (-2120.509) (-2120.614) [-2119.089] * [-2120.715] (-2122.508) (-2121.573) (-2120.482) -- 0:00:46 313000 -- [-2120.230] (-2119.978) (-2120.552) (-2120.341) * (-2119.549) (-2119.347) (-2119.506) [-2120.537] -- 0:00:46 313500 -- [-2120.913] (-2118.582) (-2118.640) (-2121.101) * (-2121.628) (-2119.184) [-2121.207] (-2117.845) -- 0:00:45 314000 -- (-2122.751) [-2119.171] (-2120.497) (-2121.690) * [-2119.762] (-2120.546) (-2119.801) (-2117.888) -- 0:00:45 314500 -- (-2123.568) (-2119.446) (-2121.645) [-2120.948] * (-2118.138) (-2118.360) (-2120.138) [-2117.831] -- 0:00:45 315000 -- (-2120.339) (-2119.215) (-2130.777) [-2119.371] * [-2121.001] (-2119.832) (-2121.399) (-2117.880) -- 0:00:45 Average standard deviation of split frequencies: 0.012022 315500 -- (-2120.969) (-2119.539) (-2120.653) [-2119.138] * (-2121.679) [-2118.584] (-2121.462) (-2118.027) -- 0:00:45 316000 -- (-2121.164) [-2118.635] (-2119.596) (-2119.821) * (-2120.325) (-2119.526) (-2123.677) [-2118.028] -- 0:00:45 316500 -- (-2120.163) (-2119.856) [-2119.202] (-2121.294) * (-2120.605) [-2118.851] (-2121.107) (-2117.929) -- 0:00:45 317000 -- (-2120.346) (-2120.676) [-2119.200] (-2119.872) * (-2119.621) (-2119.143) (-2121.191) [-2119.080] -- 0:00:45 317500 -- (-2122.936) (-2121.003) (-2117.929) [-2120.197] * (-2120.058) (-2119.222) [-2121.381] (-2121.527) -- 0:00:45 318000 -- (-2120.400) (-2119.233) (-2118.857) [-2126.453] * (-2124.028) (-2118.971) [-2124.006] (-2122.499) -- 0:00:45 318500 -- (-2120.775) (-2118.490) (-2122.445) [-2120.523] * (-2119.603) (-2119.143) [-2123.596] (-2118.941) -- 0:00:44 319000 -- [-2119.132] (-2119.804) (-2121.459) (-2120.037) * (-2121.759) (-2119.553) (-2118.890) [-2118.774] -- 0:00:44 319500 -- (-2119.725) (-2119.844) (-2121.358) [-2122.540] * [-2121.796] (-2120.477) (-2118.780) (-2123.355) -- 0:00:46 320000 -- (-2120.742) (-2121.279) [-2119.241] (-2122.920) * (-2122.908) [-2119.707] (-2120.391) (-2120.113) -- 0:00:46 Average standard deviation of split frequencies: 0.013231 320500 -- (-2122.104) [-2119.074] (-2120.034) (-2121.026) * (-2117.788) [-2120.119] (-2120.188) (-2119.545) -- 0:00:46 321000 -- (-2122.229) [-2119.359] (-2122.648) (-2120.497) * (-2124.154) (-2124.000) (-2119.693) [-2119.302] -- 0:00:46 321500 -- (-2118.776) (-2119.347) (-2124.818) [-2120.800] * (-2120.568) (-2120.285) (-2121.890) [-2121.424] -- 0:00:46 322000 -- (-2117.875) (-2119.283) [-2121.941] (-2123.965) * (-2122.284) (-2122.788) (-2122.968) [-2120.608] -- 0:00:46 322500 -- (-2119.598) (-2119.724) [-2120.317] (-2122.568) * (-2120.473) (-2119.420) (-2123.187) [-2118.449] -- 0:00:46 323000 -- (-2120.642) (-2121.423) (-2118.782) [-2120.006] * (-2120.216) (-2120.730) [-2121.097] (-2122.484) -- 0:00:46 323500 -- [-2119.649] (-2121.971) (-2119.516) (-2119.784) * [-2121.122] (-2120.718) (-2118.928) (-2123.682) -- 0:00:46 324000 -- (-2119.648) (-2118.449) (-2120.290) [-2119.971] * (-2121.069) [-2120.670] (-2118.198) (-2122.020) -- 0:00:45 324500 -- [-2120.315] (-2118.868) (-2118.245) (-2122.532) * (-2122.965) [-2120.244] (-2118.336) (-2120.132) -- 0:00:45 325000 -- [-2118.368] (-2118.308) (-2123.476) (-2119.187) * (-2124.089) (-2119.264) [-2118.286] (-2120.223) -- 0:00:45 Average standard deviation of split frequencies: 0.012334 325500 -- (-2117.773) (-2120.003) (-2121.284) [-2118.911] * [-2119.745] (-2119.907) (-2118.121) (-2120.831) -- 0:00:45 326000 -- (-2121.792) (-2121.590) [-2120.008] (-2120.246) * (-2120.522) [-2120.389] (-2119.944) (-2119.656) -- 0:00:45 326500 -- (-2127.668) [-2120.038] (-2123.274) (-2119.611) * (-2118.957) (-2123.946) (-2119.108) [-2119.752] -- 0:00:45 327000 -- [-2120.466] (-2123.280) (-2122.164) (-2120.748) * [-2118.270] (-2120.066) (-2120.047) (-2121.789) -- 0:00:45 327500 -- [-2124.237] (-2122.783) (-2124.612) (-2118.650) * [-2118.020] (-2120.450) (-2119.778) (-2120.306) -- 0:00:45 328000 -- (-2123.580) (-2119.008) [-2121.755] (-2118.634) * [-2119.356] (-2119.579) (-2121.708) (-2119.048) -- 0:00:45 328500 -- (-2121.056) (-2119.467) [-2120.633] (-2118.500) * (-2119.268) [-2118.653] (-2120.708) (-2118.285) -- 0:00:44 329000 -- [-2119.558] (-2120.604) (-2120.937) (-2119.646) * (-2118.317) (-2119.596) (-2122.289) [-2119.093] -- 0:00:44 329500 -- [-2119.796] (-2118.333) (-2123.931) (-2119.543) * (-2117.959) (-2119.006) (-2121.375) [-2117.808] -- 0:00:44 330000 -- (-2122.929) (-2118.341) [-2117.927] (-2119.864) * (-2117.962) [-2119.664] (-2119.583) (-2119.708) -- 0:00:44 Average standard deviation of split frequencies: 0.013098 330500 -- (-2119.995) (-2118.755) (-2120.518) [-2119.860] * (-2119.450) [-2120.293] (-2121.808) (-2119.143) -- 0:00:44 331000 -- (-2120.207) [-2118.996] (-2119.430) (-2121.651) * [-2120.298] (-2123.876) (-2120.034) (-2119.582) -- 0:00:44 331500 -- (-2120.031) [-2118.341] (-2117.927) (-2120.632) * (-2119.385) (-2120.353) (-2120.910) [-2117.833] -- 0:00:44 332000 -- [-2118.676] (-2118.258) (-2118.473) (-2118.605) * [-2119.941] (-2121.378) (-2122.060) (-2119.094) -- 0:00:44 332500 -- (-2123.181) (-2118.265) [-2118.219] (-2120.598) * [-2120.266] (-2118.804) (-2122.440) (-2119.378) -- 0:00:44 333000 -- (-2121.104) (-2118.328) [-2119.886] (-2118.951) * (-2120.993) (-2118.412) (-2120.042) [-2118.396] -- 0:00:44 333500 -- (-2121.245) [-2119.761] (-2118.379) (-2118.404) * (-2118.650) [-2119.000] (-2122.143) (-2119.582) -- 0:00:43 334000 -- (-2118.869) (-2119.128) [-2118.576] (-2120.413) * (-2118.623) (-2117.884) (-2121.046) [-2119.561] -- 0:00:43 334500 -- (-2121.305) (-2119.287) [-2118.546] (-2118.952) * (-2118.021) (-2119.970) [-2119.973] (-2119.085) -- 0:00:45 335000 -- (-2119.300) (-2120.972) [-2118.703] (-2117.851) * (-2122.972) [-2120.837] (-2119.061) (-2120.167) -- 0:00:45 Average standard deviation of split frequencies: 0.012715 335500 -- (-2119.418) (-2120.838) (-2119.187) [-2118.123] * (-2125.461) [-2120.361] (-2118.443) (-2121.876) -- 0:00:45 336000 -- (-2119.605) (-2119.216) (-2123.244) [-2118.160] * (-2120.978) [-2121.382] (-2119.488) (-2122.387) -- 0:00:45 336500 -- (-2119.555) [-2118.843] (-2122.118) (-2119.363) * (-2121.363) (-2121.134) [-2119.335] (-2119.178) -- 0:00:45 337000 -- (-2120.174) (-2119.778) (-2125.538) [-2118.357] * [-2120.961] (-2122.004) (-2121.514) (-2119.715) -- 0:00:45 337500 -- (-2120.981) (-2121.381) (-2122.346) [-2120.811] * (-2120.918) (-2123.202) [-2120.512] (-2122.362) -- 0:00:45 338000 -- (-2122.012) (-2118.684) [-2121.020] (-2120.829) * [-2121.164] (-2120.303) (-2119.027) (-2119.448) -- 0:00:45 338500 -- [-2125.839] (-2125.516) (-2118.545) (-2119.246) * [-2119.997] (-2120.489) (-2120.221) (-2121.654) -- 0:00:44 339000 -- (-2127.307) (-2127.324) (-2121.261) [-2119.944] * [-2120.616] (-2118.563) (-2119.874) (-2120.147) -- 0:00:44 339500 -- (-2121.893) (-2120.116) (-2119.104) [-2121.648] * [-2122.619] (-2121.457) (-2120.489) (-2120.505) -- 0:00:44 340000 -- (-2122.580) (-2120.066) [-2120.877] (-2122.063) * [-2120.195] (-2118.573) (-2120.262) (-2119.271) -- 0:00:44 Average standard deviation of split frequencies: 0.013059 340500 -- (-2119.591) (-2117.918) (-2126.372) [-2126.878] * [-2120.187] (-2118.573) (-2119.319) (-2119.002) -- 0:00:44 341000 -- (-2123.324) [-2117.900] (-2123.503) (-2123.738) * (-2121.045) [-2118.573] (-2118.537) (-2119.021) -- 0:00:44 341500 -- (-2123.845) (-2120.542) (-2120.548) [-2125.707] * (-2123.158) (-2119.443) [-2118.324] (-2119.016) -- 0:00:44 342000 -- (-2120.363) (-2120.560) (-2119.402) [-2121.344] * (-2119.047) (-2119.298) (-2119.268) [-2118.633] -- 0:00:44 342500 -- (-2117.813) [-2123.333] (-2120.777) (-2119.626) * (-2120.727) [-2118.244] (-2119.770) (-2122.374) -- 0:00:44 343000 -- [-2118.870] (-2119.359) (-2121.249) (-2119.878) * (-2119.664) (-2119.770) (-2122.327) [-2120.492] -- 0:00:44 343500 -- (-2118.872) [-2119.843] (-2122.249) (-2119.880) * [-2119.342] (-2118.682) (-2119.453) (-2120.492) -- 0:00:43 344000 -- (-2123.344) [-2119.590] (-2121.992) (-2119.925) * [-2119.457] (-2120.917) (-2119.849) (-2120.316) -- 0:00:43 344500 -- (-2119.628) (-2119.441) (-2120.432) [-2118.391] * (-2119.898) (-2121.102) [-2121.528] (-2120.355) -- 0:00:43 345000 -- [-2118.936] (-2119.909) (-2120.202) (-2118.603) * (-2119.573) (-2120.935) [-2120.193] (-2121.213) -- 0:00:43 Average standard deviation of split frequencies: 0.012823 345500 -- (-2118.269) (-2123.664) [-2120.370] (-2118.427) * (-2121.621) (-2121.979) (-2120.696) [-2121.125] -- 0:00:43 346000 -- (-2118.807) (-2122.750) (-2119.076) [-2118.339] * (-2120.610) [-2119.499] (-2120.282) (-2120.190) -- 0:00:43 346500 -- (-2120.481) [-2124.099] (-2119.347) (-2118.224) * (-2120.108) (-2121.715) (-2120.556) [-2121.309] -- 0:00:43 347000 -- (-2120.934) [-2123.085] (-2125.333) (-2118.192) * (-2119.868) (-2123.380) [-2123.018] (-2119.879) -- 0:00:43 347500 -- [-2121.539] (-2119.528) (-2123.710) (-2117.999) * (-2119.828) [-2118.775] (-2121.985) (-2118.170) -- 0:00:43 348000 -- [-2118.485] (-2119.727) (-2120.808) (-2118.338) * (-2119.744) [-2119.678] (-2121.247) (-2119.234) -- 0:00:43 348500 -- [-2119.614] (-2120.095) (-2118.907) (-2118.455) * [-2119.678] (-2119.772) (-2118.678) (-2119.533) -- 0:00:42 349000 -- (-2119.297) (-2119.158) (-2119.701) [-2120.794] * (-2123.864) [-2118.933] (-2120.675) (-2120.977) -- 0:00:42 349500 -- (-2118.202) (-2122.320) (-2119.526) [-2120.339] * (-2121.749) [-2119.218] (-2119.816) (-2119.639) -- 0:00:44 350000 -- [-2118.347] (-2123.179) (-2122.012) (-2121.662) * (-2119.393) [-2119.085] (-2119.044) (-2119.535) -- 0:00:44 Average standard deviation of split frequencies: 0.012731 350500 -- [-2119.376] (-2119.787) (-2120.862) (-2120.329) * (-2118.943) (-2118.874) [-2125.058] (-2119.506) -- 0:00:44 351000 -- (-2119.219) (-2120.865) [-2119.898] (-2119.176) * (-2119.877) [-2120.476] (-2123.813) (-2121.262) -- 0:00:44 351500 -- (-2119.668) [-2118.997] (-2121.155) (-2118.555) * [-2119.943] (-2120.636) (-2121.149) (-2119.461) -- 0:00:44 352000 -- (-2119.331) [-2119.026] (-2120.572) (-2118.688) * (-2120.937) (-2119.927) [-2119.267] (-2118.249) -- 0:00:44 352500 -- (-2122.926) (-2118.708) [-2120.038] (-2119.723) * (-2124.494) [-2118.959] (-2121.961) (-2120.812) -- 0:00:44 353000 -- (-2121.984) (-2119.079) (-2120.482) [-2120.848] * (-2118.722) (-2120.042) [-2120.031] (-2121.254) -- 0:00:43 353500 -- [-2122.137] (-2119.548) (-2120.828) (-2118.653) * (-2118.561) [-2118.867] (-2120.225) (-2121.430) -- 0:00:43 354000 -- [-2119.316] (-2120.810) (-2118.967) (-2120.501) * [-2118.791] (-2123.258) (-2118.863) (-2120.263) -- 0:00:43 354500 -- (-2120.280) (-2119.979) (-2120.898) [-2118.331] * [-2118.533] (-2123.712) (-2119.487) (-2121.632) -- 0:00:43 355000 -- (-2120.865) (-2119.223) (-2118.589) [-2122.368] * (-2119.452) (-2119.028) [-2120.484] (-2118.867) -- 0:00:43 Average standard deviation of split frequencies: 0.011835 355500 -- (-2119.484) [-2121.088] (-2118.557) (-2119.513) * (-2121.511) (-2119.028) [-2122.232] (-2120.484) -- 0:00:43 356000 -- [-2118.687] (-2122.263) (-2119.515) (-2119.665) * [-2118.679] (-2117.775) (-2120.821) (-2120.251) -- 0:00:43 356500 -- (-2120.867) (-2118.557) [-2121.737] (-2121.394) * (-2121.996) [-2118.165] (-2121.419) (-2122.228) -- 0:00:43 357000 -- (-2120.499) (-2118.982) (-2124.525) [-2120.520] * (-2119.539) (-2118.373) (-2123.712) [-2118.965] -- 0:00:43 357500 -- (-2119.775) [-2118.385] (-2118.845) (-2120.976) * [-2121.329] (-2121.298) (-2120.414) (-2121.037) -- 0:00:43 358000 -- [-2120.532] (-2117.814) (-2118.688) (-2122.883) * (-2122.595) (-2122.005) (-2125.060) [-2124.268] -- 0:00:43 358500 -- (-2119.556) [-2118.084] (-2118.775) (-2122.094) * (-2123.306) [-2125.897] (-2120.759) (-2119.302) -- 0:00:42 359000 -- (-2123.092) (-2118.483) (-2119.443) [-2120.425] * [-2119.547] (-2123.344) (-2122.510) (-2118.792) -- 0:00:42 359500 -- (-2122.975) (-2119.947) [-2121.695] (-2122.728) * (-2120.854) (-2119.365) (-2120.167) [-2120.326] -- 0:00:42 360000 -- [-2118.790] (-2123.799) (-2121.031) (-2119.960) * (-2120.942) (-2120.110) [-2120.256] (-2119.651) -- 0:00:42 Average standard deviation of split frequencies: 0.011518 360500 -- (-2119.327) (-2127.010) [-2117.820] (-2118.477) * (-2118.555) (-2120.151) [-2118.931] (-2119.880) -- 0:00:42 361000 -- [-2120.041] (-2124.101) (-2121.273) (-2119.622) * [-2118.070] (-2119.207) (-2119.943) (-2120.432) -- 0:00:42 361500 -- (-2121.390) (-2120.705) [-2121.143] (-2119.928) * (-2119.085) [-2118.504] (-2120.682) (-2122.627) -- 0:00:42 362000 -- (-2121.360) (-2123.082) (-2120.235) [-2118.899] * (-2122.910) [-2118.745] (-2121.008) (-2120.735) -- 0:00:42 362500 -- [-2124.574] (-2118.924) (-2120.470) (-2118.677) * (-2121.455) (-2120.246) (-2123.398) [-2121.169] -- 0:00:42 363000 -- (-2123.587) (-2119.296) [-2118.444] (-2118.463) * (-2122.592) [-2119.384] (-2123.750) (-2119.461) -- 0:00:42 363500 -- (-2119.307) (-2120.970) [-2118.556] (-2121.531) * [-2119.678] (-2118.745) (-2123.768) (-2121.401) -- 0:00:42 364000 -- [-2121.349] (-2120.276) (-2118.689) (-2124.196) * (-2120.295) (-2120.857) (-2121.746) [-2122.944] -- 0:00:41 364500 -- [-2118.863] (-2121.259) (-2120.235) (-2127.386) * [-2121.365] (-2119.521) (-2118.578) (-2121.117) -- 0:00:41 365000 -- (-2118.108) (-2121.024) (-2120.545) [-2120.096] * (-2124.423) (-2120.024) [-2118.904] (-2122.855) -- 0:00:43 Average standard deviation of split frequencies: 0.011753 365500 -- [-2118.244] (-2120.505) (-2122.286) (-2119.399) * (-2124.732) (-2120.024) [-2119.721] (-2123.611) -- 0:00:43 366000 -- (-2120.169) [-2118.362] (-2119.346) (-2121.894) * (-2118.435) (-2120.024) (-2119.084) [-2118.145] -- 0:00:43 366500 -- (-2120.829) (-2118.755) [-2119.616] (-2119.143) * (-2119.102) (-2119.888) (-2119.432) [-2123.696] -- 0:00:43 367000 -- (-2120.617) (-2118.615) [-2123.951] (-2118.551) * [-2119.197] (-2119.287) (-2119.477) (-2124.535) -- 0:00:43 367500 -- (-2123.087) [-2121.105] (-2121.139) (-2119.670) * (-2119.217) [-2120.431] (-2120.472) (-2123.803) -- 0:00:43 368000 -- (-2127.232) (-2122.339) (-2120.124) [-2119.042] * (-2118.831) [-2119.061] (-2118.258) (-2123.071) -- 0:00:42 368500 -- [-2119.507] (-2121.067) (-2122.502) (-2118.536) * (-2119.505) [-2119.434] (-2118.627) (-2120.733) -- 0:00:42 369000 -- [-2119.998] (-2122.024) (-2121.159) (-2122.075) * (-2120.901) (-2118.516) [-2119.817] (-2119.838) -- 0:00:42 369500 -- (-2124.171) (-2120.280) [-2119.870] (-2120.475) * (-2121.231) [-2119.382] (-2120.661) (-2120.958) -- 0:00:42 370000 -- (-2119.601) (-2119.564) (-2120.792) [-2121.664] * (-2119.277) [-2118.208] (-2118.160) (-2122.685) -- 0:00:42 Average standard deviation of split frequencies: 0.011446 370500 -- [-2121.461] (-2120.004) (-2118.393) (-2121.909) * [-2118.159] (-2118.316) (-2119.927) (-2125.367) -- 0:00:42 371000 -- (-2119.952) [-2119.897] (-2123.819) (-2118.172) * [-2118.628] (-2120.298) (-2125.791) (-2121.519) -- 0:00:42 371500 -- (-2120.846) (-2118.838) [-2121.649] (-2117.849) * (-2121.053) (-2119.184) [-2119.519] (-2119.695) -- 0:00:42 372000 -- (-2123.850) [-2119.804] (-2119.691) (-2129.980) * (-2119.603) (-2119.416) [-2119.308] (-2122.645) -- 0:00:42 372500 -- (-2121.802) (-2118.536) [-2119.141] (-2120.718) * (-2123.442) (-2120.594) [-2118.360] (-2121.643) -- 0:00:42 373000 -- (-2122.871) [-2118.863] (-2119.264) (-2117.950) * (-2124.897) (-2118.440) [-2118.462] (-2121.883) -- 0:00:42 373500 -- (-2120.611) (-2121.890) [-2121.404] (-2120.557) * (-2121.320) (-2118.431) [-2120.199] (-2121.268) -- 0:00:41 374000 -- (-2119.839) (-2119.695) (-2119.271) [-2119.050] * (-2119.206) (-2118.653) [-2120.178] (-2120.754