--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Wed Nov 02 14:53:29 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/14/Arl5-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1790.96 -1809.44
2 -1790.54 -1807.98
--------------------------------------
TOTAL -1790.73 -1808.95
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.360324 0.022172 1.097790 1.672114 1.353018 1202.77 1276.11 1.000
r(A<->C){all} 0.099697 0.000529 0.057888 0.145736 0.097994 801.80 909.01 1.000
r(A<->G){all} 0.220806 0.001570 0.147453 0.300013 0.217351 743.81 774.80 1.001
r(A<->T){all} 0.017110 0.000296 0.000013 0.051406 0.011960 522.26 757.58 1.000
r(C<->G){all} 0.055933 0.000190 0.030834 0.084527 0.054713 1046.00 1050.16 1.000
r(C<->T){all} 0.572883 0.002536 0.472851 0.666363 0.573493 650.77 746.29 1.001
r(G<->T){all} 0.033571 0.000206 0.007509 0.061226 0.032221 995.13 1033.17 1.000
pi(A){all} 0.232541 0.000313 0.199698 0.268381 0.232665 933.09 993.88 1.000
pi(C){all} 0.286523 0.000303 0.250996 0.318808 0.286229 1212.98 1296.45 1.000
pi(G){all} 0.299230 0.000334 0.264494 0.336610 0.298622 1122.53 1160.52 1.000
pi(T){all} 0.181706 0.000218 0.153801 0.210788 0.181481 970.80 1099.16 1.000
alpha{1,2} 0.072469 0.000241 0.045571 0.104129 0.073167 958.46 1019.05 1.001
alpha{3} 3.430087 0.932108 1.761111 5.327696 3.287892 1203.73 1302.82 1.000
pinvar{all} 0.303055 0.002824 0.195675 0.400741 0.303969 1166.90 1331.58 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1592.168673
Model 2: PositiveSelection -1592.166905
Model 0: one-ratio -1592.281347
Model 3: discrete -1592.166905
Model 7: beta -1592.165772
Model 8: beta&w>1 -1592.200271
Model 0 vs 1 0.22534800000039468
Model 2 vs 1 0.003535999999712658
Model 8 vs 7 0.06899799999973766
>C1
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C2
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C3
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C4
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C5
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C6
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C7
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C8
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C9
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C10
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C11
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C12
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=179
C1 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
C2 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
C3 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
C4 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
C5 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
C6 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
C7 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
C8 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
C9 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
C10 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
C11 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
C12 MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
**************************************************
C1 NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
C2 NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
C3 NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
C4 NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
C5 NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
C6 NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
C7 NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
C8 NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
C9 NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
C10 NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
C11 NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
C12 NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
**************************************************
C1 VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
C2 VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
C3 VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
C4 VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
C5 VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
C6 VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
C7 VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
C8 VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
C9 VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
C10 VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
C11 VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
C12 VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
**************************************************
C1 QWHIQACCALTGEGLYQGLEWIVQRIKNK
C2 QWHIQACCALTGEGLYQGLEWIVQRIKNK
C3 QWHIQACCALTGEGLYQGLEWIVQRIKNK
C4 QWHIQACCALTGEGLYQGLEWIVQRIKNK
C5 QWHIQACCALTGEGLYQGLEWIVQRIKNK
C6 QWHIQACCALTGEGLYQGLEWIVQRIKNK
C7 QWHIQACCALTGEGLYQGLEWIVQRIKNK
C8 QWHIQACCALTGEGLYQGLEWIVQRIKNK
C9 QWHIQACCALTGEGLYQGLEWIVQRIKNK
C10 QWHIQACCALTGEGLYQGLEWIVQRIKNK
C11 QWHIQACCALTGEGLYQGLEWIVQRIKNK
C12 QWHIQACCALTGEGLYQGLEWIVQRIKNK
*****************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 179 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 179 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23628]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [23628]--->[23628]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/14/Arl5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.639 Mb, Max= 31.278 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C2
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C3
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C4
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C5
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C6
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C7
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C8
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C9
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C10
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C11
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C12
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
FORMAT of file /tmp/tmp2996036697441589336aln Not Supported[FATAL:T-COFFEE]
>C1
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C2
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C3
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C4
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C5
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C6
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C7
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C8
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C9
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C10
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C11
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C12
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:179 S:100 BS:179
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 0 6 100.00 C1 C7 100.00
TOP 6 0 100.00 C7 C1 100.00
BOT 0 7 100.00 C1 C8 100.00
TOP 7 0 100.00 C8 C1 100.00
BOT 0 8 100.00 C1 C9 100.00
TOP 8 0 100.00 C9 C1 100.00
BOT 0 9 100.00 C1 C10 100.00
TOP 9 0 100.00 C10 C1 100.00
BOT 0 10 100.00 C1 C11 100.00
TOP 10 0 100.00 C11 C1 100.00
BOT 0 11 100.00 C1 C12 100.00
TOP 11 0 100.00 C12 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 1 6 100.00 C2 C7 100.00
TOP 6 1 100.00 C7 C2 100.00
BOT 1 7 100.00 C2 C8 100.00
TOP 7 1 100.00 C8 C2 100.00
BOT 1 8 100.00 C2 C9 100.00
TOP 8 1 100.00 C9 C2 100.00
BOT 1 9 100.00 C2 C10 100.00
TOP 9 1 100.00 C10 C2 100.00
BOT 1 10 100.00 C2 C11 100.00
TOP 10 1 100.00 C11 C2 100.00
BOT 1 11 100.00 C2 C12 100.00
TOP 11 1 100.00 C12 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 2 6 100.00 C3 C7 100.00
TOP 6 2 100.00 C7 C3 100.00
BOT 2 7 100.00 C3 C8 100.00
TOP 7 2 100.00 C8 C3 100.00
BOT 2 8 100.00 C3 C9 100.00
TOP 8 2 100.00 C9 C3 100.00
BOT 2 9 100.00 C3 C10 100.00
TOP 9 2 100.00 C10 C3 100.00
BOT 2 10 100.00 C3 C11 100.00
TOP 10 2 100.00 C11 C3 100.00
BOT 2 11 100.00 C3 C12 100.00
TOP 11 2 100.00 C12 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 3 6 100.00 C4 C7 100.00
TOP 6 3 100.00 C7 C4 100.00
BOT 3 7 100.00 C4 C8 100.00
TOP 7 3 100.00 C8 C4 100.00
BOT 3 8 100.00 C4 C9 100.00
TOP 8 3 100.00 C9 C4 100.00
BOT 3 9 100.00 C4 C10 100.00
TOP 9 3 100.00 C10 C4 100.00
BOT 3 10 100.00 C4 C11 100.00
TOP 10 3 100.00 C11 C4 100.00
BOT 3 11 100.00 C4 C12 100.00
TOP 11 3 100.00 C12 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
BOT 4 6 100.00 C5 C7 100.00
TOP 6 4 100.00 C7 C5 100.00
BOT 4 7 100.00 C5 C8 100.00
TOP 7 4 100.00 C8 C5 100.00
BOT 4 8 100.00 C5 C9 100.00
TOP 8 4 100.00 C9 C5 100.00
BOT 4 9 100.00 C5 C10 100.00
TOP 9 4 100.00 C10 C5 100.00
BOT 4 10 100.00 C5 C11 100.00
TOP 10 4 100.00 C11 C5 100.00
BOT 4 11 100.00 C5 C12 100.00
TOP 11 4 100.00 C12 C5 100.00
BOT 5 6 100.00 C6 C7 100.00
TOP 6 5 100.00 C7 C6 100.00
BOT 5 7 100.00 C6 C8 100.00
TOP 7 5 100.00 C8 C6 100.00
BOT 5 8 100.00 C6 C9 100.00
TOP 8 5 100.00 C9 C6 100.00
BOT 5 9 100.00 C6 C10 100.00
TOP 9 5 100.00 C10 C6 100.00
BOT 5 10 100.00 C6 C11 100.00
TOP 10 5 100.00 C11 C6 100.00
BOT 5 11 100.00 C6 C12 100.00
TOP 11 5 100.00 C12 C6 100.00
BOT 6 7 100.00 C7 C8 100.00
TOP 7 6 100.00 C8 C7 100.00
BOT 6 8 100.00 C7 C9 100.00
TOP 8 6 100.00 C9 C7 100.00
BOT 6 9 100.00 C7 C10 100.00
TOP 9 6 100.00 C10 C7 100.00
BOT 6 10 100.00 C7 C11 100.00
TOP 10 6 100.00 C11 C7 100.00
BOT 6 11 100.00 C7 C12 100.00
TOP 11 6 100.00 C12 C7 100.00
BOT 7 8 100.00 C8 C9 100.00
TOP 8 7 100.00 C9 C8 100.00
BOT 7 9 100.00 C8 C10 100.00
TOP 9 7 100.00 C10 C8 100.00
BOT 7 10 100.00 C8 C11 100.00
TOP 10 7 100.00 C11 C8 100.00
BOT 7 11 100.00 C8 C12 100.00
TOP 11 7 100.00 C12 C8 100.00
BOT 8 9 100.00 C9 C10 100.00
TOP 9 8 100.00 C10 C9 100.00
BOT 8 10 100.00 C9 C11 100.00
TOP 10 8 100.00 C11 C9 100.00
BOT 8 11 100.00 C9 C12 100.00
TOP 11 8 100.00 C12 C9 100.00
BOT 9 10 100.00 C10 C11 100.00
TOP 10 9 100.00 C11 C10 100.00
BOT 9 11 100.00 C10 C12 100.00
TOP 11 9 100.00 C12 C10 100.00
BOT 10 11 100.00 C11 C12 100.00
TOP 11 10 100.00 C12 C11 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
AVG 6 C7 * 100.00
AVG 7 C8 * 100.00
AVG 8 C9 * 100.00
AVG 9 C10 * 100.00
AVG 10 C11 * 100.00
AVG 11 C12 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGGACTGTTATTATCGCGGCTCTGGCGGATGTTTGGCAACGAGGAGCA
C2 ATGGGACTGTTATTATCGCGGCTCTGGCGGATGTTTGGCAACGAGGAACA
C3 ATGGGACTGTTATTATCGCGGCTCTGGCGGATGTTTGGCAACGAGGAGCA
C4 ATGGGACTGTTATTATCGCGGCTTTGGCGGATGTTTGGCAACGAGGAGCA
C5 ATGGGACTGTTATTATCGCGGCTTTGGCGGATGTTTGGCAACGAGGAGCA
C6 ATGGGACTACTATTATCGCGGCTGTGGCGGATGTTTGGCAACGAGGAGCA
C7 ATGGGCCTGCTACTATCGCGGCTGTGGCGGATGTTCGGCAACGAGGAGCA
C8 ATGGGACTGTTATTATCGCGGCTGTGGCGGATGTTTGGCAACGAGGAGCA
C9 ATGGGATTGTTATTATCGCGGCTGTGGCGGATGTTTGGAAATGAGGAGCA
C10 ATGGGACTGCTATTATCGCGGCTCTGGCGGATGTTTGGGAACGAGGAGCA
C11 ATGGGACTGTTATTATCGCGGCTGTGGCGGATGTTTGGCAACGAGGAGCA
C12 ATGGGACTGTTATTATCGCGACTGTGGCGGATGTTTGGCAACGAGGAGCA
*****. *. ** *******.** *********** ** ** *****.**
C1 CAAGCTGGTGATGGTGGGTCTGGACAACGCGGGCAAAACCACCATCCTGT
C2 CAAGCTGGTGATGGTGGGTCTGGACAACGCGGGCAAAACCACCATCCTGT
C3 CAAGCTGGTGATGGTGGGTCTGGACAACGCGGGCAAAACCACCATCCTGT
C4 CAAGCTGGTGATGGTGGGTTTGGACAACGCAGGCAAAACGACCATCCTGT
C5 CAAGCTGGTCATGGTGGGCTTGGACAACGCGGGCAAAACGACCATCCTGT
C6 CAAGCTGGTGATGGTGGGCCTGGACAACGCGGGCAAGACGACCATCCTGT
C7 CAAGCTGGTGATGGTGGGCCTGGACAACGCGGGCAAGACGACCATCCTGT
C8 CAAGCTGGTGATGGTGGGCCTGGACAACGCGGGCAAGACGACCATCCTGT
C9 TAAGCTGGTGATGGTGGGTCTGGACAATGCTGGAAAAACGACCATCCTGT
C10 CAAGCTGGTGATGGTGGGATTGGACAACGCGGGCAAGACAACCATCCTGT
C11 CAAGTTGGTGATGGTGGGCCTGGACAACGCGGGCAAAACGACCATCCTTT
C12 CAAGTTGGTGATGGTCGGTCTGGACAATGCGGGTAAAACGACTATCCTGT
*** **** ***** ** ******* ** ** **.** ** ***** *
C1 ACCAGTTCCTGATGAACGAAGTGGTCCACACAAGTCCCACGATCGGTTCC
C2 ACCAGTTCCTGATGAATGAAGTGGTCCACACAAGTCCCACGATCGGTTCC
C3 ACCAGTTCCTGATGAACGAAGTGGTCCACACAAGTCCCACGATCGGTTCC
C4 ACCAATTCCTGATGAACGAAGTGGTCCACACAAGTCCCACGATCGGTTCC
C5 ACCAATTCCTTATGAACGAAGTGGTCCACACAAGTCCCACGATCGGTTCC
C6 ACCAGTTCCTGATGAACGAGGTCGTCCACACGAGTCCCACGATCGGTTCG
C7 ACCAGTTCCTGATGAACGAGGTCGTCCACACGAGTCCCACGATCGGCTCC
C8 ACCAGTTCCTGATGAACGAGGTCGTCCACACGAGTCCCACGATCGGTTCC
C9 ATCAGTTCCTGATGAATGAGGTGGTCCATACCAGTCCTACGATCGGTTCC
C10 ACCAGTTTTTAATGAACGAAGTGGTCCACACCAGTCCCACGATCGGCTCC
C11 ACCAGTTCCTCATGAACGAGGTGGTTCATACCAGTCCAACGATCGGTTCC
C12 ACCAGTTCCTCATGAACGAGGTGGTCCACACCAGTCCCACGATCGGTTCC
* **.** * ***** **.** ** ** ** ***** ******** **
C1 AACGTGGAGGAGGTCGTCTGGCGGAATATACACTTTCTTGTCTGGGATCT
C2 AACGTGGAAGAGGTCGTCTGGCGGAATATACACTTCCTTGTCTGGGATCT
C3 AACGTGGAAGAGGTCGTCTGGCGGAATATACACTTCCTTGTCTGGGATCT
C4 AATGTAGAGGAGGTCGTCTGGCGGAATATACACTTTCTTGTCTGGGATCT
C5 AATGTGGAGGAGGTCGTCTGGCGGAATATACACTTTCTTGTCTGGGATCT
C6 AATGTGGAGGAGGTCGTCTGGCGGAACATTCACTTCCTGGTCTGGGATTT
C7 AACGTGGAGGAGGTCGTCTGGCGGAACATTCACTTTCTGGTGTGGGACCT
C8 AATGTGGAGGAGGTCGTCTGGCGGAATATCCACTTTCTGGTCTGGGACTT
C9 AATGTGGAGGAGGTCGTTTGGCGAAATATACACTTTCTCGTTTGGGATCT
C10 AATGTTGAGGAGGTCGTCTGGCGAAATATTCACTTCCTCGTTTGGGATCT
C11 AATGTGGAGGAGGTCGTTTGGCGGAATATCCACTTCCTGGTCTGGGATCT
C12 AATGTGGAGGAGGTCGTTTGGCGGAATATCCACTTCCTGGTCTGGGATCT
** ** **.******** *****.** ** ***** ** ** ***** *
C1 TGGTGGTCAGCAGAGTCTGCGCGCCGCTTGGAGCACCTACTACACGAACA
C2 TGGTGGTCAGCAGAGTCTGCGCGCCGCTTGGAGCACCTACTACACGAACA
C3 TGGTGGTCAGCAGAGTCTGCGCGCCGCTTGGAGCACCTACTACACGAACA
C4 TGGTGGTCAGCAGAGTCTCCGCGCCGCTTGGAGCACCTACTACACGAACA
C5 TGGTGGTCAGCAGAGCCTCCGCGCGGCTTGGAGCACCTACTATACGAACA
C6 GGGCGGTCAGCAGAGCCTGCGCGCCGCCTGGAGCACCTACTACACGAACA
C7 GGGCGGCCAGCAGAGCCTGCGCGCCGCCTGGAGCACCTACTACACGAACA
C8 GGGCGGCCAGCAGAGCCTCCGCGCCGCCTGGAGCACCTACTACACGAACA
C9 CGGAGGCCAGCAGAGCCTGCGAGCTGCCTGGAGCACCTATTACACGAACA
C10 TGGAGGTCAGCAAAGCCTTCGTGCCGCTTGGAGCACTTACTACACGAACA
C11 GGGCGGTCAGCAGAGCCTCCGAGCCGCCTGGAGCACTTACTACACGAACA
C12 GGGCGGTCAGCAGAGCCTCCGAGCCGCCTGGAGCACCTACTACACGAACA
** ** *****.** ** ** ** ** ******** ** ** *******
C1 CAGAGCTGGTGATCATGGTCATCGACTCCACGGACCGGGAACGGTTAGCT
C2 CAGAGCTGGTGATCATGGTCATCGACTCCACGGACCGGGAACGGTTAGCT
C3 CAGAGCTGGTGATCATGGTCATCGACTCCACGGACCGGGAACGGTTAGCT
C4 CAGAGCTGGTGATCATGGTCATCGACTCCACGGATCGGGAACGGTTAGCT
C5 CAGAGCTGGTGATCATGGTCATCGACTCCACGGACCGGGAACGGTTAGCT
C6 CAGAGCTGGTCATCATGGTCATAGACTCGACGGATCGGGAAAGGTTGGCT
C7 CAGAGCTGGTGATCATGGTCATCGACTCCACGGATCGGGAAAGGCTGGCT
C8 CAGAGCTGGTGATCATGGTCATCGACTCCACGGACCGGGAAAGGCTGGCT
C9 CAGAGCTGGTGATCATGGTCATCGACTCGACGGATCGGGAAAGGTTAGCT
C10 CGGAGCTGGTGATCATGGTCATCGACTCGACGGATCGGGAAAGACTGGCT
C11 CAGAGCTAGTGATCATGGTCATCGACTCCACGGATCGGGAAAGGCTGGCC
C12 CAGAGCTGGTGATCATGGTCATCGACTCCACGGATCGGGAAAGGCTGGCC
*.*****.** ***********.***** ***** ******.*. *.**
C1 GTTACGCGGGAAGAGCTCTACCGGATGCTGCAACATGAGGATCTGAGCAA
C2 GTTACGCGGGAAGAGCTCTACCGGATGCTGCAGCATGAGGATCTGAGCAA
C3 GTTACGCGGGAAGAGCTCTACCGGATGCTGCAGCATGAGGATCTGAGCAA
C4 GTGACGCGGGAAGAGCTCTACCGGATGCTGCAGCATGAGGATCTGAGCAA
C5 GTTACGCGGGAAGAGCTCTACAGGATGCTGCAGCATGAGGATCTGAGCAA
C6 GTGACGCGGGAGGAGCTCTACCGGATGCTGCAGCACGAGGATCTCAGCAA
C7 GTCACGCGGGAGGAGCTCTACCGGATGCTGCAGCACGAGGATCTGAGCAA
C8 GTCACGCGGGAGGAGCTCTACCGGATGCTGCAGCACGAGGATCTGAGCAA
C9 GTGACACGAGAAGAGCTCTACCGAATGCTACAGCACGAGGATCTGAGCAA
C10 GTCACTCGGGAAGAGCTCTACCGGATGCTGCAGCACGAGGATCTGAGCAA
C11 GTTACGCGGGAGGAGCTATATCGGATGCTGCAGCACGAGGATCTGAGCAA
C12 GTAACGCGGGAAGAGCTGTACCGAATGCTGCAGCACGAGGATCTGAGCAA
** ** **.**.***** ** .*.*****.**.** ******** *****
C1 GGCCAGTTTGCTGGTCTATGCCAATAAGCAGGATCTCAAGGGCTCTATGT
C2 GGCCAGTTTGCTGGTCTATGCCAATAAGCAGGATCTCAAGGGCTCCATGT
C3 GGCCAGTTTGCTGGTCTATGCCAATAAGCAGGATCTCAAGGGCTCCATGT
C4 GGCGAGTCTGCTGGTCTATGCCAATAAACAAGACCTCAAGGGCTCCATGT
C5 GGCGAGTTTGCTGGTCTATGCCAATAAACAGGACCTCAAGGGCTCCATGT
C6 GGCTAGCCTGCTGGTCTATGCCAACAAGCAGGACCTCAAGGGCTCCATGT
C7 GGCCAGCCTGCTGGTCTATGCCAACAAGCAGGACCTGAAGGGCTCCATGT
C8 GGCCAGCCTGCTGGTGTATGCCAACAAGCAGGACCTCAAGGGCTCCATGT
C9 GGCTAGCCTTCTGGTCTATGCCAACAAACAGGATCTTAAAGGTTCCATGT
C10 GGCCAGTCTGCTAGTCTACGCCAACAAGCAGGACCTCAAGGGCTCAATGT
C11 GGCCAGTTTGCTGGTCTACGCCAACAAGCAGGACCTCAAGGGATCAATGT
C12 GGCCAGCCTGCTGGTCTACGCCAACAAGCAGGACCTCAAGGGTTCCATGT
*** ** * **.** ** ***** **.**.** ** **.** ** ****
C1 CGGCGGCGGAAATCTCACGACAACTGGACCTCACCTCCATCAAGAAGCAC
C2 CGGCGGCGGAAATCTCACGACAACTGGACCTCACCTCCATCAAGAAGCAC
C3 CGGCGGCGGAAATCTCACGACAACTGGACCTCACCTCCATCAAGAAGCAC
C4 CGGCAGCGGAAATCTCAAGACAACTGGACCTCACCTCCATCAAGAAGCAC
C5 CGGCGGCGGAAATCTCAAGACAACTGGACCTCACCTCCATCAAGAAGCAC
C6 CGGCGGCGGAGATATCGCGGCAACTGGACCTCACCTCCATCAAGAAGCAC
C7 CGGCGGCGGAGATCTCGCGGCAACTGGACCTCACCTCCATCAAGAAGCAC
C8 CGGCGGCGGAGATATCGCGGCAACTGGACCTCACCTCCATCAAGAAGCAT
C9 CGGCAGCAGAGATTTCAAGACAACTAGACCTCACATCCATCAAGAAGCAC
C10 CGGCGGCGGAAATATCCCGACAACTTGACCTCACCTCCATTAAGAAGCAC
C11 CGGCGGCGGAGATATCGCGGCAACTGGACCTTACCTCCATAAAAAAGCAC
C12 CAGCGGCGGAAATATCGCGGCAACTGGACCTGACCTCTATCAAAAAGCAC
*.**.**.**.** ** .*.***** ***** **.** ** **.*****
C1 CAATGGCACATCCAGGCCTGCTGTGCGCTCACCGGCGAAGGACTCTATCA
C2 CAGTGGCACATCCAGGCCTGCTGTGCGCTCACCGGCGAAGGACTCTATCA
C3 CAGTGGCACATCCAGGCCTGCTGTGCGCTCACCGGCGAAGGACTCTATCA
C4 CAATGGCACATTCAGGCCTGCTGTGCGCTCACCGGCGAAGGACTCTATCA
C5 CAATGGCACATTCAGGCCTGCTGTGCGCTTACCGGCGAAGGACTCTATCA
C6 CAGTGGCACATCCAGGCCTGCTGCGCGCTCACCGGCGAGGGACTCTACCA
C7 CAGTGGCACATCCAGGCCTGCTGTGCGCTCACCGGCGAGGGCCTCTACCA
C8 CAGTGGCACATCCAGGCCTGCTGTGCGCTCACCGGCGAAGGACTCTATCA
C9 CAGTGGCACATCCAAGCCTGCTGTGCGCTCACAGGCGAAGGACTCTACCA
C10 CAGTGGCACATCCAGGCCTGCTGTGCGCTTACCGGCGAAGGCCTGTATCA
C11 CAGTGGCACATCCAGGCCTGCTGCGCGCTAACCGGCGAAGGACTCTACCA
C12 CAGTGGCACATTCAGGCCTGCTGCGCGCTCACTGGCGAAGGACTCTACCA
**.******** **.******** ***** ** *****.**.** ** **
C1 AGGATTAGAGTGGATCGTGCAGCGCATCAAGAACAAA
C2 AGGATTAGAGTGGATCGTGCAGCGCATCAAGAACAAA
C3 AGGATTAGAGTGGATCGTGCAGCGCATCAAGAACAAA
C4 AGGATTAGAGTGGATCGTCCAGCGCATCAAGAACAAA
C5 AGGATTAGAGTGGATCGTGCAGCGCATCAAGAACAAA
C6 AGGACTCGAGTGGATTGTCCAGCGCATCAAGAACAAA
C7 GGGACTGGAGTGGATCGTACAGCGCATCAAGAACAAA
C8 GGGATTGGAGTGGATCGTGCAGCGCATCAAGAACAAA
C9 AGGATTGGAGTGGATCGTGCAGCGCATCAAGAACAAA
C10 AGGACTGGAGTGGATCGTGCAGCGCATCAAGAACAAA
C11 AGGATTGGAGTGGATCGTGCAGCGCATCAAGAATAAA
C12 AGGACTGGAGTGGATAGTGCAGCGCATCAAGAACAAA
.*** * ******** ** ************** ***
>C1
ATGGGACTGTTATTATCGCGGCTCTGGCGGATGTTTGGCAACGAGGAGCA
CAAGCTGGTGATGGTGGGTCTGGACAACGCGGGCAAAACCACCATCCTGT
ACCAGTTCCTGATGAACGAAGTGGTCCACACAAGTCCCACGATCGGTTCC
AACGTGGAGGAGGTCGTCTGGCGGAATATACACTTTCTTGTCTGGGATCT
TGGTGGTCAGCAGAGTCTGCGCGCCGCTTGGAGCACCTACTACACGAACA
CAGAGCTGGTGATCATGGTCATCGACTCCACGGACCGGGAACGGTTAGCT
GTTACGCGGGAAGAGCTCTACCGGATGCTGCAACATGAGGATCTGAGCAA
GGCCAGTTTGCTGGTCTATGCCAATAAGCAGGATCTCAAGGGCTCTATGT
CGGCGGCGGAAATCTCACGACAACTGGACCTCACCTCCATCAAGAAGCAC
CAATGGCACATCCAGGCCTGCTGTGCGCTCACCGGCGAAGGACTCTATCA
AGGATTAGAGTGGATCGTGCAGCGCATCAAGAACAAA
>C2
ATGGGACTGTTATTATCGCGGCTCTGGCGGATGTTTGGCAACGAGGAACA
CAAGCTGGTGATGGTGGGTCTGGACAACGCGGGCAAAACCACCATCCTGT
ACCAGTTCCTGATGAATGAAGTGGTCCACACAAGTCCCACGATCGGTTCC
AACGTGGAAGAGGTCGTCTGGCGGAATATACACTTCCTTGTCTGGGATCT
TGGTGGTCAGCAGAGTCTGCGCGCCGCTTGGAGCACCTACTACACGAACA
CAGAGCTGGTGATCATGGTCATCGACTCCACGGACCGGGAACGGTTAGCT
GTTACGCGGGAAGAGCTCTACCGGATGCTGCAGCATGAGGATCTGAGCAA
GGCCAGTTTGCTGGTCTATGCCAATAAGCAGGATCTCAAGGGCTCCATGT
CGGCGGCGGAAATCTCACGACAACTGGACCTCACCTCCATCAAGAAGCAC
CAGTGGCACATCCAGGCCTGCTGTGCGCTCACCGGCGAAGGACTCTATCA
AGGATTAGAGTGGATCGTGCAGCGCATCAAGAACAAA
>C3
ATGGGACTGTTATTATCGCGGCTCTGGCGGATGTTTGGCAACGAGGAGCA
CAAGCTGGTGATGGTGGGTCTGGACAACGCGGGCAAAACCACCATCCTGT
ACCAGTTCCTGATGAACGAAGTGGTCCACACAAGTCCCACGATCGGTTCC
AACGTGGAAGAGGTCGTCTGGCGGAATATACACTTCCTTGTCTGGGATCT
TGGTGGTCAGCAGAGTCTGCGCGCCGCTTGGAGCACCTACTACACGAACA
CAGAGCTGGTGATCATGGTCATCGACTCCACGGACCGGGAACGGTTAGCT
GTTACGCGGGAAGAGCTCTACCGGATGCTGCAGCATGAGGATCTGAGCAA
GGCCAGTTTGCTGGTCTATGCCAATAAGCAGGATCTCAAGGGCTCCATGT
CGGCGGCGGAAATCTCACGACAACTGGACCTCACCTCCATCAAGAAGCAC
CAGTGGCACATCCAGGCCTGCTGTGCGCTCACCGGCGAAGGACTCTATCA
AGGATTAGAGTGGATCGTGCAGCGCATCAAGAACAAA
>C4
ATGGGACTGTTATTATCGCGGCTTTGGCGGATGTTTGGCAACGAGGAGCA
CAAGCTGGTGATGGTGGGTTTGGACAACGCAGGCAAAACGACCATCCTGT
ACCAATTCCTGATGAACGAAGTGGTCCACACAAGTCCCACGATCGGTTCC
AATGTAGAGGAGGTCGTCTGGCGGAATATACACTTTCTTGTCTGGGATCT
TGGTGGTCAGCAGAGTCTCCGCGCCGCTTGGAGCACCTACTACACGAACA
CAGAGCTGGTGATCATGGTCATCGACTCCACGGATCGGGAACGGTTAGCT
GTGACGCGGGAAGAGCTCTACCGGATGCTGCAGCATGAGGATCTGAGCAA
GGCGAGTCTGCTGGTCTATGCCAATAAACAAGACCTCAAGGGCTCCATGT
CGGCAGCGGAAATCTCAAGACAACTGGACCTCACCTCCATCAAGAAGCAC
CAATGGCACATTCAGGCCTGCTGTGCGCTCACCGGCGAAGGACTCTATCA
AGGATTAGAGTGGATCGTCCAGCGCATCAAGAACAAA
>C5
ATGGGACTGTTATTATCGCGGCTTTGGCGGATGTTTGGCAACGAGGAGCA
CAAGCTGGTCATGGTGGGCTTGGACAACGCGGGCAAAACGACCATCCTGT
ACCAATTCCTTATGAACGAAGTGGTCCACACAAGTCCCACGATCGGTTCC
AATGTGGAGGAGGTCGTCTGGCGGAATATACACTTTCTTGTCTGGGATCT
TGGTGGTCAGCAGAGCCTCCGCGCGGCTTGGAGCACCTACTATACGAACA
CAGAGCTGGTGATCATGGTCATCGACTCCACGGACCGGGAACGGTTAGCT
GTTACGCGGGAAGAGCTCTACAGGATGCTGCAGCATGAGGATCTGAGCAA
GGCGAGTTTGCTGGTCTATGCCAATAAACAGGACCTCAAGGGCTCCATGT
CGGCGGCGGAAATCTCAAGACAACTGGACCTCACCTCCATCAAGAAGCAC
CAATGGCACATTCAGGCCTGCTGTGCGCTTACCGGCGAAGGACTCTATCA
AGGATTAGAGTGGATCGTGCAGCGCATCAAGAACAAA
>C6
ATGGGACTACTATTATCGCGGCTGTGGCGGATGTTTGGCAACGAGGAGCA
CAAGCTGGTGATGGTGGGCCTGGACAACGCGGGCAAGACGACCATCCTGT
ACCAGTTCCTGATGAACGAGGTCGTCCACACGAGTCCCACGATCGGTTCG
AATGTGGAGGAGGTCGTCTGGCGGAACATTCACTTCCTGGTCTGGGATTT
GGGCGGTCAGCAGAGCCTGCGCGCCGCCTGGAGCACCTACTACACGAACA
CAGAGCTGGTCATCATGGTCATAGACTCGACGGATCGGGAAAGGTTGGCT
GTGACGCGGGAGGAGCTCTACCGGATGCTGCAGCACGAGGATCTCAGCAA
GGCTAGCCTGCTGGTCTATGCCAACAAGCAGGACCTCAAGGGCTCCATGT
CGGCGGCGGAGATATCGCGGCAACTGGACCTCACCTCCATCAAGAAGCAC
CAGTGGCACATCCAGGCCTGCTGCGCGCTCACCGGCGAGGGACTCTACCA
AGGACTCGAGTGGATTGTCCAGCGCATCAAGAACAAA
>C7
ATGGGCCTGCTACTATCGCGGCTGTGGCGGATGTTCGGCAACGAGGAGCA
CAAGCTGGTGATGGTGGGCCTGGACAACGCGGGCAAGACGACCATCCTGT
ACCAGTTCCTGATGAACGAGGTCGTCCACACGAGTCCCACGATCGGCTCC
AACGTGGAGGAGGTCGTCTGGCGGAACATTCACTTTCTGGTGTGGGACCT
GGGCGGCCAGCAGAGCCTGCGCGCCGCCTGGAGCACCTACTACACGAACA
CAGAGCTGGTGATCATGGTCATCGACTCCACGGATCGGGAAAGGCTGGCT
GTCACGCGGGAGGAGCTCTACCGGATGCTGCAGCACGAGGATCTGAGCAA
GGCCAGCCTGCTGGTCTATGCCAACAAGCAGGACCTGAAGGGCTCCATGT
CGGCGGCGGAGATCTCGCGGCAACTGGACCTCACCTCCATCAAGAAGCAC
CAGTGGCACATCCAGGCCTGCTGTGCGCTCACCGGCGAGGGCCTCTACCA
GGGACTGGAGTGGATCGTACAGCGCATCAAGAACAAA
>C8
ATGGGACTGTTATTATCGCGGCTGTGGCGGATGTTTGGCAACGAGGAGCA
CAAGCTGGTGATGGTGGGCCTGGACAACGCGGGCAAGACGACCATCCTGT
ACCAGTTCCTGATGAACGAGGTCGTCCACACGAGTCCCACGATCGGTTCC
AATGTGGAGGAGGTCGTCTGGCGGAATATCCACTTTCTGGTCTGGGACTT
GGGCGGCCAGCAGAGCCTCCGCGCCGCCTGGAGCACCTACTACACGAACA
CAGAGCTGGTGATCATGGTCATCGACTCCACGGACCGGGAAAGGCTGGCT
GTCACGCGGGAGGAGCTCTACCGGATGCTGCAGCACGAGGATCTGAGCAA
GGCCAGCCTGCTGGTGTATGCCAACAAGCAGGACCTCAAGGGCTCCATGT
CGGCGGCGGAGATATCGCGGCAACTGGACCTCACCTCCATCAAGAAGCAT
CAGTGGCACATCCAGGCCTGCTGTGCGCTCACCGGCGAAGGACTCTATCA
GGGATTGGAGTGGATCGTGCAGCGCATCAAGAACAAA
>C9
ATGGGATTGTTATTATCGCGGCTGTGGCGGATGTTTGGAAATGAGGAGCA
TAAGCTGGTGATGGTGGGTCTGGACAATGCTGGAAAAACGACCATCCTGT
ATCAGTTCCTGATGAATGAGGTGGTCCATACCAGTCCTACGATCGGTTCC
AATGTGGAGGAGGTCGTTTGGCGAAATATACACTTTCTCGTTTGGGATCT
CGGAGGCCAGCAGAGCCTGCGAGCTGCCTGGAGCACCTATTACACGAACA
CAGAGCTGGTGATCATGGTCATCGACTCGACGGATCGGGAAAGGTTAGCT
GTGACACGAGAAGAGCTCTACCGAATGCTACAGCACGAGGATCTGAGCAA
GGCTAGCCTTCTGGTCTATGCCAACAAACAGGATCTTAAAGGTTCCATGT
CGGCAGCAGAGATTTCAAGACAACTAGACCTCACATCCATCAAGAAGCAC
CAGTGGCACATCCAAGCCTGCTGTGCGCTCACAGGCGAAGGACTCTACCA
AGGATTGGAGTGGATCGTGCAGCGCATCAAGAACAAA
>C10
ATGGGACTGCTATTATCGCGGCTCTGGCGGATGTTTGGGAACGAGGAGCA
CAAGCTGGTGATGGTGGGATTGGACAACGCGGGCAAGACAACCATCCTGT
ACCAGTTTTTAATGAACGAAGTGGTCCACACCAGTCCCACGATCGGCTCC
AATGTTGAGGAGGTCGTCTGGCGAAATATTCACTTCCTCGTTTGGGATCT
TGGAGGTCAGCAAAGCCTTCGTGCCGCTTGGAGCACTTACTACACGAACA
CGGAGCTGGTGATCATGGTCATCGACTCGACGGATCGGGAAAGACTGGCT
GTCACTCGGGAAGAGCTCTACCGGATGCTGCAGCACGAGGATCTGAGCAA
GGCCAGTCTGCTAGTCTACGCCAACAAGCAGGACCTCAAGGGCTCAATGT
CGGCGGCGGAAATATCCCGACAACTTGACCTCACCTCCATTAAGAAGCAC
CAGTGGCACATCCAGGCCTGCTGTGCGCTTACCGGCGAAGGCCTGTATCA
AGGACTGGAGTGGATCGTGCAGCGCATCAAGAACAAA
>C11
ATGGGACTGTTATTATCGCGGCTGTGGCGGATGTTTGGCAACGAGGAGCA
CAAGTTGGTGATGGTGGGCCTGGACAACGCGGGCAAAACGACCATCCTTT
ACCAGTTCCTCATGAACGAGGTGGTTCATACCAGTCCAACGATCGGTTCC
AATGTGGAGGAGGTCGTTTGGCGGAATATCCACTTCCTGGTCTGGGATCT
GGGCGGTCAGCAGAGCCTCCGAGCCGCCTGGAGCACTTACTACACGAACA
CAGAGCTAGTGATCATGGTCATCGACTCCACGGATCGGGAAAGGCTGGCC
GTTACGCGGGAGGAGCTATATCGGATGCTGCAGCACGAGGATCTGAGCAA
GGCCAGTTTGCTGGTCTACGCCAACAAGCAGGACCTCAAGGGATCAATGT
CGGCGGCGGAGATATCGCGGCAACTGGACCTTACCTCCATAAAAAAGCAC
CAGTGGCACATCCAGGCCTGCTGCGCGCTAACCGGCGAAGGACTCTACCA
AGGATTGGAGTGGATCGTGCAGCGCATCAAGAATAAA
>C12
ATGGGACTGTTATTATCGCGACTGTGGCGGATGTTTGGCAACGAGGAGCA
CAAGTTGGTGATGGTCGGTCTGGACAATGCGGGTAAAACGACTATCCTGT
ACCAGTTCCTCATGAACGAGGTGGTCCACACCAGTCCCACGATCGGTTCC
AATGTGGAGGAGGTCGTTTGGCGGAATATCCACTTCCTGGTCTGGGATCT
GGGCGGTCAGCAGAGCCTCCGAGCCGCCTGGAGCACCTACTACACGAACA
CAGAGCTGGTGATCATGGTCATCGACTCCACGGATCGGGAAAGGCTGGCC
GTAACGCGGGAAGAGCTGTACCGAATGCTGCAGCACGAGGATCTGAGCAA
GGCCAGCCTGCTGGTCTACGCCAACAAGCAGGACCTCAAGGGTTCCATGT
CAGCGGCGGAAATATCGCGGCAACTGGACCTGACCTCTATCAAAAAGCAC
CAGTGGCACATTCAGGCCTGCTGCGCGCTCACTGGCGAAGGACTCTACCA
AGGACTGGAGTGGATAGTGCAGCGCATCAAGAACAAA
>C1
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C2
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C3
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C4
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C5
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C6
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C7
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C8
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C9
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C10
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C11
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
>C12
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 12 taxa and 537 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Taxon 12 -> C12
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478097346
Setting output file names to "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1025588043
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1537613268
Seed = 1278643086
Swapseed = 1478097346
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 17 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 105 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2823.670742 -- -24.979900
Chain 2 -- -2867.516709 -- -24.979900
Chain 3 -- -2794.267301 -- -24.979900
Chain 4 -- -2765.458956 -- -24.979900
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2789.991778 -- -24.979900
Chain 2 -- -2887.942464 -- -24.979900
Chain 3 -- -2839.865876 -- -24.979900
Chain 4 -- -2833.144600 -- -24.979900
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2823.671] (-2867.517) (-2794.267) (-2765.459) * [-2789.992] (-2887.942) (-2839.866) (-2833.145)
500 -- [-1981.611] (-1989.599) (-1983.060) (-1982.254) * [-1985.639] (-1998.695) (-1992.700) (-1991.049) -- 0:00:00
1000 -- (-1907.699) [-1902.755] (-1954.970) (-1932.792) * (-1932.226) (-1927.101) (-1950.930) [-1915.097] -- 0:00:00
1500 -- (-1846.390) [-1851.902] (-1902.147) (-1859.054) * (-1920.844) (-1866.229) [-1861.273] (-1868.182) -- 0:11:05
2000 -- (-1816.285) (-1813.141) [-1817.332] (-1852.704) * (-1864.034) (-1829.739) [-1818.302] (-1835.118) -- 0:08:19
2500 -- [-1799.925] (-1810.419) (-1802.557) (-1821.258) * (-1843.118) (-1826.822) [-1814.241] (-1834.443) -- 0:06:39
3000 -- [-1799.991] (-1805.102) (-1799.208) (-1804.420) * (-1816.229) (-1818.213) (-1809.322) [-1810.625] -- 0:05:32
3500 -- [-1799.684] (-1802.150) (-1803.404) (-1809.094) * [-1814.176] (-1820.942) (-1811.491) (-1810.989) -- 0:09:29
4000 -- [-1804.902] (-1798.848) (-1801.027) (-1794.851) * (-1807.935) (-1803.421) [-1800.778] (-1809.312) -- 0:08:18
4500 -- (-1795.655) [-1794.306] (-1808.813) (-1802.438) * [-1800.045] (-1807.800) (-1800.520) (-1795.946) -- 0:07:22
5000 -- (-1790.874) [-1790.341] (-1805.271) (-1797.999) * [-1796.635] (-1798.463) (-1801.043) (-1796.665) -- 0:06:38
Average standard deviation of split frequencies: 0.033672
5500 -- (-1805.221) (-1803.407) (-1801.509) [-1794.199] * (-1799.108) (-1797.222) [-1797.629] (-1810.087) -- 0:06:01
6000 -- (-1821.662) (-1810.068) [-1795.033] (-1795.079) * (-1794.272) (-1800.083) [-1800.427] (-1798.687) -- 0:08:17
6500 -- (-1808.161) (-1796.856) (-1794.864) [-1797.957] * [-1799.425] (-1794.993) (-1809.416) (-1797.995) -- 0:07:38
7000 -- (-1808.087) (-1794.382) (-1802.018) [-1798.767] * [-1793.126] (-1792.049) (-1808.025) (-1801.530) -- 0:07:05
7500 -- [-1810.820] (-1808.439) (-1803.607) (-1800.582) * (-1798.841) (-1799.922) [-1798.293] (-1816.161) -- 0:06:37
8000 -- (-1800.022) [-1796.820] (-1804.960) (-1804.427) * (-1806.518) (-1797.587) (-1801.417) [-1801.102] -- 0:08:16
8500 -- (-1794.036) (-1802.687) (-1806.394) [-1793.727] * (-1796.465) [-1796.259] (-1801.299) (-1793.792) -- 0:07:46
9000 -- (-1791.890) (-1800.524) (-1814.386) [-1798.288] * (-1799.079) [-1799.352] (-1793.856) (-1806.927) -- 0:07:20
9500 -- [-1800.641] (-1798.356) (-1799.888) (-1790.900) * (-1801.197) (-1802.136) [-1798.025] (-1809.098) -- 0:06:57
10000 -- (-1799.456) (-1796.676) (-1799.839) [-1791.006] * (-1803.710) [-1793.377] (-1794.014) (-1812.629) -- 0:08:15
Average standard deviation of split frequencies: 0.025780
10500 -- [-1791.674] (-1797.040) (-1792.824) (-1790.107) * (-1797.510) (-1797.567) (-1800.455) [-1804.322] -- 0:07:51
11000 -- (-1793.504) (-1797.150) (-1814.874) [-1791.161] * (-1798.107) (-1810.569) [-1800.213] (-1801.445) -- 0:07:29
11500 -- [-1791.127] (-1793.489) (-1804.469) (-1805.319) * (-1802.721) [-1797.434] (-1797.560) (-1803.750) -- 0:07:09
12000 -- [-1793.961] (-1795.103) (-1808.617) (-1807.302) * (-1798.801) (-1806.086) [-1795.937] (-1808.666) -- 0:06:51
12500 -- [-1797.674] (-1807.052) (-1795.998) (-1793.129) * (-1800.687) [-1803.138] (-1812.915) (-1794.136) -- 0:07:54
13000 -- (-1800.305) (-1801.102) [-1796.358] (-1808.078) * [-1790.869] (-1806.766) (-1803.100) (-1797.870) -- 0:07:35
13500 -- (-1790.064) (-1803.693) [-1796.699] (-1795.017) * (-1794.086) [-1794.305] (-1794.674) (-1806.054) -- 0:07:18
14000 -- [-1795.574] (-1801.362) (-1797.497) (-1803.180) * (-1802.363) [-1800.699] (-1805.085) (-1796.964) -- 0:07:02
14500 -- (-1799.550) (-1793.482) (-1797.466) [-1800.502] * (-1800.272) (-1796.830) [-1802.171] (-1799.702) -- 0:07:55
15000 -- (-1804.784) [-1799.438] (-1795.167) (-1805.619) * [-1795.757] (-1791.320) (-1804.697) (-1815.636) -- 0:07:39
Average standard deviation of split frequencies: 0.046649
15500 -- [-1791.988] (-1802.589) (-1798.124) (-1797.933) * (-1805.850) (-1796.586) [-1800.458] (-1793.562) -- 0:07:24
16000 -- [-1799.457] (-1790.712) (-1795.639) (-1806.103) * [-1798.344] (-1805.854) (-1799.845) (-1804.050) -- 0:07:10
16500 -- [-1795.305] (-1798.579) (-1792.779) (-1800.064) * [-1797.615] (-1811.510) (-1802.437) (-1803.189) -- 0:06:57
17000 -- (-1805.422) [-1802.218] (-1796.571) (-1794.891) * [-1796.624] (-1801.709) (-1800.197) (-1797.323) -- 0:07:42
17500 -- (-1804.196) (-1811.658) [-1792.915] (-1792.855) * (-1798.713) (-1796.787) [-1798.441] (-1799.633) -- 0:07:29
18000 -- (-1802.817) [-1801.955] (-1799.846) (-1806.990) * (-1794.097) (-1805.024) [-1796.988] (-1808.495) -- 0:07:16
18500 -- (-1806.284) (-1800.413) [-1797.231] (-1803.074) * (-1795.311) (-1811.366) [-1802.079] (-1800.491) -- 0:07:04
19000 -- (-1803.890) (-1803.212) [-1795.903] (-1802.144) * [-1793.155] (-1804.579) (-1802.030) (-1799.188) -- 0:07:44
19500 -- (-1807.755) (-1802.332) (-1804.447) [-1796.039] * [-1793.511] (-1812.213) (-1793.548) (-1802.648) -- 0:07:32
20000 -- (-1798.801) (-1804.568) [-1796.539] (-1805.131) * (-1798.071) (-1816.590) [-1796.193] (-1796.029) -- 0:07:21
Average standard deviation of split frequencies: 0.047521
20500 -- [-1800.080] (-1803.835) (-1801.905) (-1811.802) * (-1796.221) (-1806.694) (-1790.392) [-1805.519] -- 0:07:10
21000 -- (-1801.421) (-1798.575) [-1802.070] (-1807.122) * (-1807.788) (-1802.440) (-1799.418) [-1793.276] -- 0:06:59
21500 -- [-1796.015] (-1796.690) (-1806.443) (-1796.118) * (-1806.529) (-1818.025) (-1802.203) [-1800.416] -- 0:07:35
22000 -- [-1795.296] (-1806.147) (-1803.478) (-1796.113) * [-1798.091] (-1805.034) (-1799.338) (-1810.092) -- 0:07:24
22500 -- (-1797.511) (-1807.651) [-1791.689] (-1805.942) * (-1796.736) (-1812.333) (-1797.003) [-1796.210] -- 0:07:14
23000 -- (-1799.199) (-1800.962) (-1807.866) [-1802.340] * (-1795.943) [-1793.527] (-1800.592) (-1792.371) -- 0:07:04
23500 -- (-1799.548) (-1800.469) (-1804.710) [-1794.794] * (-1791.354) [-1797.728] (-1798.893) (-1796.112) -- 0:07:37
24000 -- (-1798.701) [-1800.862] (-1797.438) (-1796.990) * (-1798.194) [-1800.947] (-1798.183) (-1798.031) -- 0:07:27
24500 -- (-1802.162) [-1796.744] (-1806.375) (-1798.632) * (-1802.047) (-1798.051) (-1802.304) [-1797.524] -- 0:07:17
25000 -- (-1799.602) [-1795.568] (-1805.997) (-1800.470) * (-1804.939) (-1804.318) (-1801.272) [-1799.370] -- 0:07:09
Average standard deviation of split frequencies: 0.045327
25500 -- (-1791.752) (-1799.005) (-1814.127) [-1790.365] * [-1795.373] (-1794.649) (-1808.077) (-1803.176) -- 0:07:38
26000 -- (-1803.112) (-1795.720) (-1814.078) [-1801.159] * (-1801.279) (-1800.614) (-1800.148) [-1804.535] -- 0:07:29
26500 -- (-1799.800) [-1795.490] (-1809.831) (-1802.641) * (-1798.030) [-1800.690] (-1801.579) (-1796.842) -- 0:07:20
27000 -- (-1799.193) [-1796.152] (-1806.401) (-1802.302) * [-1791.956] (-1807.163) (-1800.491) (-1808.577) -- 0:07:12
27500 -- [-1801.781] (-1812.284) (-1808.120) (-1802.672) * [-1801.211] (-1796.051) (-1796.874) (-1806.915) -- 0:07:04
28000 -- (-1798.162) (-1800.046) (-1793.211) [-1805.135] * [-1803.429] (-1797.501) (-1798.218) (-1793.683) -- 0:07:31
28500 -- (-1794.395) (-1800.967) [-1803.057] (-1814.879) * (-1800.891) [-1802.892] (-1806.435) (-1796.464) -- 0:07:23
29000 -- (-1796.367) [-1789.926] (-1820.382) (-1804.585) * (-1798.840) (-1798.961) [-1803.339] (-1797.329) -- 0:07:15
29500 -- (-1797.211) [-1792.266] (-1808.300) (-1794.400) * (-1799.416) (-1798.574) (-1800.136) [-1804.623] -- 0:07:07
30000 -- (-1793.306) [-1798.623] (-1805.498) (-1793.588) * [-1799.476] (-1801.730) (-1800.949) (-1801.048) -- 0:07:32
Average standard deviation of split frequencies: 0.030744
30500 -- (-1804.007) (-1798.776) [-1790.661] (-1794.158) * (-1811.888) (-1803.046) [-1810.088] (-1799.845) -- 0:07:25
31000 -- (-1800.688) (-1805.296) (-1808.696) [-1806.761] * [-1798.270] (-1806.840) (-1808.836) (-1798.403) -- 0:07:17
31500 -- (-1798.672) (-1801.841) (-1795.869) [-1799.225] * (-1801.679) [-1800.772] (-1799.203) (-1796.055) -- 0:07:10
32000 -- [-1794.407] (-1793.030) (-1806.161) (-1807.945) * (-1802.315) (-1801.368) [-1799.202] (-1799.649) -- 0:07:03
32500 -- [-1796.176] (-1798.752) (-1798.816) (-1803.215) * [-1792.568] (-1798.160) (-1806.328) (-1802.972) -- 0:07:26
33000 -- (-1799.638) (-1799.681) (-1796.953) [-1800.978] * (-1798.472) [-1796.789] (-1797.254) (-1794.369) -- 0:07:19
33500 -- (-1797.719) [-1791.377] (-1814.880) (-1797.504) * (-1805.881) (-1799.725) (-1801.219) [-1803.622] -- 0:07:12
34000 -- [-1793.316] (-1803.080) (-1817.084) (-1794.290) * (-1800.746) (-1819.210) [-1792.080] (-1790.041) -- 0:07:06
34500 -- (-1795.675) (-1801.669) [-1805.695] (-1799.394) * (-1820.895) [-1803.627] (-1794.577) (-1798.038) -- 0:07:27
35000 -- (-1793.634) (-1792.153) [-1802.176] (-1797.605) * (-1808.233) [-1799.201] (-1799.809) (-1802.664) -- 0:07:21
Average standard deviation of split frequencies: 0.025098
35500 -- [-1797.339] (-1807.998) (-1804.420) (-1798.878) * (-1809.149) [-1797.073] (-1794.521) (-1796.718) -- 0:07:14
36000 -- [-1801.695] (-1800.857) (-1804.404) (-1796.440) * (-1797.634) (-1799.115) [-1794.204] (-1804.821) -- 0:07:08
36500 -- (-1801.752) (-1806.339) (-1803.123) [-1803.012] * (-1799.105) (-1802.165) (-1801.141) [-1797.369] -- 0:07:28
37000 -- (-1796.614) [-1791.972] (-1793.683) (-1803.861) * (-1801.783) (-1796.849) [-1798.365] (-1808.447) -- 0:07:22
37500 -- (-1795.886) [-1800.168] (-1795.737) (-1808.451) * (-1798.264) [-1796.235] (-1800.800) (-1801.008) -- 0:07:16
38000 -- (-1797.117) (-1794.404) [-1792.998] (-1796.082) * (-1800.157) [-1792.498] (-1798.287) (-1799.030) -- 0:07:10
38500 -- [-1791.978] (-1804.521) (-1798.648) (-1806.430) * (-1796.262) (-1795.508) [-1796.940] (-1801.593) -- 0:07:04
39000 -- [-1797.497] (-1802.574) (-1797.233) (-1795.991) * (-1798.907) [-1798.252] (-1795.601) (-1799.593) -- 0:07:23
39500 -- (-1796.659) (-1798.105) (-1803.445) [-1799.844] * (-1796.348) (-1795.685) (-1802.776) [-1795.417] -- 0:07:17
40000 -- (-1793.577) (-1792.375) (-1797.536) [-1800.696] * (-1793.413) (-1805.910) [-1795.478] (-1806.479) -- 0:07:12
Average standard deviation of split frequencies: 0.031878
40500 -- (-1790.479) (-1812.453) [-1798.891] (-1806.521) * [-1792.912] (-1806.289) (-1802.339) (-1793.316) -- 0:07:06
41000 -- [-1792.576] (-1797.783) (-1798.991) (-1797.684) * (-1795.936) [-1790.233] (-1803.745) (-1803.157) -- 0:07:24
41500 -- (-1785.914) (-1803.513) (-1795.305) [-1789.864] * (-1804.209) (-1799.706) [-1793.731] (-1796.812) -- 0:07:18
42000 -- (-1789.928) [-1791.067] (-1803.823) (-1807.793) * (-1799.548) (-1805.966) (-1798.719) [-1792.840] -- 0:07:13
42500 -- (-1812.176) (-1803.942) [-1795.021] (-1791.820) * [-1804.488] (-1804.685) (-1799.537) (-1793.941) -- 0:07:08
43000 -- (-1800.537) (-1797.888) (-1799.080) [-1798.914] * (-1806.885) (-1798.945) (-1806.633) [-1797.308] -- 0:07:02
43500 -- [-1796.112] (-1814.442) (-1798.718) (-1800.004) * [-1788.760] (-1793.954) (-1797.706) (-1793.315) -- 0:07:19
44000 -- (-1789.340) (-1806.945) (-1794.161) [-1798.748] * (-1803.309) [-1793.627] (-1803.229) (-1803.800) -- 0:07:14
44500 -- [-1799.941] (-1793.199) (-1797.367) (-1812.633) * (-1805.741) (-1809.043) [-1804.489] (-1805.251) -- 0:07:09
45000 -- (-1807.054) (-1798.496) (-1797.936) [-1794.408] * (-1794.465) (-1802.150) (-1802.486) [-1803.862] -- 0:07:04
Average standard deviation of split frequencies: 0.023058
45500 -- (-1804.090) (-1797.511) (-1799.571) [-1804.464] * (-1798.327) (-1791.545) (-1800.075) [-1801.574] -- 0:07:20
46000 -- (-1798.407) (-1794.874) (-1807.956) [-1796.921] * (-1807.789) [-1799.465] (-1795.839) (-1801.269) -- 0:07:15
46500 -- (-1796.171) (-1830.229) (-1807.897) [-1794.900] * (-1807.120) [-1805.268] (-1797.712) (-1802.591) -- 0:07:10
47000 -- [-1796.356] (-1807.174) (-1802.747) (-1799.282) * (-1793.737) (-1789.540) (-1801.312) [-1797.707] -- 0:07:05
47500 -- (-1808.706) (-1797.664) [-1788.993] (-1795.472) * (-1809.861) (-1798.701) [-1802.386] (-1802.305) -- 0:07:21
48000 -- [-1805.057] (-1801.279) (-1796.704) (-1793.413) * (-1799.711) (-1801.675) [-1795.663] (-1802.298) -- 0:07:16
48500 -- (-1805.558) (-1799.610) (-1794.344) [-1799.223] * [-1798.164] (-1806.674) (-1803.686) (-1821.415) -- 0:07:11
49000 -- (-1792.671) (-1791.141) (-1794.470) [-1791.241] * (-1797.603) (-1795.116) (-1801.581) [-1799.000] -- 0:07:06
49500 -- (-1810.086) (-1803.669) (-1801.328) [-1791.139] * (-1801.520) (-1798.072) [-1794.365] (-1798.366) -- 0:07:02
50000 -- (-1805.629) [-1797.035] (-1798.635) (-1814.399) * (-1815.492) (-1796.278) [-1790.175] (-1806.020) -- 0:07:17
Average standard deviation of split frequencies: 0.021709
50500 -- (-1801.014) [-1802.499] (-1795.263) (-1816.954) * (-1805.867) (-1788.665) (-1798.129) [-1796.983] -- 0:07:12
51000 -- [-1800.107] (-1788.925) (-1812.328) (-1814.813) * (-1801.551) (-1791.302) [-1798.926] (-1794.040) -- 0:07:07
51500 -- (-1796.419) (-1803.280) [-1808.558] (-1803.800) * (-1796.989) [-1805.415] (-1800.366) (-1800.645) -- 0:07:03
52000 -- [-1795.246] (-1797.954) (-1800.002) (-1809.065) * (-1794.275) (-1805.244) (-1803.784) [-1800.993] -- 0:07:17
52500 -- (-1805.999) (-1802.814) [-1794.750] (-1814.086) * [-1795.164] (-1805.483) (-1807.245) (-1798.193) -- 0:07:13
53000 -- (-1794.372) [-1797.000] (-1800.443) (-1803.076) * (-1799.010) [-1794.635] (-1797.121) (-1792.153) -- 0:07:08
53500 -- (-1801.504) [-1793.005] (-1805.269) (-1799.875) * [-1802.144] (-1799.154) (-1807.200) (-1801.608) -- 0:07:04
54000 -- [-1791.876] (-1803.498) (-1807.345) (-1810.097) * (-1806.971) (-1804.291) [-1797.464] (-1807.256) -- 0:07:00
54500 -- [-1789.845] (-1794.892) (-1795.686) (-1801.006) * [-1795.736] (-1800.660) (-1800.101) (-1796.132) -- 0:07:13
55000 -- (-1807.954) (-1803.512) [-1794.532] (-1803.054) * [-1806.535] (-1799.187) (-1803.453) (-1799.410) -- 0:07:09
Average standard deviation of split frequencies: 0.018940
55500 -- [-1795.330] (-1805.342) (-1804.779) (-1807.047) * (-1798.515) [-1803.893] (-1791.216) (-1803.160) -- 0:07:05
56000 -- (-1796.174) (-1795.397) [-1795.040] (-1804.144) * (-1813.215) (-1793.885) (-1791.181) [-1799.031] -- 0:07:01
56500 -- (-1788.523) [-1792.056] (-1799.612) (-1811.784) * (-1819.812) (-1802.905) (-1805.688) [-1789.412] -- 0:07:14
57000 -- (-1791.672) (-1806.476) [-1797.798] (-1807.351) * (-1805.796) (-1798.587) (-1794.845) [-1799.327] -- 0:07:10
57500 -- (-1801.347) (-1795.996) (-1806.484) [-1796.187] * (-1810.574) [-1796.591] (-1807.147) (-1803.328) -- 0:07:06
58000 -- [-1791.591] (-1793.554) (-1802.092) (-1799.502) * (-1794.929) (-1800.672) (-1805.428) [-1800.237] -- 0:07:02
58500 -- [-1803.101] (-1798.777) (-1801.637) (-1800.795) * (-1805.502) (-1799.134) (-1798.039) [-1798.069] -- 0:07:14
59000 -- (-1800.782) (-1796.848) [-1794.488] (-1808.779) * (-1806.487) (-1804.401) (-1812.058) [-1796.992] -- 0:07:10
59500 -- (-1792.761) [-1791.304] (-1806.094) (-1809.085) * (-1807.449) (-1795.842) (-1800.013) [-1796.228] -- 0:07:06
60000 -- (-1798.241) (-1798.737) [-1792.260] (-1799.351) * (-1797.623) (-1797.294) [-1795.394] (-1801.177) -- 0:07:03
Average standard deviation of split frequencies: 0.021369
60500 -- [-1796.337] (-1791.161) (-1792.310) (-1805.156) * (-1810.334) (-1810.902) (-1800.044) [-1796.653] -- 0:06:59
61000 -- (-1799.763) [-1791.733] (-1791.472) (-1795.050) * (-1801.306) [-1799.056] (-1818.707) (-1797.320) -- 0:07:11
61500 -- (-1797.030) (-1799.927) [-1797.535] (-1804.763) * (-1802.886) (-1796.119) [-1794.301] (-1796.171) -- 0:07:07
62000 -- (-1805.267) (-1797.292) [-1795.308] (-1799.633) * (-1795.074) (-1796.601) [-1791.026] (-1801.966) -- 0:07:03
62500 -- [-1801.838] (-1805.717) (-1796.312) (-1802.257) * (-1810.036) (-1809.164) [-1795.792] (-1802.333) -- 0:07:00
63000 -- [-1790.606] (-1801.777) (-1799.036) (-1798.500) * (-1799.776) (-1807.295) (-1801.837) [-1807.847] -- 0:07:11
63500 -- (-1798.365) [-1800.278] (-1798.948) (-1798.737) * (-1795.784) [-1797.393] (-1804.854) (-1798.434) -- 0:07:07
64000 -- (-1809.325) (-1796.847) (-1794.074) [-1791.376] * (-1802.666) (-1790.794) (-1800.656) [-1803.122] -- 0:07:04
64500 -- [-1796.227] (-1802.428) (-1802.890) (-1792.227) * (-1798.740) (-1797.598) (-1809.477) [-1800.138] -- 0:07:00
65000 -- (-1802.157) (-1808.430) [-1798.335] (-1803.230) * (-1801.975) (-1801.050) (-1796.684) [-1798.215] -- 0:06:57
Average standard deviation of split frequencies: 0.021427
65500 -- (-1805.326) (-1806.600) (-1802.813) [-1801.569] * [-1798.961] (-1792.124) (-1807.892) (-1798.908) -- 0:07:08
66000 -- (-1808.193) (-1806.253) [-1784.614] (-1796.768) * (-1792.587) [-1798.454] (-1793.804) (-1806.697) -- 0:07:04
66500 -- (-1806.270) (-1810.754) [-1797.774] (-1791.309) * [-1793.856] (-1803.199) (-1789.321) (-1815.079) -- 0:07:01
67000 -- (-1805.294) [-1789.857] (-1798.126) (-1801.313) * (-1800.347) (-1808.636) [-1795.170] (-1798.623) -- 0:06:57
67500 -- (-1798.265) (-1799.179) (-1794.331) [-1796.919] * [-1792.555] (-1790.367) (-1795.748) (-1794.281) -- 0:07:08
68000 -- (-1801.183) (-1802.580) [-1795.830] (-1801.550) * [-1795.197] (-1807.937) (-1797.284) (-1798.067) -- 0:07:04
68500 -- (-1792.455) (-1802.277) (-1800.059) [-1793.493] * (-1804.558) (-1805.348) [-1792.497] (-1798.416) -- 0:07:01
69000 -- (-1809.682) (-1797.877) (-1806.683) [-1790.716] * (-1797.571) (-1799.631) (-1794.264) [-1797.630] -- 0:06:58
69500 -- (-1794.537) [-1798.087] (-1793.733) (-1809.989) * (-1794.912) (-1812.440) [-1794.109] (-1799.959) -- 0:06:55
70000 -- (-1793.034) (-1796.976) [-1791.420] (-1793.099) * (-1798.899) [-1799.462] (-1793.728) (-1807.224) -- 0:07:05
Average standard deviation of split frequencies: 0.019457
70500 -- (-1793.554) (-1809.758) [-1797.278] (-1801.369) * [-1799.736] (-1794.055) (-1796.298) (-1803.571) -- 0:07:01
71000 -- [-1794.525] (-1795.081) (-1796.937) (-1796.456) * (-1801.879) (-1798.525) [-1793.013] (-1790.789) -- 0:06:58
71500 -- (-1805.588) (-1799.846) (-1799.925) [-1797.962] * (-1809.568) (-1808.040) (-1799.203) [-1794.273] -- 0:06:55
72000 -- [-1799.347] (-1807.096) (-1799.684) (-1808.402) * [-1797.345] (-1796.318) (-1797.991) (-1804.636) -- 0:07:05
72500 -- (-1794.328) (-1803.591) [-1800.466] (-1800.259) * (-1793.604) (-1791.151) [-1796.982] (-1808.904) -- 0:07:02
73000 -- (-1796.492) [-1792.535] (-1796.601) (-1800.050) * [-1804.040] (-1800.938) (-1791.704) (-1789.205) -- 0:06:59
73500 -- (-1798.898) [-1802.233] (-1810.576) (-1795.798) * (-1812.286) (-1795.795) [-1796.381] (-1795.544) -- 0:06:55
74000 -- (-1803.010) (-1803.586) (-1797.677) [-1792.306] * (-1802.370) (-1797.018) (-1799.650) [-1801.989] -- 0:07:05
74500 -- (-1798.821) (-1800.091) (-1805.050) [-1794.526] * [-1806.322] (-1804.034) (-1805.090) (-1796.795) -- 0:07:02
75000 -- [-1797.643] (-1792.193) (-1802.812) (-1810.223) * (-1795.844) [-1795.203] (-1802.618) (-1809.459) -- 0:06:59
Average standard deviation of split frequencies: 0.021709
75500 -- [-1801.241] (-1800.755) (-1812.586) (-1796.008) * (-1799.235) (-1797.333) [-1790.643] (-1803.782) -- 0:06:56
76000 -- (-1798.126) [-1800.696] (-1809.720) (-1805.221) * (-1793.436) (-1803.779) [-1802.908] (-1795.652) -- 0:06:53
76500 -- (-1800.190) (-1800.582) (-1801.952) [-1793.962] * (-1795.164) (-1805.051) (-1808.211) [-1792.997] -- 0:07:02
77000 -- (-1796.232) (-1794.105) [-1795.965] (-1792.437) * (-1794.732) [-1797.164] (-1800.499) (-1798.217) -- 0:06:59
77500 -- (-1802.550) (-1799.631) (-1795.651) [-1799.913] * (-1793.384) [-1801.601] (-1802.871) (-1800.718) -- 0:06:56
78000 -- [-1796.893] (-1797.200) (-1806.962) (-1793.551) * [-1794.796] (-1801.889) (-1793.485) (-1808.193) -- 0:06:53
78500 -- [-1801.322] (-1805.183) (-1797.751) (-1793.240) * (-1802.679) [-1789.772] (-1804.387) (-1801.598) -- 0:07:02
79000 -- (-1815.330) [-1796.455] (-1807.102) (-1795.460) * (-1798.439) [-1796.385] (-1813.174) (-1800.300) -- 0:06:59
79500 -- [-1795.269] (-1804.667) (-1805.624) (-1807.844) * (-1793.798) (-1805.114) (-1810.545) [-1795.460] -- 0:06:56
80000 -- [-1787.373] (-1798.295) (-1812.568) (-1803.348) * (-1795.680) (-1808.010) (-1811.242) [-1796.658] -- 0:06:54
Average standard deviation of split frequencies: 0.021914
80500 -- (-1798.166) [-1796.523] (-1795.074) (-1795.468) * (-1801.538) (-1800.587) (-1803.952) [-1797.344] -- 0:06:51
81000 -- [-1797.984] (-1800.549) (-1801.341) (-1795.998) * (-1795.640) [-1798.541] (-1798.906) (-1796.218) -- 0:06:59
81500 -- (-1799.091) (-1792.777) [-1799.855] (-1792.039) * (-1799.861) (-1807.231) (-1790.019) [-1800.511] -- 0:06:56
82000 -- (-1800.661) [-1795.352] (-1811.264) (-1801.122) * [-1792.818] (-1796.365) (-1804.684) (-1808.028) -- 0:06:54
82500 -- (-1805.396) (-1812.476) (-1803.875) [-1801.385] * (-1800.829) [-1800.015] (-1794.561) (-1797.547) -- 0:06:51
83000 -- (-1801.294) [-1794.617] (-1811.221) (-1795.882) * (-1798.609) [-1786.353] (-1808.509) (-1801.833) -- 0:06:59
83500 -- (-1796.188) (-1794.194) [-1806.273] (-1798.228) * [-1788.568] (-1800.563) (-1800.747) (-1803.547) -- 0:06:57
84000 -- [-1787.379] (-1797.974) (-1796.484) (-1792.815) * [-1791.480] (-1796.778) (-1799.153) (-1798.344) -- 0:06:54
84500 -- (-1796.156) [-1798.413] (-1802.588) (-1794.588) * [-1795.823] (-1796.470) (-1800.570) (-1798.736) -- 0:06:51
85000 -- [-1797.795] (-1798.123) (-1805.728) (-1803.414) * (-1792.298) (-1791.960) (-1806.354) [-1786.460] -- 0:06:59
Average standard deviation of split frequencies: 0.019185
85500 -- (-1799.086) (-1798.829) (-1805.716) [-1804.048] * (-1798.057) [-1796.339] (-1812.726) (-1798.986) -- 0:06:57
86000 -- [-1795.437] (-1815.394) (-1799.507) (-1797.095) * (-1801.816) [-1793.925] (-1794.028) (-1800.360) -- 0:06:54
86500 -- (-1798.972) (-1795.916) (-1808.609) [-1798.128] * (-1795.268) (-1802.501) (-1797.993) [-1798.933] -- 0:07:02
87000 -- (-1794.482) (-1799.374) [-1809.184] (-1789.734) * (-1799.475) [-1793.080] (-1792.965) (-1800.590) -- 0:06:59
87500 -- [-1791.680] (-1793.956) (-1800.465) (-1797.864) * [-1801.321] (-1800.193) (-1795.335) (-1814.506) -- 0:06:57
88000 -- (-1798.660) [-1794.818] (-1804.232) (-1795.878) * (-1796.222) [-1800.610] (-1808.471) (-1802.006) -- 0:06:54
88500 -- (-1809.926) (-1805.907) [-1805.415] (-1804.214) * (-1803.445) [-1796.533] (-1797.410) (-1790.104) -- 0:07:02
89000 -- (-1805.093) (-1807.023) (-1795.399) [-1794.954] * (-1811.333) (-1806.898) (-1801.555) [-1795.367] -- 0:06:59
89500 -- (-1798.238) (-1802.377) (-1801.808) [-1806.130] * (-1803.958) [-1797.727] (-1798.768) (-1797.209) -- 0:06:57
90000 -- (-1797.782) (-1798.804) [-1797.084] (-1801.702) * [-1796.756] (-1791.192) (-1786.975) (-1807.145) -- 0:06:54
Average standard deviation of split frequencies: 0.016031
90500 -- (-1792.594) [-1798.809] (-1802.077) (-1811.363) * (-1798.967) (-1804.764) [-1789.742] (-1799.724) -- 0:06:52
91000 -- (-1801.670) (-1801.004) [-1794.414] (-1800.470) * (-1806.804) (-1799.671) [-1797.140] (-1802.310) -- 0:06:59
91500 -- (-1808.303) (-1800.570) [-1798.101] (-1796.199) * (-1802.204) (-1796.797) (-1802.715) [-1800.214] -- 0:06:57
92000 -- (-1804.974) (-1798.958) (-1800.267) [-1796.678] * (-1802.309) (-1802.810) [-1798.796] (-1799.884) -- 0:06:54
92500 -- (-1800.944) [-1800.915] (-1797.980) (-1799.600) * (-1798.343) (-1800.741) (-1798.595) [-1791.981] -- 0:06:52
93000 -- [-1808.995] (-1804.283) (-1796.452) (-1799.647) * (-1795.892) [-1794.931] (-1797.784) (-1801.178) -- 0:06:59
93500 -- (-1799.600) [-1810.100] (-1801.658) (-1796.949) * (-1793.903) (-1810.544) (-1805.973) [-1791.406] -- 0:06:56
94000 -- (-1808.092) [-1803.751] (-1808.451) (-1796.466) * (-1801.235) (-1813.909) (-1799.470) [-1790.461] -- 0:06:54
94500 -- [-1804.052] (-1806.550) (-1800.516) (-1793.418) * [-1803.698] (-1810.141) (-1806.982) (-1794.979) -- 0:06:52
95000 -- (-1808.073) (-1805.304) [-1792.781] (-1801.685) * (-1806.953) [-1803.821] (-1806.751) (-1797.338) -- 0:06:49
Average standard deviation of split frequencies: 0.013095
95500 -- (-1793.532) [-1793.764] (-1796.996) (-1810.385) * (-1807.104) [-1809.352] (-1799.471) (-1799.568) -- 0:06:56
96000 -- [-1802.373] (-1794.410) (-1799.953) (-1799.326) * (-1800.108) (-1814.218) (-1808.409) [-1792.816] -- 0:06:54
96500 -- [-1798.660] (-1803.104) (-1803.349) (-1798.163) * [-1798.789] (-1802.185) (-1795.567) (-1809.405) -- 0:06:51
97000 -- (-1797.429) [-1799.954] (-1805.346) (-1808.744) * (-1796.650) [-1800.763] (-1807.402) (-1802.440) -- 0:06:49
97500 -- (-1797.644) (-1804.012) (-1802.455) [-1796.038] * [-1792.401] (-1798.103) (-1807.225) (-1802.715) -- 0:06:56
98000 -- (-1792.326) (-1801.971) [-1794.119] (-1803.336) * [-1795.329] (-1801.915) (-1812.483) (-1797.019) -- 0:06:54
98500 -- (-1799.243) (-1804.149) (-1794.959) [-1794.602] * (-1799.397) [-1796.894] (-1793.164) (-1798.806) -- 0:06:51
99000 -- (-1806.242) (-1812.075) (-1798.826) [-1794.802] * (-1793.731) (-1794.629) (-1807.124) [-1797.154] -- 0:06:49
99500 -- (-1797.353) [-1795.942] (-1797.550) (-1802.136) * (-1797.210) [-1794.551] (-1795.723) (-1797.129) -- 0:06:56
100000 -- (-1796.297) (-1804.514) (-1802.058) [-1797.162] * (-1797.686) [-1794.612] (-1801.095) (-1799.514) -- 0:06:54
Average standard deviation of split frequencies: 0.012878
100500 -- (-1802.667) (-1800.155) (-1810.522) [-1793.659] * [-1798.707] (-1796.506) (-1802.959) (-1795.989) -- 0:06:51
101000 -- (-1795.510) [-1791.632] (-1801.770) (-1800.350) * (-1813.480) [-1800.113] (-1796.195) (-1793.161) -- 0:06:49
101500 -- (-1806.776) (-1797.379) (-1799.649) [-1801.628] * [-1794.476] (-1807.983) (-1800.864) (-1798.221) -- 0:06:47
102000 -- (-1796.143) [-1791.082] (-1808.471) (-1794.599) * [-1806.059] (-1806.836) (-1806.956) (-1800.070) -- 0:06:53
102500 -- (-1796.003) [-1791.912] (-1802.122) (-1800.157) * (-1805.705) (-1807.574) [-1802.192] (-1809.518) -- 0:06:51
103000 -- (-1794.790) [-1803.492] (-1810.489) (-1809.195) * (-1806.532) [-1797.043] (-1804.529) (-1807.581) -- 0:06:49
103500 -- (-1795.339) (-1803.391) (-1799.543) [-1792.820] * [-1809.411] (-1798.017) (-1802.587) (-1802.303) -- 0:06:47
104000 -- (-1800.534) (-1807.438) (-1798.191) [-1800.896] * (-1800.284) [-1797.421] (-1803.727) (-1798.004) -- 0:06:53
104500 -- [-1799.469] (-1804.108) (-1790.772) (-1804.260) * (-1804.573) [-1801.763] (-1811.119) (-1790.570) -- 0:06:51
105000 -- (-1806.185) (-1804.563) (-1803.041) [-1799.070] * (-1796.167) [-1798.608] (-1810.841) (-1797.909) -- 0:06:49
Average standard deviation of split frequencies: 0.013342
105500 -- (-1802.723) (-1794.372) (-1802.792) [-1794.797] * (-1796.265) (-1794.707) [-1802.054] (-1801.397) -- 0:06:46
106000 -- (-1792.172) (-1806.379) [-1803.433] (-1801.547) * (-1799.776) [-1792.960] (-1792.342) (-1806.269) -- 0:06:53
106500 -- (-1803.447) (-1789.262) (-1791.891) [-1799.103] * (-1797.085) (-1791.818) [-1797.513] (-1798.534) -- 0:06:51
107000 -- (-1799.264) (-1792.924) (-1795.586) [-1793.839] * (-1798.056) (-1798.802) [-1803.635] (-1805.154) -- 0:06:48
107500 -- (-1812.304) [-1799.146] (-1794.883) (-1793.849) * (-1792.068) (-1798.208) [-1794.339] (-1795.037) -- 0:06:46
108000 -- (-1812.395) (-1795.391) [-1791.838] (-1796.893) * (-1797.861) (-1796.392) [-1797.760] (-1804.426) -- 0:06:44
108500 -- (-1801.180) [-1797.051] (-1795.805) (-1789.181) * (-1802.006) (-1805.130) [-1800.339] (-1802.586) -- 0:06:50
109000 -- (-1809.450) (-1794.554) (-1803.140) [-1789.456] * [-1790.485] (-1795.727) (-1795.956) (-1809.847) -- 0:06:48
109500 -- (-1817.535) (-1794.298) [-1790.235] (-1796.433) * [-1796.461] (-1797.556) (-1800.414) (-1801.929) -- 0:06:46
110000 -- [-1800.299] (-1796.417) (-1796.985) (-1797.643) * [-1795.605] (-1797.060) (-1803.751) (-1799.993) -- 0:06:44
Average standard deviation of split frequencies: 0.015264
110500 -- (-1811.837) (-1798.485) [-1800.314] (-1799.857) * (-1793.977) [-1793.131] (-1811.633) (-1800.092) -- 0:06:50
111000 -- (-1797.053) [-1812.635] (-1808.760) (-1805.345) * (-1799.241) (-1801.331) (-1799.258) [-1802.832] -- 0:06:48
111500 -- [-1802.691] (-1799.187) (-1796.021) (-1807.111) * [-1809.225] (-1794.799) (-1795.812) (-1802.292) -- 0:06:46
112000 -- [-1799.865] (-1806.881) (-1792.581) (-1801.134) * (-1794.492) (-1796.339) [-1796.394] (-1801.961) -- 0:06:44
112500 -- (-1806.596) [-1794.443] (-1794.658) (-1799.280) * (-1792.081) (-1802.403) [-1793.467] (-1801.442) -- 0:06:42
113000 -- (-1799.390) (-1794.322) [-1791.302] (-1799.011) * (-1795.492) [-1788.933] (-1798.993) (-1793.398) -- 0:06:48
113500 -- (-1807.737) (-1811.319) [-1797.309] (-1791.983) * (-1822.034) (-1810.564) (-1801.782) [-1793.639] -- 0:06:46
114000 -- (-1792.289) (-1792.264) [-1796.753] (-1794.815) * (-1809.036) (-1799.637) [-1793.846] (-1806.337) -- 0:06:44
114500 -- (-1800.805) (-1805.143) (-1800.634) [-1791.574] * [-1803.664] (-1794.789) (-1800.289) (-1795.666) -- 0:06:42
115000 -- (-1800.393) (-1810.624) [-1798.421] (-1796.126) * (-1797.776) [-1798.117] (-1791.520) (-1808.527) -- 0:06:47
Average standard deviation of split frequencies: 0.013207
115500 -- (-1800.198) (-1795.694) (-1802.540) [-1800.662] * [-1795.284] (-1809.966) (-1800.468) (-1799.691) -- 0:06:45
116000 -- [-1795.109] (-1806.614) (-1802.616) (-1808.429) * [-1789.013] (-1800.940) (-1803.341) (-1804.656) -- 0:06:43
116500 -- (-1798.182) [-1798.140] (-1802.757) (-1805.665) * [-1789.424] (-1793.836) (-1800.797) (-1807.606) -- 0:06:41
117000 -- [-1799.045] (-1794.542) (-1795.535) (-1807.851) * [-1797.049] (-1796.120) (-1804.952) (-1816.038) -- 0:06:47
117500 -- (-1795.660) (-1811.480) [-1800.420] (-1799.781) * (-1798.086) (-1807.071) [-1799.987] (-1806.428) -- 0:06:45
118000 -- (-1817.822) (-1798.171) (-1808.024) [-1790.865] * (-1803.230) [-1794.750] (-1798.647) (-1811.545) -- 0:06:43
118500 -- (-1800.995) (-1806.035) (-1795.695) [-1790.695] * (-1802.015) [-1794.992] (-1802.742) (-1799.258) -- 0:06:41
119000 -- (-1800.426) (-1798.262) (-1806.991) [-1793.468] * [-1800.945] (-1798.836) (-1808.433) (-1799.656) -- 0:06:39
119500 -- (-1803.005) [-1795.340] (-1798.553) (-1797.555) * (-1797.017) (-1801.131) (-1809.220) [-1798.183] -- 0:06:45
120000 -- (-1792.721) (-1800.837) (-1798.898) [-1792.543] * (-1796.151) [-1796.197] (-1808.582) (-1802.636) -- 0:06:43
Average standard deviation of split frequencies: 0.013999
120500 -- [-1794.102] (-1808.543) (-1799.155) (-1795.222) * (-1803.597) (-1793.376) (-1800.173) [-1793.826] -- 0:06:41
121000 -- (-1807.317) [-1806.721] (-1808.065) (-1803.549) * (-1796.081) [-1794.544] (-1808.940) (-1800.695) -- 0:06:39
121500 -- (-1800.007) (-1798.366) (-1794.716) [-1796.710] * (-1803.192) (-1806.775) (-1801.158) [-1797.232] -- 0:06:44
122000 -- (-1799.900) (-1803.246) [-1798.087] (-1801.533) * [-1808.398] (-1787.716) (-1797.192) (-1801.351) -- 0:06:43
122500 -- (-1799.425) [-1799.096] (-1799.781) (-1800.111) * (-1802.249) (-1800.125) (-1790.150) [-1807.156] -- 0:06:41
123000 -- (-1809.787) (-1807.327) (-1823.073) [-1802.605] * (-1807.383) [-1792.762] (-1796.890) (-1792.373) -- 0:06:39
123500 -- (-1801.011) (-1797.352) [-1811.506] (-1801.434) * (-1810.691) (-1788.936) (-1797.350) [-1793.639] -- 0:06:37
124000 -- (-1801.927) (-1794.684) [-1803.971] (-1802.033) * (-1809.329) (-1804.983) [-1796.250] (-1800.797) -- 0:06:42
124500 -- [-1798.312] (-1805.254) (-1804.684) (-1803.403) * (-1803.602) (-1808.344) (-1804.513) [-1790.849] -- 0:06:40
125000 -- [-1794.261] (-1796.076) (-1798.474) (-1793.927) * [-1794.301] (-1797.298) (-1797.780) (-1803.344) -- 0:06:39
Average standard deviation of split frequencies: 0.009977
125500 -- (-1795.798) (-1795.134) (-1796.631) [-1795.328] * (-1817.044) (-1804.392) (-1794.580) [-1805.203] -- 0:06:37
126000 -- (-1795.510) [-1796.892] (-1802.879) (-1797.403) * (-1804.114) (-1803.638) (-1799.952) [-1796.012] -- 0:06:42
126500 -- (-1797.119) [-1793.429] (-1797.614) (-1794.256) * [-1805.461] (-1798.545) (-1804.990) (-1804.158) -- 0:06:40
127000 -- [-1787.748] (-1800.131) (-1797.177) (-1797.141) * (-1802.167) (-1799.868) [-1806.898] (-1805.969) -- 0:06:38
127500 -- (-1794.527) (-1790.581) [-1794.062] (-1790.753) * (-1806.029) (-1791.274) (-1806.001) [-1806.935] -- 0:06:36
128000 -- (-1796.987) [-1799.437] (-1804.184) (-1805.788) * (-1802.075) (-1795.704) [-1807.155] (-1796.361) -- 0:06:35
128500 -- (-1820.344) (-1805.134) (-1794.577) [-1794.300] * [-1799.263] (-1809.306) (-1800.261) (-1819.400) -- 0:06:40
129000 -- (-1809.719) (-1792.188) (-1800.438) [-1793.641] * (-1799.366) (-1805.734) [-1799.904] (-1803.027) -- 0:06:38
129500 -- (-1797.651) [-1790.097] (-1803.726) (-1802.418) * [-1792.752] (-1818.844) (-1804.499) (-1796.912) -- 0:06:36
130000 -- (-1796.798) (-1792.081) (-1807.001) [-1796.461] * (-1796.980) (-1802.042) (-1811.829) [-1800.455] -- 0:06:34
Average standard deviation of split frequencies: 0.011424
130500 -- (-1802.609) (-1795.310) [-1797.758] (-1790.299) * (-1801.857) (-1807.231) [-1803.238] (-1795.717) -- 0:06:39
131000 -- [-1794.293] (-1801.082) (-1793.591) (-1793.985) * (-1796.349) [-1792.281] (-1800.498) (-1804.574) -- 0:06:38
131500 -- (-1799.744) (-1797.335) (-1799.681) [-1790.880] * (-1800.467) [-1793.111] (-1799.769) (-1804.475) -- 0:06:36
132000 -- [-1798.973] (-1793.195) (-1796.933) (-1805.561) * [-1800.764] (-1802.194) (-1808.300) (-1796.454) -- 0:06:34
132500 -- (-1797.914) (-1799.415) [-1804.166] (-1813.814) * (-1795.609) [-1800.923] (-1803.771) (-1805.908) -- 0:06:39
133000 -- [-1791.570] (-1808.671) (-1797.361) (-1799.439) * (-1804.965) (-1800.772) (-1799.862) [-1803.249] -- 0:06:37
133500 -- (-1793.160) (-1808.571) (-1794.207) [-1801.300] * [-1799.191] (-1796.813) (-1801.727) (-1794.647) -- 0:06:35
134000 -- (-1791.745) (-1811.570) (-1790.725) [-1794.386] * (-1800.786) (-1801.646) [-1803.661] (-1797.190) -- 0:06:34
134500 -- (-1798.743) (-1799.028) [-1792.065] (-1793.761) * [-1813.073] (-1799.408) (-1812.699) (-1795.579) -- 0:06:32
135000 -- (-1799.002) (-1793.433) [-1798.337] (-1795.202) * [-1800.799] (-1802.278) (-1804.091) (-1798.447) -- 0:06:37
Average standard deviation of split frequencies: 0.014154
135500 -- [-1797.353] (-1802.343) (-1800.685) (-1793.420) * (-1801.419) [-1800.162] (-1803.019) (-1808.433) -- 0:06:35
136000 -- (-1806.071) (-1798.969) (-1796.871) [-1801.245] * (-1790.117) [-1790.876] (-1802.130) (-1809.489) -- 0:06:33
136500 -- (-1804.532) [-1792.019] (-1793.181) (-1810.929) * [-1801.548] (-1794.711) (-1805.447) (-1810.411) -- 0:06:32
137000 -- (-1796.936) (-1798.577) (-1797.807) [-1795.160] * (-1804.374) [-1795.085] (-1800.351) (-1807.217) -- 0:06:36
137500 -- (-1807.004) [-1800.025] (-1797.737) (-1806.070) * (-1802.613) (-1796.742) [-1801.144] (-1801.249) -- 0:06:35
138000 -- (-1801.293) (-1793.135) (-1810.927) [-1797.245] * (-1796.976) [-1794.799] (-1800.171) (-1797.633) -- 0:06:33
138500 -- [-1794.054] (-1789.578) (-1808.289) (-1799.014) * (-1796.008) [-1802.371] (-1803.256) (-1796.652) -- 0:06:31
139000 -- [-1798.759] (-1797.980) (-1801.912) (-1816.907) * (-1802.477) [-1792.911] (-1809.218) (-1792.960) -- 0:06:30
139500 -- [-1794.864] (-1809.956) (-1796.319) (-1807.256) * (-1808.976) [-1800.660] (-1788.436) (-1794.194) -- 0:06:34
140000 -- [-1789.160] (-1800.447) (-1801.934) (-1794.162) * (-1800.353) (-1800.226) (-1794.022) [-1794.165] -- 0:06:33
Average standard deviation of split frequencies: 0.017035
140500 -- (-1806.697) (-1803.041) (-1795.346) [-1796.623] * (-1800.712) (-1809.415) (-1791.455) [-1795.941] -- 0:06:31
141000 -- (-1802.215) [-1793.965] (-1806.997) (-1797.419) * (-1809.763) (-1809.942) [-1793.818] (-1795.087) -- 0:06:29
141500 -- (-1798.658) (-1808.089) [-1799.084] (-1811.728) * [-1804.551] (-1808.771) (-1796.971) (-1793.937) -- 0:06:34
142000 -- (-1792.871) [-1805.924] (-1801.431) (-1803.663) * (-1797.786) (-1793.789) (-1795.624) [-1799.912] -- 0:06:32
142500 -- (-1800.094) (-1806.272) (-1803.393) [-1802.684] * (-1790.933) (-1804.002) (-1798.759) [-1797.060] -- 0:06:31
143000 -- [-1797.716] (-1815.803) (-1791.513) (-1809.272) * (-1801.308) (-1791.246) [-1803.396] (-1795.090) -- 0:06:29
143500 -- (-1807.692) (-1811.444) [-1793.225] (-1813.004) * (-1799.433) (-1796.362) (-1803.345) [-1792.576] -- 0:06:27
144000 -- [-1801.907] (-1803.539) (-1804.435) (-1814.205) * (-1801.698) [-1793.972] (-1794.913) (-1797.961) -- 0:06:32
144500 -- (-1812.927) (-1797.872) [-1793.388] (-1800.606) * (-1804.035) [-1793.756] (-1796.414) (-1798.104) -- 0:06:30
145000 -- (-1808.749) [-1807.309] (-1799.934) (-1800.750) * (-1807.283) (-1801.569) (-1794.836) [-1789.944] -- 0:06:29
Average standard deviation of split frequencies: 0.015875
145500 -- (-1804.364) (-1797.797) [-1798.782] (-1800.272) * (-1798.223) (-1794.017) (-1804.856) [-1793.468] -- 0:06:27
146000 -- (-1801.161) (-1809.228) [-1796.516] (-1799.132) * (-1803.897) (-1799.521) (-1797.613) [-1795.883] -- 0:06:31
146500 -- [-1794.739] (-1797.757) (-1792.853) (-1792.145) * (-1798.533) (-1805.170) [-1787.639] (-1800.289) -- 0:06:30
147000 -- (-1800.073) [-1795.877] (-1797.811) (-1800.688) * (-1807.388) (-1789.610) [-1790.269] (-1782.374) -- 0:06:28
147500 -- (-1802.982) (-1795.038) [-1797.985] (-1791.745) * (-1800.426) [-1798.174] (-1796.372) (-1806.137) -- 0:06:27
148000 -- (-1795.436) (-1790.711) [-1796.022] (-1796.506) * (-1799.909) [-1792.865] (-1803.266) (-1794.892) -- 0:06:31
148500 -- (-1795.608) (-1789.191) (-1794.273) [-1799.170] * (-1804.147) [-1799.377] (-1801.009) (-1800.838) -- 0:06:29
149000 -- (-1803.829) [-1794.941] (-1807.767) (-1790.795) * (-1798.576) (-1805.617) (-1807.182) [-1789.417] -- 0:06:28
149500 -- (-1798.530) (-1796.989) (-1794.754) [-1789.406] * (-1796.180) (-1797.542) [-1798.522] (-1800.497) -- 0:06:26
150000 -- (-1804.757) (-1803.527) [-1794.309] (-1789.586) * [-1796.753] (-1791.512) (-1796.733) (-1811.744) -- 0:06:25
Average standard deviation of split frequencies: 0.016687
150500 -- (-1797.550) (-1799.639) (-1811.098) [-1798.906] * (-1798.178) [-1800.503] (-1817.400) (-1795.567) -- 0:06:29
151000 -- (-1800.286) (-1799.741) (-1790.981) [-1794.962] * (-1800.275) (-1803.205) (-1804.337) [-1793.098] -- 0:06:27
151500 -- [-1802.409] (-1804.733) (-1791.768) (-1801.411) * [-1794.007] (-1800.767) (-1800.460) (-1794.032) -- 0:06:26
152000 -- (-1806.491) [-1803.476] (-1799.600) (-1802.804) * (-1799.452) [-1796.710] (-1811.603) (-1803.900) -- 0:06:24
152500 -- [-1796.058] (-1804.274) (-1789.342) (-1798.388) * [-1792.365] (-1806.079) (-1800.139) (-1803.931) -- 0:06:29
153000 -- (-1810.044) (-1793.260) [-1799.181] (-1803.614) * (-1793.008) (-1800.059) (-1801.992) [-1800.145] -- 0:06:27
153500 -- (-1804.685) [-1790.075] (-1812.846) (-1803.454) * (-1798.544) (-1807.642) [-1799.993] (-1806.240) -- 0:06:26
154000 -- [-1788.668] (-1809.886) (-1804.121) (-1798.224) * [-1793.683] (-1810.712) (-1808.414) (-1797.365) -- 0:06:24
154500 -- (-1792.477) [-1800.445] (-1794.741) (-1806.133) * [-1796.833] (-1802.317) (-1804.449) (-1806.164) -- 0:06:23
155000 -- (-1800.116) (-1796.350) [-1793.938] (-1801.456) * [-1798.337] (-1798.748) (-1801.963) (-1801.436) -- 0:06:27
Average standard deviation of split frequencies: 0.017124
155500 -- (-1800.944) (-1801.770) [-1796.487] (-1793.562) * (-1801.004) [-1801.711] (-1799.445) (-1794.474) -- 0:06:25
156000 -- (-1801.530) (-1796.491) (-1798.479) [-1795.503] * (-1804.698) [-1796.465] (-1794.138) (-1797.333) -- 0:06:24
156500 -- (-1804.723) [-1794.359] (-1801.809) (-1796.853) * (-1797.861) (-1800.693) [-1802.248] (-1807.538) -- 0:06:22
157000 -- [-1799.395] (-1804.713) (-1797.877) (-1791.172) * (-1801.400) (-1797.360) (-1803.835) [-1808.779] -- 0:06:26
157500 -- (-1797.297) (-1809.739) [-1790.611] (-1797.553) * (-1800.663) [-1799.763] (-1805.119) (-1793.373) -- 0:06:25
158000 -- (-1795.945) (-1804.870) [-1802.954] (-1796.120) * [-1792.811] (-1797.976) (-1799.808) (-1797.848) -- 0:06:23
158500 -- (-1806.144) [-1802.208] (-1801.935) (-1802.779) * (-1796.930) [-1794.554] (-1795.778) (-1794.626) -- 0:06:22
159000 -- [-1800.224] (-1805.217) (-1803.692) (-1801.053) * (-1795.642) (-1797.094) [-1797.998] (-1795.435) -- 0:06:20
159500 -- (-1798.959) [-1797.325] (-1797.697) (-1804.142) * (-1800.955) (-1799.486) (-1814.533) [-1796.639] -- 0:06:24
160000 -- (-1789.715) (-1791.998) (-1787.947) [-1810.587] * (-1806.335) (-1797.543) (-1803.854) [-1793.632] -- 0:06:23
Average standard deviation of split frequencies: 0.016871
160500 -- [-1792.682] (-1797.097) (-1797.279) (-1804.005) * (-1805.746) (-1800.647) [-1800.132] (-1793.008) -- 0:06:21
161000 -- [-1806.919] (-1801.441) (-1800.103) (-1806.496) * [-1801.682] (-1794.541) (-1795.296) (-1800.645) -- 0:06:20
161500 -- (-1803.098) (-1803.528) (-1801.001) [-1793.716] * [-1808.562] (-1787.448) (-1794.908) (-1798.944) -- 0:06:24
162000 -- [-1807.830] (-1793.680) (-1796.983) (-1793.635) * (-1803.932) [-1791.139] (-1794.227) (-1810.592) -- 0:06:22
162500 -- [-1796.202] (-1797.500) (-1807.291) (-1795.520) * (-1804.805) [-1797.400] (-1803.654) (-1797.470) -- 0:06:21
163000 -- (-1798.722) [-1797.548] (-1803.171) (-1790.912) * (-1797.205) (-1806.410) (-1795.206) [-1795.490] -- 0:06:19
163500 -- (-1793.770) (-1793.558) (-1805.591) [-1791.041] * (-1802.055) (-1799.503) [-1801.493] (-1798.433) -- 0:06:18
164000 -- (-1800.951) [-1791.609] (-1817.860) (-1797.008) * (-1802.120) [-1804.618] (-1799.464) (-1813.020) -- 0:06:22
164500 -- (-1799.547) (-1796.281) (-1809.848) [-1801.461] * (-1803.182) (-1795.093) [-1791.715] (-1808.668) -- 0:06:20
165000 -- [-1791.932] (-1797.044) (-1802.126) (-1795.319) * (-1808.365) [-1792.431] (-1793.474) (-1791.045) -- 0:06:19
Average standard deviation of split frequencies: 0.014909
165500 -- (-1794.105) (-1795.589) [-1797.607] (-1797.315) * (-1800.901) (-1793.043) [-1795.388] (-1801.290) -- 0:06:18
166000 -- (-1805.339) (-1795.573) [-1790.837] (-1796.238) * (-1816.257) (-1790.958) (-1799.809) [-1798.937] -- 0:06:21
166500 -- (-1793.682) [-1797.346] (-1791.507) (-1801.730) * (-1802.581) (-1793.594) (-1800.085) [-1802.222] -- 0:06:20
167000 -- (-1802.835) (-1796.619) (-1796.384) [-1794.464] * (-1810.837) [-1796.346] (-1794.493) (-1798.822) -- 0:06:19
167500 -- [-1796.145] (-1800.393) (-1800.375) (-1792.208) * (-1799.832) (-1800.336) (-1796.145) [-1795.282] -- 0:06:17
168000 -- (-1800.221) (-1796.678) [-1796.882] (-1801.756) * (-1801.005) (-1801.013) [-1797.984] (-1795.545) -- 0:06:21
168500 -- (-1798.274) (-1822.078) [-1791.513] (-1806.265) * [-1792.702] (-1801.017) (-1797.492) (-1801.186) -- 0:06:19
169000 -- [-1800.219] (-1804.140) (-1796.503) (-1799.757) * (-1800.301) (-1795.555) [-1796.569] (-1794.241) -- 0:06:18
169500 -- [-1801.117] (-1799.055) (-1806.034) (-1806.179) * (-1795.822) (-1804.835) (-1807.674) [-1792.457] -- 0:06:17
170000 -- (-1795.748) [-1801.993] (-1796.355) (-1799.497) * (-1793.092) (-1807.318) (-1810.570) [-1793.851] -- 0:06:15
Average standard deviation of split frequencies: 0.013581
170500 -- (-1800.402) [-1796.817] (-1804.855) (-1801.758) * [-1799.745] (-1811.366) (-1796.250) (-1797.955) -- 0:06:19
171000 -- [-1788.718] (-1791.392) (-1799.064) (-1803.024) * (-1804.872) [-1794.763] (-1800.761) (-1800.663) -- 0:06:18
171500 -- (-1792.275) (-1800.272) [-1799.507] (-1803.923) * (-1796.374) (-1787.287) [-1793.125] (-1789.216) -- 0:06:16
172000 -- (-1799.760) (-1795.278) [-1801.275] (-1797.560) * (-1804.497) [-1798.916] (-1794.066) (-1796.599) -- 0:06:15
172500 -- (-1795.114) [-1800.171] (-1797.602) (-1801.582) * (-1798.829) [-1789.660] (-1798.160) (-1802.204) -- 0:06:18
173000 -- (-1795.717) (-1804.067) [-1788.362] (-1797.488) * (-1802.133) [-1793.396] (-1805.549) (-1796.865) -- 0:06:17
173500 -- (-1795.151) (-1793.740) (-1801.668) [-1795.868] * (-1803.265) [-1794.418] (-1812.496) (-1797.981) -- 0:06:16
174000 -- (-1803.226) (-1799.777) (-1811.259) [-1804.795] * (-1807.129) (-1796.444) [-1795.440] (-1799.755) -- 0:06:15
174500 -- [-1795.633] (-1805.916) (-1791.877) (-1802.393) * (-1796.514) (-1798.702) (-1802.914) [-1804.178] -- 0:06:13
175000 -- (-1802.157) (-1796.305) (-1791.954) [-1791.970] * (-1806.748) [-1800.612] (-1795.778) (-1799.212) -- 0:06:17
Average standard deviation of split frequencies: 0.013169
175500 -- (-1800.412) (-1798.052) (-1812.244) [-1802.578] * (-1798.035) (-1792.548) [-1794.985] (-1796.468) -- 0:06:15
176000 -- [-1791.857] (-1802.949) (-1791.280) (-1799.658) * (-1798.901) [-1792.919] (-1793.705) (-1802.025) -- 0:06:14
176500 -- (-1801.079) [-1795.288] (-1800.008) (-1800.152) * (-1797.740) (-1798.806) [-1796.980] (-1796.376) -- 0:06:13
177000 -- [-1799.291] (-1799.333) (-1803.614) (-1793.662) * (-1801.499) (-1805.254) (-1802.149) [-1793.011] -- 0:06:16
177500 -- [-1795.187] (-1799.921) (-1795.161) (-1801.483) * (-1802.327) (-1803.888) [-1794.567] (-1805.131) -- 0:06:15
178000 -- (-1792.075) (-1810.283) [-1794.057] (-1787.859) * (-1801.013) (-1799.080) (-1799.160) [-1798.976] -- 0:06:14
178500 -- [-1795.269] (-1795.699) (-1797.092) (-1807.402) * (-1798.108) (-1800.992) (-1793.414) [-1795.578] -- 0:06:12
179000 -- [-1796.325] (-1797.666) (-1801.161) (-1803.178) * [-1800.454] (-1799.732) (-1797.646) (-1800.603) -- 0:06:11
179500 -- (-1797.766) [-1797.372] (-1797.488) (-1803.088) * (-1804.222) (-1799.795) (-1800.842) [-1795.849] -- 0:06:14
180000 -- (-1800.160) (-1801.593) (-1802.353) [-1794.354] * (-1805.826) (-1794.634) (-1795.280) [-1799.974] -- 0:06:13
Average standard deviation of split frequencies: 0.012177
180500 -- (-1789.452) (-1796.412) (-1797.656) [-1801.262] * (-1800.557) [-1798.038] (-1796.524) (-1804.272) -- 0:06:12
181000 -- (-1795.351) [-1799.903] (-1795.795) (-1802.907) * (-1805.996) [-1795.497] (-1805.284) (-1804.085) -- 0:06:11
181500 -- (-1796.617) (-1792.721) [-1799.039] (-1803.705) * [-1800.474] (-1804.713) (-1803.092) (-1790.118) -- 0:06:14
182000 -- (-1788.520) [-1788.116] (-1804.107) (-1797.717) * (-1802.561) (-1798.033) (-1803.110) [-1790.277] -- 0:06:13
182500 -- [-1795.121] (-1801.305) (-1803.735) (-1795.744) * (-1796.178) (-1793.597) [-1793.577] (-1804.412) -- 0:06:11
183000 -- (-1807.080) (-1802.209) (-1806.508) [-1790.127] * (-1801.319) (-1806.836) [-1797.342] (-1795.337) -- 0:06:10
183500 -- (-1796.576) (-1797.424) (-1792.975) [-1794.666] * (-1800.528) [-1790.044] (-1800.592) (-1803.058) -- 0:06:13
184000 -- (-1802.844) (-1803.817) [-1799.146] (-1787.838) * (-1794.682) (-1795.693) [-1795.133] (-1796.523) -- 0:06:12
184500 -- (-1798.172) [-1791.635] (-1795.681) (-1803.161) * [-1800.623] (-1802.190) (-1797.917) (-1795.706) -- 0:06:11
185000 -- (-1810.140) [-1796.170] (-1797.364) (-1798.727) * (-1802.008) (-1803.357) [-1802.852] (-1803.723) -- 0:06:10
Average standard deviation of split frequencies: 0.015207
185500 -- (-1792.447) [-1795.823] (-1801.383) (-1797.238) * (-1793.374) (-1801.387) (-1808.501) [-1796.210] -- 0:06:08
186000 -- (-1800.583) (-1810.060) [-1791.916] (-1803.358) * (-1793.074) (-1789.217) [-1798.463] (-1804.574) -- 0:06:11
186500 -- [-1799.355] (-1794.490) (-1795.319) (-1797.296) * (-1798.130) [-1800.075] (-1798.707) (-1796.599) -- 0:06:10
187000 -- (-1797.467) (-1799.250) [-1795.389] (-1800.706) * (-1801.652) (-1819.344) [-1799.609] (-1813.089) -- 0:06:09
187500 -- (-1811.286) (-1794.345) [-1793.165] (-1809.887) * (-1793.662) (-1802.169) (-1798.539) [-1799.854] -- 0:06:08
188000 -- [-1798.145] (-1803.920) (-1792.017) (-1807.018) * (-1804.071) [-1808.016] (-1798.227) (-1804.897) -- 0:06:11
188500 -- [-1797.590] (-1810.569) (-1811.675) (-1806.108) * (-1812.846) (-1802.880) [-1797.025] (-1794.594) -- 0:06:10
189000 -- [-1795.280] (-1807.826) (-1801.030) (-1801.345) * (-1804.031) (-1803.999) [-1802.321] (-1805.635) -- 0:06:09
189500 -- [-1790.998] (-1800.045) (-1792.616) (-1801.429) * [-1791.969] (-1809.040) (-1796.752) (-1796.549) -- 0:06:07
190000 -- [-1792.109] (-1800.701) (-1796.771) (-1797.718) * (-1806.203) (-1807.783) [-1797.236] (-1793.443) -- 0:06:06
Average standard deviation of split frequencies: 0.015865
190500 -- (-1804.257) [-1804.866] (-1806.613) (-1788.779) * (-1795.953) (-1797.429) (-1791.210) [-1798.392] -- 0:06:09
191000 -- [-1801.646] (-1798.360) (-1794.334) (-1802.890) * (-1800.742) (-1804.212) (-1794.062) [-1794.472] -- 0:06:08
191500 -- [-1799.973] (-1796.312) (-1795.801) (-1796.468) * (-1791.386) (-1814.294) (-1790.096) [-1796.852] -- 0:06:07
192000 -- (-1813.255) [-1790.494] (-1798.124) (-1798.239) * (-1791.356) (-1820.305) (-1803.693) [-1799.661] -- 0:06:06
192500 -- (-1805.738) [-1793.654] (-1797.532) (-1797.269) * (-1802.346) (-1808.262) [-1787.351] (-1797.914) -- 0:06:09
193000 -- (-1807.953) (-1798.501) [-1793.636] (-1798.629) * [-1799.136] (-1790.486) (-1790.603) (-1794.927) -- 0:06:07
193500 -- (-1805.079) (-1800.792) (-1795.787) [-1803.673] * (-1804.303) (-1794.483) [-1793.081] (-1794.755) -- 0:06:06
194000 -- (-1808.399) (-1800.886) (-1802.047) [-1787.591] * [-1805.997] (-1792.068) (-1792.607) (-1793.633) -- 0:06:05
194500 -- (-1800.544) (-1794.219) (-1801.401) [-1792.105] * (-1793.978) (-1801.133) (-1798.049) [-1798.316] -- 0:06:08
195000 -- (-1803.934) (-1799.981) [-1795.896] (-1804.109) * (-1798.505) (-1796.265) [-1791.777] (-1798.034) -- 0:06:07
Average standard deviation of split frequencies: 0.016235
195500 -- (-1796.664) [-1797.787] (-1797.183) (-1796.698) * [-1785.386] (-1818.851) (-1802.559) (-1796.106) -- 0:06:06
196000 -- (-1796.785) (-1798.248) (-1810.396) [-1791.854] * (-1795.454) (-1810.854) [-1791.874] (-1802.837) -- 0:06:05
196500 -- (-1789.632) (-1793.053) (-1803.531) [-1795.586] * (-1801.094) (-1806.019) [-1793.257] (-1805.151) -- 0:06:03
197000 -- (-1805.142) (-1792.079) [-1800.884] (-1797.460) * (-1792.199) [-1789.774] (-1801.663) (-1800.421) -- 0:06:06
197500 -- [-1797.024] (-1795.729) (-1796.884) (-1792.315) * (-1797.719) (-1798.187) (-1797.493) [-1793.804] -- 0:06:05
198000 -- [-1790.987] (-1796.203) (-1807.473) (-1805.265) * (-1802.227) (-1797.787) (-1796.269) [-1789.280] -- 0:06:04
198500 -- (-1813.093) (-1806.919) [-1804.651] (-1798.017) * (-1794.871) (-1796.619) (-1797.346) [-1795.698] -- 0:06:03
199000 -- (-1799.255) [-1795.459] (-1799.791) (-1803.689) * (-1792.608) [-1794.258] (-1797.858) (-1796.979) -- 0:06:06
199500 -- (-1797.077) [-1792.508] (-1806.305) (-1795.338) * (-1796.690) (-1796.109) [-1797.745] (-1797.230) -- 0:06:05
200000 -- (-1813.074) (-1801.831) [-1802.241] (-1793.139) * (-1804.680) (-1799.411) [-1801.162] (-1804.710) -- 0:06:04
Average standard deviation of split frequencies: 0.015270
200500 -- (-1794.821) [-1791.185] (-1792.087) (-1799.262) * [-1798.551] (-1794.842) (-1805.292) (-1802.173) -- 0:06:02
201000 -- (-1803.966) [-1798.784] (-1794.404) (-1805.918) * (-1796.129) [-1794.768] (-1798.762) (-1794.938) -- 0:06:01
201500 -- (-1800.835) (-1797.254) [-1797.824] (-1805.932) * (-1807.496) [-1793.741] (-1801.069) (-1798.280) -- 0:06:04
202000 -- (-1801.395) (-1803.717) (-1814.484) [-1801.661] * (-1798.360) (-1805.272) [-1797.482] (-1801.096) -- 0:06:03
202500 -- (-1803.686) (-1798.761) (-1804.190) [-1796.500] * (-1808.658) (-1795.609) [-1808.356] (-1798.677) -- 0:06:02
203000 -- (-1810.778) (-1795.213) (-1803.445) [-1803.991] * (-1804.525) (-1791.967) (-1803.039) [-1793.652] -- 0:06:01
203500 -- (-1800.193) (-1807.852) (-1801.566) [-1797.260] * (-1808.045) (-1803.820) [-1797.387] (-1801.256) -- 0:06:04
204000 -- (-1799.232) [-1801.482] (-1798.706) (-1806.077) * (-1799.104) [-1786.382] (-1806.226) (-1810.393) -- 0:06:02
204500 -- (-1796.196) (-1790.644) [-1793.872] (-1804.815) * [-1802.811] (-1801.665) (-1809.283) (-1805.982) -- 0:06:01
205000 -- (-1800.320) [-1795.957] (-1795.812) (-1793.962) * (-1797.150) (-1802.523) (-1802.311) [-1796.820] -- 0:06:00
Average standard deviation of split frequencies: 0.015447
205500 -- [-1801.778] (-1797.599) (-1796.364) (-1791.916) * [-1795.818] (-1800.149) (-1801.673) (-1788.842) -- 0:05:59
206000 -- [-1798.455] (-1794.368) (-1803.920) (-1799.035) * (-1799.145) [-1797.018] (-1801.608) (-1790.530) -- 0:06:02
206500 -- [-1795.164] (-1804.410) (-1815.535) (-1807.386) * (-1799.918) (-1804.545) (-1803.107) [-1796.058] -- 0:06:01
207000 -- [-1798.338] (-1812.926) (-1798.971) (-1807.909) * (-1799.252) [-1799.032] (-1802.668) (-1808.145) -- 0:06:00
207500 -- (-1799.089) (-1807.987) [-1795.518] (-1804.607) * (-1797.755) (-1798.441) [-1797.710] (-1807.966) -- 0:05:59
208000 -- (-1806.131) [-1794.227] (-1816.953) (-1793.573) * (-1795.344) (-1794.876) (-1795.970) [-1801.881] -- 0:06:01
208500 -- (-1802.080) (-1802.221) [-1800.816] (-1797.632) * [-1799.972] (-1822.652) (-1800.838) (-1814.133) -- 0:06:00
209000 -- (-1806.592) (-1801.639) [-1801.408] (-1798.897) * (-1798.463) (-1806.931) (-1799.726) [-1791.060] -- 0:05:59
209500 -- (-1798.263) (-1799.043) (-1793.806) [-1805.349] * (-1806.718) (-1801.932) [-1794.160] (-1799.073) -- 0:05:58
210000 -- [-1790.003] (-1801.598) (-1794.674) (-1798.218) * (-1798.524) (-1797.699) (-1804.636) [-1799.315] -- 0:05:57
Average standard deviation of split frequencies: 0.015291
210500 -- [-1797.604] (-1791.456) (-1810.508) (-1796.994) * (-1792.938) (-1799.090) (-1804.380) [-1796.087] -- 0:06:00
211000 -- (-1787.649) (-1802.040) (-1802.682) [-1798.933] * (-1799.451) (-1792.444) (-1795.323) [-1802.167] -- 0:05:58
211500 -- (-1795.452) (-1793.386) (-1800.613) [-1802.878] * [-1801.596] (-1800.154) (-1795.925) (-1805.412) -- 0:05:57
212000 -- [-1798.837] (-1804.409) (-1804.733) (-1812.745) * [-1788.214] (-1806.475) (-1790.052) (-1805.561) -- 0:05:56
212500 -- (-1794.568) (-1795.219) [-1788.750] (-1809.795) * (-1804.151) (-1808.098) (-1800.558) [-1793.245] -- 0:05:59
213000 -- [-1791.606] (-1804.089) (-1805.017) (-1801.754) * (-1800.680) (-1806.545) (-1804.067) [-1796.475] -- 0:05:58
213500 -- [-1792.037] (-1798.318) (-1800.595) (-1807.881) * (-1798.546) (-1814.705) [-1794.645] (-1802.417) -- 0:05:57
214000 -- (-1808.780) [-1796.481] (-1796.816) (-1805.868) * (-1801.129) (-1803.787) (-1806.294) [-1799.978] -- 0:05:56
214500 -- (-1799.306) (-1792.774) (-1804.678) [-1790.065] * (-1802.176) (-1819.943) (-1800.171) [-1802.405] -- 0:05:58
215000 -- (-1796.776) [-1800.707] (-1794.955) (-1797.747) * (-1799.326) [-1810.224] (-1792.144) (-1803.741) -- 0:05:57
Average standard deviation of split frequencies: 0.014550
215500 -- (-1806.289) (-1795.296) (-1800.494) [-1787.318] * (-1799.147) (-1804.336) (-1802.558) [-1793.250] -- 0:05:56
216000 -- (-1803.805) (-1790.763) (-1804.004) [-1796.497] * (-1789.252) [-1794.474] (-1805.238) (-1793.809) -- 0:05:55
216500 -- [-1797.373] (-1801.116) (-1803.712) (-1793.573) * (-1808.139) [-1793.153] (-1805.684) (-1799.115) -- 0:05:54
217000 -- (-1808.229) (-1800.793) (-1800.690) [-1795.076] * (-1802.753) [-1810.391] (-1796.351) (-1788.338) -- 0:05:57
217500 -- (-1808.756) (-1802.437) [-1796.011] (-1804.752) * (-1805.770) (-1796.152) [-1805.915] (-1803.493) -- 0:05:56
218000 -- (-1807.313) (-1801.699) (-1801.795) [-1803.483] * [-1811.898] (-1797.772) (-1801.743) (-1804.609) -- 0:05:55
218500 -- (-1799.465) (-1803.586) (-1792.367) [-1792.467] * (-1812.598) [-1799.154] (-1807.962) (-1799.305) -- 0:05:54
219000 -- (-1798.870) (-1805.643) (-1804.961) [-1791.519] * (-1800.750) (-1810.155) (-1794.869) [-1797.663] -- 0:05:56
219500 -- [-1797.390] (-1803.160) (-1804.429) (-1794.590) * (-1787.896) [-1798.443] (-1795.228) (-1796.932) -- 0:05:55
220000 -- [-1792.808] (-1800.387) (-1804.151) (-1790.440) * [-1795.210] (-1799.203) (-1809.760) (-1790.921) -- 0:05:54
Average standard deviation of split frequencies: 0.013352
220500 -- (-1803.388) [-1789.006] (-1801.190) (-1798.506) * (-1797.143) (-1802.120) [-1800.957] (-1798.855) -- 0:05:53
221000 -- [-1799.634] (-1794.540) (-1811.943) (-1798.825) * (-1808.421) (-1806.636) (-1795.601) [-1793.108] -- 0:05:52
221500 -- (-1797.873) (-1804.919) (-1796.097) [-1803.602] * (-1796.225) (-1805.560) [-1798.911] (-1797.070) -- 0:05:54
222000 -- (-1797.176) [-1797.623] (-1803.904) (-1804.191) * (-1811.244) (-1813.939) [-1802.952] (-1793.902) -- 0:05:53
222500 -- (-1802.202) [-1801.398] (-1803.643) (-1812.172) * (-1795.193) [-1795.366] (-1798.938) (-1797.344) -- 0:05:52
223000 -- (-1803.347) (-1800.255) (-1809.542) [-1796.666] * (-1795.890) (-1801.277) (-1800.944) [-1792.190] -- 0:05:51
223500 -- (-1799.326) (-1796.717) [-1807.753] (-1797.883) * [-1797.912] (-1823.681) (-1798.563) (-1797.434) -- 0:05:54
224000 -- (-1803.186) (-1794.405) (-1801.276) [-1788.800] * [-1796.927] (-1803.278) (-1802.010) (-1807.484) -- 0:05:53
224500 -- (-1804.428) (-1798.290) (-1796.136) [-1793.318] * (-1805.139) (-1800.756) (-1802.501) [-1797.733] -- 0:05:52
225000 -- (-1801.353) (-1814.294) (-1799.211) [-1799.606] * (-1807.590) (-1794.478) (-1795.179) [-1795.420] -- 0:05:51
Average standard deviation of split frequencies: 0.013037
225500 -- [-1792.697] (-1809.441) (-1798.229) (-1796.850) * [-1797.890] (-1806.643) (-1799.563) (-1805.657) -- 0:05:53
226000 -- (-1797.732) [-1797.164] (-1794.382) (-1814.331) * (-1803.575) (-1801.601) (-1792.967) [-1805.559] -- 0:05:52
226500 -- (-1801.047) (-1786.536) (-1801.271) [-1801.085] * (-1792.551) (-1814.599) (-1797.969) [-1796.746] -- 0:05:51
227000 -- (-1795.994) (-1800.038) [-1803.842] (-1797.403) * (-1805.142) (-1797.873) [-1795.154] (-1791.971) -- 0:05:50
227500 -- (-1795.090) [-1797.971] (-1806.687) (-1803.299) * [-1795.196] (-1801.486) (-1805.293) (-1792.830) -- 0:05:49
228000 -- [-1805.828] (-1798.963) (-1800.482) (-1805.189) * [-1795.182] (-1809.889) (-1803.007) (-1798.346) -- 0:05:52
228500 -- [-1803.097] (-1796.976) (-1799.194) (-1795.350) * [-1798.445] (-1797.114) (-1804.824) (-1800.505) -- 0:05:51
229000 -- (-1798.930) [-1795.565] (-1804.227) (-1814.314) * (-1796.996) (-1802.626) [-1791.192] (-1800.137) -- 0:05:50
229500 -- (-1798.854) (-1788.431) (-1795.839) [-1800.612] * (-1803.385) (-1803.371) (-1802.970) [-1803.417] -- 0:05:49
230000 -- (-1796.061) (-1794.876) (-1798.124) [-1805.583] * (-1797.167) (-1802.175) (-1791.540) [-1798.863] -- 0:05:51
Average standard deviation of split frequencies: 0.014306
230500 -- (-1802.523) [-1798.310] (-1798.256) (-1805.431) * (-1797.615) (-1804.463) [-1796.715] (-1816.627) -- 0:05:50
231000 -- [-1797.513] (-1804.735) (-1807.540) (-1794.735) * (-1792.988) (-1805.473) (-1806.099) [-1801.885] -- 0:05:49
231500 -- (-1806.355) (-1799.510) (-1804.668) [-1803.213] * (-1799.189) (-1802.855) (-1804.012) [-1803.910] -- 0:05:48
232000 -- (-1814.172) [-1802.839] (-1794.390) (-1803.126) * (-1803.203) (-1806.875) [-1793.116] (-1798.090) -- 0:05:47
232500 -- (-1806.480) (-1793.371) (-1794.353) [-1789.180] * (-1804.450) (-1793.756) (-1802.492) [-1797.852] -- 0:05:49
233000 -- (-1798.921) (-1809.190) [-1794.907] (-1798.277) * [-1791.917] (-1811.418) (-1792.096) (-1800.130) -- 0:05:48
233500 -- [-1798.473] (-1801.663) (-1798.748) (-1801.724) * [-1798.068] (-1795.156) (-1802.343) (-1803.448) -- 0:05:47
234000 -- (-1802.428) (-1797.954) (-1794.980) [-1795.541] * (-1798.264) [-1805.647] (-1795.880) (-1795.358) -- 0:05:46
234500 -- (-1806.494) (-1796.115) (-1802.716) [-1790.929] * (-1799.565) (-1793.200) (-1797.883) [-1799.579] -- 0:05:49
235000 -- (-1806.620) (-1795.504) (-1804.814) [-1809.954] * (-1805.114) (-1801.866) [-1804.792] (-1799.106) -- 0:05:48
Average standard deviation of split frequencies: 0.014315
235500 -- (-1802.554) (-1814.944) [-1797.490] (-1800.354) * (-1794.735) (-1796.339) (-1799.191) [-1796.454] -- 0:05:47
236000 -- (-1800.557) (-1801.091) [-1795.191] (-1809.848) * (-1801.278) [-1794.569] (-1792.075) (-1806.300) -- 0:05:46
236500 -- (-1801.287) [-1797.631] (-1798.482) (-1805.679) * (-1796.656) (-1793.956) (-1803.720) [-1800.754] -- 0:05:48
237000 -- (-1798.740) (-1797.010) (-1795.566) [-1795.807] * [-1800.411] (-1802.832) (-1800.705) (-1803.904) -- 0:05:47
237500 -- [-1794.684] (-1805.624) (-1801.914) (-1799.776) * (-1792.011) (-1808.203) [-1801.760] (-1799.754) -- 0:05:46
238000 -- (-1799.270) (-1804.073) [-1802.955] (-1799.755) * (-1799.988) [-1789.559] (-1793.346) (-1797.691) -- 0:05:45
238500 -- [-1791.481] (-1796.387) (-1794.944) (-1797.135) * [-1807.932] (-1792.398) (-1797.939) (-1807.108) -- 0:05:44
239000 -- (-1802.665) (-1794.431) (-1801.956) [-1796.782] * (-1800.017) (-1801.413) [-1796.905] (-1800.246) -- 0:05:47
239500 -- (-1798.393) (-1796.532) [-1793.638] (-1805.709) * (-1797.848) (-1806.176) [-1799.279] (-1800.959) -- 0:05:46
240000 -- [-1799.857] (-1797.096) (-1801.716) (-1798.674) * (-1802.211) [-1794.611] (-1802.734) (-1815.061) -- 0:05:45
Average standard deviation of split frequencies: 0.015670
240500 -- [-1803.468] (-1807.600) (-1800.037) (-1808.857) * [-1787.217] (-1805.531) (-1801.424) (-1793.151) -- 0:05:44
241000 -- (-1801.952) [-1789.695] (-1799.699) (-1794.602) * (-1791.377) (-1801.426) (-1802.384) [-1808.124] -- 0:05:46
241500 -- (-1804.591) (-1806.825) (-1794.750) [-1793.251] * [-1792.586] (-1801.334) (-1797.738) (-1805.554) -- 0:05:45
242000 -- (-1810.085) (-1799.281) [-1794.538] (-1793.107) * [-1798.167] (-1798.401) (-1795.934) (-1803.203) -- 0:05:44
242500 -- (-1812.434) (-1792.755) (-1794.913) [-1805.227] * (-1800.221) (-1803.980) (-1801.503) [-1801.765] -- 0:05:43
243000 -- (-1799.766) (-1796.227) [-1798.571] (-1797.609) * [-1790.132] (-1797.341) (-1799.750) (-1804.163) -- 0:05:42
243500 -- [-1790.995] (-1797.879) (-1805.078) (-1797.313) * (-1798.054) (-1794.667) (-1806.092) [-1792.156] -- 0:05:44
244000 -- [-1801.563] (-1791.080) (-1804.447) (-1808.000) * [-1801.111] (-1791.987) (-1798.591) (-1804.554) -- 0:05:43
244500 -- (-1799.628) (-1794.510) (-1801.921) [-1788.751] * (-1799.721) [-1797.091] (-1798.765) (-1800.852) -- 0:05:42
245000 -- (-1806.943) (-1800.744) [-1797.473] (-1806.178) * (-1794.622) (-1793.255) (-1809.492) [-1792.033] -- 0:05:42
Average standard deviation of split frequencies: 0.015171
245500 -- (-1795.753) [-1797.672] (-1798.849) (-1801.804) * (-1802.028) (-1802.895) [-1816.953] (-1802.160) -- 0:05:44
246000 -- (-1802.001) (-1798.113) (-1796.678) [-1791.866] * (-1795.098) [-1800.510] (-1803.805) (-1800.219) -- 0:05:43
246500 -- (-1791.298) (-1807.212) (-1808.491) [-1790.807] * (-1800.367) (-1802.653) (-1799.731) [-1799.989] -- 0:05:42
247000 -- [-1794.362] (-1801.654) (-1807.389) (-1803.764) * [-1792.102] (-1799.544) (-1797.128) (-1808.014) -- 0:05:41
247500 -- (-1805.672) [-1797.839] (-1801.020) (-1805.635) * (-1801.473) (-1798.630) [-1793.082] (-1800.184) -- 0:05:43
248000 -- (-1793.647) [-1798.020] (-1804.935) (-1799.365) * (-1804.208) (-1794.218) [-1795.416] (-1800.022) -- 0:05:42
248500 -- (-1794.877) (-1800.643) (-1798.620) [-1793.107] * (-1804.183) (-1802.576) [-1801.391] (-1797.172) -- 0:05:41
249000 -- (-1805.801) (-1798.774) (-1795.265) [-1801.999] * (-1803.421) [-1800.289] (-1804.598) (-1806.790) -- 0:05:40
249500 -- (-1797.739) (-1798.576) [-1799.895] (-1790.416) * (-1801.178) [-1797.010] (-1808.542) (-1806.864) -- 0:05:39
250000 -- [-1801.158] (-1802.182) (-1803.993) (-1800.267) * (-1803.952) (-1794.597) (-1806.583) [-1796.912] -- 0:05:42
Average standard deviation of split frequencies: 0.016455
250500 -- [-1794.285] (-1792.827) (-1793.396) (-1800.308) * (-1795.586) [-1801.461] (-1797.349) (-1799.651) -- 0:05:41
251000 -- (-1794.725) (-1813.878) (-1805.660) [-1792.383] * (-1803.210) (-1813.940) [-1795.353] (-1796.302) -- 0:05:40
251500 -- [-1797.717] (-1802.072) (-1806.997) (-1803.915) * [-1803.097] (-1801.584) (-1804.427) (-1801.136) -- 0:05:39
252000 -- (-1791.912) [-1799.559] (-1798.250) (-1802.068) * (-1796.299) [-1800.214] (-1803.491) (-1803.087) -- 0:05:41
252500 -- [-1794.515] (-1803.817) (-1802.613) (-1803.211) * [-1799.162] (-1801.151) (-1814.175) (-1799.285) -- 0:05:40
253000 -- (-1803.401) (-1795.354) [-1797.656] (-1793.011) * (-1796.560) [-1807.076] (-1796.769) (-1811.823) -- 0:05:39
253500 -- (-1790.077) (-1807.734) [-1802.093] (-1807.868) * [-1799.471] (-1802.942) (-1801.456) (-1806.796) -- 0:05:38
254000 -- (-1804.099) [-1798.081] (-1797.600) (-1803.688) * (-1801.828) (-1797.719) [-1797.335] (-1819.812) -- 0:05:37
254500 -- [-1798.752] (-1805.198) (-1799.260) (-1806.369) * [-1798.295] (-1801.853) (-1804.887) (-1795.444) -- 0:05:39
255000 -- [-1794.168] (-1805.500) (-1801.228) (-1797.658) * (-1818.534) (-1800.925) [-1792.790] (-1798.214) -- 0:05:38
Average standard deviation of split frequencies: 0.015499
255500 -- (-1809.065) (-1805.247) (-1802.494) [-1794.398] * (-1800.127) (-1801.853) [-1796.343] (-1797.693) -- 0:05:38
256000 -- (-1803.359) (-1810.495) [-1800.483] (-1802.443) * [-1796.894] (-1794.325) (-1798.816) (-1795.489) -- 0:05:37
256500 -- (-1809.942) (-1799.111) (-1805.065) [-1795.602] * (-1800.683) (-1796.739) [-1798.059] (-1796.088) -- 0:05:39
257000 -- (-1797.860) (-1812.171) (-1793.895) [-1795.236] * (-1798.626) [-1794.861] (-1804.629) (-1795.793) -- 0:05:38
257500 -- [-1800.015] (-1800.077) (-1795.421) (-1790.095) * (-1805.132) (-1793.642) [-1797.997] (-1797.251) -- 0:05:37
258000 -- (-1801.056) (-1796.246) (-1807.646) [-1792.662] * (-1795.908) [-1790.798] (-1800.617) (-1794.041) -- 0:05:36
258500 -- (-1799.744) [-1797.271] (-1808.863) (-1804.834) * (-1801.810) (-1796.903) (-1800.517) [-1798.375] -- 0:05:38
259000 -- (-1809.188) [-1797.956] (-1801.408) (-1802.761) * (-1802.226) [-1789.631] (-1801.529) (-1794.407) -- 0:05:37
259500 -- (-1798.008) [-1791.328] (-1800.476) (-1799.619) * [-1788.070] (-1791.488) (-1803.842) (-1791.487) -- 0:05:36
260000 -- (-1794.524) [-1796.576] (-1803.937) (-1802.798) * (-1801.949) [-1804.873] (-1800.335) (-1789.566) -- 0:05:35
Average standard deviation of split frequencies: 0.014618
260500 -- (-1800.131) (-1806.783) [-1793.927] (-1803.477) * (-1793.788) (-1800.135) [-1795.910] (-1792.953) -- 0:05:34
261000 -- (-1802.376) (-1797.170) [-1803.774] (-1800.357) * (-1792.964) (-1806.836) (-1797.557) [-1795.220] -- 0:05:36
261500 -- (-1808.783) (-1799.737) [-1810.294] (-1801.971) * (-1795.663) (-1788.340) (-1800.735) [-1793.062] -- 0:05:36
262000 -- (-1798.935) [-1797.578] (-1813.981) (-1796.224) * (-1799.082) [-1796.249] (-1800.416) (-1799.659) -- 0:05:35
262500 -- (-1800.123) [-1800.661] (-1798.140) (-1801.641) * (-1792.014) (-1809.663) [-1795.879] (-1811.619) -- 0:05:34
263000 -- (-1804.663) (-1796.028) (-1800.200) [-1794.447] * (-1792.061) (-1796.336) (-1808.122) [-1794.885] -- 0:05:36
263500 -- [-1796.944] (-1808.800) (-1798.936) (-1803.641) * [-1800.776] (-1797.897) (-1815.315) (-1810.962) -- 0:05:35
264000 -- (-1806.091) [-1797.847] (-1797.116) (-1801.602) * (-1807.708) (-1800.531) [-1797.863] (-1793.537) -- 0:05:34
264500 -- [-1803.364] (-1795.485) (-1799.527) (-1797.135) * (-1798.942) [-1797.340] (-1796.026) (-1795.688) -- 0:05:33
265000 -- (-1801.688) [-1798.743] (-1805.738) (-1794.483) * (-1801.042) (-1804.435) [-1798.355] (-1812.052) -- 0:05:32
Average standard deviation of split frequencies: 0.014030
265500 -- (-1815.902) (-1796.526) (-1796.155) [-1797.495] * (-1798.498) (-1801.629) [-1802.238] (-1807.879) -- 0:05:34
266000 -- (-1794.989) (-1796.991) [-1792.515] (-1806.853) * (-1794.041) (-1795.844) [-1791.713] (-1807.572) -- 0:05:33
266500 -- (-1801.926) [-1793.293] (-1817.419) (-1804.247) * (-1802.317) (-1803.258) [-1802.739] (-1805.769) -- 0:05:33
267000 -- (-1800.199) [-1797.547] (-1798.385) (-1803.403) * (-1804.546) (-1797.141) [-1793.192] (-1808.476) -- 0:05:32
267500 -- (-1798.322) (-1796.526) (-1797.998) [-1798.760] * (-1798.988) (-1792.421) (-1799.708) [-1800.748] -- 0:05:34
268000 -- (-1800.123) (-1798.669) (-1798.691) [-1794.199] * (-1793.447) (-1798.860) [-1794.242] (-1796.563) -- 0:05:33
268500 -- [-1795.939] (-1797.712) (-1805.102) (-1801.257) * (-1801.685) (-1804.842) [-1792.273] (-1793.790) -- 0:05:32
269000 -- [-1795.230] (-1798.961) (-1805.840) (-1810.906) * (-1804.524) (-1802.583) [-1799.516] (-1791.726) -- 0:05:31
269500 -- (-1797.314) [-1801.394] (-1815.534) (-1799.891) * (-1798.074) (-1803.288) (-1799.377) [-1795.369] -- 0:05:33
270000 -- [-1790.444] (-1801.765) (-1803.237) (-1792.946) * (-1797.545) (-1792.942) (-1797.154) [-1796.718] -- 0:05:32
Average standard deviation of split frequencies: 0.014514
270500 -- (-1789.867) [-1794.848] (-1796.678) (-1795.305) * (-1796.055) (-1807.208) [-1801.270] (-1811.531) -- 0:05:31
271000 -- (-1791.875) (-1798.571) [-1797.429] (-1806.199) * [-1800.762] (-1796.814) (-1819.261) (-1800.729) -- 0:05:30
271500 -- [-1797.916] (-1793.814) (-1801.109) (-1802.786) * [-1800.463] (-1788.970) (-1799.000) (-1797.051) -- 0:05:30
272000 -- (-1806.415) [-1808.693] (-1804.287) (-1795.049) * (-1807.866) [-1793.047] (-1795.444) (-1806.787) -- 0:05:31
272500 -- (-1796.791) [-1794.827] (-1806.409) (-1799.995) * (-1798.339) [-1795.943] (-1800.442) (-1809.384) -- 0:05:31
273000 -- (-1796.572) [-1795.944] (-1790.598) (-1807.278) * (-1802.513) (-1796.333) [-1794.003] (-1802.681) -- 0:05:30
273500 -- (-1807.150) [-1794.622] (-1790.507) (-1802.098) * (-1806.788) [-1794.772] (-1808.054) (-1798.254) -- 0:05:29
274000 -- (-1796.077) [-1804.210] (-1806.392) (-1799.623) * (-1797.718) [-1798.046] (-1796.223) (-1800.252) -- 0:05:31
274500 -- [-1801.193] (-1806.560) (-1795.117) (-1800.190) * (-1794.770) (-1798.832) [-1796.953] (-1800.050) -- 0:05:30
275000 -- (-1799.014) (-1792.880) [-1797.517] (-1801.993) * (-1793.756) [-1793.474] (-1796.361) (-1794.627) -- 0:05:29
Average standard deviation of split frequencies: 0.014518
275500 -- [-1790.941] (-1807.386) (-1796.099) (-1796.552) * (-1800.561) [-1791.067] (-1811.607) (-1812.472) -- 0:05:28
276000 -- [-1797.145] (-1805.605) (-1801.210) (-1806.036) * (-1803.700) (-1801.622) [-1795.789] (-1807.865) -- 0:05:27
276500 -- (-1795.679) (-1792.795) (-1798.443) [-1798.410] * (-1801.017) [-1802.614] (-1795.132) (-1793.924) -- 0:05:29
277000 -- (-1807.304) [-1796.354] (-1800.122) (-1799.381) * [-1787.799] (-1801.325) (-1797.793) (-1794.528) -- 0:05:28
277500 -- [-1794.156] (-1806.111) (-1801.040) (-1801.434) * (-1799.471) [-1799.144] (-1811.633) (-1806.049) -- 0:05:28
278000 -- [-1791.035] (-1801.060) (-1799.515) (-1797.536) * (-1791.346) (-1805.261) [-1790.871] (-1806.419) -- 0:05:27
278500 -- (-1795.642) [-1799.226] (-1799.143) (-1803.976) * (-1791.992) (-1797.856) [-1801.442] (-1796.724) -- 0:05:29
279000 -- [-1796.419] (-1800.043) (-1805.835) (-1795.524) * (-1793.432) [-1800.271] (-1798.765) (-1795.028) -- 0:05:28
279500 -- (-1805.605) (-1804.286) [-1794.266] (-1803.433) * [-1796.904] (-1799.063) (-1799.767) (-1795.243) -- 0:05:27
280000 -- (-1797.729) [-1803.683] (-1808.004) (-1809.938) * (-1796.766) (-1798.036) (-1806.968) [-1801.674] -- 0:05:26
Average standard deviation of split frequencies: 0.013717
280500 -- (-1801.733) (-1804.074) [-1795.641] (-1788.603) * (-1816.302) [-1797.123] (-1803.552) (-1797.221) -- 0:05:25
281000 -- (-1799.038) [-1793.996] (-1806.100) (-1797.145) * (-1793.233) (-1786.357) [-1795.756] (-1802.105) -- 0:05:27
281500 -- [-1791.969] (-1789.847) (-1797.981) (-1794.938) * (-1799.133) (-1798.149) [-1794.787] (-1804.614) -- 0:05:26
282000 -- (-1795.891) (-1801.695) [-1789.479] (-1815.162) * (-1800.115) [-1798.623] (-1803.699) (-1814.254) -- 0:05:25
282500 -- (-1793.780) (-1797.878) [-1795.783] (-1796.391) * (-1803.845) (-1790.529) [-1798.804] (-1812.283) -- 0:05:25
283000 -- (-1792.120) (-1804.235) [-1797.055] (-1811.232) * [-1791.713] (-1804.810) (-1797.438) (-1800.733) -- 0:05:26
283500 -- (-1792.306) (-1810.389) [-1798.466] (-1811.553) * [-1798.373] (-1793.898) (-1798.072) (-1812.814) -- 0:05:26
284000 -- [-1793.041] (-1797.528) (-1797.022) (-1798.882) * (-1798.585) [-1802.082] (-1805.765) (-1808.697) -- 0:05:25
284500 -- (-1805.912) [-1794.534] (-1797.041) (-1797.341) * (-1801.095) (-1794.571) (-1797.938) [-1790.854] -- 0:05:24
285000 -- (-1801.613) (-1807.410) (-1796.319) [-1793.547] * (-1804.449) (-1801.124) [-1800.523] (-1799.127) -- 0:05:26
Average standard deviation of split frequencies: 0.012774
285500 -- (-1807.767) (-1807.880) [-1794.572] (-1794.154) * (-1803.457) (-1792.762) [-1793.599] (-1795.751) -- 0:05:25
286000 -- (-1801.088) (-1805.226) [-1799.452] (-1799.973) * (-1810.597) (-1797.935) (-1795.864) [-1789.659] -- 0:05:24
286500 -- [-1794.954] (-1802.798) (-1811.525) (-1791.494) * (-1802.014) [-1795.596] (-1799.425) (-1805.438) -- 0:05:23
287000 -- (-1793.004) (-1802.700) (-1807.528) [-1799.339] * (-1805.873) (-1804.954) [-1795.047] (-1796.136) -- 0:05:22
287500 -- (-1794.192) [-1802.166] (-1811.190) (-1798.185) * (-1794.511) [-1794.812] (-1802.256) (-1795.783) -- 0:05:24
288000 -- (-1797.759) (-1802.720) [-1806.868] (-1805.667) * (-1796.541) (-1797.062) [-1793.305] (-1794.483) -- 0:05:23
288500 -- [-1793.773] (-1807.072) (-1810.428) (-1804.077) * (-1795.931) (-1800.908) [-1789.325] (-1794.097) -- 0:05:23
289000 -- [-1793.011] (-1809.778) (-1803.862) (-1798.774) * (-1806.033) (-1802.017) [-1792.547] (-1815.732) -- 0:05:22
289500 -- (-1800.077) (-1797.108) [-1799.410] (-1795.024) * (-1795.344) (-1792.888) [-1795.099] (-1798.664) -- 0:05:23
290000 -- (-1800.094) [-1797.604] (-1801.787) (-1801.592) * [-1793.467] (-1794.058) (-1796.882) (-1804.896) -- 0:05:23
Average standard deviation of split frequencies: 0.013110
290500 -- (-1813.889) (-1800.324) [-1795.371] (-1796.947) * [-1802.231] (-1798.419) (-1799.350) (-1801.607) -- 0:05:22
291000 -- [-1799.265] (-1807.705) (-1796.300) (-1807.635) * (-1810.421) (-1796.484) (-1797.993) [-1795.337] -- 0:05:21
291500 -- (-1802.758) (-1805.088) [-1792.500] (-1820.496) * (-1810.075) (-1805.650) (-1790.628) [-1790.060] -- 0:05:23
292000 -- (-1791.995) (-1803.658) [-1794.711] (-1802.530) * (-1813.092) [-1795.893] (-1791.706) (-1790.025) -- 0:05:22
292500 -- [-1793.537] (-1802.266) (-1790.722) (-1805.011) * (-1801.728) (-1806.568) [-1797.169] (-1800.803) -- 0:05:21
293000 -- (-1792.903) [-1795.663] (-1786.488) (-1794.512) * (-1808.330) [-1793.663] (-1801.576) (-1798.158) -- 0:05:20
293500 -- [-1798.998] (-1796.738) (-1802.243) (-1792.702) * [-1793.640] (-1801.545) (-1803.344) (-1802.542) -- 0:05:20
294000 -- (-1803.438) (-1793.730) (-1789.911) [-1796.080] * [-1794.061] (-1802.457) (-1815.873) (-1802.391) -- 0:05:21
294500 -- (-1789.625) (-1809.527) [-1795.437] (-1800.308) * (-1796.922) (-1799.369) (-1803.998) [-1790.673] -- 0:05:21
295000 -- (-1800.405) [-1803.700] (-1795.875) (-1801.037) * [-1790.398] (-1798.782) (-1799.932) (-1787.501) -- 0:05:20
Average standard deviation of split frequencies: 0.013802
295500 -- [-1795.851] (-1794.384) (-1800.709) (-1799.353) * (-1805.489) (-1803.435) (-1796.301) [-1804.752] -- 0:05:19
296000 -- [-1805.930] (-1795.486) (-1801.273) (-1804.540) * (-1805.453) (-1803.205) (-1798.258) [-1798.215] -- 0:05:21
296500 -- (-1800.336) (-1797.829) [-1800.884] (-1794.837) * [-1799.472] (-1804.825) (-1791.601) (-1792.484) -- 0:05:20
297000 -- (-1791.420) [-1796.430] (-1801.583) (-1798.815) * (-1798.112) (-1793.181) (-1788.852) [-1794.729] -- 0:05:19
297500 -- (-1789.598) (-1791.412) [-1801.680] (-1796.304) * (-1800.301) (-1806.084) [-1799.304] (-1800.252) -- 0:05:18
298000 -- (-1802.728) [-1797.793] (-1797.162) (-1801.979) * (-1804.215) [-1803.164] (-1797.359) (-1802.527) -- 0:05:18
298500 -- [-1798.199] (-1797.981) (-1814.217) (-1803.789) * (-1800.530) (-1795.603) [-1791.470] (-1795.003) -- 0:05:19
299000 -- (-1800.055) (-1803.813) [-1803.115] (-1798.806) * [-1795.670] (-1797.543) (-1792.515) (-1803.340) -- 0:05:18
299500 -- (-1809.959) (-1800.741) [-1797.090] (-1797.772) * (-1797.524) [-1787.948] (-1793.001) (-1796.920) -- 0:05:18
300000 -- (-1803.539) (-1790.582) [-1798.753] (-1796.715) * (-1807.406) (-1789.844) (-1803.361) [-1795.290] -- 0:05:17
Average standard deviation of split frequencies: 0.014241
300500 -- (-1807.300) (-1794.146) [-1799.050] (-1798.910) * (-1807.238) (-1800.696) [-1794.139] (-1800.697) -- 0:05:18
301000 -- (-1801.741) [-1803.228] (-1802.089) (-1801.028) * (-1807.250) (-1795.072) [-1796.685] (-1793.168) -- 0:05:18
301500 -- (-1795.214) [-1794.014] (-1805.020) (-1792.786) * (-1805.552) (-1800.921) [-1791.194] (-1793.513) -- 0:05:17
302000 -- (-1803.399) (-1801.076) (-1806.477) [-1791.434] * [-1802.241] (-1799.749) (-1796.764) (-1809.205) -- 0:05:16
302500 -- (-1793.423) (-1804.238) (-1803.443) [-1797.224] * [-1798.618] (-1792.574) (-1797.930) (-1797.433) -- 0:05:18
303000 -- (-1797.252) (-1814.664) [-1802.765] (-1804.796) * (-1811.567) (-1797.906) [-1797.156] (-1788.526) -- 0:05:17
303500 -- (-1802.406) (-1799.813) [-1794.528] (-1799.337) * (-1806.410) (-1796.516) [-1790.966] (-1800.652) -- 0:05:16
304000 -- (-1796.378) [-1796.752] (-1791.986) (-1810.505) * [-1808.038] (-1800.445) (-1797.862) (-1792.171) -- 0:05:15
304500 -- (-1806.762) (-1803.615) (-1802.616) [-1797.747] * (-1794.546) [-1795.203] (-1801.731) (-1802.770) -- 0:05:15
305000 -- (-1799.297) (-1798.105) (-1806.528) [-1793.691] * (-1796.199) [-1799.023] (-1794.160) (-1793.434) -- 0:05:16
Average standard deviation of split frequencies: 0.014635
305500 -- [-1796.784] (-1802.779) (-1809.128) (-1802.770) * (-1799.317) (-1810.118) (-1799.460) [-1788.874] -- 0:05:15
306000 -- (-1795.011) [-1798.348] (-1809.794) (-1798.197) * (-1806.592) (-1806.335) (-1792.097) [-1800.594] -- 0:05:15
306500 -- [-1793.606] (-1790.990) (-1792.141) (-1800.006) * [-1793.370] (-1803.303) (-1817.276) (-1802.337) -- 0:05:14
307000 -- (-1792.283) [-1804.741] (-1795.120) (-1809.834) * [-1799.323] (-1805.900) (-1813.322) (-1798.668) -- 0:05:16
307500 -- (-1797.915) (-1802.656) (-1787.882) [-1801.083] * (-1797.281) [-1790.237] (-1802.476) (-1799.417) -- 0:05:15
308000 -- (-1804.546) (-1801.493) [-1793.065] (-1796.231) * (-1798.796) [-1794.832] (-1804.355) (-1804.508) -- 0:05:14
308500 -- [-1797.897] (-1812.879) (-1792.789) (-1800.124) * [-1810.126] (-1798.386) (-1801.908) (-1803.962) -- 0:05:13
309000 -- (-1803.707) (-1806.207) [-1791.422] (-1798.170) * (-1799.953) (-1792.176) [-1794.566] (-1806.758) -- 0:05:15
309500 -- (-1794.302) (-1797.541) (-1805.394) [-1797.202] * (-1805.489) (-1801.312) [-1794.262] (-1795.674) -- 0:05:14
310000 -- [-1796.410] (-1795.834) (-1802.108) (-1808.427) * (-1805.529) (-1797.682) (-1798.894) [-1793.286] -- 0:05:13
Average standard deviation of split frequencies: 0.014542
310500 -- (-1803.281) [-1795.904] (-1795.671) (-1797.495) * (-1809.189) (-1799.374) (-1800.357) [-1790.543] -- 0:05:13
311000 -- [-1802.138] (-1792.861) (-1800.021) (-1810.609) * (-1803.955) (-1796.302) [-1796.681] (-1804.229) -- 0:05:12
311500 -- (-1798.701) (-1807.368) (-1793.156) [-1794.494] * (-1802.316) (-1792.800) [-1796.376] (-1801.405) -- 0:05:13
312000 -- [-1795.338] (-1806.480) (-1798.848) (-1801.644) * (-1799.523) (-1803.867) (-1796.093) [-1798.890] -- 0:05:13
312500 -- [-1800.645] (-1802.642) (-1799.507) (-1794.997) * [-1798.899] (-1799.747) (-1804.926) (-1810.583) -- 0:05:12
313000 -- [-1801.276] (-1801.579) (-1793.234) (-1795.211) * (-1801.852) [-1793.532] (-1806.846) (-1796.082) -- 0:05:11
313500 -- (-1795.288) (-1798.858) (-1793.228) [-1791.898] * (-1801.860) (-1808.478) (-1797.793) [-1790.964] -- 0:05:13
314000 -- [-1794.238] (-1797.397) (-1799.788) (-1805.085) * (-1796.742) (-1797.123) (-1805.092) [-1798.986] -- 0:05:12
314500 -- (-1800.005) (-1800.621) [-1790.175] (-1801.468) * (-1798.946) [-1803.212] (-1804.801) (-1803.807) -- 0:05:11
315000 -- (-1799.336) (-1795.006) (-1802.955) [-1790.405] * [-1793.742] (-1796.415) (-1801.786) (-1799.037) -- 0:05:10
Average standard deviation of split frequencies: 0.014794
315500 -- [-1792.734] (-1804.414) (-1788.230) (-1794.912) * (-1802.771) [-1797.586] (-1795.891) (-1800.535) -- 0:05:10
316000 -- (-1799.799) (-1799.034) [-1798.451] (-1793.331) * (-1796.353) [-1795.714] (-1794.990) (-1795.385) -- 0:05:11
316500 -- (-1806.689) (-1795.784) (-1811.601) [-1793.163] * (-1793.076) (-1798.621) [-1798.025] (-1797.128) -- 0:05:10
317000 -- (-1804.700) (-1798.402) (-1812.590) [-1794.930] * (-1798.626) [-1807.812] (-1803.583) (-1799.808) -- 0:05:10
317500 -- (-1800.577) (-1795.849) [-1792.260] (-1795.405) * (-1794.971) (-1796.498) [-1801.843] (-1805.519) -- 0:05:09
318000 -- (-1805.084) (-1801.671) [-1794.859] (-1800.156) * (-1791.968) (-1795.842) [-1803.731] (-1791.677) -- 0:05:10
318500 -- (-1799.510) (-1798.149) [-1790.404] (-1803.339) * (-1795.342) [-1800.180] (-1798.632) (-1802.457) -- 0:05:10
319000 -- [-1792.531] (-1791.488) (-1801.534) (-1803.216) * (-1798.819) [-1801.304] (-1799.540) (-1802.386) -- 0:05:09
319500 -- (-1817.458) [-1792.252] (-1803.033) (-1795.669) * (-1796.908) (-1804.592) (-1791.125) [-1794.182] -- 0:05:08
320000 -- (-1796.288) [-1802.974] (-1796.707) (-1796.517) * [-1797.292] (-1815.356) (-1800.030) (-1811.620) -- 0:05:10
Average standard deviation of split frequencies: 0.015068
320500 -- (-1795.049) (-1798.446) [-1793.386] (-1807.373) * (-1795.102) (-1804.126) (-1802.567) [-1797.742] -- 0:05:09
321000 -- [-1789.955] (-1809.531) (-1805.201) (-1800.791) * (-1802.104) (-1800.524) (-1817.453) [-1796.254] -- 0:05:08
321500 -- [-1794.454] (-1801.821) (-1800.513) (-1801.342) * (-1796.338) [-1804.616] (-1800.698) (-1816.753) -- 0:05:08
322000 -- [-1794.122] (-1801.242) (-1800.303) (-1801.410) * (-1799.792) [-1793.420] (-1791.880) (-1803.327) -- 0:05:07
322500 -- [-1806.203] (-1801.555) (-1810.291) (-1798.155) * (-1795.076) [-1793.467] (-1797.539) (-1800.557) -- 0:05:08
323000 -- (-1810.543) (-1801.466) [-1802.340] (-1805.632) * (-1798.012) (-1794.515) (-1791.915) [-1787.033] -- 0:05:08
323500 -- (-1794.694) (-1802.477) (-1797.760) [-1797.960] * (-1794.937) (-1799.299) [-1794.640] (-1790.756) -- 0:05:07
324000 -- [-1790.489] (-1810.528) (-1798.743) (-1804.125) * [-1790.519] (-1791.841) (-1791.414) (-1797.330) -- 0:05:06
324500 -- (-1791.835) (-1817.004) (-1798.692) [-1801.109] * (-1799.208) (-1792.563) [-1792.515] (-1807.100) -- 0:05:08
325000 -- (-1799.861) (-1798.627) [-1798.385] (-1794.366) * (-1795.270) [-1800.112] (-1802.934) (-1798.844) -- 0:05:07
Average standard deviation of split frequencies: 0.013617
325500 -- [-1799.833] (-1800.563) (-1796.030) (-1800.993) * [-1799.432] (-1804.527) (-1806.552) (-1804.518) -- 0:05:06
326000 -- (-1801.622) (-1795.517) [-1797.735] (-1803.654) * (-1803.201) (-1800.390) [-1799.619] (-1803.937) -- 0:05:05
326500 -- [-1796.946] (-1810.908) (-1791.060) (-1794.176) * [-1793.592] (-1799.302) (-1794.065) (-1799.478) -- 0:05:07
327000 -- [-1794.318] (-1800.811) (-1792.554) (-1801.858) * [-1796.706] (-1805.062) (-1796.981) (-1806.844) -- 0:05:06
327500 -- [-1788.648] (-1804.567) (-1795.193) (-1805.049) * (-1798.357) (-1799.762) [-1794.304] (-1801.051) -- 0:05:05
328000 -- [-1794.497] (-1801.081) (-1801.348) (-1795.496) * [-1803.678] (-1797.687) (-1805.962) (-1800.491) -- 0:05:05
328500 -- (-1800.702) (-1796.454) [-1795.766] (-1792.741) * (-1801.334) (-1807.068) (-1806.894) [-1805.779] -- 0:05:04
329000 -- (-1796.388) (-1791.457) (-1796.773) [-1799.443] * (-1791.255) (-1800.984) (-1806.098) [-1799.639] -- 0:05:05
329500 -- (-1804.304) (-1795.943) [-1799.443] (-1790.205) * (-1803.389) (-1795.972) (-1803.010) [-1795.482] -- 0:05:05
330000 -- (-1795.368) [-1791.048] (-1799.701) (-1795.986) * [-1794.400] (-1806.607) (-1795.698) (-1793.370) -- 0:05:04
Average standard deviation of split frequencies: 0.014375
330500 -- (-1797.506) (-1794.916) (-1798.967) [-1797.867] * (-1801.885) (-1804.566) [-1802.228] (-1800.044) -- 0:05:03
331000 -- (-1800.822) [-1795.937] (-1792.556) (-1807.728) * (-1792.122) (-1797.298) (-1800.159) [-1799.194] -- 0:05:05
331500 -- (-1798.805) (-1810.819) [-1792.834] (-1803.339) * (-1798.426) (-1794.096) (-1804.616) [-1798.161] -- 0:05:04
332000 -- (-1797.201) [-1797.160] (-1790.949) (-1805.239) * (-1798.121) [-1796.289] (-1796.312) (-1794.435) -- 0:05:03
332500 -- [-1801.628] (-1800.010) (-1799.652) (-1798.150) * (-1799.996) [-1804.336] (-1803.508) (-1798.048) -- 0:05:03
333000 -- (-1804.639) (-1805.866) (-1800.007) [-1792.617] * (-1793.702) (-1803.808) (-1807.390) [-1795.563] -- 0:05:04
333500 -- [-1796.681] (-1799.249) (-1797.012) (-1795.439) * [-1796.357] (-1806.158) (-1804.370) (-1798.197) -- 0:05:03
334000 -- (-1800.062) (-1802.214) (-1792.826) [-1798.101] * [-1789.743] (-1798.880) (-1801.983) (-1793.784) -- 0:05:03
334500 -- [-1801.977] (-1788.589) (-1793.797) (-1796.026) * (-1809.101) (-1798.498) (-1800.686) [-1797.196] -- 0:05:02
335000 -- (-1799.377) (-1791.728) [-1801.865] (-1814.726) * [-1795.318] (-1800.424) (-1797.697) (-1791.478) -- 0:05:01
Average standard deviation of split frequencies: 0.013913
335500 -- [-1801.046] (-1803.868) (-1799.219) (-1799.946) * (-1797.735) (-1797.818) (-1802.333) [-1789.261] -- 0:05:03
336000 -- (-1799.550) (-1804.025) (-1795.329) [-1792.342] * (-1799.266) (-1801.277) [-1791.281] (-1797.716) -- 0:05:02
336500 -- [-1793.895] (-1795.488) (-1792.627) (-1798.245) * (-1793.316) (-1800.448) (-1802.561) [-1795.397] -- 0:05:01
337000 -- (-1802.837) (-1807.627) [-1794.904] (-1809.547) * (-1803.867) (-1795.256) (-1797.982) [-1791.691] -- 0:05:01
337500 -- (-1793.005) [-1799.074] (-1801.945) (-1795.200) * (-1797.472) (-1807.597) [-1794.926] (-1806.658) -- 0:05:02
338000 -- (-1808.943) [-1806.593] (-1799.917) (-1797.710) * (-1795.811) (-1805.025) (-1791.410) [-1798.742] -- 0:05:01
338500 -- (-1806.839) [-1800.559] (-1798.603) (-1805.959) * [-1798.252] (-1805.485) (-1797.198) (-1803.756) -- 0:05:00
339000 -- (-1820.074) [-1802.012] (-1802.060) (-1802.275) * (-1808.461) [-1797.508] (-1793.124) (-1790.312) -- 0:05:00
339500 -- (-1805.266) [-1801.005] (-1793.019) (-1805.747) * (-1799.317) [-1800.014] (-1798.174) (-1798.376) -- 0:04:59
340000 -- (-1799.570) [-1794.552] (-1792.061) (-1796.815) * [-1800.350] (-1801.593) (-1798.076) (-1798.227) -- 0:05:00
Average standard deviation of split frequencies: 0.012915
340500 -- (-1800.226) (-1802.848) (-1802.159) [-1801.240] * (-1800.903) [-1797.577] (-1802.854) (-1791.502) -- 0:05:00
341000 -- (-1806.987) [-1800.658] (-1800.081) (-1795.672) * [-1791.554] (-1796.748) (-1806.459) (-1804.710) -- 0:04:59
341500 -- (-1802.747) [-1794.172] (-1799.179) (-1799.013) * [-1797.321] (-1795.257) (-1798.982) (-1801.469) -- 0:04:58
342000 -- [-1793.610] (-1795.398) (-1814.633) (-1808.654) * (-1813.053) [-1799.196] (-1795.643) (-1799.169) -- 0:05:00
342500 -- (-1805.045) (-1793.569) (-1797.682) [-1805.115] * (-1810.265) (-1794.454) (-1794.623) [-1790.053] -- 0:04:59
343000 -- (-1795.630) (-1800.384) (-1810.024) [-1795.760] * [-1803.736] (-1799.094) (-1799.288) (-1800.476) -- 0:04:58
343500 -- (-1793.608) [-1790.863] (-1802.982) (-1800.774) * (-1806.909) [-1799.185] (-1797.731) (-1807.048) -- 0:04:58
344000 -- (-1802.626) (-1789.700) [-1804.978] (-1801.975) * (-1817.276) (-1793.406) [-1795.437] (-1795.376) -- 0:04:57
344500 -- (-1806.198) (-1797.591) (-1807.417) [-1786.864] * (-1801.867) [-1789.902] (-1809.467) (-1799.065) -- 0:04:58
345000 -- [-1796.707] (-1797.060) (-1809.454) (-1799.487) * [-1807.090] (-1796.159) (-1803.475) (-1802.461) -- 0:04:58
Average standard deviation of split frequencies: 0.012489
345500 -- (-1803.759) (-1801.144) [-1796.185] (-1790.317) * (-1806.940) (-1797.276) (-1801.141) [-1794.210] -- 0:04:57
346000 -- (-1796.959) (-1801.479) [-1797.610] (-1797.259) * (-1819.567) (-1795.347) [-1795.800] (-1795.028) -- 0:04:56
346500 -- [-1793.531] (-1810.712) (-1805.658) (-1808.052) * (-1802.868) (-1801.832) [-1793.230] (-1797.167) -- 0:04:57
347000 -- (-1801.677) [-1796.200] (-1802.380) (-1806.919) * (-1809.414) [-1789.172] (-1800.943) (-1802.389) -- 0:04:57
347500 -- (-1792.659) (-1804.902) (-1797.398) [-1799.863] * [-1790.909] (-1800.982) (-1796.600) (-1804.492) -- 0:04:56
348000 -- (-1802.056) (-1798.611) (-1799.031) [-1798.141] * (-1802.596) (-1809.819) (-1816.290) [-1799.570] -- 0:04:56
348500 -- (-1796.575) (-1802.463) [-1795.840] (-1796.733) * (-1799.042) (-1799.369) (-1810.110) [-1803.932] -- 0:04:57
349000 -- [-1794.135] (-1797.056) (-1799.743) (-1802.786) * [-1795.707] (-1802.404) (-1797.464) (-1801.878) -- 0:04:56
349500 -- (-1808.294) [-1797.041] (-1805.456) (-1795.310) * [-1799.328] (-1802.105) (-1804.875) (-1805.194) -- 0:04:55
350000 -- (-1810.947) (-1797.260) (-1818.111) [-1797.244] * (-1810.771) (-1800.700) [-1803.068] (-1793.087) -- 0:04:55
Average standard deviation of split frequencies: 0.010530
350500 -- (-1801.789) (-1794.275) [-1796.179] (-1801.295) * (-1795.865) (-1800.181) [-1798.333] (-1799.995) -- 0:04:54
351000 -- (-1807.444) (-1789.588) [-1799.994] (-1799.408) * (-1806.588) (-1807.469) [-1794.406] (-1800.064) -- 0:04:55
351500 -- (-1791.041) [-1794.134] (-1807.210) (-1797.556) * (-1799.880) (-1804.816) [-1795.597] (-1796.291) -- 0:04:55
352000 -- (-1808.239) (-1798.063) (-1804.555) [-1792.213] * (-1802.425) (-1804.760) (-1805.538) [-1799.498] -- 0:04:54
352500 -- [-1795.397] (-1793.684) (-1797.843) (-1793.433) * (-1801.057) (-1801.452) [-1798.563] (-1794.030) -- 0:04:53
353000 -- (-1814.752) (-1796.240) (-1797.062) [-1802.702] * (-1806.089) (-1799.927) (-1797.327) [-1790.786] -- 0:04:55
353500 -- (-1805.203) [-1800.626] (-1794.645) (-1796.492) * (-1804.811) (-1801.134) [-1795.684] (-1805.725) -- 0:04:54
354000 -- [-1801.925] (-1793.501) (-1799.858) (-1806.529) * [-1801.744] (-1800.469) (-1804.501) (-1819.394) -- 0:04:53
354500 -- (-1807.005) (-1792.603) (-1799.848) [-1797.292] * (-1789.538) [-1799.527] (-1796.962) (-1794.452) -- 0:04:53
355000 -- [-1791.653] (-1810.350) (-1810.761) (-1801.398) * [-1797.178] (-1794.739) (-1794.777) (-1806.073) -- 0:04:52
Average standard deviation of split frequencies: 0.010152
355500 -- [-1792.530] (-1796.779) (-1797.657) (-1805.313) * (-1796.071) (-1811.207) (-1795.610) [-1798.119] -- 0:04:53
356000 -- (-1809.730) (-1799.301) [-1799.513] (-1800.638) * (-1799.582) (-1802.722) (-1799.938) [-1799.425] -- 0:04:53
356500 -- (-1805.825) (-1796.751) (-1790.942) [-1802.931] * (-1804.465) [-1793.561] (-1798.548) (-1789.946) -- 0:04:52
357000 -- (-1799.135) [-1796.632] (-1800.552) (-1797.299) * (-1800.238) (-1800.454) (-1799.778) [-1794.476] -- 0:04:51
357500 -- (-1796.552) (-1792.888) [-1797.763] (-1798.734) * [-1793.487] (-1808.400) (-1811.122) (-1802.257) -- 0:04:52
358000 -- [-1795.139] (-1796.876) (-1817.206) (-1790.420) * (-1788.814) (-1796.778) [-1802.502] (-1807.280) -- 0:04:52
358500 -- (-1802.853) [-1794.796] (-1801.488) (-1796.437) * [-1796.050] (-1796.443) (-1805.719) (-1797.776) -- 0:04:51
359000 -- [-1799.976] (-1792.282) (-1809.274) (-1808.847) * (-1801.184) (-1797.289) (-1796.195) [-1793.628] -- 0:04:51
359500 -- (-1801.740) [-1797.514] (-1797.450) (-1819.474) * (-1795.316) [-1798.920] (-1806.718) (-1794.061) -- 0:04:50
360000 -- (-1803.451) [-1802.188] (-1792.883) (-1795.643) * (-1817.699) [-1798.322] (-1798.127) (-1794.913) -- 0:04:51
Average standard deviation of split frequencies: 0.009803
360500 -- (-1803.720) (-1806.059) [-1804.796] (-1795.671) * (-1800.989) (-1799.159) (-1795.595) [-1797.983] -- 0:04:50
361000 -- (-1794.389) (-1798.389) (-1793.098) [-1797.089] * (-1798.705) [-1797.501] (-1798.426) (-1805.537) -- 0:04:50
361500 -- [-1797.574] (-1791.053) (-1800.167) (-1793.555) * [-1797.959] (-1800.785) (-1787.205) (-1802.757) -- 0:04:49
362000 -- [-1794.672] (-1804.895) (-1795.963) (-1794.422) * [-1798.981] (-1798.364) (-1799.712) (-1800.701) -- 0:04:50
362500 -- (-1799.824) (-1795.051) (-1802.975) [-1798.801] * (-1803.876) (-1802.820) (-1796.222) [-1796.040] -- 0:04:50
363000 -- (-1792.027) (-1796.840) (-1810.061) [-1796.323] * (-1793.680) (-1803.008) (-1798.004) [-1804.580] -- 0:04:49
363500 -- (-1802.694) (-1805.969) (-1802.130) [-1792.672] * [-1793.809] (-1803.587) (-1806.881) (-1804.267) -- 0:04:48
364000 -- (-1798.520) (-1798.785) [-1794.585] (-1796.623) * (-1799.662) [-1788.696] (-1800.648) (-1800.417) -- 0:04:50
364500 -- [-1799.980] (-1792.924) (-1804.203) (-1802.569) * (-1795.454) [-1794.820] (-1811.062) (-1796.414) -- 0:04:49
365000 -- (-1800.850) (-1799.999) [-1796.450] (-1795.954) * [-1796.162] (-1798.009) (-1803.064) (-1795.252) -- 0:04:48
Average standard deviation of split frequencies: 0.009982
365500 -- [-1800.367] (-1803.109) (-1794.801) (-1802.361) * (-1804.081) (-1796.242) [-1805.557] (-1798.644) -- 0:04:48
366000 -- (-1805.051) (-1800.777) [-1799.108] (-1803.924) * (-1795.118) (-1805.967) [-1790.959] (-1801.252) -- 0:04:47
366500 -- (-1816.292) (-1804.940) (-1797.410) [-1794.765] * (-1794.186) [-1789.828] (-1801.836) (-1803.772) -- 0:04:48
367000 -- [-1800.020] (-1811.387) (-1796.225) (-1796.869) * (-1806.643) (-1796.547) [-1811.881] (-1804.195) -- 0:04:48
367500 -- (-1804.394) [-1798.797] (-1802.121) (-1794.676) * (-1801.580) (-1798.472) (-1797.787) [-1794.149] -- 0:04:47
368000 -- (-1801.608) (-1803.290) [-1799.954] (-1802.827) * (-1800.734) [-1796.948] (-1801.728) (-1806.637) -- 0:04:46
368500 -- [-1804.753] (-1795.378) (-1804.376) (-1797.581) * (-1793.213) [-1795.577] (-1802.921) (-1798.753) -- 0:04:47
369000 -- (-1801.227) [-1797.891] (-1803.559) (-1802.091) * (-1799.152) [-1803.748] (-1810.817) (-1805.873) -- 0:04:47
369500 -- (-1802.811) (-1796.440) (-1797.912) [-1797.291] * (-1820.427) (-1801.742) (-1807.444) [-1800.406] -- 0:04:46
370000 -- [-1798.411] (-1797.192) (-1799.597) (-1804.387) * (-1809.998) (-1795.958) [-1799.722] (-1806.803) -- 0:04:46
Average standard deviation of split frequencies: 0.009538
370500 -- (-1805.900) (-1813.056) [-1803.553] (-1793.099) * [-1798.267] (-1798.738) (-1803.000) (-1803.572) -- 0:04:45
371000 -- (-1796.835) (-1795.886) [-1800.319] (-1812.481) * [-1800.660] (-1806.176) (-1792.431) (-1803.373) -- 0:04:46
371500 -- (-1794.789) (-1797.783) (-1807.840) [-1794.915] * [-1798.209] (-1804.231) (-1797.878) (-1799.754) -- 0:04:45
372000 -- (-1796.550) [-1790.722] (-1810.928) (-1794.041) * (-1800.101) (-1794.348) (-1791.113) [-1794.736] -- 0:04:45
372500 -- [-1790.920] (-1793.353) (-1804.185) (-1807.005) * (-1792.611) [-1794.053] (-1796.235) (-1806.369) -- 0:04:44
373000 -- (-1800.093) (-1802.677) [-1793.382] (-1806.301) * (-1803.481) (-1792.512) [-1790.677] (-1807.403) -- 0:04:45
373500 -- (-1796.642) [-1793.249] (-1790.945) (-1791.504) * (-1802.605) [-1800.022] (-1799.634) (-1788.707) -- 0:04:45
374000 -- [-1786.711] (-1794.561) (-1800.226) (-1799.176) * (-1789.604) [-1795.354] (-1802.784) (-1795.403) -- 0:04:44
374500 -- (-1798.410) (-1788.360) [-1793.697] (-1812.128) * (-1789.762) (-1799.232) (-1799.719) [-1800.057] -- 0:04:43
375000 -- [-1802.181] (-1799.560) (-1795.371) (-1823.247) * [-1796.344] (-1797.782) (-1811.976) (-1789.478) -- 0:04:45
Average standard deviation of split frequencies: 0.009821
375500 -- [-1798.395] (-1803.057) (-1799.952) (-1808.203) * (-1794.539) [-1799.150] (-1795.449) (-1803.294) -- 0:04:44
376000 -- [-1796.344] (-1799.954) (-1805.676) (-1801.875) * (-1812.467) (-1803.340) [-1799.743] (-1800.027) -- 0:04:43
376500 -- (-1802.220) (-1794.569) (-1807.286) [-1801.029] * (-1795.888) [-1815.001] (-1798.400) (-1805.052) -- 0:04:43
377000 -- [-1795.865] (-1790.992) (-1807.120) (-1796.904) * [-1802.730] (-1795.404) (-1800.732) (-1809.133) -- 0:04:42
377500 -- (-1807.156) (-1802.229) [-1795.886] (-1800.843) * (-1804.282) [-1799.043] (-1806.918) (-1807.141) -- 0:04:43
378000 -- (-1795.410) (-1805.258) (-1801.695) [-1797.538] * (-1805.164) (-1793.036) (-1791.576) [-1798.144] -- 0:04:43
378500 -- [-1799.864] (-1804.799) (-1804.872) (-1800.920) * [-1801.177] (-1790.847) (-1807.317) (-1804.796) -- 0:04:42
379000 -- (-1803.908) (-1805.847) [-1796.810] (-1799.640) * (-1805.144) [-1793.302] (-1807.054) (-1790.789) -- 0:04:41
379500 -- (-1799.568) (-1795.270) [-1793.227] (-1803.410) * (-1800.990) (-1802.284) (-1804.735) [-1796.971] -- 0:04:42
380000 -- [-1796.916] (-1799.219) (-1802.667) (-1801.873) * (-1792.763) (-1805.454) [-1794.053] (-1802.569) -- 0:04:42
Average standard deviation of split frequencies: 0.010320
380500 -- (-1792.831) (-1798.832) [-1788.593] (-1800.768) * (-1803.700) [-1788.371] (-1794.609) (-1806.591) -- 0:04:41
381000 -- (-1802.211) (-1802.389) [-1795.939] (-1800.528) * (-1806.752) [-1792.537] (-1800.688) (-1801.854) -- 0:04:41
381500 -- (-1803.531) (-1801.426) (-1793.091) [-1788.847] * (-1806.226) (-1810.714) [-1799.408] (-1795.613) -- 0:04:42
382000 -- (-1797.404) [-1796.726] (-1796.220) (-1790.352) * [-1799.292] (-1792.924) (-1805.390) (-1803.273) -- 0:04:41
382500 -- (-1798.655) [-1795.311] (-1796.419) (-1792.854) * [-1806.615] (-1790.929) (-1799.385) (-1792.908) -- 0:04:40
383000 -- [-1796.101] (-1795.820) (-1793.749) (-1797.370) * (-1801.485) [-1798.045] (-1791.446) (-1800.172) -- 0:04:40
383500 -- (-1796.431) [-1795.009] (-1799.748) (-1802.666) * (-1806.118) (-1801.166) (-1796.396) [-1804.486] -- 0:04:39
384000 -- (-1796.524) [-1792.220] (-1796.494) (-1810.131) * [-1797.075] (-1793.062) (-1798.424) (-1798.725) -- 0:04:40
384500 -- (-1796.906) [-1794.669] (-1800.135) (-1809.114) * [-1798.040] (-1802.032) (-1801.495) (-1796.671) -- 0:04:40
385000 -- (-1796.790) (-1799.696) [-1800.277] (-1805.843) * (-1799.482) [-1795.588] (-1801.610) (-1803.505) -- 0:04:39
Average standard deviation of split frequencies: 0.008752
385500 -- (-1800.719) (-1802.005) [-1799.570] (-1799.298) * [-1792.966] (-1799.638) (-1800.703) (-1798.508) -- 0:04:38
386000 -- (-1806.118) [-1797.545] (-1794.872) (-1793.762) * (-1798.610) (-1794.996) (-1806.576) [-1792.589] -- 0:04:39
386500 -- [-1798.228] (-1802.251) (-1796.967) (-1798.655) * (-1800.756) [-1796.687] (-1802.261) (-1806.151) -- 0:04:39
387000 -- (-1809.559) (-1789.308) [-1799.593] (-1796.011) * [-1792.682] (-1799.110) (-1799.594) (-1796.191) -- 0:04:38
387500 -- [-1805.174] (-1800.297) (-1801.583) (-1799.450) * (-1795.947) (-1810.308) (-1802.417) [-1801.410] -- 0:04:38
388000 -- (-1801.835) [-1802.191] (-1803.423) (-1800.080) * (-1797.166) (-1807.806) [-1792.767] (-1796.368) -- 0:04:37
388500 -- (-1802.120) (-1797.938) (-1794.065) [-1797.146] * [-1793.510] (-1800.977) (-1799.980) (-1808.653) -- 0:04:38
389000 -- (-1800.350) (-1800.778) (-1808.252) [-1807.363] * (-1810.835) [-1798.590] (-1799.285) (-1803.118) -- 0:04:38
389500 -- (-1808.464) (-1794.687) [-1791.536] (-1791.600) * (-1811.125) [-1795.509] (-1793.682) (-1802.506) -- 0:04:37
390000 -- [-1798.222] (-1792.509) (-1797.176) (-1797.152) * (-1804.699) [-1801.480] (-1792.498) (-1799.250) -- 0:04:36
Average standard deviation of split frequencies: 0.009251
390500 -- (-1814.530) (-1789.494) (-1809.821) [-1795.213] * (-1799.644) [-1805.995] (-1810.813) (-1802.229) -- 0:04:37
391000 -- (-1801.630) (-1801.725) [-1795.161] (-1797.309) * [-1791.652] (-1795.152) (-1805.429) (-1809.149) -- 0:04:37
391500 -- (-1817.859) (-1796.575) [-1800.098] (-1800.961) * (-1798.678) [-1793.639] (-1795.665) (-1807.467) -- 0:04:36
392000 -- (-1819.029) [-1798.003] (-1794.385) (-1794.671) * (-1805.393) (-1797.885) [-1796.627] (-1806.484) -- 0:04:36
392500 -- (-1809.256) (-1794.767) (-1796.978) [-1794.005] * (-1809.382) [-1794.023] (-1808.165) (-1802.265) -- 0:04:37
393000 -- (-1809.934) (-1797.977) [-1800.527] (-1797.311) * (-1802.876) (-1810.147) [-1798.328] (-1799.319) -- 0:04:36
393500 -- [-1804.193] (-1799.220) (-1798.624) (-1792.102) * (-1798.851) (-1802.715) [-1801.649] (-1797.198) -- 0:04:35
394000 -- [-1802.321] (-1807.179) (-1797.415) (-1803.657) * [-1798.683] (-1801.513) (-1801.243) (-1800.282) -- 0:04:35
394500 -- [-1794.494] (-1799.293) (-1803.162) (-1793.180) * (-1803.581) [-1799.052] (-1802.731) (-1802.098) -- 0:04:34
395000 -- [-1796.228] (-1799.937) (-1798.337) (-1795.855) * (-1800.470) (-1800.754) [-1793.551] (-1797.883) -- 0:04:35
Average standard deviation of split frequencies: 0.008829
395500 -- (-1798.500) (-1802.067) [-1798.417] (-1801.175) * (-1802.015) (-1804.150) [-1790.480] (-1800.311) -- 0:04:35
396000 -- (-1800.036) (-1800.530) (-1801.433) [-1797.305] * (-1799.631) (-1793.304) [-1793.096] (-1790.636) -- 0:04:34
396500 -- [-1794.753] (-1817.117) (-1791.136) (-1798.821) * (-1799.551) [-1798.709] (-1794.008) (-1799.293) -- 0:04:33
397000 -- [-1795.678] (-1806.421) (-1799.222) (-1801.357) * (-1803.757) [-1791.324] (-1806.233) (-1800.769) -- 0:04:34
397500 -- [-1802.577] (-1813.371) (-1794.588) (-1799.264) * [-1795.678] (-1792.147) (-1804.523) (-1799.962) -- 0:04:34
398000 -- (-1794.885) [-1802.896] (-1796.989) (-1798.598) * [-1796.556] (-1796.635) (-1801.976) (-1803.939) -- 0:04:33
398500 -- (-1801.129) (-1798.071) [-1797.488] (-1798.222) * (-1796.264) (-1799.696) (-1794.200) [-1795.052] -- 0:04:33
399000 -- (-1796.806) (-1800.854) (-1802.051) [-1796.794] * (-1808.566) (-1796.542) (-1798.521) [-1802.027] -- 0:04:32
399500 -- (-1807.365) [-1792.230] (-1803.758) (-1797.516) * (-1797.884) (-1802.579) (-1803.687) [-1796.638] -- 0:04:33
400000 -- (-1797.073) (-1797.405) (-1799.107) [-1793.433] * (-1799.041) (-1808.773) (-1803.018) [-1787.621] -- 0:04:33
Average standard deviation of split frequencies: 0.007844
400500 -- (-1798.857) [-1789.747] (-1800.638) (-1802.512) * [-1795.812] (-1805.239) (-1811.518) (-1798.767) -- 0:04:32
401000 -- [-1794.770] (-1798.151) (-1794.228) (-1797.615) * [-1798.163] (-1799.399) (-1801.902) (-1801.837) -- 0:04:31
401500 -- (-1802.128) (-1807.466) [-1789.817] (-1797.415) * (-1816.800) (-1798.539) (-1799.109) [-1802.346] -- 0:04:32
402000 -- (-1797.295) [-1793.393] (-1797.598) (-1793.640) * [-1798.050] (-1801.884) (-1804.716) (-1792.052) -- 0:04:32
402500 -- [-1792.531] (-1797.222) (-1804.756) (-1794.054) * [-1794.572] (-1798.239) (-1800.048) (-1797.421) -- 0:04:31
403000 -- (-1793.641) (-1798.150) (-1794.735) [-1795.041] * (-1809.836) (-1801.305) [-1797.681] (-1799.459) -- 0:04:31
403500 -- (-1795.383) (-1803.100) [-1799.366] (-1800.741) * (-1801.066) [-1802.765] (-1795.189) (-1807.329) -- 0:04:30
404000 -- [-1799.347] (-1803.119) (-1795.683) (-1797.588) * (-1801.947) (-1798.516) [-1792.194] (-1793.186) -- 0:04:31
404500 -- (-1797.541) (-1799.363) (-1800.159) [-1800.416] * (-1802.869) (-1801.578) [-1798.279] (-1804.273) -- 0:04:30
405000 -- (-1792.602) (-1807.653) [-1805.855] (-1802.456) * (-1795.862) (-1815.694) [-1793.301] (-1792.873) -- 0:04:30
Average standard deviation of split frequencies: 0.007934
405500 -- [-1792.338] (-1801.771) (-1794.216) (-1804.747) * [-1797.587] (-1800.973) (-1797.654) (-1794.533) -- 0:04:29
406000 -- [-1789.721] (-1805.220) (-1795.895) (-1820.090) * [-1794.722] (-1798.965) (-1789.241) (-1794.181) -- 0:04:30
406500 -- [-1792.697] (-1806.695) (-1801.720) (-1794.466) * (-1803.137) (-1800.692) (-1797.161) [-1793.652] -- 0:04:30
407000 -- [-1793.529] (-1802.155) (-1802.251) (-1803.803) * (-1796.214) (-1797.410) [-1799.905] (-1799.480) -- 0:04:29
407500 -- (-1796.744) (-1791.125) (-1796.339) [-1797.717] * [-1793.300] (-1798.797) (-1809.320) (-1799.469) -- 0:04:28
408000 -- [-1794.501] (-1791.884) (-1802.928) (-1807.536) * (-1796.541) (-1807.370) [-1795.725] (-1796.626) -- 0:04:29
408500 -- (-1797.394) [-1793.922] (-1794.447) (-1809.122) * (-1800.456) (-1806.459) [-1797.190] (-1805.320) -- 0:04:29
409000 -- (-1794.658) [-1790.458] (-1806.820) (-1802.420) * [-1789.438] (-1795.775) (-1797.412) (-1812.649) -- 0:04:28
409500 -- [-1789.847] (-1804.570) (-1799.750) (-1802.852) * (-1798.987) [-1800.695] (-1793.628) (-1814.812) -- 0:04:28
410000 -- (-1802.613) (-1790.343) (-1793.940) [-1798.517] * (-1799.347) (-1800.990) [-1795.164] (-1810.314) -- 0:04:27
Average standard deviation of split frequencies: 0.007557
410500 -- (-1803.739) [-1803.324] (-1796.995) (-1791.833) * [-1792.692] (-1798.397) (-1798.236) (-1796.822) -- 0:04:28
411000 -- [-1800.413] (-1807.432) (-1792.007) (-1799.283) * [-1792.701] (-1797.531) (-1795.620) (-1794.857) -- 0:04:27
411500 -- [-1801.085] (-1806.489) (-1793.780) (-1796.602) * [-1801.863] (-1802.321) (-1794.237) (-1797.280) -- 0:04:27
412000 -- (-1799.182) (-1806.562) (-1798.794) [-1794.081] * [-1799.435] (-1804.615) (-1792.768) (-1801.346) -- 0:04:26
412500 -- (-1801.578) (-1797.617) [-1797.503] (-1799.511) * [-1801.124] (-1796.792) (-1793.661) (-1798.870) -- 0:04:27
413000 -- (-1804.221) (-1802.705) [-1794.749] (-1803.995) * (-1795.621) [-1802.632] (-1802.201) (-1796.832) -- 0:04:27
413500 -- (-1801.946) (-1796.521) [-1796.299] (-1791.062) * (-1792.270) [-1799.740] (-1800.759) (-1805.256) -- 0:04:26
414000 -- [-1798.046] (-1796.924) (-1792.474) (-1800.157) * (-1796.044) (-1796.681) (-1792.573) [-1790.801] -- 0:04:26
414500 -- (-1801.556) (-1806.951) (-1802.712) [-1791.698] * [-1799.428] (-1809.488) (-1795.370) (-1797.505) -- 0:04:25
415000 -- (-1800.585) (-1801.627) [-1790.768] (-1803.152) * (-1808.369) (-1806.921) [-1792.601] (-1792.652) -- 0:04:26
Average standard deviation of split frequencies: 0.007366
415500 -- (-1809.500) (-1800.539) (-1801.889) [-1800.766] * [-1803.577] (-1797.636) (-1804.075) (-1800.756) -- 0:04:25
416000 -- (-1803.156) (-1802.548) [-1800.202] (-1798.738) * (-1797.093) (-1800.514) (-1800.224) [-1794.559] -- 0:04:25
416500 -- [-1803.200] (-1794.595) (-1799.292) (-1792.253) * (-1803.959) [-1797.128] (-1807.305) (-1796.408) -- 0:04:24
417000 -- (-1810.479) [-1791.559] (-1801.036) (-1791.809) * [-1795.740] (-1796.519) (-1793.375) (-1806.311) -- 0:04:25
417500 -- (-1791.247) (-1797.079) (-1803.265) [-1788.913] * (-1803.019) [-1805.203] (-1797.588) (-1810.525) -- 0:04:25
418000 -- (-1804.139) (-1812.409) [-1795.359] (-1800.976) * (-1797.625) (-1806.103) [-1801.551] (-1806.636) -- 0:04:24
418500 -- (-1795.933) (-1798.550) [-1800.748] (-1808.937) * [-1796.868] (-1790.404) (-1797.698) (-1796.957) -- 0:04:24
419000 -- (-1794.090) [-1794.085] (-1796.552) (-1802.681) * (-1801.738) [-1797.604] (-1815.456) (-1800.653) -- 0:04:24
419500 -- (-1798.248) (-1799.847) (-1798.427) [-1792.058] * [-1799.219] (-1798.496) (-1800.517) (-1801.320) -- 0:04:24
420000 -- (-1802.431) (-1796.511) (-1797.382) [-1793.175] * (-1800.654) (-1801.432) (-1808.955) [-1798.122] -- 0:04:23
Average standard deviation of split frequencies: 0.007377
420500 -- (-1794.689) (-1799.863) [-1805.844] (-1800.286) * (-1803.580) [-1797.415] (-1794.953) (-1801.691) -- 0:04:23
421000 -- (-1802.978) (-1807.280) (-1800.225) [-1800.620] * (-1804.899) (-1794.202) (-1794.936) [-1795.814] -- 0:04:24
421500 -- [-1793.247] (-1797.693) (-1792.840) (-1796.897) * (-1798.052) (-1796.360) [-1791.226] (-1794.142) -- 0:04:23
422000 -- (-1793.757) [-1798.057] (-1803.595) (-1796.328) * [-1797.642] (-1799.882) (-1799.262) (-1801.788) -- 0:04:22
422500 -- [-1797.797] (-1806.154) (-1798.394) (-1794.598) * [-1796.934] (-1797.037) (-1794.806) (-1798.016) -- 0:04:22
423000 -- (-1792.088) (-1793.808) [-1790.570] (-1791.709) * (-1801.361) (-1796.418) [-1794.560] (-1807.885) -- 0:04:21
423500 -- (-1796.403) (-1794.818) [-1795.668] (-1794.479) * [-1796.137] (-1803.752) (-1795.319) (-1803.130) -- 0:04:22
424000 -- [-1796.435] (-1798.331) (-1797.641) (-1795.079) * (-1792.998) (-1792.895) [-1792.849] (-1803.812) -- 0:04:22
424500 -- (-1800.668) (-1796.921) [-1794.416] (-1797.383) * (-1804.580) (-1803.676) (-1794.818) [-1800.931] -- 0:04:21
425000 -- [-1795.161] (-1809.759) (-1806.973) (-1795.565) * (-1809.150) [-1796.136] (-1801.597) (-1797.893) -- 0:04:21
Average standard deviation of split frequencies: 0.007285
425500 -- (-1807.220) [-1796.247] (-1807.681) (-1804.266) * (-1810.770) (-1805.281) [-1795.484] (-1788.552) -- 0:04:21
426000 -- (-1801.257) (-1798.767) (-1798.522) [-1793.001] * (-1807.945) [-1798.194] (-1796.730) (-1795.539) -- 0:04:21
426500 -- (-1798.077) [-1796.589] (-1807.071) (-1798.549) * (-1809.256) (-1806.926) [-1797.087] (-1815.995) -- 0:04:20
427000 -- [-1807.511] (-1806.932) (-1799.695) (-1805.042) * [-1801.287] (-1800.801) (-1803.268) (-1797.980) -- 0:04:20
427500 -- (-1796.658) (-1812.144) (-1798.173) [-1794.949] * (-1821.609) (-1807.105) [-1802.715] (-1800.924) -- 0:04:19
428000 -- (-1797.422) (-1797.301) [-1790.784] (-1812.725) * (-1799.062) [-1791.108] (-1795.723) (-1804.010) -- 0:04:20
428500 -- [-1797.691] (-1794.609) (-1793.156) (-1806.110) * (-1805.595) [-1796.198] (-1796.472) (-1801.842) -- 0:04:20
429000 -- [-1795.158] (-1799.339) (-1809.523) (-1796.903) * [-1799.527] (-1800.711) (-1794.281) (-1790.964) -- 0:04:19
429500 -- (-1796.735) (-1794.514) (-1801.064) [-1814.699] * (-1804.336) [-1800.753] (-1800.886) (-1794.593) -- 0:04:19
430000 -- (-1790.979) (-1799.657) [-1800.648] (-1797.964) * (-1800.318) [-1791.740] (-1809.131) (-1796.929) -- 0:04:19
Average standard deviation of split frequencies: 0.006203
430500 -- (-1796.005) (-1791.832) [-1795.678] (-1805.238) * [-1805.640] (-1800.049) (-1801.952) (-1802.331) -- 0:04:19
431000 -- (-1804.876) (-1799.451) (-1790.136) [-1799.599] * (-1805.171) (-1793.199) (-1803.299) [-1794.684] -- 0:04:18
431500 -- (-1810.888) (-1808.437) [-1795.209] (-1796.910) * [-1793.562] (-1804.757) (-1807.039) (-1786.516) -- 0:04:18
432000 -- (-1807.079) (-1794.785) [-1793.735] (-1796.678) * (-1797.785) (-1806.663) (-1817.918) [-1801.358] -- 0:04:19
432500 -- [-1801.271] (-1804.239) (-1803.946) (-1794.455) * (-1800.603) (-1806.975) (-1808.003) [-1802.100] -- 0:04:18
433000 -- [-1797.930] (-1802.855) (-1807.655) (-1794.694) * (-1788.053) (-1808.914) [-1805.525] (-1802.023) -- 0:04:17
433500 -- [-1792.945] (-1791.254) (-1792.498) (-1805.577) * [-1795.113] (-1806.290) (-1803.702) (-1805.118) -- 0:04:17
434000 -- [-1794.930] (-1807.457) (-1794.924) (-1802.371) * (-1803.345) (-1802.063) (-1797.723) [-1802.102] -- 0:04:16
434500 -- (-1799.982) [-1797.894] (-1797.992) (-1796.819) * [-1793.192] (-1802.178) (-1807.775) (-1800.910) -- 0:04:17
435000 -- (-1800.816) [-1797.456] (-1792.954) (-1816.068) * (-1792.439) [-1805.133] (-1807.942) (-1798.615) -- 0:04:17
Average standard deviation of split frequencies: 0.006487
435500 -- (-1796.225) [-1796.077] (-1803.066) (-1798.436) * [-1799.221] (-1798.495) (-1805.223) (-1793.308) -- 0:04:16
436000 -- (-1799.210) [-1798.911] (-1794.802) (-1806.538) * (-1796.599) (-1790.363) (-1797.726) [-1795.897] -- 0:04:16
436500 -- [-1792.376] (-1796.915) (-1795.787) (-1801.882) * (-1806.220) [-1793.087] (-1816.405) (-1795.030) -- 0:04:16
437000 -- (-1797.748) (-1794.726) (-1798.366) [-1804.841] * (-1804.764) (-1809.580) [-1802.749] (-1801.897) -- 0:04:16
437500 -- [-1788.111] (-1792.312) (-1808.842) (-1799.877) * (-1794.797) [-1803.299] (-1799.539) (-1794.721) -- 0:04:15
438000 -- (-1793.421) (-1798.032) (-1799.455) [-1793.827] * [-1795.375] (-1794.280) (-1792.273) (-1802.047) -- 0:04:15
438500 -- [-1789.181] (-1805.742) (-1804.597) (-1791.990) * (-1792.585) (-1796.217) [-1796.077] (-1798.629) -- 0:04:16
439000 -- (-1805.513) (-1801.507) (-1801.072) [-1799.483] * (-1801.293) (-1797.580) [-1798.008] (-1800.413) -- 0:04:15
439500 -- (-1800.422) [-1796.062] (-1789.994) (-1802.866) * [-1796.996] (-1799.551) (-1800.586) (-1798.433) -- 0:04:15
440000 -- (-1806.195) [-1796.220] (-1812.900) (-1797.590) * (-1799.941) (-1797.116) (-1813.466) [-1799.120] -- 0:04:14
Average standard deviation of split frequencies: 0.006329
440500 -- (-1804.353) (-1804.871) (-1800.734) [-1793.208] * [-1800.377] (-1800.690) (-1812.059) (-1790.187) -- 0:04:14
441000 -- (-1795.193) (-1806.953) [-1803.365] (-1796.346) * [-1798.874] (-1798.642) (-1797.172) (-1797.675) -- 0:04:14
441500 -- [-1805.065] (-1801.294) (-1806.515) (-1804.274) * (-1800.523) (-1795.771) [-1799.797] (-1796.607) -- 0:04:14
442000 -- (-1799.828) (-1801.916) [-1793.580] (-1796.382) * (-1801.698) (-1798.616) (-1790.077) [-1806.537] -- 0:04:13
442500 -- (-1797.400) (-1802.437) [-1801.728] (-1802.943) * (-1795.528) (-1802.327) (-1807.649) [-1794.524] -- 0:04:13
443000 -- (-1799.411) (-1794.122) (-1792.683) [-1794.509] * (-1793.420) (-1806.071) (-1796.565) [-1799.821] -- 0:04:13
443500 -- (-1796.376) [-1793.331] (-1797.120) (-1792.998) * (-1793.539) (-1792.506) (-1792.565) [-1792.852] -- 0:04:13
444000 -- [-1798.485] (-1798.490) (-1800.753) (-1804.183) * (-1795.431) (-1796.674) (-1797.289) [-1799.805] -- 0:04:12
444500 -- [-1793.976] (-1802.165) (-1813.313) (-1801.442) * (-1800.704) [-1800.910] (-1787.962) (-1799.266) -- 0:04:12
445000 -- [-1808.286] (-1805.358) (-1802.355) (-1800.314) * (-1808.462) [-1795.022] (-1805.421) (-1793.896) -- 0:04:11
Average standard deviation of split frequencies: 0.006606
445500 -- [-1800.582] (-1801.996) (-1808.096) (-1798.157) * (-1803.687) (-1804.170) (-1798.953) [-1795.938] -- 0:04:12
446000 -- (-1801.370) [-1797.690] (-1798.364) (-1796.406) * [-1801.104] (-1810.180) (-1800.954) (-1809.464) -- 0:04:12
446500 -- (-1796.081) [-1798.260] (-1806.068) (-1798.396) * [-1793.734] (-1802.380) (-1798.255) (-1798.218) -- 0:04:11
447000 -- (-1796.106) [-1793.945] (-1802.551) (-1803.825) * (-1805.845) [-1796.326] (-1793.313) (-1794.156) -- 0:04:11
447500 -- (-1805.536) [-1799.563] (-1811.003) (-1797.513) * (-1804.476) (-1792.118) (-1799.788) [-1796.954] -- 0:04:11
448000 -- [-1795.099] (-1794.975) (-1795.953) (-1799.158) * [-1799.067] (-1798.595) (-1800.217) (-1803.141) -- 0:04:11
448500 -- (-1797.154) (-1805.982) [-1803.157] (-1802.850) * (-1803.807) (-1793.915) [-1794.428] (-1801.630) -- 0:04:10
449000 -- [-1794.228] (-1800.287) (-1803.835) (-1802.768) * (-1797.430) (-1798.257) [-1793.213] (-1790.506) -- 0:04:10
449500 -- (-1803.753) [-1799.887] (-1805.636) (-1810.708) * (-1794.255) [-1802.737] (-1793.300) (-1809.598) -- 0:04:11
450000 -- (-1790.999) (-1806.541) [-1794.025] (-1803.238) * [-1797.764] (-1801.907) (-1796.292) (-1801.466) -- 0:04:10
Average standard deviation of split frequencies: 0.005927
450500 -- [-1807.174] (-1802.943) (-1796.165) (-1803.374) * (-1794.164) (-1795.486) [-1794.888] (-1795.734) -- 0:04:10
451000 -- [-1809.892] (-1807.613) (-1793.904) (-1805.026) * (-1802.965) [-1799.794] (-1794.657) (-1789.427) -- 0:04:09
451500 -- [-1789.297] (-1801.163) (-1798.694) (-1803.533) * [-1800.970] (-1801.954) (-1805.830) (-1794.312) -- 0:04:09
452000 -- (-1800.472) (-1801.539) (-1809.927) [-1804.248] * (-1795.051) (-1801.641) (-1808.585) [-1795.719] -- 0:04:09
452500 -- (-1795.253) (-1791.327) (-1801.352) [-1801.194] * (-1799.947) (-1803.248) (-1803.879) [-1796.631] -- 0:04:09
453000 -- (-1801.510) (-1799.080) (-1799.461) [-1793.888] * [-1784.980] (-1795.151) (-1796.893) (-1797.637) -- 0:04:08
453500 -- (-1801.122) (-1806.756) (-1809.602) [-1800.741] * (-1792.950) (-1798.922) [-1798.859] (-1798.228) -- 0:04:08
454000 -- [-1793.167] (-1810.184) (-1800.565) (-1807.324) * [-1796.791] (-1799.377) (-1794.671) (-1793.705) -- 0:04:08
454500 -- (-1790.702) (-1808.458) (-1800.422) [-1795.748] * (-1793.251) (-1807.160) (-1797.753) [-1801.075] -- 0:04:08
455000 -- (-1796.917) [-1804.688] (-1798.369) (-1810.101) * (-1800.824) (-1800.945) (-1799.911) [-1793.663] -- 0:04:07
Average standard deviation of split frequencies: 0.006547
455500 -- [-1794.002] (-1796.812) (-1793.818) (-1805.432) * (-1812.509) [-1799.291] (-1803.679) (-1799.035) -- 0:04:07
456000 -- (-1794.693) (-1800.484) [-1800.808] (-1797.734) * (-1803.087) [-1800.004] (-1795.393) (-1803.374) -- 0:04:06
456500 -- [-1793.210] (-1803.116) (-1793.524) (-1791.867) * (-1795.786) (-1798.122) [-1796.932] (-1799.780) -- 0:04:07
457000 -- (-1797.283) (-1793.672) (-1792.937) [-1786.973] * (-1809.534) (-1799.438) (-1796.854) [-1810.590] -- 0:04:07
457500 -- (-1798.482) [-1792.398] (-1800.203) (-1810.522) * (-1794.159) (-1801.561) [-1800.394] (-1807.963) -- 0:04:06
458000 -- (-1794.988) (-1800.213) [-1795.538] (-1807.913) * [-1795.254] (-1802.392) (-1797.451) (-1795.334) -- 0:04:06
458500 -- (-1794.019) (-1803.729) [-1804.779] (-1799.287) * (-1802.376) (-1805.745) (-1796.384) [-1801.915] -- 0:04:06
459000 -- (-1801.915) (-1815.484) [-1797.084] (-1808.642) * (-1789.934) [-1796.043] (-1800.891) (-1795.067) -- 0:04:06
459500 -- [-1799.361] (-1810.279) (-1809.809) (-1799.321) * (-1807.683) (-1800.869) (-1795.263) [-1799.373] -- 0:04:05
460000 -- (-1794.755) (-1809.843) [-1799.093] (-1794.899) * (-1804.195) [-1801.806] (-1795.313) (-1794.391) -- 0:04:05
Average standard deviation of split frequencies: 0.007334
460500 -- (-1796.948) (-1813.920) (-1795.414) [-1790.844] * (-1796.130) [-1786.430] (-1803.956) (-1792.888) -- 0:04:06
461000 -- (-1800.564) (-1791.960) [-1787.847] (-1797.644) * (-1799.839) (-1795.926) (-1801.159) [-1797.188] -- 0:04:05
461500 -- (-1796.217) (-1799.703) [-1804.434] (-1801.568) * (-1795.685) [-1786.146] (-1816.199) (-1794.744) -- 0:04:05
462000 -- (-1794.252) (-1798.050) [-1804.323] (-1795.873) * [-1801.464] (-1793.345) (-1804.106) (-1805.269) -- 0:04:04
462500 -- (-1800.772) [-1804.008] (-1804.978) (-1801.705) * (-1814.931) [-1793.884] (-1813.721) (-1798.214) -- 0:04:04
463000 -- [-1788.212] (-1789.837) (-1808.500) (-1805.563) * (-1799.274) (-1800.386) (-1817.408) [-1798.891] -- 0:04:04
463500 -- (-1790.710) (-1794.937) [-1797.154] (-1794.064) * (-1809.006) (-1805.337) (-1802.743) [-1805.133] -- 0:04:04
464000 -- (-1795.428) (-1802.650) [-1794.738] (-1796.840) * (-1804.597) (-1814.577) [-1797.523] (-1800.949) -- 0:04:03
464500 -- (-1807.484) [-1799.311] (-1810.158) (-1794.124) * (-1803.140) (-1807.437) [-1803.112] (-1801.966) -- 0:04:03
465000 -- (-1821.695) (-1796.328) [-1801.447] (-1800.293) * (-1804.807) [-1798.544] (-1794.211) (-1804.538) -- 0:04:03
Average standard deviation of split frequencies: 0.006660
465500 -- (-1802.505) (-1797.199) (-1815.861) [-1791.739] * (-1804.128) [-1799.325] (-1797.875) (-1802.742) -- 0:04:03
466000 -- (-1799.402) [-1800.834] (-1813.472) (-1808.593) * (-1820.598) [-1800.867] (-1802.018) (-1814.510) -- 0:04:02
466500 -- (-1799.901) [-1796.330] (-1798.192) (-1806.534) * (-1805.123) (-1806.409) [-1801.621] (-1806.134) -- 0:04:02
467000 -- [-1793.507] (-1796.338) (-1798.117) (-1794.734) * (-1804.472) [-1793.268] (-1802.117) (-1802.814) -- 0:04:01
467500 -- [-1797.140] (-1793.577) (-1800.394) (-1809.350) * (-1807.859) (-1793.899) [-1804.125] (-1809.221) -- 0:04:02
468000 -- (-1795.901) (-1802.265) (-1799.709) [-1796.566] * (-1791.469) (-1803.732) [-1792.672] (-1800.507) -- 0:04:02
468500 -- (-1798.941) [-1800.284] (-1792.765) (-1800.337) * (-1801.708) [-1799.060] (-1793.525) (-1812.142) -- 0:04:01
469000 -- (-1802.060) (-1799.702) (-1790.693) [-1806.382] * (-1801.058) [-1801.986] (-1794.218) (-1807.064) -- 0:04:01
469500 -- [-1801.679] (-1801.122) (-1801.614) (-1797.971) * (-1804.110) (-1806.425) (-1800.756) [-1798.933] -- 0:04:01
470000 -- [-1816.384] (-1799.216) (-1798.403) (-1808.908) * (-1800.155) [-1798.239] (-1802.715) (-1798.775) -- 0:04:01
Average standard deviation of split frequencies: 0.006928
470500 -- (-1806.699) (-1791.512) [-1795.705] (-1803.476) * (-1797.032) [-1801.657] (-1801.733) (-1803.505) -- 0:04:00
471000 -- (-1806.137) (-1799.064) [-1795.558] (-1795.175) * (-1799.105) [-1805.912] (-1792.198) (-1802.972) -- 0:04:00
471500 -- (-1805.567) [-1798.809] (-1807.424) (-1803.542) * (-1800.301) (-1799.198) [-1790.001] (-1795.404) -- 0:03:59
472000 -- (-1800.975) (-1804.199) (-1801.099) [-1796.700] * [-1799.967] (-1796.723) (-1800.221) (-1801.706) -- 0:04:00
472500 -- [-1793.775] (-1800.286) (-1809.362) (-1798.756) * [-1800.854] (-1791.956) (-1798.225) (-1797.909) -- 0:04:00
473000 -- [-1795.222] (-1800.254) (-1814.020) (-1811.334) * (-1805.137) (-1799.781) [-1795.513] (-1804.376) -- 0:03:59
473500 -- [-1795.856] (-1805.012) (-1804.784) (-1801.749) * [-1794.279] (-1812.665) (-1818.517) (-1802.579) -- 0:03:59
474000 -- [-1788.432] (-1808.686) (-1804.447) (-1803.956) * [-1792.641] (-1808.995) (-1798.543) (-1818.404) -- 0:03:59
474500 -- (-1797.318) (-1804.140) [-1794.450] (-1798.389) * [-1797.943] (-1796.027) (-1804.747) (-1805.882) -- 0:03:59
475000 -- (-1798.358) (-1800.672) [-1800.676] (-1796.667) * (-1796.138) (-1807.922) [-1801.408] (-1805.370) -- 0:03:58
Average standard deviation of split frequencies: 0.006602
475500 -- (-1800.333) [-1801.709] (-1797.139) (-1793.725) * (-1797.144) (-1812.224) (-1800.653) [-1793.067] -- 0:03:58
476000 -- [-1790.499] (-1800.944) (-1798.861) (-1799.784) * (-1794.258) (-1806.658) (-1802.364) [-1790.212] -- 0:03:58
476500 -- (-1794.311) [-1791.557] (-1791.695) (-1812.496) * (-1797.571) (-1802.406) (-1795.999) [-1798.646] -- 0:03:58
477000 -- (-1797.391) [-1789.500] (-1804.459) (-1803.465) * (-1793.304) (-1806.226) [-1799.489] (-1795.284) -- 0:03:57
477500 -- (-1794.396) (-1803.283) (-1799.345) [-1789.022] * (-1803.886) (-1804.318) [-1795.342] (-1800.658) -- 0:03:57
478000 -- [-1792.505] (-1793.491) (-1791.662) (-1803.464) * (-1804.041) [-1803.542] (-1800.818) (-1798.245) -- 0:03:56
478500 -- (-1804.023) [-1797.031] (-1796.931) (-1796.617) * (-1792.878) (-1804.249) [-1788.351] (-1807.380) -- 0:03:57
479000 -- (-1798.207) [-1796.874] (-1794.091) (-1805.333) * (-1799.514) [-1794.947] (-1805.126) (-1805.897) -- 0:03:57
479500 -- [-1794.913] (-1800.563) (-1794.453) (-1805.305) * (-1802.851) (-1804.159) (-1805.265) [-1796.553] -- 0:03:56
480000 -- (-1802.202) (-1806.209) [-1788.679] (-1794.386) * (-1791.198) (-1804.533) (-1806.480) [-1809.840] -- 0:03:56
Average standard deviation of split frequencies: 0.006702
480500 -- [-1798.590] (-1805.198) (-1798.968) (-1797.665) * (-1797.881) [-1793.497] (-1798.527) (-1801.171) -- 0:03:56
481000 -- [-1791.675] (-1804.323) (-1796.126) (-1796.327) * (-1801.729) (-1799.494) [-1797.887] (-1796.963) -- 0:03:56
481500 -- [-1795.492] (-1808.007) (-1796.376) (-1797.852) * (-1812.309) (-1802.116) [-1792.956] (-1801.048) -- 0:03:55
482000 -- [-1794.779] (-1801.216) (-1802.355) (-1790.239) * (-1798.805) (-1798.442) [-1794.990] (-1797.307) -- 0:03:55
482500 -- [-1794.349] (-1801.219) (-1799.608) (-1794.419) * (-1802.127) [-1804.779] (-1795.688) (-1812.154) -- 0:03:54
483000 -- (-1808.023) (-1803.312) [-1802.678] (-1793.792) * [-1793.665] (-1801.530) (-1794.780) (-1803.828) -- 0:03:55
483500 -- [-1795.741] (-1805.778) (-1801.136) (-1795.506) * (-1799.227) (-1790.326) (-1797.680) [-1807.404] -- 0:03:55
484000 -- [-1793.720] (-1811.587) (-1794.331) (-1805.679) * (-1798.399) (-1795.915) (-1805.123) [-1794.196] -- 0:03:54
484500 -- (-1793.972) (-1810.466) [-1794.641] (-1799.266) * (-1801.216) (-1799.819) (-1806.293) [-1800.339] -- 0:03:54
485000 -- [-1800.473] (-1804.266) (-1800.767) (-1796.975) * [-1794.047] (-1802.081) (-1801.413) (-1811.035) -- 0:03:54
Average standard deviation of split frequencies: 0.007032
485500 -- (-1804.363) (-1800.316) [-1796.222] (-1801.198) * [-1793.647] (-1801.231) (-1809.092) (-1801.222) -- 0:03:54
486000 -- (-1798.160) [-1795.580] (-1803.085) (-1803.133) * (-1805.665) (-1806.479) [-1797.193] (-1799.305) -- 0:03:53
486500 -- (-1805.218) (-1798.505) [-1793.959] (-1800.969) * (-1794.937) (-1801.883) [-1796.869] (-1799.893) -- 0:03:53
487000 -- (-1793.825) (-1803.517) [-1807.001] (-1804.783) * (-1795.618) [-1791.171] (-1800.636) (-1800.086) -- 0:03:53
487500 -- (-1811.244) [-1802.867] (-1804.496) (-1794.211) * [-1785.905] (-1807.097) (-1799.524) (-1797.243) -- 0:03:53
488000 -- (-1799.943) (-1804.849) [-1800.673] (-1807.029) * (-1805.022) (-1793.080) [-1792.807] (-1800.181) -- 0:03:52
488500 -- [-1795.983] (-1801.685) (-1791.033) (-1803.795) * [-1801.868] (-1803.546) (-1793.862) (-1799.688) -- 0:03:52
489000 -- (-1798.377) [-1796.803] (-1792.237) (-1799.115) * [-1804.632] (-1798.190) (-1794.720) (-1800.067) -- 0:03:51
489500 -- (-1801.521) (-1801.077) (-1805.575) [-1798.830] * (-1796.136) [-1800.798] (-1803.752) (-1801.627) -- 0:03:52
490000 -- (-1801.298) [-1792.981] (-1805.484) (-1801.042) * (-1801.737) (-1794.358) (-1794.734) [-1805.343] -- 0:03:52
Average standard deviation of split frequencies: 0.006565
490500 -- (-1807.532) [-1802.759] (-1800.170) (-1806.482) * (-1806.539) [-1794.453] (-1794.512) (-1814.667) -- 0:03:51
491000 -- (-1816.498) [-1794.029] (-1800.802) (-1796.710) * (-1795.368) (-1807.122) [-1796.218] (-1806.404) -- 0:03:51
491500 -- (-1806.955) [-1791.833] (-1801.317) (-1806.422) * [-1797.097] (-1796.023) (-1797.079) (-1802.758) -- 0:03:51
492000 -- [-1794.486] (-1795.708) (-1800.239) (-1810.429) * (-1806.108) (-1802.658) [-1793.444] (-1812.472) -- 0:03:51
492500 -- [-1790.360] (-1805.600) (-1807.278) (-1808.440) * (-1798.716) (-1799.487) (-1792.107) [-1799.300] -- 0:03:50
493000 -- (-1800.266) (-1804.925) [-1802.433] (-1808.566) * (-1805.972) (-1792.893) [-1802.929] (-1805.734) -- 0:03:50
493500 -- (-1797.302) (-1813.540) [-1794.946] (-1810.639) * [-1798.944] (-1799.984) (-1794.898) (-1816.192) -- 0:03:49
494000 -- (-1796.955) (-1811.974) [-1789.054] (-1808.121) * (-1808.803) (-1794.018) [-1790.199] (-1803.168) -- 0:03:50
494500 -- (-1797.024) (-1793.745) (-1807.626) [-1800.254] * [-1802.858] (-1794.832) (-1800.131) (-1798.735) -- 0:03:50
495000 -- (-1806.541) (-1806.047) (-1820.464) [-1797.675] * (-1795.546) [-1793.007] (-1797.787) (-1802.798) -- 0:03:49
Average standard deviation of split frequencies: 0.006970
495500 -- (-1798.923) (-1800.161) (-1796.501) [-1801.856] * [-1794.924] (-1788.744) (-1799.422) (-1807.343) -- 0:03:49
496000 -- [-1793.127] (-1803.440) (-1800.502) (-1794.663) * [-1798.232] (-1801.167) (-1810.736) (-1811.589) -- 0:03:49
496500 -- (-1798.498) (-1798.435) [-1799.222] (-1809.643) * [-1787.888] (-1794.696) (-1801.933) (-1806.325) -- 0:03:49
497000 -- (-1797.045) (-1801.138) [-1801.954] (-1801.080) * (-1789.119) (-1806.067) [-1798.909] (-1802.177) -- 0:03:48
497500 -- [-1796.876] (-1798.200) (-1801.492) (-1801.011) * [-1799.201] (-1801.474) (-1795.918) (-1804.730) -- 0:03:48
498000 -- (-1800.500) (-1799.106) (-1799.650) [-1795.105] * (-1797.055) [-1799.285] (-1799.995) (-1804.488) -- 0:03:47
498500 -- [-1793.025] (-1794.733) (-1797.512) (-1794.827) * [-1793.986] (-1799.439) (-1811.229) (-1794.597) -- 0:03:48
499000 -- (-1791.142) (-1795.633) (-1802.840) [-1799.837] * (-1800.545) [-1794.822] (-1799.315) (-1803.545) -- 0:03:47
499500 -- (-1792.173) (-1799.163) (-1793.957) [-1802.055] * (-1798.526) [-1793.125] (-1804.018) (-1808.815) -- 0:03:47
500000 -- [-1802.038] (-1802.859) (-1808.900) (-1799.951) * (-1797.229) (-1800.918) [-1796.229] (-1804.139) -- 0:03:47
Average standard deviation of split frequencies: 0.006748
500500 -- [-1801.994] (-1798.552) (-1800.509) (-1794.680) * (-1803.212) (-1801.665) (-1797.869) [-1803.774] -- 0:03:47
501000 -- (-1803.435) (-1798.549) [-1796.603] (-1795.572) * [-1792.450] (-1792.987) (-1793.119) (-1804.177) -- 0:03:47
501500 -- (-1791.422) (-1800.855) [-1802.206] (-1799.128) * (-1790.607) (-1791.067) [-1800.402] (-1796.114) -- 0:03:46
502000 -- (-1789.604) (-1803.219) [-1789.765] (-1800.448) * (-1792.682) [-1798.724] (-1802.768) (-1806.515) -- 0:03:46
502500 -- (-1796.190) (-1787.440) [-1795.092] (-1796.795) * (-1798.158) (-1789.130) (-1807.282) [-1798.581] -- 0:03:46
503000 -- (-1796.035) (-1798.530) (-1796.315) [-1800.528] * [-1794.064] (-1797.122) (-1807.423) (-1804.302) -- 0:03:46
503500 -- (-1786.727) (-1800.122) (-1795.538) [-1796.410] * [-1793.668] (-1799.747) (-1801.356) (-1803.505) -- 0:03:45
504000 -- (-1808.710) [-1795.149] (-1794.045) (-1799.061) * (-1797.948) (-1793.278) [-1797.129] (-1795.820) -- 0:03:45
504500 -- [-1794.061] (-1799.379) (-1797.694) (-1799.257) * [-1794.766] (-1798.883) (-1798.697) (-1796.716) -- 0:03:44
505000 -- (-1791.062) (-1798.658) [-1799.954] (-1796.003) * (-1805.419) (-1801.629) (-1802.894) [-1800.201] -- 0:03:45
Average standard deviation of split frequencies: 0.006444
505500 -- (-1805.065) (-1804.607) (-1796.803) [-1796.645] * (-1799.866) [-1786.635] (-1792.535) (-1790.662) -- 0:03:44
506000 -- (-1798.981) [-1801.805] (-1796.088) (-1804.934) * (-1808.375) (-1814.958) [-1803.137] (-1791.851) -- 0:03:44
506500 -- [-1798.830] (-1805.797) (-1813.801) (-1790.390) * [-1786.687] (-1800.958) (-1802.613) (-1796.055) -- 0:03:44
507000 -- (-1797.132) (-1797.795) [-1800.754] (-1800.121) * [-1792.323] (-1793.441) (-1801.297) (-1803.973) -- 0:03:44
507500 -- (-1796.708) [-1796.504] (-1799.084) (-1792.590) * (-1801.904) (-1803.339) (-1809.218) [-1793.598] -- 0:03:44
508000 -- (-1807.766) (-1792.546) (-1805.866) [-1796.099] * (-1790.234) (-1799.180) (-1803.942) [-1799.886] -- 0:03:43
508500 -- (-1795.755) [-1798.920] (-1811.303) (-1802.030) * (-1800.841) (-1801.735) (-1792.138) [-1795.330] -- 0:03:43
509000 -- (-1791.597) (-1805.260) [-1796.063] (-1793.657) * (-1794.627) (-1804.396) (-1808.678) [-1796.018] -- 0:03:42
509500 -- (-1795.933) (-1798.416) (-1810.902) [-1797.593] * (-1803.852) (-1801.263) [-1799.107] (-1809.690) -- 0:03:43
510000 -- (-1795.756) (-1802.870) (-1810.027) [-1795.167] * [-1802.037] (-1805.859) (-1795.119) (-1799.023) -- 0:03:42
Average standard deviation of split frequencies: 0.006077
510500 -- [-1794.610] (-1795.530) (-1800.228) (-1792.949) * (-1804.735) (-1804.419) (-1795.396) [-1801.389] -- 0:03:42
511000 -- (-1794.481) (-1798.451) (-1805.563) [-1789.090] * (-1795.497) [-1793.598] (-1800.623) (-1809.997) -- 0:03:42
511500 -- (-1802.497) [-1791.391] (-1803.285) (-1799.003) * (-1803.742) (-1794.504) [-1795.545] (-1803.444) -- 0:03:42
512000 -- [-1799.812] (-1800.408) (-1800.043) (-1796.977) * [-1796.381] (-1797.573) (-1803.125) (-1796.373) -- 0:03:42
512500 -- (-1795.233) (-1795.564) [-1800.621] (-1805.943) * (-1798.724) (-1795.409) (-1801.152) [-1793.555] -- 0:03:41
513000 -- (-1798.060) (-1797.112) (-1814.733) [-1792.442] * (-1808.499) [-1795.293] (-1803.242) (-1795.026) -- 0:03:41
513500 -- (-1800.027) [-1795.823] (-1798.285) (-1795.902) * [-1807.199] (-1799.610) (-1793.307) (-1798.829) -- 0:03:41
514000 -- (-1799.455) (-1800.052) (-1796.267) [-1800.617] * (-1799.040) (-1794.401) [-1795.645] (-1793.157) -- 0:03:41
514500 -- (-1799.266) (-1805.343) (-1800.522) [-1790.905] * (-1800.502) (-1794.272) (-1800.422) [-1790.100] -- 0:03:40
515000 -- (-1798.685) [-1803.430] (-1808.689) (-1799.311) * (-1799.196) [-1797.251] (-1803.868) (-1793.079) -- 0:03:40
Average standard deviation of split frequencies: 0.006547
515500 -- [-1799.624] (-1798.453) (-1808.230) (-1811.880) * (-1795.285) (-1803.703) [-1795.522] (-1805.040) -- 0:03:39
516000 -- [-1797.950] (-1798.156) (-1806.411) (-1799.979) * (-1805.421) [-1800.268] (-1801.649) (-1799.787) -- 0:03:40
516500 -- [-1805.878] (-1793.786) (-1798.920) (-1805.747) * (-1802.060) [-1793.025] (-1805.895) (-1798.689) -- 0:03:39
517000 -- (-1807.018) (-1793.157) (-1794.518) [-1795.189] * [-1793.709] (-1798.147) (-1808.935) (-1801.322) -- 0:03:39
517500 -- (-1801.848) (-1793.405) [-1790.234] (-1808.767) * (-1793.886) (-1798.300) (-1809.798) [-1790.595] -- 0:03:39
518000 -- (-1800.040) (-1808.307) (-1795.293) [-1800.852] * (-1806.112) [-1798.629] (-1815.876) (-1799.060) -- 0:03:39
518500 -- (-1795.964) (-1808.862) [-1798.039] (-1796.086) * [-1797.865] (-1799.349) (-1808.286) (-1798.443) -- 0:03:39
519000 -- (-1793.990) [-1797.087] (-1799.655) (-1792.915) * [-1789.617] (-1804.223) (-1823.383) (-1804.386) -- 0:03:38
519500 -- (-1793.089) (-1796.023) (-1808.035) [-1790.534] * [-1800.066] (-1795.076) (-1807.144) (-1798.915) -- 0:03:38
520000 -- (-1801.923) (-1795.559) (-1794.382) [-1794.820] * (-1796.795) (-1802.866) (-1798.378) [-1806.119] -- 0:03:37
Average standard deviation of split frequencies: 0.006036
520500 -- (-1796.496) (-1800.386) [-1799.371] (-1797.490) * (-1802.253) (-1799.639) [-1801.823] (-1803.037) -- 0:03:38
521000 -- (-1795.427) [-1797.853] (-1803.938) (-1802.650) * (-1800.598) (-1807.026) [-1799.426] (-1794.339) -- 0:03:37
521500 -- (-1814.646) [-1790.122] (-1798.802) (-1800.892) * (-1798.870) (-1808.331) [-1804.597] (-1810.550) -- 0:03:37
522000 -- (-1799.517) (-1804.234) [-1795.801] (-1802.959) * (-1805.823) (-1802.424) [-1795.098] (-1795.387) -- 0:03:37
522500 -- (-1800.554) (-1809.954) (-1798.491) [-1796.027] * (-1802.584) (-1804.224) [-1799.258] (-1791.881) -- 0:03:37
523000 -- (-1800.286) (-1814.799) [-1795.533] (-1798.872) * (-1803.401) (-1809.273) (-1803.177) [-1796.458] -- 0:03:37
523500 -- (-1793.444) [-1802.646] (-1791.082) (-1795.567) * [-1792.065] (-1805.622) (-1804.088) (-1789.595) -- 0:03:36
524000 -- (-1804.621) (-1803.207) (-1798.585) [-1798.464] * [-1796.626] (-1803.771) (-1819.064) (-1797.255) -- 0:03:36
524500 -- (-1797.737) (-1801.183) (-1792.109) [-1792.938] * (-1798.693) [-1797.469] (-1804.397) (-1799.363) -- 0:03:35
525000 -- (-1796.575) (-1819.104) [-1804.848] (-1790.100) * [-1798.452] (-1795.719) (-1805.540) (-1796.660) -- 0:03:36
Average standard deviation of split frequencies: 0.006273
525500 -- (-1803.763) (-1802.533) (-1802.975) [-1793.979] * (-1802.028) (-1798.118) (-1801.988) [-1796.005] -- 0:03:35
526000 -- (-1801.583) [-1802.914] (-1803.256) (-1802.606) * (-1797.821) (-1800.269) (-1817.347) [-1792.178] -- 0:03:35
526500 -- [-1797.020] (-1805.762) (-1806.313) (-1797.990) * (-1799.707) [-1800.443] (-1805.200) (-1795.382) -- 0:03:34
527000 -- (-1801.525) (-1802.131) [-1788.222] (-1815.988) * [-1798.202] (-1795.851) (-1800.250) (-1797.925) -- 0:03:35
527500 -- (-1791.261) (-1801.883) (-1790.102) [-1797.900] * (-1792.668) [-1790.801] (-1798.661) (-1799.196) -- 0:03:34
528000 -- [-1798.786] (-1804.443) (-1802.680) (-1804.461) * (-1799.619) (-1805.349) (-1793.757) [-1790.267] -- 0:03:34
528500 -- [-1808.210] (-1799.857) (-1792.442) (-1803.771) * [-1800.088] (-1798.960) (-1795.157) (-1800.845) -- 0:03:34
529000 -- (-1799.094) [-1802.625] (-1805.059) (-1798.976) * (-1804.732) [-1794.158] (-1797.569) (-1794.973) -- 0:03:34
529500 -- [-1802.856] (-1791.666) (-1800.156) (-1812.848) * [-1801.735] (-1808.352) (-1800.500) (-1802.758) -- 0:03:34
530000 -- (-1793.964) (-1792.109) (-1790.976) [-1792.593] * (-1800.081) (-1792.154) [-1802.187] (-1798.954) -- 0:03:33
Average standard deviation of split frequencies: 0.006292
530500 -- (-1805.935) (-1791.589) (-1800.031) [-1799.071] * (-1801.461) (-1796.488) (-1801.860) [-1800.886] -- 0:03:33
531000 -- (-1804.075) [-1796.063] (-1802.970) (-1800.260) * (-1796.182) (-1794.503) (-1798.793) [-1804.579] -- 0:03:32
531500 -- [-1789.462] (-1795.054) (-1811.795) (-1808.550) * [-1800.236] (-1800.161) (-1805.474) (-1801.299) -- 0:03:33
532000 -- (-1808.816) (-1801.262) (-1799.872) [-1794.774] * (-1805.246) [-1793.797] (-1801.907) (-1797.450) -- 0:03:32
532500 -- (-1797.383) [-1799.867] (-1795.434) (-1798.412) * (-1801.766) [-1797.976] (-1795.087) (-1796.704) -- 0:03:32
533000 -- (-1801.946) (-1792.393) (-1802.467) [-1786.705] * (-1802.567) [-1800.066] (-1793.697) (-1794.224) -- 0:03:32
533500 -- (-1797.680) (-1797.475) (-1804.345) [-1803.048] * (-1800.984) [-1802.432] (-1793.269) (-1797.111) -- 0:03:32
534000 -- (-1796.631) (-1794.532) (-1810.129) [-1791.644] * (-1794.943) [-1799.299] (-1802.029) (-1801.220) -- 0:03:32
534500 -- (-1798.124) (-1793.923) (-1799.866) [-1789.541] * (-1805.283) (-1805.348) [-1791.661] (-1808.041) -- 0:03:31
535000 -- (-1800.829) [-1802.967] (-1806.947) (-1798.967) * (-1800.313) (-1807.139) [-1789.731] (-1805.000) -- 0:03:31
Average standard deviation of split frequencies: 0.005497
535500 -- (-1823.355) (-1801.285) (-1796.708) [-1795.720] * (-1808.303) (-1801.507) (-1797.499) [-1799.932] -- 0:03:31
536000 -- (-1799.785) (-1807.160) (-1805.047) [-1798.703] * (-1800.370) [-1800.148] (-1795.282) (-1795.081) -- 0:03:31
536500 -- (-1803.300) [-1793.950] (-1798.075) (-1796.135) * (-1801.967) (-1801.911) (-1796.474) [-1798.154] -- 0:03:30
537000 -- (-1796.762) (-1802.833) [-1803.590] (-1792.753) * (-1793.112) (-1800.462) (-1813.304) [-1803.273] -- 0:03:30
537500 -- [-1792.306] (-1806.043) (-1804.322) (-1804.648) * (-1797.224) (-1801.933) [-1790.653] (-1789.674) -- 0:03:29
538000 -- [-1795.399] (-1803.897) (-1793.051) (-1794.272) * (-1802.182) [-1796.180] (-1793.291) (-1792.379) -- 0:03:30
538500 -- (-1793.408) (-1800.338) (-1808.895) [-1787.821] * (-1792.052) (-1800.167) [-1801.431] (-1811.007) -- 0:03:29
539000 -- (-1808.221) [-1798.468] (-1822.115) (-1808.509) * [-1794.653] (-1810.129) (-1791.026) (-1803.586) -- 0:03:29
539500 -- (-1807.390) [-1804.210] (-1809.100) (-1793.148) * (-1799.845) (-1794.595) [-1789.957] (-1807.945) -- 0:03:29
540000 -- (-1802.877) [-1803.105] (-1814.243) (-1800.991) * [-1797.346] (-1799.055) (-1806.378) (-1799.685) -- 0:03:29
Average standard deviation of split frequencies: 0.004941
540500 -- (-1804.100) (-1800.717) (-1805.938) [-1788.229] * (-1794.854) (-1815.515) (-1803.950) [-1805.083] -- 0:03:29
541000 -- [-1796.365] (-1803.028) (-1797.601) (-1801.598) * (-1803.590) (-1799.617) [-1796.093] (-1790.354) -- 0:03:28
541500 -- [-1793.679] (-1808.990) (-1790.326) (-1797.641) * (-1806.808) (-1795.696) (-1795.573) [-1793.721] -- 0:03:28
542000 -- (-1791.200) (-1813.121) (-1797.501) [-1794.682] * (-1799.651) [-1798.571] (-1800.027) (-1810.223) -- 0:03:28
542500 -- (-1801.145) (-1798.174) [-1793.990] (-1799.037) * (-1806.841) [-1795.393] (-1803.009) (-1803.469) -- 0:03:28
543000 -- (-1791.672) (-1811.074) (-1797.160) [-1793.565] * [-1806.615] (-1801.144) (-1801.232) (-1816.768) -- 0:03:27
543500 -- [-1800.769] (-1803.252) (-1797.787) (-1805.868) * (-1809.113) (-1801.754) [-1800.601] (-1808.853) -- 0:03:27
544000 -- (-1803.001) (-1791.129) [-1801.689] (-1803.029) * (-1815.406) [-1798.508] (-1793.557) (-1808.689) -- 0:03:27
544500 -- (-1809.102) [-1796.380] (-1804.611) (-1798.730) * (-1800.188) (-1793.298) [-1801.072] (-1811.022) -- 0:03:27
545000 -- (-1813.055) [-1797.180] (-1796.553) (-1795.834) * (-1802.210) (-1804.904) [-1796.485] (-1796.921) -- 0:03:27
Average standard deviation of split frequencies: 0.004892
545500 -- (-1803.668) (-1799.648) [-1804.121] (-1801.636) * (-1808.662) (-1798.533) (-1798.043) [-1796.084] -- 0:03:26
546000 -- [-1791.104] (-1789.256) (-1802.696) (-1805.065) * (-1807.334) (-1799.462) [-1794.491] (-1797.238) -- 0:03:26
546500 -- (-1800.040) [-1791.525] (-1806.359) (-1800.588) * (-1797.117) [-1792.856] (-1801.429) (-1804.696) -- 0:03:26
547000 -- (-1805.353) (-1801.706) (-1792.534) [-1791.604] * (-1804.903) (-1796.840) (-1798.258) [-1800.316] -- 0:03:26
547500 -- (-1802.697) [-1798.491] (-1797.658) (-1800.892) * (-1804.268) (-1795.092) (-1796.004) [-1795.159] -- 0:03:25
548000 -- (-1799.748) (-1794.481) (-1794.948) [-1792.260] * (-1801.000) [-1788.217] (-1800.366) (-1798.601) -- 0:03:25
548500 -- (-1793.878) [-1794.182] (-1805.126) (-1802.318) * (-1801.033) (-1791.471) [-1798.388] (-1806.404) -- 0:03:24
549000 -- (-1795.380) (-1813.541) [-1798.328] (-1793.210) * (-1797.899) (-1801.289) [-1803.553] (-1811.099) -- 0:03:25
549500 -- (-1803.950) [-1797.331] (-1791.978) (-1801.326) * [-1801.136] (-1804.156) (-1797.371) (-1796.133) -- 0:03:24
550000 -- (-1800.208) (-1805.207) [-1796.755] (-1790.329) * (-1794.130) [-1798.518] (-1815.231) (-1811.292) -- 0:03:24
Average standard deviation of split frequencies: 0.004851
550500 -- (-1802.209) (-1797.269) [-1794.417] (-1801.198) * (-1802.884) (-1800.833) [-1795.346] (-1804.026) -- 0:03:24
551000 -- (-1805.305) [-1788.050] (-1806.834) (-1802.049) * [-1793.666] (-1801.934) (-1792.988) (-1800.357) -- 0:03:24
551500 -- (-1801.297) (-1791.846) (-1799.366) [-1802.598] * (-1799.192) (-1802.235) (-1794.718) [-1795.275] -- 0:03:24
552000 -- (-1802.722) [-1796.847] (-1799.349) (-1798.470) * (-1797.579) (-1813.578) (-1800.585) [-1790.537] -- 0:03:23
552500 -- (-1807.121) (-1800.450) [-1795.328] (-1793.271) * [-1797.599] (-1812.217) (-1811.348) (-1798.371) -- 0:03:23
553000 -- (-1795.058) [-1796.897] (-1799.105) (-1802.871) * [-1799.504] (-1798.452) (-1793.831) (-1793.699) -- 0:03:23
553500 -- (-1801.292) (-1800.880) [-1793.242] (-1800.291) * (-1798.358) (-1800.231) [-1804.321] (-1800.810) -- 0:03:23
554000 -- (-1793.074) [-1813.819] (-1808.443) (-1798.372) * [-1788.168] (-1797.415) (-1804.210) (-1810.590) -- 0:03:22
554500 -- [-1793.544] (-1800.735) (-1792.602) (-1807.761) * (-1803.743) (-1795.008) (-1803.384) [-1801.522] -- 0:03:22
555000 -- (-1805.281) [-1792.520] (-1795.383) (-1798.050) * (-1795.002) (-1801.026) (-1803.296) [-1794.856] -- 0:03:22
Average standard deviation of split frequencies: 0.004451
555500 -- (-1801.706) (-1793.663) [-1791.963] (-1792.723) * [-1794.012] (-1810.539) (-1793.717) (-1801.938) -- 0:03:22
556000 -- (-1804.600) (-1800.639) (-1799.996) [-1805.220] * (-1808.386) (-1797.707) [-1794.622] (-1797.958) -- 0:03:22
556500 -- [-1795.893] (-1795.878) (-1797.088) (-1802.977) * (-1804.014) (-1797.113) (-1808.591) [-1798.591] -- 0:03:21
557000 -- (-1805.224) (-1807.086) (-1796.457) [-1802.343] * (-1799.429) [-1794.831] (-1801.023) (-1796.138) -- 0:03:21
557500 -- (-1811.431) (-1796.834) [-1795.551] (-1797.156) * (-1803.124) (-1797.561) [-1807.137] (-1790.806) -- 0:03:21
558000 -- (-1806.234) (-1791.947) [-1793.446] (-1795.010) * [-1792.191] (-1799.392) (-1815.527) (-1812.833) -- 0:03:21
558500 -- (-1800.617) (-1806.767) (-1801.109) [-1793.208] * (-1797.495) (-1798.081) (-1818.124) [-1791.787] -- 0:03:20
559000 -- (-1804.513) [-1804.156] (-1804.583) (-1797.717) * (-1794.616) (-1797.202) (-1811.064) [-1793.628] -- 0:03:20
559500 -- (-1802.774) (-1793.280) [-1798.725] (-1807.049) * (-1805.187) [-1795.169] (-1799.201) (-1798.013) -- 0:03:20
560000 -- (-1800.617) (-1789.680) (-1798.387) [-1789.343] * (-1802.548) (-1802.895) [-1791.389] (-1797.821) -- 0:03:20
Average standard deviation of split frequencies: 0.004134
560500 -- (-1794.609) (-1798.314) [-1791.282] (-1793.952) * [-1796.009] (-1792.035) (-1793.026) (-1800.197) -- 0:03:19
561000 -- (-1793.075) (-1807.088) (-1791.910) [-1791.076] * (-1801.282) (-1793.510) [-1795.559] (-1814.309) -- 0:03:19
561500 -- (-1807.428) (-1798.889) (-1805.306) [-1807.328] * (-1805.174) [-1790.174] (-1796.781) (-1806.327) -- 0:03:19
562000 -- (-1804.794) [-1794.286] (-1794.707) (-1803.624) * [-1799.386] (-1795.367) (-1804.196) (-1800.211) -- 0:03:19
562500 -- (-1808.050) [-1787.260] (-1802.592) (-1794.292) * [-1790.751] (-1806.395) (-1800.192) (-1794.118) -- 0:03:19
563000 -- (-1799.542) [-1790.922] (-1799.424) (-1804.389) * (-1792.741) (-1816.584) (-1795.270) [-1795.589] -- 0:03:18
563500 -- (-1798.316) [-1797.875] (-1801.600) (-1808.662) * (-1803.841) (-1811.746) [-1797.063] (-1793.528) -- 0:03:18
564000 -- (-1809.481) [-1797.547] (-1812.367) (-1804.043) * (-1792.055) (-1801.498) (-1799.564) [-1801.070] -- 0:03:18
564500 -- (-1795.591) [-1800.828] (-1815.233) (-1810.892) * [-1798.776] (-1806.719) (-1792.322) (-1803.750) -- 0:03:18
565000 -- [-1798.196] (-1803.690) (-1817.291) (-1798.766) * (-1801.769) (-1816.475) [-1798.163] (-1798.884) -- 0:03:17
Average standard deviation of split frequencies: 0.004026
565500 -- (-1801.043) (-1789.960) (-1807.060) [-1790.218] * (-1801.664) (-1795.947) [-1796.342] (-1804.475) -- 0:03:17
566000 -- (-1810.785) (-1790.825) (-1808.214) [-1793.906] * (-1801.048) [-1797.140] (-1807.043) (-1796.613) -- 0:03:17
566500 -- [-1797.173] (-1793.812) (-1803.850) (-1807.115) * (-1800.587) (-1800.698) (-1809.617) [-1793.123] -- 0:03:17
567000 -- [-1791.589] (-1802.322) (-1801.787) (-1802.105) * [-1796.710] (-1810.089) (-1794.972) (-1798.837) -- 0:03:17
567500 -- (-1791.318) (-1801.673) (-1801.997) [-1807.781] * (-1791.996) (-1807.340) (-1797.918) [-1795.376] -- 0:03:16
568000 -- [-1800.297] (-1796.095) (-1802.169) (-1805.367) * (-1797.003) (-1796.945) (-1795.064) [-1791.177] -- 0:03:16
568500 -- (-1803.914) (-1817.810) [-1799.588] (-1797.198) * (-1796.113) (-1795.892) (-1805.194) [-1800.869] -- 0:03:16
569000 -- (-1795.497) (-1804.003) (-1801.166) [-1790.584] * (-1794.005) [-1794.598] (-1800.982) (-1797.552) -- 0:03:16
569500 -- (-1807.698) (-1800.201) [-1801.007] (-1794.375) * (-1792.335) (-1802.138) (-1804.545) [-1795.352] -- 0:03:15
570000 -- (-1792.927) (-1802.074) (-1798.090) [-1794.164] * (-1804.321) [-1799.740] (-1816.157) (-1800.219) -- 0:03:16
Average standard deviation of split frequencies: 0.004199
570500 -- (-1794.839) (-1798.435) (-1801.265) [-1800.734] * (-1793.003) (-1809.444) [-1803.783] (-1805.822) -- 0:03:15
571000 -- (-1802.074) [-1795.218] (-1796.591) (-1800.503) * (-1797.838) (-1804.884) (-1802.820) [-1792.924] -- 0:03:15
571500 -- [-1802.668] (-1803.445) (-1798.101) (-1797.317) * (-1793.547) (-1804.685) [-1799.234] (-1797.521) -- 0:03:14
572000 -- (-1804.165) (-1809.479) [-1793.197] (-1800.107) * [-1791.407] (-1790.365) (-1801.702) (-1802.065) -- 0:03:14
572500 -- (-1791.053) (-1802.697) (-1806.208) [-1791.547] * (-1788.017) [-1787.863] (-1810.384) (-1795.310) -- 0:03:14
573000 -- [-1793.827] (-1814.694) (-1802.020) (-1798.897) * (-1795.686) (-1804.663) (-1797.618) [-1791.540] -- 0:03:14
573500 -- (-1798.969) (-1810.737) [-1797.145] (-1796.939) * (-1796.261) (-1811.915) [-1795.516] (-1798.012) -- 0:03:14
574000 -- (-1799.414) (-1797.145) [-1793.226] (-1806.379) * [-1789.670] (-1807.670) (-1792.432) (-1797.798) -- 0:03:13
574500 -- (-1794.683) (-1806.941) [-1788.524] (-1803.474) * [-1808.575] (-1814.539) (-1799.821) (-1793.870) -- 0:03:14
575000 -- (-1808.717) (-1800.250) [-1794.106] (-1799.573) * (-1791.014) [-1797.358] (-1808.493) (-1800.386) -- 0:03:13
Average standard deviation of split frequencies: 0.004910
575500 -- (-1802.313) (-1805.047) (-1803.834) [-1793.931] * [-1795.752] (-1793.585) (-1795.667) (-1804.708) -- 0:03:13
576000 -- (-1800.718) (-1795.266) (-1807.090) [-1793.397] * (-1801.641) [-1801.800] (-1795.451) (-1801.566) -- 0:03:12
576500 -- (-1801.883) (-1793.019) (-1811.981) [-1798.130] * (-1794.383) [-1808.067] (-1801.830) (-1805.945) -- 0:03:12
577000 -- (-1800.247) (-1793.521) (-1803.755) [-1794.016] * [-1790.766] (-1794.022) (-1805.838) (-1802.330) -- 0:03:12
577500 -- (-1801.727) [-1794.278] (-1800.203) (-1795.733) * (-1790.160) [-1796.360] (-1805.076) (-1802.254) -- 0:03:12
578000 -- (-1802.495) [-1798.421] (-1807.122) (-1820.312) * (-1800.046) [-1794.014] (-1802.570) (-1804.932) -- 0:03:12
578500 -- (-1797.905) [-1793.737] (-1795.064) (-1811.049) * (-1801.152) (-1792.344) (-1800.107) [-1794.603] -- 0:03:11
579000 -- (-1802.973) [-1804.006] (-1802.529) (-1801.035) * (-1801.615) (-1793.353) [-1799.663] (-1799.169) -- 0:03:11
579500 -- (-1803.675) (-1805.225) (-1792.764) [-1805.329] * (-1815.303) (-1790.950) (-1792.944) [-1801.859] -- 0:03:11
580000 -- (-1800.701) (-1812.141) (-1799.673) [-1796.794] * (-1811.112) (-1796.262) [-1790.785] (-1799.329) -- 0:03:11
Average standard deviation of split frequencies: 0.005006
580500 -- (-1815.338) [-1794.053] (-1794.655) (-1813.920) * (-1798.577) (-1792.168) [-1791.710] (-1796.826) -- 0:03:10
581000 -- (-1816.426) (-1807.136) (-1794.562) [-1796.202] * (-1794.661) [-1796.321] (-1791.498) (-1797.381) -- 0:03:11
581500 -- (-1794.487) [-1790.903] (-1799.822) (-1799.723) * (-1813.796) (-1793.234) [-1792.499] (-1799.457) -- 0:03:10
582000 -- [-1800.011] (-1795.358) (-1798.718) (-1811.087) * [-1801.465] (-1805.708) (-1798.915) (-1798.074) -- 0:03:10
582500 -- (-1809.271) (-1795.466) [-1802.225] (-1797.224) * (-1803.199) (-1805.022) (-1800.321) [-1795.259] -- 0:03:09
583000 -- (-1807.859) (-1788.501) (-1796.041) [-1793.641] * (-1806.978) (-1797.551) [-1794.166] (-1799.732) -- 0:03:09
583500 -- [-1802.460] (-1797.894) (-1798.327) (-1794.624) * (-1811.054) (-1802.022) [-1792.865] (-1795.705) -- 0:03:09
584000 -- (-1807.614) (-1805.937) (-1791.283) [-1799.695] * (-1807.498) [-1795.659] (-1793.724) (-1799.220) -- 0:03:09
584500 -- (-1801.421) [-1798.724] (-1800.700) (-1798.123) * (-1797.062) (-1802.578) [-1791.532] (-1807.380) -- 0:03:09
585000 -- (-1801.595) (-1805.617) (-1794.726) [-1795.504] * (-1798.795) (-1799.225) [-1792.829] (-1799.754) -- 0:03:08
Average standard deviation of split frequencies: 0.004290
585500 -- [-1797.809] (-1793.212) (-1814.533) (-1798.318) * (-1810.083) (-1794.557) [-1789.921] (-1795.212) -- 0:03:09
586000 -- [-1793.999] (-1799.687) (-1797.697) (-1795.218) * (-1802.119) (-1799.193) [-1801.072] (-1796.652) -- 0:03:08
586500 -- [-1797.934] (-1803.887) (-1795.124) (-1797.338) * (-1806.019) [-1792.745] (-1799.410) (-1792.505) -- 0:03:08
587000 -- [-1802.345] (-1802.995) (-1811.937) (-1799.903) * (-1803.818) (-1801.575) (-1796.797) [-1786.457] -- 0:03:07
587500 -- [-1806.064] (-1798.829) (-1795.241) (-1792.414) * (-1799.980) (-1799.380) [-1800.540] (-1801.528) -- 0:03:07
588000 -- (-1804.697) (-1804.907) (-1795.810) [-1795.046] * (-1798.688) [-1791.895] (-1804.424) (-1803.881) -- 0:03:07
588500 -- (-1820.779) (-1789.929) [-1794.340] (-1795.074) * (-1797.570) (-1800.282) (-1801.799) [-1795.029] -- 0:03:07
589000 -- (-1798.866) [-1796.612] (-1801.172) (-1795.087) * [-1793.369] (-1800.963) (-1798.380) (-1795.508) -- 0:03:07
589500 -- (-1800.021) [-1791.626] (-1793.584) (-1799.441) * (-1804.124) (-1811.192) [-1789.889] (-1806.270) -- 0:03:06
590000 -- (-1794.362) [-1793.502] (-1802.351) (-1800.790) * (-1804.213) (-1798.382) (-1793.792) [-1800.193] -- 0:03:06
Average standard deviation of split frequencies: 0.003924
590500 -- (-1795.133) (-1797.118) [-1792.995] (-1804.202) * (-1818.420) (-1802.027) [-1801.501] (-1790.900) -- 0:03:06
591000 -- (-1795.998) (-1795.504) (-1807.706) [-1799.646] * (-1811.386) (-1803.500) [-1797.004] (-1794.637) -- 0:03:06
591500 -- (-1793.380) (-1802.369) (-1800.964) [-1796.502] * (-1799.258) (-1809.714) (-1792.777) [-1793.907] -- 0:03:05
592000 -- (-1803.147) (-1808.125) (-1800.302) [-1789.307] * (-1797.664) (-1797.160) [-1802.983] (-1790.633) -- 0:03:06
592500 -- (-1810.117) (-1801.031) (-1800.593) [-1796.304] * (-1805.634) (-1793.679) (-1795.254) [-1809.091] -- 0:03:05
593000 -- (-1811.393) [-1799.543] (-1801.531) (-1793.458) * (-1798.397) (-1801.742) (-1800.023) [-1794.455] -- 0:03:05
593500 -- (-1797.953) (-1800.276) (-1802.710) [-1799.036] * [-1791.382] (-1794.839) (-1797.147) (-1796.179) -- 0:03:04
594000 -- (-1809.027) (-1806.574) (-1804.934) [-1792.118] * (-1802.709) (-1789.143) (-1795.418) [-1793.193] -- 0:03:04
594500 -- (-1796.326) (-1806.706) (-1807.401) [-1798.172] * (-1798.485) (-1800.332) (-1808.925) [-1797.410] -- 0:03:04
595000 -- (-1793.553) (-1796.551) (-1799.958) [-1791.863] * (-1795.851) [-1806.037] (-1797.673) (-1799.073) -- 0:03:04
Average standard deviation of split frequencies: 0.004218
595500 -- (-1798.738) (-1804.271) (-1796.114) [-1796.285] * (-1799.644) [-1791.614] (-1801.053) (-1793.704) -- 0:03:04
596000 -- (-1799.714) [-1797.657] (-1794.618) (-1794.170) * (-1807.209) (-1796.794) (-1811.128) [-1797.088] -- 0:03:03
596500 -- (-1798.105) (-1800.815) [-1793.912] (-1794.845) * (-1804.300) (-1796.272) (-1791.536) [-1794.403] -- 0:03:03
597000 -- (-1800.787) (-1795.967) [-1807.492] (-1797.877) * (-1800.574) (-1804.081) [-1798.604] (-1807.342) -- 0:03:03
597500 -- (-1799.487) [-1792.819] (-1799.882) (-1794.233) * (-1806.789) (-1798.378) [-1793.922] (-1807.680) -- 0:03:03
598000 -- [-1797.514] (-1795.878) (-1795.233) (-1802.587) * (-1791.943) (-1803.302) [-1799.884] (-1799.100) -- 0:03:02
598500 -- (-1797.967) [-1796.311] (-1794.523) (-1802.582) * (-1804.321) [-1795.764] (-1800.881) (-1806.379) -- 0:03:02
599000 -- (-1799.203) [-1801.590] (-1806.314) (-1803.854) * (-1802.877) (-1799.516) [-1795.166] (-1803.507) -- 0:03:02
599500 -- (-1796.877) (-1795.386) [-1796.913] (-1800.927) * (-1799.989) (-1804.457) (-1799.590) [-1796.309] -- 0:03:02
600000 -- (-1804.504) (-1796.319) [-1796.551] (-1808.204) * (-1796.169) [-1794.688] (-1800.063) (-1805.271) -- 0:03:02
Average standard deviation of split frequencies: 0.003532
600500 -- (-1811.887) (-1805.508) [-1802.892] (-1815.216) * [-1795.203] (-1798.896) (-1804.553) (-1797.858) -- 0:03:01
601000 -- (-1798.133) (-1797.224) [-1804.252] (-1806.066) * (-1803.302) [-1792.165] (-1816.773) (-1787.055) -- 0:03:01
601500 -- (-1810.026) (-1802.159) (-1795.546) [-1794.924] * (-1817.119) (-1800.938) [-1799.272] (-1795.206) -- 0:03:01
602000 -- [-1794.303] (-1794.550) (-1798.674) (-1807.103) * (-1795.534) (-1811.489) (-1801.144) [-1794.953] -- 0:03:01
602500 -- (-1798.848) (-1811.862) [-1793.438] (-1792.554) * [-1798.180] (-1808.868) (-1801.430) (-1810.733) -- 0:03:00
603000 -- (-1794.779) (-1802.301) (-1800.609) [-1793.769] * (-1801.808) [-1795.917] (-1800.082) (-1824.693) -- 0:03:00
603500 -- (-1796.649) (-1802.034) (-1794.833) [-1801.172] * (-1797.539) [-1791.529] (-1799.653) (-1799.000) -- 0:03:00
604000 -- (-1795.247) (-1807.979) (-1791.992) [-1792.778] * (-1793.130) (-1798.165) (-1795.915) [-1800.294] -- 0:03:00
604500 -- (-1796.123) (-1797.871) [-1800.162] (-1794.264) * [-1800.404] (-1803.214) (-1801.728) (-1801.439) -- 0:02:59
605000 -- (-1805.594) [-1796.633] (-1791.368) (-1793.864) * (-1796.833) [-1792.976] (-1804.035) (-1799.816) -- 0:02:59
Average standard deviation of split frequencies: 0.004343
605500 -- [-1796.477] (-1815.399) (-1797.613) (-1792.826) * (-1796.168) (-1799.811) [-1793.534] (-1795.230) -- 0:02:59
606000 -- (-1803.399) (-1804.019) (-1802.120) [-1793.470] * (-1801.030) (-1802.089) [-1798.705] (-1807.288) -- 0:02:59
606500 -- [-1799.129] (-1807.156) (-1798.160) (-1796.932) * (-1801.414) [-1792.787] (-1810.959) (-1797.392) -- 0:02:59
607000 -- (-1811.980) (-1797.673) [-1793.823] (-1800.914) * [-1792.721] (-1789.524) (-1807.337) (-1797.877) -- 0:02:58
607500 -- (-1797.483) [-1789.552] (-1802.892) (-1792.091) * (-1801.423) (-1792.365) [-1800.386] (-1790.149) -- 0:02:58
608000 -- [-1797.476] (-1794.663) (-1812.353) (-1795.853) * (-1803.257) (-1797.809) [-1788.919] (-1798.137) -- 0:02:58
608500 -- (-1797.535) [-1788.395] (-1802.753) (-1802.022) * (-1795.655) (-1797.526) [-1795.225] (-1808.974) -- 0:02:58
609000 -- (-1798.540) (-1790.508) [-1799.668] (-1816.512) * (-1801.155) (-1803.359) (-1805.133) [-1798.237] -- 0:02:57
609500 -- [-1794.790] (-1800.268) (-1802.213) (-1803.644) * [-1796.904] (-1806.571) (-1807.571) (-1794.175) -- 0:02:57
610000 -- (-1807.869) [-1792.804] (-1805.664) (-1801.927) * [-1804.361] (-1803.332) (-1805.526) (-1796.610) -- 0:02:57
Average standard deviation of split frequencies: 0.004567
610500 -- (-1811.096) (-1797.947) [-1792.399] (-1806.528) * (-1791.589) (-1802.795) (-1805.666) [-1793.587] -- 0:02:57
611000 -- (-1803.058) (-1799.542) [-1792.961] (-1803.752) * (-1797.170) (-1801.175) [-1801.131] (-1802.285) -- 0:02:56
611500 -- (-1807.331) (-1800.438) (-1797.536) [-1805.355] * (-1812.915) (-1795.013) (-1799.517) [-1804.985] -- 0:02:56
612000 -- (-1806.332) (-1805.550) [-1797.081] (-1798.112) * (-1807.758) (-1804.980) [-1799.249] (-1803.690) -- 0:02:56
612500 -- (-1798.745) [-1797.971] (-1795.039) (-1809.092) * (-1803.762) (-1798.053) [-1792.463] (-1791.912) -- 0:02:56
613000 -- (-1801.386) (-1798.342) (-1796.161) [-1796.720] * (-1810.081) (-1797.413) (-1802.727) [-1799.759] -- 0:02:56
613500 -- (-1802.187) (-1810.069) [-1793.339] (-1796.039) * (-1794.455) (-1794.356) (-1811.856) [-1795.633] -- 0:02:55
614000 -- (-1797.943) (-1808.392) (-1797.152) [-1802.467] * (-1791.421) [-1795.458] (-1793.102) (-1796.418) -- 0:02:55
614500 -- [-1794.488] (-1803.455) (-1800.509) (-1808.790) * (-1795.171) (-1804.605) (-1814.666) [-1798.277] -- 0:02:55
615000 -- (-1795.689) [-1790.977] (-1791.575) (-1803.843) * (-1810.596) (-1797.079) [-1800.535] (-1806.601) -- 0:02:55
Average standard deviation of split frequencies: 0.004847
615500 -- [-1793.890] (-1801.108) (-1810.783) (-1804.504) * (-1801.844) (-1792.175) (-1790.635) [-1798.212] -- 0:02:54
616000 -- (-1802.219) [-1790.582] (-1813.301) (-1799.392) * (-1809.252) [-1796.317] (-1793.262) (-1806.189) -- 0:02:54
616500 -- [-1799.900] (-1811.645) (-1810.395) (-1789.661) * (-1810.893) [-1792.433] (-1792.451) (-1798.586) -- 0:02:54
617000 -- [-1796.697] (-1811.530) (-1799.647) (-1800.979) * (-1805.511) (-1800.757) (-1812.125) [-1793.690] -- 0:02:54
617500 -- (-1811.977) (-1793.982) (-1811.817) [-1793.503] * (-1805.462) [-1795.106] (-1799.542) (-1796.216) -- 0:02:54
618000 -- (-1811.461) (-1812.269) (-1809.239) [-1796.308] * (-1801.775) (-1801.386) (-1800.041) [-1793.056] -- 0:02:53
618500 -- (-1801.144) [-1801.475] (-1801.063) (-1798.752) * [-1795.576] (-1797.755) (-1801.535) (-1795.401) -- 0:02:53
619000 -- [-1797.034] (-1811.347) (-1808.133) (-1794.953) * (-1801.869) [-1797.695] (-1801.394) (-1802.012) -- 0:02:53
619500 -- (-1791.946) (-1794.263) [-1802.599] (-1793.047) * [-1797.934] (-1794.567) (-1794.997) (-1794.093) -- 0:02:53
620000 -- (-1794.271) (-1797.899) (-1794.675) [-1790.336] * [-1805.638] (-1791.738) (-1799.788) (-1792.837) -- 0:02:52
Average standard deviation of split frequencies: 0.005506
620500 -- (-1807.979) [-1793.307] (-1807.224) (-1791.508) * [-1801.740] (-1794.109) (-1791.222) (-1807.164) -- 0:02:52
621000 -- (-1807.200) [-1796.437] (-1799.191) (-1792.958) * [-1797.122] (-1801.652) (-1810.112) (-1803.839) -- 0:02:52
621500 -- (-1802.777) (-1795.906) (-1801.016) [-1797.263] * (-1807.670) (-1797.053) (-1799.730) [-1801.697] -- 0:02:52
622000 -- (-1796.166) (-1802.823) [-1797.832] (-1798.143) * (-1802.344) (-1802.388) (-1800.606) [-1792.748] -- 0:02:51
622500 -- (-1804.507) (-1802.939) [-1796.184] (-1798.934) * (-1797.448) [-1797.020] (-1805.566) (-1801.887) -- 0:02:51
623000 -- (-1798.990) (-1805.336) (-1803.961) [-1797.686] * (-1815.388) [-1789.005] (-1800.280) (-1805.574) -- 0:02:51
623500 -- (-1806.932) (-1808.685) (-1796.724) [-1797.090] * (-1799.113) [-1795.090] (-1814.403) (-1806.075) -- 0:02:51
624000 -- (-1800.436) (-1807.439) (-1787.070) [-1798.985] * (-1794.379) (-1806.288) (-1816.239) [-1795.288] -- 0:02:51
624500 -- (-1808.183) (-1792.868) [-1796.823] (-1793.834) * (-1803.015) [-1789.598] (-1798.704) (-1795.956) -- 0:02:50
625000 -- (-1810.760) [-1792.570] (-1804.288) (-1791.778) * (-1807.231) (-1793.138) [-1798.606] (-1802.658) -- 0:02:50
Average standard deviation of split frequencies: 0.005585
625500 -- [-1798.233] (-1791.291) (-1793.545) (-1807.144) * (-1806.255) [-1792.355] (-1797.560) (-1798.450) -- 0:02:50
626000 -- (-1801.185) (-1805.780) [-1794.961] (-1805.915) * (-1802.091) [-1797.522] (-1804.518) (-1808.454) -- 0:02:50
626500 -- (-1801.246) (-1801.504) (-1796.229) [-1802.114] * (-1804.300) [-1799.097] (-1806.004) (-1801.009) -- 0:02:49
627000 -- (-1809.865) (-1799.158) [-1799.247] (-1805.760) * (-1796.308) (-1798.244) [-1800.077] (-1800.846) -- 0:02:49
627500 -- (-1800.230) (-1794.184) [-1790.240] (-1806.643) * (-1804.738) (-1803.560) (-1801.903) [-1802.028] -- 0:02:49
628000 -- (-1797.443) (-1791.652) (-1800.846) [-1797.333] * [-1798.423] (-1802.944) (-1802.005) (-1802.753) -- 0:02:49
628500 -- (-1808.102) (-1795.988) (-1810.472) [-1807.920] * (-1797.200) (-1802.602) (-1801.134) [-1794.233] -- 0:02:49
629000 -- (-1809.135) (-1795.274) [-1803.066] (-1806.640) * [-1788.611] (-1797.498) (-1804.651) (-1802.828) -- 0:02:48
629500 -- (-1794.027) [-1794.698] (-1800.231) (-1797.192) * [-1797.728] (-1794.598) (-1794.168) (-1809.707) -- 0:02:48
630000 -- [-1798.395] (-1801.556) (-1791.434) (-1794.441) * (-1803.442) (-1794.184) [-1797.436] (-1809.298) -- 0:02:48
Average standard deviation of split frequencies: 0.006353
630500 -- (-1799.894) (-1795.456) [-1797.904] (-1798.801) * (-1798.786) [-1799.555] (-1796.609) (-1798.463) -- 0:02:48
631000 -- (-1799.310) [-1798.285] (-1796.034) (-1800.255) * (-1797.626) [-1797.433] (-1788.410) (-1799.392) -- 0:02:47
631500 -- [-1800.375] (-1794.219) (-1798.429) (-1798.341) * (-1805.269) (-1805.903) (-1797.067) [-1807.478] -- 0:02:47
632000 -- [-1795.593] (-1807.840) (-1798.394) (-1802.650) * (-1802.532) (-1795.580) (-1804.611) [-1806.128] -- 0:02:47
632500 -- (-1796.975) (-1798.210) [-1798.615] (-1801.001) * (-1799.737) (-1795.925) [-1799.237] (-1807.100) -- 0:02:47
633000 -- [-1797.526] (-1796.076) (-1806.172) (-1805.946) * (-1798.824) (-1793.980) [-1800.880] (-1811.631) -- 0:02:46
633500 -- [-1794.704] (-1805.244) (-1800.229) (-1799.784) * (-1800.547) (-1793.902) (-1797.454) [-1801.979] -- 0:02:46
634000 -- [-1793.956] (-1794.080) (-1792.305) (-1803.232) * [-1806.793] (-1798.750) (-1801.023) (-1799.096) -- 0:02:46
634500 -- (-1803.351) [-1795.935] (-1798.557) (-1796.809) * (-1795.437) (-1818.375) (-1797.631) [-1801.238] -- 0:02:46
635000 -- [-1807.571] (-1796.478) (-1810.716) (-1797.853) * [-1797.041] (-1800.568) (-1799.201) (-1802.586) -- 0:02:46
Average standard deviation of split frequencies: 0.005930
635500 -- (-1797.280) (-1794.523) (-1799.465) [-1797.332] * [-1797.787] (-1807.764) (-1801.020) (-1798.638) -- 0:02:45
636000 -- (-1799.478) [-1797.472] (-1805.713) (-1799.811) * [-1796.829] (-1803.220) (-1806.768) (-1805.005) -- 0:02:45
636500 -- (-1798.778) (-1802.097) [-1796.701] (-1800.975) * (-1794.213) (-1805.382) (-1793.193) [-1802.921] -- 0:02:45
637000 -- (-1808.688) (-1798.097) (-1804.791) [-1794.100] * [-1793.045] (-1801.602) (-1791.885) (-1799.743) -- 0:02:45
637500 -- (-1806.775) (-1802.871) (-1801.447) [-1796.696] * (-1794.254) [-1797.342] (-1795.891) (-1802.797) -- 0:02:44
638000 -- [-1802.470] (-1803.055) (-1794.453) (-1796.475) * (-1796.976) (-1810.651) [-1802.384] (-1798.874) -- 0:02:44
638500 -- [-1801.663] (-1801.765) (-1794.887) (-1805.534) * (-1802.696) (-1804.010) [-1795.147] (-1803.638) -- 0:02:44
639000 -- (-1805.366) (-1807.019) [-1798.785] (-1801.924) * (-1797.168) (-1806.667) [-1794.039] (-1803.542) -- 0:02:44
639500 -- (-1806.181) (-1791.333) (-1801.060) [-1795.163] * (-1809.027) (-1798.991) (-1794.270) [-1788.469] -- 0:02:44
640000 -- (-1796.772) (-1800.132) (-1810.028) [-1800.064] * (-1801.498) (-1802.453) (-1794.398) [-1790.671] -- 0:02:43
Average standard deviation of split frequencies: 0.005457
640500 -- [-1802.214] (-1799.558) (-1802.965) (-1798.666) * (-1805.046) [-1801.327] (-1810.527) (-1796.021) -- 0:02:43
641000 -- [-1796.674] (-1800.271) (-1798.830) (-1807.445) * (-1794.769) [-1794.781] (-1805.325) (-1800.219) -- 0:02:43
641500 -- (-1802.104) [-1797.690] (-1798.994) (-1798.328) * [-1795.135] (-1805.419) (-1800.636) (-1793.372) -- 0:02:43
642000 -- (-1795.471) [-1794.287] (-1794.516) (-1805.351) * (-1794.402) (-1795.016) (-1802.048) [-1803.721] -- 0:02:42
642500 -- (-1798.688) (-1789.184) [-1795.530] (-1802.468) * (-1798.089) (-1797.742) [-1796.366] (-1805.581) -- 0:02:42
643000 -- (-1794.525) [-1810.702] (-1799.858) (-1805.899) * (-1803.644) (-1792.331) [-1800.473] (-1800.004) -- 0:02:42
643500 -- (-1798.385) (-1803.524) (-1804.678) [-1799.613] * (-1801.973) (-1803.379) (-1798.733) [-1789.006] -- 0:02:42
644000 -- [-1787.485] (-1794.222) (-1814.543) (-1795.188) * (-1796.560) (-1802.812) (-1807.570) [-1795.258] -- 0:02:41
644500 -- [-1790.238] (-1811.349) (-1803.643) (-1797.093) * (-1797.536) (-1797.144) (-1804.312) [-1797.158] -- 0:02:41
645000 -- (-1800.797) (-1797.427) (-1798.621) [-1800.268] * (-1800.745) [-1796.264] (-1801.330) (-1799.998) -- 0:02:41
Average standard deviation of split frequencies: 0.005899
645500 -- [-1797.087] (-1802.423) (-1805.228) (-1809.542) * [-1794.484] (-1795.997) (-1792.170) (-1799.546) -- 0:02:41
646000 -- [-1801.879] (-1801.242) (-1799.872) (-1798.781) * (-1799.987) (-1803.555) (-1795.991) [-1800.094] -- 0:02:41
646500 -- (-1805.919) (-1799.424) [-1796.824] (-1812.904) * (-1792.139) (-1801.398) [-1797.874] (-1790.415) -- 0:02:40
647000 -- (-1808.484) [-1792.120] (-1801.206) (-1796.719) * [-1798.487] (-1797.214) (-1796.399) (-1806.564) -- 0:02:40
647500 -- [-1800.324] (-1808.884) (-1800.617) (-1800.233) * [-1798.082] (-1802.966) (-1807.797) (-1801.239) -- 0:02:40
648000 -- [-1798.996] (-1798.508) (-1795.101) (-1798.444) * (-1811.495) (-1795.380) (-1801.679) [-1795.336] -- 0:02:40
648500 -- (-1801.820) (-1804.038) [-1806.766] (-1794.786) * [-1795.275] (-1795.065) (-1803.820) (-1793.907) -- 0:02:39
649000 -- [-1796.306] (-1789.563) (-1804.915) (-1802.745) * [-1790.634] (-1793.704) (-1804.652) (-1799.762) -- 0:02:39
649500 -- (-1797.886) [-1797.100] (-1806.451) (-1787.063) * [-1789.300] (-1804.106) (-1798.109) (-1799.111) -- 0:02:39
650000 -- (-1804.583) (-1804.697) (-1796.215) [-1798.279] * (-1807.204) (-1800.028) [-1790.138] (-1801.003) -- 0:02:39
Average standard deviation of split frequencies: 0.005977
650500 -- (-1799.603) [-1791.505] (-1804.332) (-1797.057) * (-1797.977) (-1795.909) [-1796.092] (-1801.843) -- 0:02:39
651000 -- (-1801.124) (-1799.939) [-1801.353] (-1800.349) * (-1788.577) (-1806.567) [-1792.837] (-1804.033) -- 0:02:38
651500 -- (-1804.752) (-1808.990) (-1797.638) [-1798.724] * (-1795.632) [-1792.673] (-1798.678) (-1799.816) -- 0:02:38
652000 -- [-1801.961] (-1809.267) (-1800.753) (-1795.348) * (-1802.213) (-1795.339) (-1795.555) [-1792.418] -- 0:02:38
652500 -- (-1796.611) (-1802.199) [-1793.442] (-1792.880) * [-1797.714] (-1794.035) (-1793.406) (-1801.206) -- 0:02:38
653000 -- (-1795.845) (-1812.328) [-1797.485] (-1791.755) * [-1788.994] (-1796.320) (-1795.024) (-1807.983) -- 0:02:37
653500 -- (-1797.336) [-1806.855] (-1808.704) (-1794.675) * (-1804.860) [-1795.267] (-1798.423) (-1807.410) -- 0:02:37
654000 -- [-1796.972] (-1800.446) (-1797.914) (-1790.693) * [-1794.870] (-1797.672) (-1801.181) (-1799.573) -- 0:02:37
654500 -- [-1795.484] (-1797.674) (-1796.305) (-1797.672) * [-1791.028] (-1799.410) (-1803.759) (-1795.367) -- 0:02:37
655000 -- [-1797.892] (-1792.476) (-1795.266) (-1803.116) * (-1799.415) (-1804.612) (-1803.775) [-1798.324] -- 0:02:36
Average standard deviation of split frequencies: 0.005928
655500 -- (-1803.387) (-1798.606) [-1791.635] (-1807.942) * (-1814.689) [-1795.839] (-1789.897) (-1796.600) -- 0:02:36
656000 -- [-1795.815] (-1793.028) (-1793.528) (-1806.610) * (-1804.001) (-1816.331) [-1791.069] (-1797.521) -- 0:02:36
656500 -- (-1801.326) (-1802.046) (-1803.067) [-1803.317] * (-1794.894) (-1796.513) [-1790.421] (-1810.306) -- 0:02:36
657000 -- (-1804.024) [-1795.694] (-1804.779) (-1807.554) * (-1804.785) (-1793.318) [-1795.678] (-1803.989) -- 0:02:36
657500 -- (-1797.490) (-1803.092) [-1803.045] (-1814.424) * [-1790.996] (-1800.266) (-1790.873) (-1799.292) -- 0:02:35
658000 -- (-1800.020) [-1794.672] (-1803.611) (-1814.752) * (-1795.663) (-1800.530) [-1794.858] (-1801.534) -- 0:02:35
658500 -- (-1807.051) (-1805.513) (-1800.871) [-1800.911] * (-1795.917) (-1805.852) (-1797.088) [-1795.967] -- 0:02:35
659000 -- (-1798.106) (-1802.394) [-1793.604] (-1803.350) * (-1805.193) (-1819.466) (-1794.178) [-1787.602] -- 0:02:35
659500 -- (-1800.584) (-1804.017) (-1800.102) [-1792.101] * (-1800.405) (-1812.465) [-1795.800] (-1797.659) -- 0:02:34
660000 -- [-1803.110] (-1799.155) (-1807.475) (-1807.095) * (-1804.088) (-1800.019) (-1801.424) [-1799.980] -- 0:02:34
Average standard deviation of split frequencies: 0.005768
660500 -- (-1800.752) [-1796.644] (-1801.173) (-1797.016) * (-1795.721) (-1793.977) [-1805.080] (-1805.140) -- 0:02:34
661000 -- (-1798.482) [-1790.937] (-1798.800) (-1803.224) * (-1799.548) (-1791.036) [-1795.452] (-1805.124) -- 0:02:34
661500 -- [-1793.110] (-1813.366) (-1798.728) (-1806.686) * (-1806.614) (-1807.638) [-1790.697] (-1800.151) -- 0:02:34
662000 -- (-1796.789) (-1803.883) (-1810.716) [-1798.086] * (-1802.937) [-1806.995] (-1791.343) (-1791.186) -- 0:02:33
662500 -- (-1794.441) [-1794.869] (-1807.439) (-1796.403) * (-1797.889) (-1803.176) (-1802.543) [-1792.763] -- 0:02:33
663000 -- [-1799.121] (-1802.065) (-1800.697) (-1792.056) * (-1794.209) (-1797.367) [-1794.665] (-1794.550) -- 0:02:33
663500 -- (-1807.910) (-1798.559) (-1801.002) [-1792.877] * (-1804.790) (-1802.301) (-1795.137) [-1796.822] -- 0:02:33
664000 -- (-1812.582) (-1795.912) [-1793.410] (-1797.714) * (-1799.107) [-1795.447] (-1802.036) (-1809.119) -- 0:02:32
664500 -- (-1789.344) [-1797.757] (-1805.849) (-1786.261) * (-1788.934) (-1803.733) [-1798.331] (-1811.490) -- 0:02:32
665000 -- (-1798.448) (-1801.473) [-1796.019] (-1795.007) * (-1799.727) (-1799.570) [-1797.605] (-1807.881) -- 0:02:32
Average standard deviation of split frequencies: 0.005722
665500 -- [-1802.970] (-1813.552) (-1805.434) (-1796.517) * (-1797.578) (-1793.526) (-1796.248) [-1808.308] -- 0:02:32
666000 -- [-1792.396] (-1818.071) (-1797.770) (-1795.453) * [-1795.782] (-1809.518) (-1794.736) (-1801.675) -- 0:02:31
666500 -- [-1799.892] (-1807.006) (-1804.802) (-1798.315) * [-1794.664] (-1800.697) (-1804.254) (-1804.380) -- 0:02:31
667000 -- [-1800.834] (-1804.019) (-1803.396) (-1804.183) * (-1793.043) [-1798.598] (-1804.817) (-1798.281) -- 0:02:31
667500 -- (-1797.576) [-1797.274] (-1799.782) (-1798.817) * (-1813.386) (-1806.991) (-1799.520) [-1797.602] -- 0:02:31
668000 -- (-1801.365) (-1807.668) [-1794.748] (-1797.572) * (-1797.100) (-1805.006) (-1799.720) [-1797.055] -- 0:02:31
668500 -- (-1798.240) (-1809.743) [-1790.367] (-1796.716) * (-1789.160) [-1788.431] (-1800.505) (-1803.532) -- 0:02:30
669000 -- (-1795.028) [-1797.905] (-1789.573) (-1798.747) * (-1798.544) [-1796.285] (-1802.420) (-1798.572) -- 0:02:30
669500 -- (-1809.141) (-1799.666) [-1793.750] (-1798.844) * (-1814.228) (-1797.620) [-1796.787] (-1793.250) -- 0:02:30
670000 -- (-1795.215) (-1803.881) [-1794.689] (-1809.547) * (-1800.615) (-1798.938) (-1793.599) [-1792.664] -- 0:02:30
Average standard deviation of split frequencies: 0.005682
670500 -- [-1802.586] (-1804.089) (-1795.539) (-1800.988) * [-1798.263] (-1796.513) (-1800.529) (-1806.110) -- 0:02:29
671000 -- (-1796.014) (-1807.053) [-1796.292] (-1804.930) * (-1796.725) [-1795.213] (-1806.379) (-1800.842) -- 0:02:29
671500 -- [-1800.049] (-1801.968) (-1793.607) (-1802.537) * (-1793.322) [-1796.074] (-1803.098) (-1801.597) -- 0:02:29
672000 -- (-1803.012) (-1795.143) [-1798.088] (-1818.853) * (-1799.904) (-1794.371) (-1792.147) [-1792.483] -- 0:02:29
672500 -- [-1808.508] (-1800.048) (-1792.402) (-1800.428) * (-1804.220) (-1806.892) (-1791.617) [-1792.574] -- 0:02:29
673000 -- (-1796.355) [-1799.954] (-1792.769) (-1800.842) * (-1812.067) [-1800.715] (-1805.204) (-1786.884) -- 0:02:28
673500 -- (-1798.305) [-1798.984] (-1798.731) (-1806.048) * (-1807.762) [-1796.632] (-1798.341) (-1797.380) -- 0:02:28
674000 -- (-1804.999) [-1794.755] (-1796.390) (-1800.136) * (-1798.580) (-1798.138) [-1791.356] (-1808.183) -- 0:02:28
674500 -- (-1799.249) (-1799.758) (-1803.066) [-1794.753] * [-1793.622] (-1795.671) (-1803.429) (-1806.568) -- 0:02:28
675000 -- (-1811.012) (-1803.384) (-1805.232) [-1796.535] * (-1796.792) (-1804.777) [-1800.782] (-1796.452) -- 0:02:27
Average standard deviation of split frequencies: 0.004998
675500 -- (-1816.954) (-1791.639) [-1795.949] (-1793.239) * [-1799.128] (-1801.248) (-1814.983) (-1797.229) -- 0:02:27
676000 -- (-1813.076) (-1793.852) (-1794.471) [-1793.592] * (-1800.854) [-1801.055] (-1805.142) (-1804.592) -- 0:02:27
676500 -- (-1813.661) [-1796.674] (-1803.169) (-1792.772) * (-1803.462) (-1793.828) (-1802.552) [-1803.831] -- 0:02:27
677000 -- (-1814.713) (-1794.687) (-1797.642) [-1799.579] * (-1804.534) [-1799.568] (-1793.471) (-1797.329) -- 0:02:26
677500 -- [-1801.103] (-1801.657) (-1793.100) (-1802.793) * [-1795.711] (-1796.319) (-1797.061) (-1801.209) -- 0:02:26
678000 -- (-1803.178) (-1806.006) [-1800.989] (-1794.838) * (-1797.376) (-1791.013) (-1801.843) [-1792.399] -- 0:02:26
678500 -- (-1799.955) (-1803.690) [-1794.563] (-1803.769) * (-1795.653) [-1795.332] (-1792.468) (-1792.413) -- 0:02:26
679000 -- (-1802.565) (-1806.573) [-1797.634] (-1801.867) * (-1804.905) (-1797.933) [-1789.337] (-1796.594) -- 0:02:26
679500 -- [-1800.040] (-1799.878) (-1793.663) (-1792.380) * (-1809.363) (-1796.103) (-1794.052) [-1805.524] -- 0:02:25
680000 -- (-1805.674) [-1800.364] (-1807.951) (-1797.347) * (-1791.731) [-1798.104] (-1803.150) (-1794.130) -- 0:02:25
Average standard deviation of split frequencies: 0.005310
680500 -- [-1792.356] (-1798.269) (-1809.125) (-1802.685) * (-1795.513) [-1797.567] (-1805.486) (-1796.073) -- 0:02:25
681000 -- [-1792.441] (-1794.534) (-1796.092) (-1799.219) * (-1801.785) (-1797.409) (-1808.225) [-1806.936] -- 0:02:25
681500 -- (-1799.408) (-1799.808) (-1795.366) [-1791.335] * (-1809.004) (-1798.885) [-1795.323] (-1806.000) -- 0:02:24
682000 -- [-1792.609] (-1802.302) (-1807.103) (-1799.986) * (-1791.646) [-1795.676] (-1800.253) (-1797.483) -- 0:02:24
682500 -- (-1795.422) (-1800.550) [-1794.121] (-1804.080) * [-1804.688] (-1796.865) (-1804.341) (-1799.076) -- 0:02:24
683000 -- (-1802.491) (-1788.998) (-1797.614) [-1803.088] * (-1800.510) (-1794.065) [-1801.406] (-1795.668) -- 0:02:24
683500 -- [-1796.752] (-1807.013) (-1809.389) (-1805.893) * (-1802.005) [-1791.761] (-1798.231) (-1804.431) -- 0:02:24
684000 -- (-1798.384) (-1809.143) [-1803.308] (-1809.532) * (-1794.067) [-1800.882] (-1804.339) (-1804.254) -- 0:02:23
684500 -- (-1798.632) (-1792.682) (-1821.191) [-1791.411] * (-1797.189) (-1795.343) [-1792.520] (-1810.826) -- 0:02:23
685000 -- [-1792.675] (-1796.762) (-1804.231) (-1801.802) * (-1802.317) (-1797.832) [-1796.113] (-1796.697) -- 0:02:23
Average standard deviation of split frequencies: 0.005383
685500 -- (-1803.856) (-1801.648) (-1794.804) [-1798.334] * [-1798.620] (-1813.048) (-1794.708) (-1795.455) -- 0:02:23
686000 -- (-1808.346) (-1797.352) [-1795.617] (-1807.540) * (-1796.486) (-1801.916) [-1793.681] (-1802.402) -- 0:02:22
686500 -- (-1801.995) (-1799.046) [-1793.518] (-1806.625) * (-1799.698) [-1796.038] (-1807.818) (-1800.880) -- 0:02:22
687000 -- [-1793.716] (-1804.518) (-1795.914) (-1812.922) * (-1793.911) (-1795.494) (-1808.238) [-1796.709] -- 0:02:22
687500 -- (-1805.130) (-1796.790) [-1798.676] (-1808.939) * (-1802.035) (-1800.377) (-1798.382) [-1799.124] -- 0:02:22
688000 -- (-1804.044) (-1793.540) (-1796.046) [-1800.864] * [-1799.077] (-1796.272) (-1798.015) (-1806.213) -- 0:02:21
688500 -- (-1803.365) (-1808.971) (-1794.864) [-1792.718] * (-1793.667) [-1801.307] (-1795.027) (-1805.352) -- 0:02:21
689000 -- (-1817.967) (-1796.772) [-1787.615] (-1791.413) * (-1798.459) [-1797.023] (-1793.054) (-1791.235) -- 0:02:21
689500 -- (-1822.111) [-1795.545] (-1802.620) (-1799.369) * (-1809.050) (-1794.281) (-1798.637) [-1789.155] -- 0:02:21
690000 -- (-1814.146) [-1790.504] (-1794.444) (-1788.814) * (-1807.549) (-1801.001) (-1799.228) [-1801.608] -- 0:02:21
Average standard deviation of split frequencies: 0.005517
690500 -- [-1798.143] (-1796.635) (-1795.367) (-1805.833) * (-1794.426) (-1792.264) [-1794.741] (-1802.837) -- 0:02:20
691000 -- (-1804.470) (-1800.313) [-1794.746] (-1797.685) * (-1797.822) [-1806.283] (-1795.280) (-1795.407) -- 0:02:20
691500 -- (-1812.530) (-1795.010) (-1799.175) [-1798.890] * [-1805.308] (-1799.428) (-1790.286) (-1803.778) -- 0:02:20
692000 -- (-1803.256) (-1797.454) (-1798.380) [-1792.048] * [-1796.310] (-1802.014) (-1804.365) (-1798.102) -- 0:02:20
692500 -- [-1804.020] (-1808.603) (-1805.530) (-1800.492) * (-1796.266) (-1795.338) (-1803.694) [-1802.251] -- 0:02:19
693000 -- (-1800.825) (-1792.242) (-1801.837) [-1800.092] * (-1798.194) (-1798.812) [-1799.400] (-1792.373) -- 0:02:19
693500 -- (-1798.274) (-1799.887) (-1790.602) [-1800.733] * (-1795.827) [-1812.013] (-1794.395) (-1804.169) -- 0:02:19
694000 -- [-1797.798] (-1801.736) (-1803.915) (-1798.812) * [-1791.172] (-1810.563) (-1807.460) (-1809.393) -- 0:02:19
694500 -- (-1798.923) (-1805.722) [-1793.863] (-1796.722) * (-1796.333) [-1792.192] (-1797.090) (-1796.010) -- 0:02:19
695000 -- (-1796.653) (-1804.330) (-1801.497) [-1792.253] * (-1806.062) (-1811.820) (-1793.620) [-1796.929] -- 0:02:18
Average standard deviation of split frequencies: 0.005757
695500 -- (-1803.683) (-1804.642) (-1797.541) [-1802.332] * (-1796.562) (-1807.807) (-1798.672) [-1799.920] -- 0:02:18
696000 -- (-1807.485) [-1799.696] (-1809.088) (-1807.635) * (-1798.091) (-1806.388) [-1793.249] (-1796.858) -- 0:02:18
696500 -- (-1800.782) (-1795.758) [-1801.683] (-1788.203) * (-1801.700) (-1805.591) [-1793.504] (-1795.768) -- 0:02:18
697000 -- (-1789.368) [-1794.020] (-1799.164) (-1796.127) * (-1799.871) (-1801.715) [-1799.902] (-1802.076) -- 0:02:17
697500 -- [-1806.094] (-1792.245) (-1806.175) (-1795.497) * (-1795.671) [-1797.706] (-1814.010) (-1792.692) -- 0:02:17
698000 -- [-1786.072] (-1804.804) (-1794.899) (-1802.389) * [-1790.619] (-1795.990) (-1791.296) (-1796.851) -- 0:02:17
698500 -- (-1801.391) (-1801.760) (-1801.300) [-1790.831] * (-1798.574) (-1793.580) [-1800.715] (-1806.873) -- 0:02:17
699000 -- (-1800.484) (-1796.650) [-1808.288] (-1803.329) * (-1797.982) [-1792.167] (-1800.657) (-1794.720) -- 0:02:16
699500 -- (-1799.641) [-1804.087] (-1795.257) (-1803.151) * (-1819.515) (-1804.280) [-1796.266] (-1800.660) -- 0:02:16
700000 -- [-1798.528] (-1794.275) (-1797.541) (-1809.545) * (-1800.229) (-1801.182) (-1806.960) [-1792.765] -- 0:02:16
Average standard deviation of split frequencies: 0.004934
700500 -- (-1796.254) (-1799.232) [-1802.857] (-1809.668) * (-1793.994) (-1796.582) [-1804.010] (-1796.843) -- 0:02:16
701000 -- [-1800.769] (-1815.922) (-1798.959) (-1811.269) * (-1804.443) (-1809.384) [-1795.912] (-1802.423) -- 0:02:16
701500 -- (-1803.322) (-1797.276) (-1803.055) [-1800.200] * (-1799.529) (-1804.654) [-1790.909] (-1802.464) -- 0:02:15
702000 -- (-1801.558) (-1809.153) (-1808.803) [-1805.657] * (-1797.993) (-1794.437) [-1793.645] (-1801.955) -- 0:02:15
702500 -- (-1804.811) [-1802.217] (-1813.216) (-1805.950) * [-1795.722] (-1789.937) (-1800.700) (-1812.434) -- 0:02:15
703000 -- (-1801.569) (-1797.461) [-1794.183] (-1800.336) * (-1802.582) (-1794.858) (-1799.273) [-1795.412] -- 0:02:15
703500 -- (-1800.702) [-1796.170] (-1796.970) (-1796.258) * (-1793.924) (-1796.407) [-1804.036] (-1800.286) -- 0:02:14
704000 -- (-1792.057) (-1805.389) [-1800.619] (-1795.643) * [-1796.612] (-1800.151) (-1796.529) (-1798.793) -- 0:02:14
704500 -- [-1794.778] (-1820.084) (-1809.631) (-1794.251) * (-1797.781) (-1791.547) [-1802.792] (-1791.668) -- 0:02:14
705000 -- (-1794.369) (-1800.549) (-1801.345) [-1792.565] * [-1795.542] (-1798.684) (-1797.408) (-1796.955) -- 0:02:14
Average standard deviation of split frequencies: 0.005509
705500 -- [-1801.618] (-1810.337) (-1802.613) (-1801.597) * [-1796.181] (-1799.747) (-1796.562) (-1792.943) -- 0:02:13
706000 -- (-1799.762) (-1796.521) (-1811.748) [-1805.842] * (-1804.273) [-1797.433] (-1794.444) (-1802.460) -- 0:02:13
706500 -- [-1798.794] (-1806.317) (-1806.221) (-1808.712) * (-1813.394) [-1794.071] (-1788.249) (-1797.046) -- 0:02:13
707000 -- (-1810.494) [-1795.138] (-1826.854) (-1794.081) * (-1802.679) (-1792.438) [-1795.565] (-1799.894) -- 0:02:13
707500 -- [-1795.982] (-1790.413) (-1798.646) (-1806.647) * [-1796.902] (-1792.729) (-1802.394) (-1807.349) -- 0:02:13
708000 -- (-1798.920) (-1795.918) [-1799.914] (-1800.265) * (-1794.194) (-1797.933) [-1792.780] (-1804.016) -- 0:02:12
708500 -- (-1794.605) [-1793.749] (-1795.617) (-1802.755) * (-1798.290) (-1795.822) (-1807.261) [-1796.659] -- 0:02:12
709000 -- (-1800.602) [-1798.190] (-1804.645) (-1801.873) * (-1797.620) (-1802.654) [-1801.716] (-1797.070) -- 0:02:12
709500 -- (-1807.883) (-1809.920) [-1792.850] (-1793.322) * (-1801.894) (-1795.889) (-1806.892) [-1795.489] -- 0:02:12
710000 -- (-1795.127) [-1798.634] (-1811.085) (-1795.736) * [-1796.449] (-1798.645) (-1825.093) (-1794.083) -- 0:02:11
Average standard deviation of split frequencies: 0.005638
710500 -- (-1798.528) [-1796.127] (-1792.425) (-1791.951) * (-1798.121) (-1799.238) (-1811.117) [-1796.765] -- 0:02:11
711000 -- [-1804.509] (-1791.898) (-1794.917) (-1796.326) * [-1798.138] (-1794.951) (-1800.677) (-1802.198) -- 0:02:11
711500 -- (-1803.289) (-1802.765) [-1791.866] (-1794.866) * (-1800.415) (-1810.991) (-1800.448) [-1791.427] -- 0:02:11
712000 -- [-1796.742] (-1804.416) (-1800.077) (-1800.635) * (-1797.241) (-1797.352) [-1800.816] (-1799.184) -- 0:02:11
712500 -- (-1800.323) (-1792.334) [-1793.587] (-1805.844) * (-1805.141) (-1802.972) (-1802.756) [-1802.553] -- 0:02:10
713000 -- (-1801.328) (-1797.529) (-1800.010) [-1789.663] * (-1805.559) [-1798.926] (-1798.605) (-1797.940) -- 0:02:10
713500 -- [-1795.663] (-1812.312) (-1806.709) (-1795.141) * (-1811.119) (-1804.354) (-1804.062) [-1792.592] -- 0:02:10
714000 -- [-1803.298] (-1795.172) (-1796.580) (-1802.724) * (-1800.496) [-1795.774] (-1802.041) (-1801.251) -- 0:02:10
714500 -- [-1796.958] (-1797.453) (-1795.474) (-1800.552) * (-1798.857) [-1797.260] (-1805.403) (-1795.851) -- 0:02:09
715000 -- (-1807.101) [-1799.504] (-1794.724) (-1795.509) * (-1793.785) [-1812.344] (-1797.930) (-1799.567) -- 0:02:09
Average standard deviation of split frequencies: 0.005761
715500 -- (-1805.099) (-1799.348) (-1792.789) [-1797.835] * (-1801.189) (-1809.016) [-1790.040] (-1802.174) -- 0:02:09
716000 -- (-1795.215) (-1796.821) [-1800.630] (-1797.149) * (-1801.467) [-1796.290] (-1795.017) (-1801.819) -- 0:02:09
716500 -- (-1799.307) (-1789.330) [-1802.125] (-1798.038) * (-1811.853) (-1807.722) [-1798.930] (-1801.711) -- 0:02:08
717000 -- (-1804.823) (-1794.093) [-1795.054] (-1798.707) * (-1794.677) [-1799.253] (-1798.632) (-1798.880) -- 0:02:08
717500 -- (-1800.129) [-1797.903] (-1798.964) (-1798.657) * (-1801.533) (-1791.720) [-1797.479] (-1812.138) -- 0:02:08
718000 -- (-1797.927) (-1794.276) [-1791.708] (-1800.198) * (-1802.783) (-1798.657) [-1804.675] (-1806.534) -- 0:02:08
718500 -- [-1802.369] (-1800.518) (-1798.381) (-1800.310) * (-1799.361) (-1806.101) (-1810.676) [-1796.654] -- 0:02:08
719000 -- (-1795.134) (-1805.736) [-1793.038] (-1797.411) * (-1808.995) (-1803.469) (-1792.849) [-1799.743] -- 0:02:07
719500 -- (-1800.292) [-1795.259] (-1822.891) (-1799.188) * (-1806.829) (-1805.556) [-1791.717] (-1810.372) -- 0:02:07
720000 -- (-1796.850) (-1802.580) (-1804.783) [-1797.830] * (-1805.391) (-1793.000) [-1796.215] (-1813.623) -- 0:02:07
Average standard deviation of split frequencies: 0.005996
720500 -- (-1807.397) (-1797.759) (-1807.437) [-1796.617] * [-1803.449] (-1802.592) (-1790.119) (-1801.166) -- 0:02:07
721000 -- [-1809.360] (-1806.421) (-1805.008) (-1805.415) * [-1796.077] (-1798.563) (-1790.482) (-1804.526) -- 0:02:06
721500 -- (-1797.689) [-1791.896] (-1813.226) (-1813.049) * [-1797.487] (-1811.150) (-1789.209) (-1803.949) -- 0:02:06
722000 -- (-1797.270) [-1795.944] (-1803.659) (-1797.125) * [-1789.406] (-1802.974) (-1793.887) (-1802.603) -- 0:02:06
722500 -- (-1794.128) (-1799.155) (-1807.913) [-1798.399] * [-1787.920] (-1793.769) (-1805.478) (-1798.439) -- 0:02:06
723000 -- (-1792.009) (-1801.530) (-1801.497) [-1791.431] * (-1790.580) (-1801.526) [-1794.591] (-1809.113) -- 0:02:06
723500 -- (-1789.489) (-1796.826) [-1794.887] (-1810.268) * (-1794.980) (-1809.294) [-1798.565] (-1797.702) -- 0:02:05
724000 -- (-1803.219) (-1810.101) [-1799.169] (-1801.706) * (-1806.951) (-1795.224) [-1787.726] (-1807.333) -- 0:02:05
724500 -- (-1802.160) (-1797.148) [-1789.827] (-1799.138) * (-1804.259) (-1796.801) (-1798.756) [-1795.438] -- 0:02:05
725000 -- (-1807.483) (-1796.130) (-1801.492) [-1804.673] * (-1803.072) (-1798.286) [-1801.396] (-1795.335) -- 0:02:05
Average standard deviation of split frequencies: 0.005952
725500 -- (-1801.019) (-1798.659) [-1808.337] (-1795.652) * [-1799.877] (-1791.586) (-1793.984) (-1799.852) -- 0:02:04
726000 -- (-1809.169) (-1801.216) [-1797.913] (-1797.253) * [-1793.278] (-1797.521) (-1802.304) (-1806.092) -- 0:02:04
726500 -- (-1796.826) [-1801.625] (-1802.675) (-1799.382) * (-1796.934) (-1800.917) [-1800.818] (-1810.933) -- 0:02:04
727000 -- [-1795.750] (-1811.338) (-1807.066) (-1795.567) * (-1798.910) (-1793.360) (-1795.881) [-1793.314] -- 0:02:04
727500 -- [-1796.776] (-1807.142) (-1808.820) (-1801.550) * (-1801.598) [-1797.906] (-1798.358) (-1802.000) -- 0:02:03
728000 -- (-1803.205) (-1791.155) (-1796.640) [-1795.752] * (-1800.562) (-1815.791) [-1793.399] (-1804.049) -- 0:02:03
728500 -- (-1805.166) (-1807.828) (-1791.677) [-1795.418] * [-1795.941] (-1822.682) (-1797.657) (-1798.195) -- 0:02:03
729000 -- (-1803.376) (-1795.592) [-1800.554] (-1798.059) * [-1801.021] (-1806.690) (-1796.767) (-1797.783) -- 0:02:03
729500 -- (-1801.236) [-1790.898] (-1792.856) (-1798.572) * (-1809.200) (-1808.883) (-1796.868) [-1794.659] -- 0:02:03
730000 -- (-1799.360) (-1798.037) (-1798.244) [-1789.929] * [-1796.078] (-1800.639) (-1807.906) (-1798.551) -- 0:02:02
Average standard deviation of split frequencies: 0.006075
730500 -- (-1800.585) (-1801.441) (-1790.074) [-1789.696] * [-1788.691] (-1795.503) (-1798.386) (-1801.650) -- 0:02:02
731000 -- [-1799.018] (-1801.026) (-1792.505) (-1798.321) * (-1797.496) (-1813.148) (-1805.621) [-1796.459] -- 0:02:02
731500 -- [-1788.397] (-1803.023) (-1789.824) (-1804.332) * (-1796.880) (-1796.523) (-1803.213) [-1793.968] -- 0:02:02
732000 -- (-1796.654) [-1802.331] (-1791.844) (-1796.697) * [-1799.991] (-1799.681) (-1796.913) (-1804.567) -- 0:02:01
732500 -- (-1800.374) (-1805.774) [-1793.707] (-1801.797) * (-1803.364) [-1798.660] (-1793.789) (-1805.386) -- 0:02:01
733000 -- (-1792.630) [-1795.392] (-1803.013) (-1799.147) * (-1791.511) [-1797.844] (-1798.599) (-1799.513) -- 0:02:01
733500 -- (-1791.539) (-1799.356) [-1797.902] (-1802.151) * [-1797.006] (-1795.911) (-1801.245) (-1795.303) -- 0:02:01
734000 -- (-1793.906) (-1793.338) [-1792.796] (-1795.844) * [-1796.779] (-1800.492) (-1799.706) (-1805.902) -- 0:02:01
734500 -- (-1795.085) [-1799.395] (-1796.121) (-1800.275) * (-1802.795) (-1799.064) [-1794.339] (-1791.986) -- 0:02:00
735000 -- (-1793.587) (-1792.431) (-1802.351) [-1800.477] * (-1797.726) (-1792.427) (-1794.281) [-1800.008] -- 0:02:00
Average standard deviation of split frequencies: 0.006298
735500 -- (-1796.992) [-1790.216] (-1796.413) (-1797.967) * (-1798.483) (-1793.770) [-1790.254] (-1802.348) -- 0:02:00
736000 -- (-1799.525) [-1795.223] (-1794.237) (-1798.684) * (-1798.392) (-1797.703) (-1804.491) [-1784.892] -- 0:02:00
736500 -- (-1803.779) [-1803.918] (-1797.822) (-1802.343) * [-1795.647] (-1790.409) (-1800.733) (-1792.476) -- 0:01:59
737000 -- [-1801.955] (-1806.281) (-1807.037) (-1794.319) * (-1794.790) (-1799.246) [-1797.823] (-1813.897) -- 0:01:59
737500 -- (-1805.331) (-1804.223) [-1796.516] (-1808.709) * (-1793.327) (-1797.096) [-1801.983] (-1807.556) -- 0:01:59
738000 -- (-1807.366) (-1799.297) (-1804.648) [-1796.844] * (-1796.318) [-1801.799] (-1799.270) (-1801.023) -- 0:01:59
738500 -- (-1812.620) (-1801.913) [-1793.315] (-1804.439) * (-1799.915) (-1809.398) [-1794.009] (-1804.937) -- 0:01:58
739000 -- (-1796.241) (-1808.819) (-1801.437) [-1789.659] * (-1801.789) [-1800.013] (-1795.551) (-1812.936) -- 0:01:58
739500 -- (-1797.738) (-1808.258) [-1792.666] (-1789.944) * (-1804.270) (-1796.713) [-1795.576] (-1800.994) -- 0:01:58
740000 -- (-1813.129) (-1802.436) (-1797.978) [-1798.165] * (-1815.874) (-1799.137) (-1804.962) [-1791.896] -- 0:01:58
Average standard deviation of split frequencies: 0.006789
740500 -- [-1797.678] (-1810.122) (-1798.011) (-1805.316) * (-1801.594) [-1808.152] (-1806.445) (-1799.271) -- 0:01:58
741000 -- (-1800.500) (-1795.044) [-1797.529] (-1797.305) * (-1811.484) [-1803.963] (-1809.679) (-1796.452) -- 0:01:57
741500 -- [-1793.431] (-1792.397) (-1800.026) (-1802.574) * [-1800.411] (-1811.972) (-1803.702) (-1796.665) -- 0:01:57
742000 -- (-1799.737) [-1796.817] (-1798.485) (-1797.844) * (-1809.603) (-1812.874) (-1797.733) [-1800.093] -- 0:01:57
742500 -- (-1805.263) (-1801.997) (-1789.819) [-1794.229] * (-1803.086) (-1806.482) [-1797.154] (-1797.863) -- 0:01:57
743000 -- (-1806.702) (-1800.739) [-1800.732] (-1796.390) * (-1813.751) (-1802.110) (-1797.278) [-1799.259] -- 0:01:56
743500 -- [-1797.415] (-1808.640) (-1803.647) (-1802.491) * (-1811.836) [-1793.858] (-1812.758) (-1806.408) -- 0:01:56
744000 -- (-1801.062) (-1796.603) (-1792.545) [-1797.915] * (-1798.965) (-1795.865) (-1799.625) [-1794.404] -- 0:01:56
744500 -- [-1800.868] (-1813.338) (-1799.724) (-1806.042) * (-1801.709) (-1795.722) (-1796.469) [-1791.477] -- 0:01:56
745000 -- (-1798.447) [-1793.888] (-1809.617) (-1791.845) * (-1794.914) [-1798.681] (-1793.638) (-1791.490) -- 0:01:56
Average standard deviation of split frequencies: 0.007162
745500 -- [-1795.618] (-1794.438) (-1805.936) (-1801.964) * (-1798.854) (-1801.637) (-1786.826) [-1803.338] -- 0:01:55
746000 -- (-1801.941) [-1792.967] (-1790.007) (-1809.612) * (-1794.143) (-1796.773) (-1802.082) [-1797.429] -- 0:01:55
746500 -- (-1802.557) [-1794.613] (-1796.086) (-1804.026) * (-1795.551) (-1804.166) [-1795.274] (-1806.889) -- 0:01:55
747000 -- (-1804.238) [-1794.314] (-1803.800) (-1805.975) * (-1803.607) (-1809.464) [-1797.317] (-1802.803) -- 0:01:55
747500 -- (-1804.571) (-1812.667) (-1794.310) [-1794.941] * (-1816.535) [-1800.792] (-1801.914) (-1798.804) -- 0:01:54
748000 -- [-1797.528] (-1812.868) (-1800.496) (-1801.030) * [-1803.006] (-1800.300) (-1799.426) (-1804.675) -- 0:01:54
748500 -- (-1800.579) [-1802.794] (-1806.842) (-1798.324) * (-1814.198) (-1803.371) [-1807.393] (-1796.307) -- 0:01:54
749000 -- [-1804.618] (-1794.765) (-1792.651) (-1803.015) * (-1808.846) (-1807.667) [-1805.511] (-1802.454) -- 0:01:54
749500 -- (-1801.601) (-1805.679) (-1802.492) [-1801.510] * (-1796.177) (-1796.081) [-1796.994] (-1805.094) -- 0:01:53
750000 -- (-1803.026) (-1790.785) [-1795.518] (-1801.792) * (-1807.191) (-1796.197) [-1795.909] (-1798.589) -- 0:01:53
Average standard deviation of split frequencies: 0.006960
750500 -- (-1806.213) (-1797.148) [-1789.844] (-1796.043) * (-1795.985) (-1803.635) [-1805.775] (-1805.894) -- 0:01:53
751000 -- (-1806.621) (-1797.162) (-1794.347) [-1795.103] * (-1804.608) [-1799.403] (-1803.749) (-1798.580) -- 0:01:53
751500 -- [-1798.335] (-1800.562) (-1802.330) (-1800.748) * (-1794.640) (-1802.626) [-1793.747] (-1797.071) -- 0:01:53
752000 -- (-1793.769) (-1804.290) (-1803.410) [-1802.819] * [-1789.710] (-1803.438) (-1800.645) (-1799.090) -- 0:01:52
752500 -- (-1803.554) [-1797.089] (-1796.019) (-1791.403) * (-1794.468) (-1793.862) (-1810.257) [-1792.371] -- 0:01:52
753000 -- (-1804.638) (-1809.721) [-1799.260] (-1804.197) * (-1803.616) (-1796.839) (-1797.163) [-1792.882] -- 0:01:52
753500 -- (-1801.161) (-1794.064) [-1793.613] (-1799.529) * [-1791.438] (-1800.876) (-1801.501) (-1802.649) -- 0:01:52
754000 -- (-1800.410) [-1796.356] (-1794.667) (-1805.760) * [-1791.099] (-1804.127) (-1800.619) (-1790.139) -- 0:01:51
754500 -- (-1798.222) [-1790.550] (-1800.451) (-1806.018) * (-1804.403) (-1800.648) (-1802.106) [-1800.117] -- 0:01:51
755000 -- [-1800.240] (-1795.695) (-1803.113) (-1793.708) * (-1805.716) [-1795.504] (-1802.713) (-1801.033) -- 0:01:51
Average standard deviation of split frequencies: 0.006859
755500 -- (-1792.430) [-1799.800] (-1799.096) (-1798.404) * (-1804.250) (-1800.038) (-1798.034) [-1793.728] -- 0:01:51
756000 -- (-1794.786) [-1797.488] (-1798.294) (-1798.931) * (-1802.262) [-1803.367] (-1798.319) (-1802.522) -- 0:01:51
756500 -- [-1797.513] (-1800.235) (-1793.489) (-1792.075) * (-1799.397) (-1799.048) [-1794.981] (-1797.542) -- 0:01:50
757000 -- [-1795.620] (-1789.394) (-1799.498) (-1791.997) * (-1806.922) (-1802.467) (-1804.480) [-1797.266] -- 0:01:50
757500 -- [-1794.579] (-1800.513) (-1796.926) (-1800.288) * (-1799.421) (-1797.169) (-1792.878) [-1803.070] -- 0:01:50
758000 -- (-1804.033) (-1806.194) (-1800.004) [-1795.817] * (-1797.954) [-1800.245] (-1806.218) (-1790.259) -- 0:01:50
758500 -- (-1797.068) (-1804.244) (-1803.037) [-1806.275] * (-1803.296) (-1791.223) (-1808.240) [-1800.849] -- 0:01:49
759000 -- (-1802.963) (-1798.471) (-1795.454) [-1803.454] * (-1799.952) [-1794.224] (-1796.708) (-1798.443) -- 0:01:49
759500 -- [-1795.663] (-1791.914) (-1803.237) (-1807.381) * (-1796.761) [-1800.076] (-1791.867) (-1799.192) -- 0:01:49
760000 -- (-1796.282) (-1796.595) (-1795.490) [-1794.011] * (-1801.358) [-1795.016] (-1794.206) (-1802.601) -- 0:01:49
Average standard deviation of split frequencies: 0.006972
760500 -- [-1795.122] (-1806.051) (-1798.790) (-1805.358) * (-1795.414) (-1797.454) [-1797.140] (-1800.928) -- 0:01:48
761000 -- [-1805.802] (-1800.194) (-1798.100) (-1808.278) * (-1801.293) (-1791.446) (-1789.692) [-1803.807] -- 0:01:48
761500 -- (-1801.089) (-1796.051) [-1794.789] (-1796.209) * (-1804.348) (-1795.696) (-1802.685) [-1801.700] -- 0:01:48
762000 -- (-1812.735) [-1794.802] (-1798.507) (-1790.573) * (-1809.796) (-1807.991) (-1796.245) [-1803.565] -- 0:01:48
762500 -- (-1803.304) (-1789.938) (-1798.356) [-1794.837] * [-1794.321] (-1797.880) (-1804.688) (-1804.922) -- 0:01:48
763000 -- [-1803.205] (-1802.761) (-1799.290) (-1803.408) * [-1799.828] (-1802.591) (-1805.559) (-1802.116) -- 0:01:47
763500 -- [-1790.498] (-1809.146) (-1792.469) (-1799.117) * (-1798.920) (-1807.181) (-1791.811) [-1792.962] -- 0:01:47
764000 -- (-1791.888) (-1810.773) [-1788.713] (-1798.359) * [-1798.636] (-1805.206) (-1798.483) (-1801.393) -- 0:01:47
764500 -- [-1795.617] (-1806.410) (-1797.856) (-1796.885) * (-1799.965) [-1796.771] (-1809.431) (-1794.376) -- 0:01:47
765000 -- [-1797.000] (-1800.911) (-1797.745) (-1794.813) * [-1795.861] (-1795.444) (-1810.574) (-1803.258) -- 0:01:46
Average standard deviation of split frequencies: 0.006975
765500 -- (-1810.264) [-1798.906] (-1798.451) (-1803.819) * (-1800.063) [-1794.944] (-1800.855) (-1803.566) -- 0:01:46
766000 -- (-1806.050) (-1802.978) (-1796.676) [-1797.048] * (-1794.902) (-1795.275) (-1801.575) [-1799.291] -- 0:01:46
766500 -- (-1799.613) [-1794.974] (-1798.088) (-1810.727) * [-1788.547] (-1796.993) (-1812.579) (-1795.336) -- 0:01:46
767000 -- (-1795.383) (-1801.013) [-1793.976] (-1794.633) * [-1792.435] (-1802.127) (-1807.537) (-1801.870) -- 0:01:46
767500 -- [-1808.268] (-1797.255) (-1796.893) (-1799.959) * (-1796.834) (-1792.353) [-1798.363] (-1801.741) -- 0:01:45
768000 -- (-1800.403) (-1792.457) [-1798.674] (-1803.933) * [-1795.455] (-1792.098) (-1796.828) (-1805.542) -- 0:01:45
768500 -- (-1799.985) (-1796.682) (-1803.465) [-1794.003] * (-1802.808) [-1792.929] (-1796.246) (-1806.261) -- 0:01:45
769000 -- (-1795.237) (-1801.057) (-1806.713) [-1796.125] * (-1808.335) (-1793.040) (-1807.579) [-1800.309] -- 0:01:45
769500 -- (-1793.069) [-1800.141] (-1807.768) (-1794.201) * [-1797.622] (-1789.060) (-1805.155) (-1808.580) -- 0:01:44
770000 -- (-1809.185) [-1796.262] (-1793.750) (-1799.116) * [-1797.308] (-1799.195) (-1795.053) (-1811.462) -- 0:01:44
Average standard deviation of split frequencies: 0.007187
770500 -- (-1793.674) (-1793.520) [-1794.408] (-1811.250) * (-1800.050) (-1797.164) (-1800.039) [-1806.834] -- 0:01:44
771000 -- [-1801.787] (-1798.998) (-1790.629) (-1802.694) * (-1810.677) (-1802.947) (-1807.789) [-1811.116] -- 0:01:44
771500 -- (-1793.310) (-1794.391) (-1790.096) [-1798.965] * (-1797.076) (-1799.778) [-1791.028] (-1797.973) -- 0:01:43
772000 -- (-1802.408) (-1799.885) [-1801.560] (-1811.118) * (-1800.476) [-1797.164] (-1796.319) (-1805.110) -- 0:01:43
772500 -- (-1806.800) [-1796.683] (-1803.490) (-1794.799) * (-1797.538) [-1798.581] (-1794.877) (-1801.969) -- 0:01:43
773000 -- (-1812.535) [-1798.844] (-1814.717) (-1794.743) * (-1795.255) (-1801.884) [-1793.077] (-1794.886) -- 0:01:43
773500 -- [-1795.841] (-1799.491) (-1804.075) (-1798.219) * (-1806.763) (-1806.578) (-1804.581) [-1797.942] -- 0:01:43
774000 -- (-1801.949) [-1808.482] (-1797.896) (-1792.782) * (-1803.626) (-1804.871) [-1802.030] (-1792.740) -- 0:01:42
774500 -- (-1793.727) [-1792.752] (-1805.940) (-1792.623) * (-1790.450) (-1793.397) [-1799.333] (-1793.240) -- 0:01:42
775000 -- (-1800.436) [-1796.316] (-1805.867) (-1802.220) * (-1795.527) (-1796.453) (-1797.829) [-1793.283] -- 0:01:42
Average standard deviation of split frequencies: 0.006530
775500 -- (-1803.811) (-1803.754) (-1809.936) [-1796.263] * [-1791.094] (-1798.046) (-1807.622) (-1800.732) -- 0:01:42
776000 -- (-1801.933) [-1801.151] (-1796.365) (-1791.164) * (-1799.000) (-1807.459) (-1798.408) [-1794.470] -- 0:01:41
776500 -- (-1806.547) (-1790.675) [-1790.237] (-1806.023) * [-1793.747] (-1799.695) (-1805.919) (-1791.290) -- 0:01:41
777000 -- (-1810.715) (-1800.961) [-1794.308] (-1797.921) * [-1794.335] (-1804.858) (-1797.717) (-1801.505) -- 0:01:41
777500 -- (-1798.475) (-1797.642) [-1791.873] (-1801.797) * [-1797.354] (-1800.774) (-1796.061) (-1815.355) -- 0:01:41
778000 -- (-1796.969) (-1798.233) (-1799.588) [-1803.831] * (-1802.004) (-1802.514) (-1801.745) [-1802.268] -- 0:01:41
778500 -- (-1800.887) [-1806.214] (-1802.200) (-1792.874) * (-1799.121) (-1796.189) (-1803.925) [-1791.822] -- 0:01:40
779000 -- [-1800.238] (-1793.077) (-1797.498) (-1795.872) * (-1795.727) [-1792.147] (-1797.127) (-1791.440) -- 0:01:40
779500 -- (-1796.677) [-1793.691] (-1790.481) (-1799.105) * (-1798.218) (-1795.541) (-1794.833) [-1798.270] -- 0:01:40
780000 -- (-1820.127) (-1792.202) [-1799.071] (-1794.812) * (-1799.671) (-1796.638) (-1796.174) [-1799.948] -- 0:01:40
Average standard deviation of split frequencies: 0.006944
780500 -- [-1801.822] (-1797.336) (-1804.607) (-1801.000) * (-1799.216) (-1801.019) [-1801.583] (-1800.382) -- 0:01:39
781000 -- [-1798.330] (-1798.234) (-1799.057) (-1803.626) * (-1799.449) [-1798.394] (-1799.916) (-1807.012) -- 0:01:39
781500 -- [-1799.973] (-1795.955) (-1800.353) (-1813.218) * [-1790.629] (-1797.147) (-1794.537) (-1805.814) -- 0:01:39
782000 -- (-1791.965) [-1802.388] (-1803.825) (-1791.565) * (-1799.672) (-1802.600) [-1797.532] (-1806.003) -- 0:01:39
782500 -- (-1792.956) [-1799.997] (-1800.290) (-1804.013) * (-1818.578) (-1801.346) [-1791.673] (-1795.195) -- 0:01:38
783000 -- (-1802.719) [-1792.589] (-1796.141) (-1808.158) * (-1804.815) (-1800.334) (-1808.408) [-1792.504] -- 0:01:38
783500 -- (-1806.470) (-1795.982) (-1802.387) [-1796.041] * (-1805.863) [-1809.442] (-1796.475) (-1792.001) -- 0:01:38
784000 -- (-1801.581) (-1802.733) (-1807.145) [-1792.036] * (-1809.199) (-1800.649) (-1796.725) [-1797.820] -- 0:01:38
784500 -- [-1801.592] (-1805.266) (-1796.622) (-1803.021) * [-1802.195] (-1798.756) (-1812.971) (-1804.396) -- 0:01:38
785000 -- (-1804.345) [-1798.583] (-1802.691) (-1796.579) * (-1799.759) [-1793.409] (-1794.004) (-1789.948) -- 0:01:37
Average standard deviation of split frequencies: 0.007047
785500 -- (-1805.839) [-1793.547] (-1802.185) (-1796.182) * (-1795.660) [-1793.657] (-1810.528) (-1800.785) -- 0:01:37
786000 -- (-1797.295) (-1798.919) [-1795.976] (-1797.760) * (-1803.529) (-1804.765) (-1819.226) [-1795.873] -- 0:01:37
786500 -- (-1811.434) (-1799.058) (-1805.732) [-1791.324] * (-1794.217) (-1806.089) (-1798.072) [-1788.878] -- 0:01:37
787000 -- [-1798.055] (-1810.960) (-1804.500) (-1792.026) * (-1799.871) (-1810.798) [-1795.517] (-1796.839) -- 0:01:36
787500 -- (-1796.713) (-1798.803) (-1809.944) [-1794.186] * (-1800.844) (-1803.197) (-1801.453) [-1800.290] -- 0:01:36
788000 -- [-1799.380] (-1797.708) (-1816.832) (-1798.419) * [-1798.374] (-1802.529) (-1796.742) (-1806.901) -- 0:01:36
788500 -- (-1795.589) (-1800.438) (-1797.550) [-1797.034] * (-1786.403) (-1806.045) [-1803.803] (-1802.664) -- 0:01:36
789000 -- (-1806.645) (-1794.457) [-1792.540] (-1799.566) * (-1793.117) (-1793.425) [-1797.022] (-1799.411) -- 0:01:36
789500 -- (-1808.406) (-1800.336) (-1800.136) [-1791.009] * (-1795.962) (-1806.198) (-1797.271) [-1795.962] -- 0:01:35
790000 -- [-1796.990] (-1808.536) (-1798.408) (-1806.217) * (-1797.818) (-1801.343) (-1804.800) [-1791.748] -- 0:01:35
Average standard deviation of split frequencies: 0.006707
790500 -- [-1795.107] (-1793.734) (-1802.972) (-1793.189) * (-1802.863) (-1794.961) (-1811.352) [-1800.036] -- 0:01:35
791000 -- (-1804.500) [-1798.749] (-1796.541) (-1798.582) * (-1800.091) [-1798.794] (-1795.282) (-1802.869) -- 0:01:35
791500 -- (-1791.486) (-1791.525) [-1795.346] (-1795.781) * (-1799.934) (-1799.536) (-1792.606) [-1792.792] -- 0:01:34
792000 -- (-1794.692) (-1803.663) (-1803.878) [-1796.205] * [-1795.310] (-1807.134) (-1793.903) (-1799.017) -- 0:01:34
792500 -- (-1799.046) (-1816.547) [-1790.366] (-1796.070) * [-1800.848] (-1799.104) (-1792.987) (-1791.581) -- 0:01:34
793000 -- (-1795.532) (-1797.437) [-1792.772] (-1802.185) * [-1801.910] (-1794.653) (-1798.818) (-1810.905) -- 0:01:34
793500 -- (-1796.041) (-1799.752) [-1790.391] (-1797.232) * (-1802.451) (-1796.144) [-1795.537] (-1800.211) -- 0:01:33
794000 -- (-1792.764) (-1791.927) [-1788.951] (-1798.109) * (-1809.024) (-1797.825) [-1799.299] (-1803.001) -- 0:01:33
794500 -- (-1802.862) (-1797.191) [-1796.292] (-1797.478) * (-1800.620) (-1799.598) [-1800.367] (-1801.506) -- 0:01:33
795000 -- (-1794.682) (-1800.471) (-1805.565) [-1797.009] * (-1793.484) (-1817.413) [-1799.895] (-1793.988) -- 0:01:33
Average standard deviation of split frequencies: 0.006564
795500 -- (-1805.511) (-1797.611) (-1798.174) [-1800.770] * (-1798.417) (-1796.272) [-1796.056] (-1801.489) -- 0:01:33
796000 -- [-1793.972] (-1805.571) (-1793.702) (-1802.330) * [-1798.632] (-1810.478) (-1796.491) (-1803.459) -- 0:01:32
796500 -- [-1793.145] (-1807.328) (-1803.547) (-1811.081) * (-1795.158) (-1798.388) (-1800.502) [-1802.278] -- 0:01:32
797000 -- (-1804.446) (-1810.582) [-1808.264] (-1810.766) * [-1791.214] (-1798.706) (-1796.280) (-1792.652) -- 0:01:32
797500 -- (-1795.694) [-1793.940] (-1795.648) (-1794.302) * (-1796.498) [-1794.170] (-1801.070) (-1792.799) -- 0:01:32
798000 -- (-1798.729) (-1809.210) [-1790.847] (-1800.493) * (-1800.003) (-1792.911) (-1798.315) [-1798.690] -- 0:01:31
798500 -- (-1802.387) (-1797.015) (-1798.488) [-1790.247] * (-1791.637) (-1793.287) [-1799.014] (-1794.662) -- 0:01:31
799000 -- (-1796.237) [-1791.872] (-1801.029) (-1803.524) * (-1800.050) (-1803.377) (-1791.236) [-1789.217] -- 0:01:31
799500 -- (-1793.460) (-1802.747) (-1799.917) [-1803.613] * (-1809.084) [-1790.453] (-1793.575) (-1790.195) -- 0:01:31
800000 -- (-1798.455) (-1811.179) [-1797.861] (-1801.791) * [-1798.267] (-1804.497) (-1809.543) (-1792.093) -- 0:01:31
Average standard deviation of split frequencies: 0.006427
800500 -- (-1794.548) (-1814.475) [-1794.802] (-1793.538) * (-1792.541) (-1809.872) [-1795.027] (-1795.092) -- 0:01:30
801000 -- (-1799.292) (-1792.867) [-1795.293] (-1793.344) * (-1798.072) (-1801.764) [-1798.936] (-1795.874) -- 0:01:30
801500 -- (-1795.278) (-1790.800) (-1797.579) [-1795.632] * (-1794.945) (-1794.900) [-1791.369] (-1790.526) -- 0:01:30
802000 -- (-1802.341) [-1791.980] (-1804.122) (-1809.921) * (-1793.279) (-1803.837) (-1793.441) [-1789.907] -- 0:01:30
802500 -- (-1801.562) (-1799.563) [-1795.727] (-1795.513) * (-1795.341) [-1797.157] (-1790.676) (-1802.889) -- 0:01:29
803000 -- (-1802.829) (-1801.943) [-1798.097] (-1807.565) * (-1799.445) (-1796.456) (-1796.154) [-1797.570] -- 0:01:29
803500 -- (-1796.981) (-1796.534) [-1794.282] (-1805.680) * (-1806.690) (-1792.663) (-1802.747) [-1792.603] -- 0:01:29
804000 -- (-1802.802) (-1812.749) (-1791.715) [-1793.172] * (-1801.554) (-1808.630) [-1791.422] (-1808.300) -- 0:01:29
804500 -- (-1799.773) [-1797.619] (-1794.539) (-1803.420) * (-1796.864) (-1807.446) [-1789.708] (-1805.355) -- 0:01:28
805000 -- (-1796.673) [-1806.755] (-1802.870) (-1799.923) * (-1795.928) (-1794.567) (-1809.106) [-1806.299] -- 0:01:28
Average standard deviation of split frequencies: 0.005849
805500 -- (-1811.376) [-1800.088] (-1787.542) (-1799.142) * [-1795.035] (-1802.823) (-1799.136) (-1804.288) -- 0:01:28
806000 -- (-1805.745) (-1801.856) (-1801.756) [-1792.255] * (-1801.283) (-1803.097) [-1799.069] (-1809.500) -- 0:01:28
806500 -- [-1807.159] (-1802.341) (-1804.370) (-1803.066) * (-1795.459) [-1792.011] (-1801.914) (-1798.611) -- 0:01:28
807000 -- (-1808.735) (-1808.619) [-1793.118] (-1810.449) * (-1796.066) [-1797.225] (-1802.188) (-1798.475) -- 0:01:27
807500 -- (-1800.570) [-1799.540] (-1796.823) (-1798.808) * (-1796.579) (-1809.427) (-1812.274) [-1802.422] -- 0:01:27
808000 -- [-1800.646] (-1808.787) (-1804.042) (-1805.027) * (-1801.996) [-1795.710] (-1799.928) (-1795.771) -- 0:01:27
808500 -- (-1798.121) (-1804.783) [-1797.782] (-1796.074) * [-1793.555] (-1793.072) (-1795.745) (-1811.651) -- 0:01:27
809000 -- (-1809.750) (-1799.534) (-1791.982) [-1799.611] * (-1794.047) (-1806.535) [-1789.871] (-1799.596) -- 0:01:26
809500 -- (-1796.208) (-1796.391) [-1792.164] (-1804.714) * (-1797.293) (-1801.449) [-1793.800] (-1803.007) -- 0:01:26
810000 -- [-1810.667] (-1794.156) (-1797.140) (-1794.659) * (-1796.128) [-1794.964] (-1800.979) (-1796.102) -- 0:01:26
Average standard deviation of split frequencies: 0.005718
810500 -- (-1803.124) (-1802.575) (-1802.025) [-1805.667] * (-1798.468) (-1795.099) (-1800.462) [-1797.611] -- 0:01:26
811000 -- [-1803.157] (-1803.871) (-1793.385) (-1798.490) * (-1796.750) (-1800.642) [-1801.714] (-1801.155) -- 0:01:25
811500 -- (-1800.971) (-1796.735) (-1797.777) [-1792.684] * [-1793.068] (-1793.034) (-1795.355) (-1803.448) -- 0:01:25
812000 -- (-1798.328) (-1803.033) (-1808.800) [-1799.063] * (-1802.910) [-1795.441] (-1798.729) (-1815.050) -- 0:01:25
812500 -- [-1800.159] (-1803.605) (-1795.485) (-1797.197) * (-1793.168) (-1802.936) (-1802.975) [-1799.415] -- 0:01:25
813000 -- [-1796.749] (-1823.330) (-1799.905) (-1800.242) * [-1808.016] (-1807.759) (-1805.449) (-1792.611) -- 0:01:25
813500 -- (-1806.868) (-1800.297) (-1809.194) [-1798.505] * [-1812.357] (-1795.967) (-1803.789) (-1797.163) -- 0:01:24
814000 -- (-1806.037) [-1795.448] (-1813.044) (-1791.234) * (-1798.268) (-1795.931) (-1797.093) [-1791.820] -- 0:01:24
814500 -- [-1792.293] (-1798.883) (-1802.362) (-1803.387) * (-1790.862) (-1797.810) [-1794.868] (-1808.218) -- 0:01:24
815000 -- (-1806.056) (-1804.772) [-1801.527] (-1815.480) * (-1800.641) [-1798.088] (-1804.264) (-1795.074) -- 0:01:24
Average standard deviation of split frequencies: 0.005392
815500 -- (-1804.632) (-1796.588) (-1805.139) [-1798.029] * [-1798.270] (-1824.729) (-1812.150) (-1803.249) -- 0:01:23
816000 -- (-1810.574) [-1796.763] (-1792.680) (-1804.634) * (-1797.181) (-1804.974) (-1800.667) [-1796.004] -- 0:01:23
816500 -- (-1803.627) (-1800.641) [-1792.911] (-1794.456) * (-1807.297) (-1800.637) [-1791.702] (-1793.096) -- 0:01:23
817000 -- (-1800.340) (-1801.341) (-1803.854) [-1793.976] * (-1808.524) [-1795.754] (-1799.097) (-1794.731) -- 0:01:23
817500 -- (-1804.786) [-1799.323] (-1802.228) (-1792.347) * (-1797.437) [-1794.191] (-1805.994) (-1798.868) -- 0:01:23
818000 -- [-1794.434] (-1792.415) (-1797.532) (-1792.162) * (-1799.382) (-1804.399) (-1800.456) [-1790.120] -- 0:01:22
818500 -- (-1789.914) [-1800.649] (-1801.492) (-1797.255) * [-1797.233] (-1792.050) (-1797.224) (-1794.603) -- 0:01:22
819000 -- (-1794.971) (-1795.404) (-1806.015) [-1796.071] * [-1798.042] (-1802.322) (-1805.728) (-1795.937) -- 0:01:22
819500 -- (-1802.868) (-1787.184) (-1801.017) [-1797.077] * (-1795.184) (-1797.264) (-1799.135) [-1798.543] -- 0:01:22
820000 -- (-1808.134) (-1793.094) [-1799.073] (-1794.396) * (-1800.553) (-1797.680) [-1798.962] (-1802.937) -- 0:01:21
Average standard deviation of split frequencies: 0.005361
820500 -- (-1810.675) (-1794.115) (-1796.196) [-1798.733] * [-1803.720] (-1796.085) (-1798.927) (-1796.866) -- 0:01:21
821000 -- (-1797.617) (-1801.951) [-1798.145] (-1802.092) * [-1795.645] (-1796.802) (-1813.242) (-1806.118) -- 0:01:21
821500 -- [-1788.211] (-1799.380) (-1799.149) (-1794.348) * [-1794.933] (-1802.660) (-1808.588) (-1801.292) -- 0:01:21
822000 -- (-1791.603) (-1796.190) (-1802.951) [-1791.624] * (-1795.666) (-1795.213) [-1787.197] (-1808.120) -- 0:01:20
822500 -- (-1794.765) (-1795.826) (-1804.709) [-1798.699] * (-1802.249) (-1795.412) [-1797.873] (-1796.766) -- 0:01:20
823000 -- [-1792.200] (-1806.581) (-1811.616) (-1799.003) * (-1799.175) (-1809.381) [-1803.073] (-1802.620) -- 0:01:20
823500 -- (-1796.509) (-1808.404) (-1809.147) [-1801.017] * (-1793.413) (-1806.659) [-1800.285] (-1804.994) -- 0:01:20
824000 -- (-1797.742) [-1800.726] (-1815.714) (-1800.594) * (-1798.241) (-1805.348) (-1800.906) [-1787.489] -- 0:01:20
824500 -- (-1802.309) (-1788.714) [-1801.203] (-1795.496) * (-1796.342) (-1802.816) [-1793.622] (-1791.615) -- 0:01:19
825000 -- (-1813.199) [-1799.374] (-1804.305) (-1794.053) * (-1799.263) (-1805.297) (-1799.674) [-1791.412] -- 0:01:19
Average standard deviation of split frequencies: 0.004899
825500 -- [-1803.253] (-1800.819) (-1806.989) (-1799.185) * (-1802.970) (-1814.307) (-1797.780) [-1795.999] -- 0:01:19
826000 -- [-1799.167] (-1795.194) (-1809.474) (-1798.849) * (-1802.250) [-1789.861] (-1821.590) (-1805.489) -- 0:01:19
826500 -- (-1808.886) (-1795.578) (-1806.345) [-1792.092] * (-1807.344) [-1791.747] (-1799.540) (-1801.313) -- 0:01:18
827000 -- (-1799.867) (-1804.531) [-1795.639] (-1799.139) * (-1802.795) (-1794.176) (-1810.849) [-1792.622] -- 0:01:18
827500 -- (-1794.780) (-1808.300) [-1797.760] (-1796.272) * (-1800.272) (-1794.187) (-1811.216) [-1794.652] -- 0:01:18
828000 -- (-1804.606) [-1796.050] (-1793.670) (-1806.271) * (-1801.685) (-1801.513) (-1804.578) [-1794.138] -- 0:01:18
828500 -- (-1796.439) (-1802.820) [-1794.982] (-1804.572) * (-1797.001) [-1791.274] (-1800.290) (-1795.457) -- 0:01:18
829000 -- (-1808.595) (-1795.211) [-1796.308] (-1814.712) * [-1796.134] (-1796.731) (-1802.997) (-1805.633) -- 0:01:17
829500 -- [-1797.168] (-1795.933) (-1801.984) (-1803.261) * (-1795.864) (-1793.592) [-1804.009] (-1804.114) -- 0:01:17
830000 -- [-1792.192] (-1799.877) (-1805.929) (-1795.806) * (-1798.813) (-1793.288) (-1805.367) [-1793.629] -- 0:01:17
Average standard deviation of split frequencies: 0.004587
830500 -- [-1794.298] (-1797.433) (-1808.823) (-1797.772) * (-1796.734) [-1810.819] (-1799.963) (-1813.066) -- 0:01:17
831000 -- (-1802.861) [-1797.243] (-1802.371) (-1812.428) * (-1804.328) (-1800.245) [-1798.726] (-1806.385) -- 0:01:16
831500 -- (-1804.280) (-1800.118) [-1801.278] (-1813.827) * (-1803.520) [-1795.469] (-1806.375) (-1805.423) -- 0:01:16
832000 -- (-1799.647) (-1795.901) (-1803.185) [-1800.691] * (-1793.320) (-1792.681) [-1804.935] (-1795.844) -- 0:01:16
832500 -- (-1800.384) (-1792.298) [-1802.068] (-1799.930) * [-1799.200] (-1798.500) (-1798.020) (-1803.067) -- 0:01:16
833000 -- (-1808.830) (-1805.382) (-1804.364) [-1800.044] * [-1803.074] (-1804.230) (-1800.674) (-1797.205) -- 0:01:15
833500 -- [-1795.998] (-1802.093) (-1805.825) (-1796.231) * [-1794.200] (-1804.090) (-1800.899) (-1814.042) -- 0:01:15
834000 -- (-1800.219) (-1801.201) [-1801.395] (-1790.638) * (-1799.511) (-1804.716) [-1796.260] (-1798.351) -- 0:01:15
834500 -- [-1800.431] (-1798.886) (-1802.042) (-1802.520) * [-1795.561] (-1800.256) (-1798.881) (-1811.418) -- 0:01:15
835000 -- (-1813.030) (-1802.798) (-1804.050) [-1798.042] * (-1799.088) (-1800.888) (-1796.329) [-1795.764] -- 0:01:15
Average standard deviation of split frequencies: 0.004887
835500 -- [-1801.622] (-1796.864) (-1804.071) (-1812.382) * (-1797.353) (-1815.248) [-1795.596] (-1803.619) -- 0:01:14
836000 -- (-1808.973) (-1792.992) (-1807.559) [-1797.275] * [-1793.119] (-1792.546) (-1791.997) (-1794.211) -- 0:01:14
836500 -- (-1806.488) [-1795.279] (-1808.972) (-1792.574) * (-1811.497) (-1791.172) [-1795.295] (-1795.867) -- 0:01:14
837000 -- (-1795.599) (-1796.270) [-1798.527] (-1800.338) * (-1802.561) (-1803.858) [-1789.947] (-1795.826) -- 0:01:14
837500 -- (-1801.110) [-1793.953] (-1804.363) (-1798.103) * (-1796.368) [-1795.569] (-1797.024) (-1801.783) -- 0:01:13
838000 -- (-1793.167) (-1802.496) (-1803.683) [-1793.464] * (-1803.192) [-1795.408] (-1797.593) (-1800.336) -- 0:01:13
838500 -- (-1793.901) (-1805.975) (-1805.756) [-1796.767] * [-1796.047] (-1806.578) (-1792.731) (-1803.631) -- 0:01:13
839000 -- (-1797.556) [-1794.692] (-1801.140) (-1803.609) * [-1792.570] (-1801.163) (-1800.267) (-1804.225) -- 0:01:13
839500 -- (-1801.380) [-1791.009] (-1803.554) (-1794.688) * (-1799.035) [-1798.519] (-1791.955) (-1802.860) -- 0:01:13
840000 -- [-1796.955] (-1791.553) (-1798.229) (-1806.696) * (-1796.039) (-1809.477) (-1800.709) [-1793.392] -- 0:01:12
Average standard deviation of split frequencies: 0.005000
840500 -- (-1798.641) [-1788.496] (-1793.838) (-1800.909) * (-1800.162) (-1807.406) [-1794.630] (-1802.785) -- 0:01:12
841000 -- [-1794.641] (-1792.912) (-1795.473) (-1793.636) * (-1803.152) (-1804.471) [-1799.234] (-1806.321) -- 0:01:12
841500 -- [-1788.730] (-1797.400) (-1795.860) (-1803.933) * (-1795.120) (-1796.401) [-1788.539] (-1801.476) -- 0:01:12
842000 -- (-1797.364) [-1793.965] (-1803.093) (-1803.866) * (-1801.828) [-1795.364] (-1790.227) (-1794.947) -- 0:01:11
842500 -- (-1804.089) (-1805.363) [-1793.000] (-1801.148) * (-1801.963) [-1792.305] (-1799.879) (-1810.092) -- 0:01:11
843000 -- [-1805.635] (-1795.095) (-1801.689) (-1814.609) * (-1795.299) (-1798.464) [-1793.238] (-1799.357) -- 0:01:11
843500 -- (-1799.861) (-1800.999) (-1798.949) [-1793.880] * (-1791.809) [-1792.003] (-1798.915) (-1796.527) -- 0:01:11
844000 -- (-1797.799) (-1800.301) [-1797.477] (-1804.231) * [-1792.925] (-1797.490) (-1806.834) (-1796.180) -- 0:01:10
844500 -- (-1794.696) (-1789.028) [-1788.477] (-1797.424) * [-1797.149] (-1797.401) (-1803.296) (-1793.392) -- 0:01:10
845000 -- (-1797.368) [-1796.276] (-1793.208) (-1803.671) * (-1796.883) [-1797.519] (-1797.594) (-1801.814) -- 0:01:10
Average standard deviation of split frequencies: 0.005015
845500 -- (-1799.383) (-1798.249) [-1791.939] (-1799.751) * (-1804.980) (-1801.261) (-1798.505) [-1793.689] -- 0:01:10
846000 -- (-1796.945) (-1809.152) (-1795.125) [-1799.947] * (-1801.366) (-1792.429) [-1798.484] (-1800.081) -- 0:01:10
846500 -- (-1801.007) (-1800.401) [-1801.502] (-1793.791) * (-1802.257) (-1801.498) (-1807.482) [-1800.046] -- 0:01:09
847000 -- (-1796.653) (-1788.666) [-1795.821] (-1808.968) * (-1797.770) (-1811.833) (-1795.065) [-1791.509] -- 0:01:09
847500 -- (-1801.615) [-1799.440] (-1807.954) (-1796.914) * [-1792.752] (-1806.447) (-1796.368) (-1799.398) -- 0:01:09
848000 -- (-1805.995) (-1791.708) (-1799.892) [-1794.948] * (-1805.220) (-1803.860) (-1800.025) [-1791.650] -- 0:01:09
848500 -- (-1799.947) (-1797.042) [-1794.810] (-1798.842) * (-1801.004) [-1794.207] (-1795.481) (-1803.408) -- 0:01:08
849000 -- (-1795.014) (-1797.761) [-1796.552] (-1800.276) * (-1799.781) (-1797.450) [-1791.586] (-1792.655) -- 0:01:08
849500 -- [-1792.492] (-1807.773) (-1806.514) (-1793.252) * [-1790.670] (-1804.271) (-1795.876) (-1792.756) -- 0:01:08
850000 -- [-1805.306] (-1803.171) (-1803.934) (-1791.630) * [-1797.170] (-1800.626) (-1799.531) (-1794.641) -- 0:01:08
Average standard deviation of split frequencies: 0.005126
850500 -- (-1794.532) [-1794.948] (-1806.677) (-1792.473) * (-1795.909) [-1795.522] (-1804.052) (-1804.674) -- 0:01:08
851000 -- (-1807.768) (-1806.126) [-1796.694] (-1804.385) * (-1805.966) (-1796.711) (-1800.476) [-1790.276] -- 0:01:07
851500 -- (-1796.470) [-1798.857] (-1797.293) (-1805.108) * (-1797.928) (-1806.880) (-1790.282) [-1792.382] -- 0:01:07
852000 -- (-1801.286) (-1802.037) (-1794.913) [-1789.564] * (-1804.506) (-1812.003) [-1798.563] (-1799.083) -- 0:01:07
852500 -- (-1809.968) (-1802.800) (-1796.492) [-1796.113] * (-1805.870) (-1789.866) [-1789.257] (-1792.828) -- 0:01:07
853000 -- (-1805.640) [-1799.752] (-1805.795) (-1803.283) * [-1800.263] (-1796.820) (-1799.738) (-1796.521) -- 0:01:06
853500 -- [-1797.474] (-1802.195) (-1801.113) (-1796.576) * (-1798.762) (-1791.277) [-1797.585] (-1793.045) -- 0:01:06
854000 -- (-1798.972) [-1793.264] (-1805.231) (-1806.096) * (-1805.181) (-1797.676) [-1803.275] (-1797.934) -- 0:01:06
854500 -- [-1803.060] (-1795.029) (-1816.594) (-1795.772) * (-1796.743) (-1808.642) [-1793.022] (-1793.394) -- 0:01:06
855000 -- (-1801.798) [-1797.777] (-1802.432) (-1804.388) * (-1805.368) (-1805.607) (-1801.278) [-1793.670] -- 0:01:05
Average standard deviation of split frequencies: 0.004910
855500 -- [-1803.230] (-1803.128) (-1803.637) (-1796.707) * (-1801.177) (-1803.694) (-1794.996) [-1796.076] -- 0:01:05
856000 -- (-1804.005) [-1794.487] (-1798.459) (-1802.345) * (-1797.278) (-1809.278) (-1799.118) [-1802.003] -- 0:01:05
856500 -- (-1807.941) (-1799.639) (-1798.718) [-1798.354] * (-1794.478) (-1795.336) [-1794.682] (-1803.015) -- 0:01:05
857000 -- [-1797.549] (-1793.384) (-1797.768) (-1811.902) * (-1795.173) (-1806.290) (-1798.786) [-1787.759] -- 0:01:05
857500 -- (-1794.188) [-1795.461] (-1800.555) (-1803.132) * (-1796.859) (-1800.662) [-1796.003] (-1801.992) -- 0:01:04
858000 -- (-1790.366) (-1802.729) (-1806.019) [-1795.879] * (-1799.060) (-1799.425) (-1805.486) [-1792.791] -- 0:01:04
858500 -- (-1793.396) (-1803.035) [-1799.503] (-1788.095) * (-1801.298) [-1801.201] (-1796.029) (-1798.471) -- 0:01:04
859000 -- (-1797.761) (-1804.338) [-1791.053] (-1790.343) * (-1795.001) (-1797.233) (-1793.252) [-1794.812] -- 0:01:04
859500 -- (-1795.457) (-1802.140) [-1796.851] (-1794.548) * [-1798.814] (-1803.397) (-1802.450) (-1797.970) -- 0:01:03
860000 -- (-1808.365) (-1802.056) (-1795.207) [-1801.462] * (-1794.817) (-1799.717) (-1803.385) [-1797.647] -- 0:01:03
Average standard deviation of split frequencies: 0.005386
860500 -- (-1793.598) (-1800.618) [-1791.223] (-1795.043) * [-1793.989] (-1801.040) (-1799.429) (-1794.165) -- 0:01:03
861000 -- (-1793.627) (-1806.053) [-1785.861] (-1794.080) * (-1789.141) (-1796.481) [-1797.329] (-1806.504) -- 0:01:03
861500 -- (-1806.157) (-1796.369) [-1798.168] (-1798.851) * (-1795.635) (-1802.262) [-1807.239] (-1796.977) -- 0:01:03
862000 -- [-1791.790] (-1806.958) (-1794.810) (-1813.076) * [-1795.066] (-1805.212) (-1794.124) (-1793.507) -- 0:01:02
862500 -- [-1797.320] (-1796.151) (-1803.732) (-1800.740) * (-1802.581) (-1799.473) (-1795.138) [-1794.756] -- 0:01:02
863000 -- (-1804.157) [-1789.757] (-1802.917) (-1812.157) * (-1797.127) [-1790.626] (-1794.988) (-1794.835) -- 0:01:02
863500 -- (-1802.615) [-1793.289] (-1807.499) (-1801.248) * (-1812.029) (-1803.261) [-1797.515] (-1799.010) -- 0:01:02
864000 -- (-1812.341) (-1795.038) [-1794.880] (-1790.851) * (-1801.470) (-1793.803) [-1794.098] (-1801.962) -- 0:01:01
864500 -- (-1809.448) (-1797.745) [-1793.333] (-1799.107) * (-1803.232) [-1800.195] (-1800.916) (-1790.682) -- 0:01:01
865000 -- [-1793.237] (-1795.298) (-1801.188) (-1811.902) * (-1798.847) (-1805.790) [-1796.846] (-1791.827) -- 0:01:01
Average standard deviation of split frequencies: 0.005489
865500 -- [-1802.924] (-1800.434) (-1805.262) (-1805.051) * (-1806.833) [-1795.870] (-1797.053) (-1801.703) -- 0:01:01
866000 -- (-1796.801) (-1799.916) [-1814.279] (-1799.409) * [-1796.442] (-1800.279) (-1806.331) (-1803.758) -- 0:01:00
866500 -- [-1806.479] (-1805.403) (-1793.947) (-1810.409) * (-1798.100) (-1808.359) (-1797.918) [-1790.525] -- 0:01:00
867000 -- (-1808.990) [-1811.997] (-1798.354) (-1796.652) * (-1802.279) (-1813.682) (-1793.881) [-1795.549] -- 0:01:00
867500 -- (-1811.266) [-1804.080] (-1797.874) (-1794.404) * (-1799.647) [-1796.934] (-1790.354) (-1808.483) -- 0:01:00
868000 -- (-1802.900) (-1799.827) [-1802.058] (-1808.104) * (-1809.140) (-1806.358) [-1802.147] (-1803.454) -- 0:01:00
868500 -- (-1795.374) [-1790.355] (-1790.176) (-1797.785) * (-1806.068) (-1800.239) (-1796.031) [-1798.137] -- 0:00:59
869000 -- [-1794.028] (-1797.161) (-1801.120) (-1806.858) * (-1810.261) (-1796.938) (-1801.371) [-1792.566] -- 0:00:59
869500 -- (-1804.117) (-1805.143) (-1791.067) [-1797.345] * (-1803.264) (-1809.228) (-1816.214) [-1794.495] -- 0:00:59
870000 -- (-1794.578) [-1792.675] (-1796.397) (-1807.847) * (-1800.338) [-1794.494] (-1797.937) (-1795.035) -- 0:00:59
Average standard deviation of split frequencies: 0.005189
870500 -- (-1796.745) (-1797.176) [-1796.752] (-1795.903) * (-1797.267) [-1796.133] (-1801.399) (-1808.374) -- 0:00:58
871000 -- (-1808.235) (-1791.693) (-1801.246) [-1797.439] * [-1791.910] (-1801.491) (-1802.522) (-1812.258) -- 0:00:58
871500 -- (-1818.151) (-1794.863) (-1799.873) [-1792.563] * (-1803.582) (-1793.518) [-1791.534] (-1806.236) -- 0:00:58
872000 -- (-1797.083) (-1799.567) (-1797.994) [-1803.167] * [-1795.892] (-1796.934) (-1802.473) (-1799.566) -- 0:00:58
872500 -- [-1792.270] (-1803.553) (-1800.489) (-1799.491) * (-1791.713) (-1790.181) [-1797.956] (-1801.267) -- 0:00:58
873000 -- (-1794.253) [-1793.624] (-1798.238) (-1804.534) * [-1792.089] (-1802.094) (-1811.434) (-1798.907) -- 0:00:57
873500 -- (-1794.224) [-1795.491] (-1795.248) (-1794.519) * (-1799.175) [-1797.075] (-1807.730) (-1799.155) -- 0:00:57
874000 -- [-1790.781] (-1794.266) (-1806.337) (-1801.814) * [-1797.408] (-1796.099) (-1815.723) (-1797.689) -- 0:00:57
874500 -- (-1796.889) (-1795.403) [-1794.614] (-1800.592) * [-1792.940] (-1804.432) (-1803.322) (-1797.102) -- 0:00:57
875000 -- (-1804.467) [-1795.717] (-1808.140) (-1808.780) * (-1807.052) (-1796.022) (-1794.067) [-1792.603] -- 0:00:56
Average standard deviation of split frequencies: 0.004933
875500 -- [-1797.147] (-1810.576) (-1803.302) (-1794.142) * (-1803.934) (-1800.781) [-1796.244] (-1797.260) -- 0:00:56
876000 -- (-1798.914) (-1795.361) [-1803.299] (-1797.943) * (-1808.813) (-1799.088) [-1802.680] (-1793.814) -- 0:00:56
876500 -- [-1795.344] (-1797.786) (-1793.947) (-1786.424) * (-1797.789) (-1798.047) (-1801.497) [-1803.505] -- 0:00:56
877000 -- (-1801.371) (-1796.771) [-1804.179] (-1795.058) * (-1795.515) (-1807.686) (-1797.031) [-1800.333] -- 0:00:55
877500 -- (-1794.530) (-1801.660) (-1806.523) [-1800.770] * (-1804.158) (-1802.456) (-1801.627) [-1793.845] -- 0:00:55
878000 -- [-1795.023] (-1794.273) (-1803.125) (-1797.334) * (-1798.303) [-1798.948] (-1797.032) (-1802.918) -- 0:00:55
878500 -- (-1793.193) [-1789.984] (-1798.933) (-1792.265) * (-1805.079) (-1804.460) (-1798.679) [-1793.559] -- 0:00:55
879000 -- [-1797.604] (-1795.018) (-1797.161) (-1801.041) * (-1804.571) (-1789.352) (-1805.760) [-1796.207] -- 0:00:55
879500 -- [-1796.125] (-1801.134) (-1798.265) (-1801.866) * (-1798.969) [-1797.158] (-1801.058) (-1796.702) -- 0:00:54
880000 -- (-1794.185) (-1804.254) (-1806.510) [-1799.903] * (-1797.861) (-1807.385) (-1800.183) [-1794.225] -- 0:00:54
Average standard deviation of split frequencies: 0.004818
880500 -- (-1798.316) (-1807.772) [-1792.561] (-1793.595) * [-1792.907] (-1797.701) (-1797.651) (-1796.681) -- 0:00:54
881000 -- [-1792.593] (-1803.047) (-1796.198) (-1791.433) * (-1794.786) (-1798.863) (-1800.566) [-1800.882] -- 0:00:54
881500 -- (-1792.807) (-1803.251) (-1808.597) [-1793.443] * (-1795.308) (-1801.514) (-1795.791) [-1795.521] -- 0:00:53
882000 -- (-1791.457) (-1808.264) (-1798.708) [-1792.549] * (-1812.234) (-1800.016) (-1806.569) [-1798.987] -- 0:00:53
882500 -- (-1802.681) (-1804.019) [-1793.984] (-1796.014) * (-1804.213) (-1798.331) (-1798.853) [-1802.329] -- 0:00:53
883000 -- [-1797.749] (-1792.796) (-1804.457) (-1794.478) * (-1802.067) [-1797.236] (-1794.253) (-1803.312) -- 0:00:53
883500 -- [-1794.244] (-1796.159) (-1801.355) (-1802.071) * (-1799.410) [-1798.349] (-1794.841) (-1801.834) -- 0:00:53
884000 -- [-1793.818] (-1795.697) (-1800.198) (-1796.062) * [-1796.971] (-1804.428) (-1800.105) (-1805.037) -- 0:00:52
884500 -- (-1795.951) (-1801.610) (-1798.975) [-1792.340] * [-1797.960] (-1794.216) (-1805.201) (-1808.488) -- 0:00:52
885000 -- (-1802.696) (-1804.199) [-1798.837] (-1794.430) * (-1794.965) [-1789.463] (-1802.443) (-1794.928) -- 0:00:52
Average standard deviation of split frequencies: 0.005188
885500 -- (-1802.730) (-1804.985) (-1798.284) [-1795.629] * (-1794.143) (-1804.602) [-1800.963] (-1799.216) -- 0:00:52
886000 -- (-1802.889) [-1794.773] (-1800.350) (-1795.538) * [-1795.005] (-1793.150) (-1797.618) (-1788.510) -- 0:00:51
886500 -- [-1795.903] (-1796.729) (-1801.364) (-1802.290) * (-1807.500) (-1811.010) (-1800.002) [-1791.945] -- 0:00:51
887000 -- [-1790.287] (-1805.890) (-1797.784) (-1795.505) * (-1809.720) [-1798.985] (-1798.855) (-1804.411) -- 0:00:51
887500 -- [-1802.813] (-1801.624) (-1813.611) (-1794.619) * (-1797.232) [-1791.750] (-1800.373) (-1800.063) -- 0:00:51
888000 -- (-1796.877) [-1796.375] (-1803.686) (-1791.271) * [-1806.772] (-1801.465) (-1806.679) (-1796.392) -- 0:00:50
888500 -- (-1804.750) [-1789.730] (-1794.529) (-1810.775) * (-1791.841) [-1793.972] (-1802.127) (-1797.309) -- 0:00:50
889000 -- [-1792.221] (-1797.152) (-1794.827) (-1800.788) * (-1794.674) [-1796.864] (-1802.129) (-1794.207) -- 0:00:50
889500 -- (-1804.519) (-1803.364) (-1800.689) [-1796.290] * (-1809.993) [-1800.841] (-1811.585) (-1802.425) -- 0:00:50
890000 -- (-1796.349) (-1799.640) (-1804.126) [-1791.942] * (-1795.967) (-1802.521) [-1791.795] (-1803.205) -- 0:00:50
Average standard deviation of split frequencies: 0.004940
890500 -- (-1789.113) (-1811.145) [-1795.579] (-1796.560) * (-1794.523) (-1803.992) [-1789.968] (-1798.012) -- 0:00:49
891000 -- [-1799.018] (-1806.967) (-1809.443) (-1800.173) * (-1819.086) (-1796.512) [-1801.540] (-1797.793) -- 0:00:49
891500 -- (-1809.813) [-1792.865] (-1807.397) (-1788.848) * (-1798.506) [-1799.611] (-1814.262) (-1800.647) -- 0:00:49
892000 -- (-1809.911) (-1798.702) (-1796.317) [-1793.807] * (-1810.255) (-1801.495) (-1803.648) [-1803.427] -- 0:00:49
892500 -- [-1798.301] (-1813.931) (-1795.449) (-1791.876) * (-1803.739) (-1792.968) (-1793.165) [-1789.988] -- 0:00:48
893000 -- [-1791.292] (-1800.475) (-1799.098) (-1802.235) * (-1795.523) (-1807.710) [-1799.750] (-1799.156) -- 0:00:48
893500 -- (-1791.029) (-1806.736) [-1795.025] (-1803.206) * (-1810.921) (-1803.968) [-1801.404] (-1805.726) -- 0:00:48
894000 -- (-1799.793) (-1816.871) [-1795.363] (-1800.287) * (-1803.719) [-1798.511] (-1792.928) (-1795.358) -- 0:00:48
894500 -- (-1811.146) (-1801.057) [-1794.479] (-1796.728) * (-1797.092) (-1817.455) (-1806.049) [-1794.115] -- 0:00:48
895000 -- [-1790.032] (-1808.324) (-1802.915) (-1796.693) * (-1796.463) (-1809.057) [-1799.395] (-1792.353) -- 0:00:47
Average standard deviation of split frequencies: 0.004867
895500 -- (-1809.068) (-1808.048) [-1810.682] (-1797.518) * (-1795.924) (-1799.956) [-1802.377] (-1800.940) -- 0:00:47
896000 -- (-1800.423) (-1795.676) [-1792.500] (-1801.315) * (-1794.937) (-1804.063) (-1792.265) [-1792.216] -- 0:00:47
896500 -- (-1799.507) [-1798.389] (-1802.960) (-1800.599) * (-1801.467) (-1803.279) [-1800.066] (-1800.285) -- 0:00:47
897000 -- [-1795.246] (-1807.730) (-1800.720) (-1799.762) * [-1800.212] (-1793.390) (-1809.562) (-1796.248) -- 0:00:46
897500 -- (-1792.553) [-1792.361] (-1797.858) (-1799.967) * (-1804.377) [-1803.301] (-1799.921) (-1800.847) -- 0:00:46
898000 -- [-1801.521] (-1797.901) (-1796.736) (-1805.349) * (-1808.506) (-1792.953) [-1802.532] (-1801.202) -- 0:00:46
898500 -- (-1810.914) [-1798.744] (-1799.723) (-1791.794) * (-1793.772) (-1810.804) (-1801.872) [-1792.167] -- 0:00:46
899000 -- [-1793.869] (-1797.874) (-1797.120) (-1802.051) * (-1796.281) [-1789.296] (-1807.601) (-1795.766) -- 0:00:45
899500 -- [-1803.349] (-1806.151) (-1793.309) (-1804.099) * (-1796.972) [-1803.838] (-1799.898) (-1795.303) -- 0:00:45
900000 -- (-1798.012) (-1796.289) (-1804.418) [-1801.153] * [-1796.600] (-1799.385) (-1790.992) (-1790.863) -- 0:00:45
Average standard deviation of split frequencies: 0.004449
900500 -- (-1800.103) (-1795.714) (-1805.106) [-1791.149] * (-1796.845) (-1806.006) [-1795.041] (-1805.805) -- 0:00:45
901000 -- (-1804.123) (-1794.197) [-1796.923] (-1798.575) * (-1804.611) (-1795.261) (-1806.284) [-1799.792] -- 0:00:45
901500 -- (-1814.725) (-1800.540) (-1797.069) [-1800.013] * (-1801.052) [-1792.278] (-1794.745) (-1800.534) -- 0:00:44
902000 -- (-1797.164) [-1801.178] (-1794.097) (-1805.447) * (-1794.797) (-1804.945) [-1798.844] (-1805.551) -- 0:00:44
902500 -- [-1800.132] (-1803.863) (-1801.513) (-1798.397) * (-1802.456) (-1798.075) (-1802.949) [-1799.239] -- 0:00:44
903000 -- (-1804.651) (-1806.060) (-1796.688) [-1801.155] * (-1807.253) (-1798.052) (-1795.287) [-1799.365] -- 0:00:44
903500 -- (-1802.691) [-1797.035] (-1799.630) (-1790.980) * (-1797.747) [-1801.699] (-1806.144) (-1815.795) -- 0:00:43
904000 -- (-1805.324) (-1806.341) [-1797.322] (-1807.980) * (-1797.993) (-1813.222) [-1799.799] (-1790.051) -- 0:00:43
904500 -- [-1807.145] (-1802.683) (-1801.656) (-1800.016) * (-1801.821) (-1805.895) [-1799.973] (-1794.078) -- 0:00:43
905000 -- (-1806.767) (-1811.906) (-1794.999) [-1792.577] * (-1793.285) (-1799.140) [-1796.161] (-1798.426) -- 0:00:43
Average standard deviation of split frequencies: 0.004639
905500 -- (-1796.618) [-1792.655] (-1796.086) (-1804.409) * (-1798.648) [-1797.637] (-1795.887) (-1798.405) -- 0:00:42
906000 -- (-1805.556) [-1791.390] (-1801.653) (-1796.398) * (-1798.137) [-1794.017] (-1802.562) (-1800.914) -- 0:00:42
906500 -- (-1804.299) (-1800.004) (-1799.578) [-1793.987] * [-1794.875] (-1800.455) (-1791.235) (-1814.065) -- 0:00:42
907000 -- [-1797.517] (-1797.903) (-1793.709) (-1799.075) * [-1794.485] (-1813.776) (-1801.735) (-1801.973) -- 0:00:42
907500 -- (-1808.397) (-1798.587) [-1798.455] (-1797.390) * (-1797.257) (-1806.372) (-1806.588) [-1801.529] -- 0:00:42
908000 -- [-1805.704] (-1804.006) (-1786.601) (-1794.725) * [-1796.248] (-1806.563) (-1795.182) (-1799.720) -- 0:00:41
908500 -- (-1803.220) [-1800.633] (-1795.103) (-1807.041) * [-1800.782] (-1798.560) (-1800.700) (-1807.458) -- 0:00:41
909000 -- (-1811.858) (-1798.942) [-1794.941] (-1803.265) * (-1797.826) (-1800.153) [-1794.869] (-1808.479) -- 0:00:41
909500 -- (-1804.237) (-1799.030) [-1799.274] (-1802.176) * (-1805.811) [-1797.672] (-1802.715) (-1808.388) -- 0:00:41
910000 -- (-1801.712) [-1794.838] (-1796.343) (-1799.050) * (-1797.513) (-1802.892) [-1795.571] (-1802.288) -- 0:00:40
Average standard deviation of split frequencies: 0.004745
910500 -- (-1802.339) [-1801.143] (-1792.153) (-1796.064) * (-1800.003) [-1797.505] (-1798.404) (-1804.346) -- 0:00:40
911000 -- (-1797.939) (-1797.556) (-1798.720) [-1792.831] * (-1804.725) [-1795.421] (-1804.751) (-1798.782) -- 0:00:40
911500 -- (-1799.827) [-1792.880] (-1788.987) (-1798.285) * [-1806.324] (-1805.710) (-1810.247) (-1799.828) -- 0:00:40
912000 -- [-1789.669] (-1805.276) (-1804.266) (-1797.106) * (-1807.157) (-1807.591) (-1803.918) [-1806.822] -- 0:00:40
912500 -- (-1795.221) (-1789.931) [-1800.062] (-1814.924) * [-1805.031] (-1796.050) (-1802.975) (-1801.613) -- 0:00:39
913000 -- (-1795.276) (-1796.455) [-1794.938] (-1804.687) * [-1796.976] (-1806.876) (-1805.851) (-1806.639) -- 0:00:39
913500 -- (-1804.960) (-1805.619) (-1801.217) [-1798.785] * (-1799.137) [-1805.998] (-1793.990) (-1795.852) -- 0:00:39
914000 -- (-1798.137) (-1804.347) (-1800.473) [-1796.342] * (-1795.468) (-1802.188) (-1793.815) [-1790.128] -- 0:00:39
914500 -- (-1796.538) (-1796.208) [-1798.639] (-1807.185) * (-1800.471) (-1793.750) [-1791.609] (-1796.568) -- 0:00:38
915000 -- (-1799.390) [-1792.870] (-1810.716) (-1797.203) * [-1799.167] (-1798.386) (-1796.076) (-1797.598) -- 0:00:38
Average standard deviation of split frequencies: 0.004975
915500 -- (-1813.103) (-1800.556) [-1805.628] (-1791.919) * (-1798.858) (-1796.609) [-1801.716] (-1797.697) -- 0:00:38
916000 -- [-1794.046] (-1806.426) (-1800.976) (-1806.799) * (-1802.418) [-1800.173] (-1805.410) (-1794.589) -- 0:00:38
916500 -- (-1802.000) [-1802.457] (-1803.693) (-1802.269) * (-1806.688) (-1793.376) (-1804.662) [-1798.452] -- 0:00:37
917000 -- (-1794.705) [-1803.482] (-1807.495) (-1804.636) * [-1800.038] (-1801.489) (-1791.377) (-1806.788) -- 0:00:37
917500 -- [-1792.902] (-1801.764) (-1800.861) (-1804.367) * (-1793.296) [-1798.257] (-1807.043) (-1792.095) -- 0:00:37
918000 -- [-1792.227] (-1792.754) (-1802.938) (-1804.837) * (-1799.260) (-1793.178) (-1802.467) [-1794.652] -- 0:00:37
918500 -- (-1804.113) (-1795.326) [-1791.234] (-1795.109) * [-1798.219] (-1803.501) (-1805.734) (-1810.181) -- 0:00:37
919000 -- (-1804.527) [-1794.224] (-1803.138) (-1804.561) * (-1801.524) (-1808.336) (-1804.477) [-1793.199] -- 0:00:36
919500 -- (-1802.133) (-1796.074) (-1809.755) [-1795.004] * (-1804.991) (-1808.708) (-1809.908) [-1791.773] -- 0:00:36
920000 -- [-1797.586] (-1796.936) (-1790.440) (-1797.322) * (-1803.502) (-1798.780) (-1811.833) [-1790.310] -- 0:00:36
Average standard deviation of split frequencies: 0.005291
920500 -- (-1793.761) (-1792.869) (-1798.186) [-1806.680] * [-1799.123] (-1793.903) (-1799.971) (-1804.391) -- 0:00:36
921000 -- (-1797.501) (-1800.601) [-1799.030] (-1805.760) * [-1810.664] (-1792.379) (-1792.947) (-1793.571) -- 0:00:35
921500 -- (-1798.914) (-1804.059) [-1787.996] (-1804.698) * (-1807.411) [-1802.099] (-1802.561) (-1803.791) -- 0:00:35
922000 -- (-1802.903) (-1797.965) [-1793.262] (-1795.900) * (-1812.072) [-1791.719] (-1800.431) (-1800.489) -- 0:00:35
922500 -- (-1796.852) (-1795.574) (-1797.179) [-1791.841] * (-1797.087) (-1796.938) (-1808.103) [-1797.774] -- 0:00:35
923000 -- [-1797.785] (-1790.680) (-1804.979) (-1799.512) * (-1796.382) [-1797.172] (-1796.798) (-1797.262) -- 0:00:35
923500 -- (-1804.264) (-1797.300) (-1809.835) [-1796.415] * [-1798.760] (-1792.396) (-1793.622) (-1798.621) -- 0:00:34
924000 -- (-1799.159) (-1799.572) [-1803.433] (-1804.471) * [-1803.191] (-1797.111) (-1801.908) (-1802.408) -- 0:00:34
924500 -- (-1799.688) (-1802.707) [-1795.928] (-1804.968) * [-1796.330] (-1800.920) (-1800.653) (-1825.990) -- 0:00:34
925000 -- (-1797.720) (-1801.452) [-1794.009] (-1802.879) * (-1795.134) (-1801.736) [-1797.749] (-1808.196) -- 0:00:34
Average standard deviation of split frequencies: 0.005812
925500 -- (-1804.179) [-1799.578] (-1796.050) (-1795.418) * [-1794.925] (-1800.248) (-1798.709) (-1799.980) -- 0:00:33
926000 -- (-1802.668) (-1795.112) (-1792.093) [-1804.287] * [-1802.564] (-1800.430) (-1801.213) (-1797.613) -- 0:00:33
926500 -- (-1814.057) (-1804.169) (-1796.401) [-1799.396] * (-1799.124) (-1802.849) [-1790.658] (-1804.057) -- 0:00:33
927000 -- (-1805.920) (-1786.532) (-1798.182) [-1796.359] * (-1789.922) (-1800.529) [-1791.279] (-1810.804) -- 0:00:33
927500 -- (-1807.083) (-1796.601) (-1797.573) [-1802.438] * (-1805.399) (-1798.773) [-1795.630] (-1808.185) -- 0:00:32
928000 -- (-1812.504) [-1800.294] (-1801.896) (-1791.125) * (-1799.984) [-1801.213] (-1817.880) (-1794.463) -- 0:00:32
928500 -- (-1802.206) [-1793.467] (-1795.913) (-1804.469) * (-1802.152) (-1797.373) [-1801.836] (-1795.896) -- 0:00:32
929000 -- (-1801.998) (-1793.374) (-1795.426) [-1802.743] * (-1807.362) (-1791.292) (-1807.709) [-1805.841] -- 0:00:32
929500 -- (-1799.028) (-1796.720) [-1802.049] (-1797.865) * (-1800.906) (-1804.107) (-1807.184) [-1795.192] -- 0:00:32
930000 -- (-1801.193) [-1791.840] (-1802.767) (-1800.700) * [-1801.274] (-1802.755) (-1798.799) (-1799.405) -- 0:00:31
Average standard deviation of split frequencies: 0.005867
930500 -- (-1798.098) (-1793.545) (-1799.287) [-1798.555] * (-1801.755) [-1796.578] (-1796.820) (-1799.507) -- 0:00:31
931000 -- (-1791.464) [-1796.241] (-1799.667) (-1802.224) * [-1800.234] (-1795.050) (-1808.861) (-1811.247) -- 0:00:31
931500 -- [-1796.066] (-1810.008) (-1805.729) (-1805.464) * [-1792.710] (-1806.997) (-1796.517) (-1799.550) -- 0:00:31
932000 -- (-1798.387) (-1803.861) (-1794.199) [-1801.418] * (-1801.550) (-1806.669) [-1796.548] (-1793.282) -- 0:00:30
932500 -- [-1800.605] (-1803.517) (-1804.587) (-1794.088) * [-1799.606] (-1803.764) (-1796.702) (-1804.432) -- 0:00:30
933000 -- (-1804.518) (-1795.460) (-1806.090) [-1797.976] * (-1814.129) (-1793.346) (-1793.757) [-1791.378] -- 0:00:30
933500 -- (-1801.808) [-1802.289] (-1797.128) (-1801.009) * (-1808.949) (-1801.277) [-1795.717] (-1797.635) -- 0:00:30
934000 -- [-1792.598] (-1802.369) (-1804.138) (-1802.256) * (-1793.881) (-1799.889) (-1797.157) [-1797.442] -- 0:00:30
934500 -- (-1798.994) (-1812.684) [-1801.376] (-1795.251) * [-1799.037] (-1796.182) (-1808.350) (-1796.975) -- 0:00:29
935000 -- [-1794.973] (-1798.322) (-1794.599) (-1808.916) * [-1792.914] (-1808.159) (-1798.294) (-1807.915) -- 0:00:29
Average standard deviation of split frequencies: 0.005876
935500 -- (-1803.023) (-1800.936) [-1795.447] (-1804.016) * (-1813.832) [-1798.208] (-1800.904) (-1798.951) -- 0:00:29
936000 -- (-1805.506) [-1798.814] (-1793.786) (-1808.009) * (-1803.383) [-1806.590] (-1797.157) (-1794.321) -- 0:00:29
936500 -- (-1798.745) (-1799.327) [-1806.015] (-1799.986) * (-1797.522) [-1797.370] (-1802.909) (-1795.392) -- 0:00:28
937000 -- (-1800.796) [-1789.642] (-1808.214) (-1797.961) * (-1794.443) [-1791.624] (-1796.789) (-1799.098) -- 0:00:28
937500 -- (-1795.619) (-1801.604) (-1802.906) [-1796.208] * (-1792.034) [-1800.989] (-1811.504) (-1805.336) -- 0:00:28
938000 -- (-1797.562) [-1797.451] (-1801.118) (-1801.780) * [-1799.578] (-1800.838) (-1791.875) (-1802.161) -- 0:00:28
938500 -- (-1801.146) (-1797.301) [-1798.029] (-1797.921) * [-1795.234] (-1800.952) (-1795.698) (-1792.092) -- 0:00:27
939000 -- (-1801.894) (-1816.747) (-1796.910) [-1799.467] * [-1793.521] (-1788.038) (-1810.317) (-1800.891) -- 0:00:27
939500 -- (-1800.931) (-1805.716) (-1799.872) [-1798.404] * (-1794.772) [-1788.577] (-1803.259) (-1801.859) -- 0:00:27
940000 -- (-1802.276) [-1799.163] (-1801.310) (-1799.967) * (-1788.898) (-1806.590) [-1794.565] (-1806.018) -- 0:00:27
Average standard deviation of split frequencies: 0.005638
940500 -- (-1810.778) [-1791.002] (-1804.105) (-1799.632) * [-1791.945] (-1799.980) (-1795.253) (-1804.527) -- 0:00:27
941000 -- [-1791.879] (-1798.727) (-1805.393) (-1799.547) * (-1804.895) (-1806.608) [-1793.804] (-1795.346) -- 0:00:26
941500 -- (-1795.337) (-1799.482) [-1810.157] (-1808.266) * (-1802.540) (-1797.513) (-1804.272) [-1793.329] -- 0:00:26
942000 -- (-1801.308) (-1800.877) [-1812.711] (-1802.413) * (-1805.126) [-1794.223] (-1810.163) (-1797.427) -- 0:00:26
942500 -- (-1791.948) (-1792.595) (-1800.939) [-1788.182] * (-1799.300) [-1791.168] (-1801.676) (-1797.180) -- 0:00:26
943000 -- (-1797.356) (-1810.897) (-1801.354) [-1791.659] * (-1798.649) (-1801.692) (-1805.548) [-1801.388] -- 0:00:25
943500 -- [-1794.071] (-1806.467) (-1793.108) (-1793.615) * (-1810.001) (-1800.990) (-1797.530) [-1791.273] -- 0:00:25
944000 -- (-1802.252) (-1805.314) (-1793.506) [-1800.351] * (-1791.862) [-1805.131] (-1793.098) (-1797.229) -- 0:00:25
944500 -- (-1802.381) (-1805.053) (-1797.989) [-1794.399] * (-1800.407) [-1795.499] (-1802.124) (-1801.221) -- 0:00:25
945000 -- (-1807.118) (-1799.111) (-1798.167) [-1799.114] * (-1793.862) (-1801.912) [-1799.961] (-1801.994) -- 0:00:25
Average standard deviation of split frequencies: 0.006063
945500 -- [-1797.176] (-1795.612) (-1795.736) (-1806.374) * [-1794.229] (-1797.146) (-1807.129) (-1800.958) -- 0:00:24
946000 -- [-1795.011] (-1793.143) (-1800.380) (-1795.069) * (-1799.771) (-1805.311) (-1797.002) [-1798.360] -- 0:00:24
946500 -- [-1792.809] (-1801.934) (-1803.007) (-1806.554) * [-1797.163] (-1808.747) (-1794.803) (-1797.622) -- 0:00:24
947000 -- [-1791.910] (-1798.467) (-1796.185) (-1796.010) * [-1798.262] (-1795.516) (-1803.580) (-1802.666) -- 0:00:24
947500 -- (-1798.120) (-1794.267) [-1802.492] (-1808.812) * (-1803.679) (-1793.983) (-1798.128) [-1796.137] -- 0:00:23
948000 -- (-1818.231) (-1817.997) [-1786.520] (-1806.340) * (-1796.293) [-1791.638] (-1797.767) (-1800.816) -- 0:00:23
948500 -- (-1811.038) (-1801.343) [-1797.125] (-1799.671) * [-1793.578] (-1789.586) (-1800.084) (-1791.506) -- 0:00:23
949000 -- (-1804.252) [-1801.891] (-1797.747) (-1801.669) * [-1791.443] (-1803.937) (-1796.060) (-1796.279) -- 0:00:23
949500 -- [-1792.938] (-1806.099) (-1799.101) (-1803.970) * (-1799.339) (-1803.063) (-1800.350) [-1798.036] -- 0:00:22
950000 -- [-1793.049] (-1803.750) (-1800.650) (-1797.746) * [-1793.180] (-1798.172) (-1809.197) (-1796.108) -- 0:00:22
Average standard deviation of split frequencies: 0.005496
950500 -- [-1796.803] (-1797.579) (-1803.518) (-1802.346) * (-1800.605) [-1792.781] (-1798.474) (-1798.162) -- 0:00:22
951000 -- [-1795.278] (-1800.314) (-1808.817) (-1798.413) * [-1797.482] (-1795.641) (-1793.399) (-1810.826) -- 0:00:22
951500 -- (-1800.844) [-1787.376] (-1793.988) (-1796.784) * (-1802.750) (-1788.357) (-1795.520) [-1803.446] -- 0:00:22
952000 -- (-1795.144) (-1797.045) [-1797.895] (-1794.453) * [-1797.218] (-1795.688) (-1791.982) (-1798.409) -- 0:00:21
952500 -- (-1807.841) (-1803.739) (-1805.042) [-1787.725] * (-1802.901) (-1797.289) (-1811.196) [-1806.395] -- 0:00:21
953000 -- (-1805.159) (-1807.825) [-1804.925] (-1801.603) * (-1797.754) (-1793.069) [-1792.380] (-1806.963) -- 0:00:21
953500 -- (-1799.221) (-1810.339) (-1800.625) [-1789.453] * (-1809.647) [-1792.427] (-1803.859) (-1800.262) -- 0:00:21
954000 -- (-1800.781) [-1798.140] (-1795.413) (-1801.819) * (-1814.086) (-1804.296) [-1793.869] (-1793.846) -- 0:00:20
954500 -- (-1806.794) (-1794.916) [-1793.924] (-1803.092) * (-1802.391) [-1799.990] (-1795.684) (-1799.865) -- 0:00:20
955000 -- (-1797.714) [-1794.229] (-1789.772) (-1801.580) * [-1792.191] (-1802.986) (-1789.290) (-1802.888) -- 0:00:20
Average standard deviation of split frequencies: 0.005465
955500 -- (-1799.417) (-1813.957) (-1800.525) [-1797.342] * (-1793.174) (-1806.588) (-1795.323) [-1796.129] -- 0:00:20
956000 -- (-1814.654) (-1810.174) [-1792.851] (-1797.871) * (-1798.695) (-1815.568) [-1789.756] (-1793.647) -- 0:00:20
956500 -- [-1795.330] (-1813.834) (-1800.362) (-1804.142) * (-1801.918) (-1808.230) [-1799.642] (-1798.260) -- 0:00:19
957000 -- (-1802.806) (-1796.386) [-1799.288] (-1788.467) * (-1809.345) (-1807.627) [-1791.890] (-1810.239) -- 0:00:19
957500 -- (-1799.298) (-1799.817) (-1805.235) [-1795.769] * (-1799.269) (-1806.966) [-1793.581] (-1802.046) -- 0:00:19
958000 -- [-1799.882] (-1795.768) (-1798.770) (-1807.604) * (-1799.316) (-1798.040) [-1791.085] (-1804.827) -- 0:00:19
958500 -- [-1786.732] (-1793.423) (-1802.511) (-1794.930) * (-1805.148) (-1796.902) [-1795.119] (-1803.193) -- 0:00:18
959000 -- [-1795.304] (-1806.850) (-1808.996) (-1794.316) * (-1798.617) (-1796.434) [-1800.531] (-1799.342) -- 0:00:18
959500 -- (-1794.654) (-1800.460) (-1799.172) [-1793.239] * [-1799.431] (-1801.199) (-1801.823) (-1803.773) -- 0:00:18
960000 -- (-1797.386) (-1800.468) (-1799.094) [-1794.989] * (-1798.408) (-1806.062) [-1795.689] (-1809.641) -- 0:00:18
Average standard deviation of split frequencies: 0.005602
960500 -- (-1799.722) (-1806.296) [-1796.575] (-1806.131) * [-1801.252] (-1806.151) (-1803.263) (-1811.289) -- 0:00:17
961000 -- (-1795.477) [-1794.444] (-1798.384) (-1805.636) * (-1797.633) (-1813.247) (-1811.124) [-1791.419] -- 0:00:17
961500 -- (-1799.813) (-1800.257) [-1794.785] (-1805.645) * (-1808.953) (-1800.763) (-1807.082) [-1793.356] -- 0:00:17
962000 -- (-1804.654) (-1796.812) [-1799.805] (-1793.998) * (-1800.826) (-1797.491) [-1801.749] (-1804.548) -- 0:00:17
962500 -- [-1796.973] (-1799.067) (-1800.984) (-1795.968) * (-1801.356) (-1792.540) (-1795.102) [-1793.667] -- 0:00:17
963000 -- (-1796.106) (-1799.689) (-1797.377) [-1799.720] * (-1805.728) [-1792.665] (-1804.694) (-1798.589) -- 0:00:16
963500 -- (-1790.458) [-1793.956] (-1800.093) (-1800.178) * (-1803.955) [-1793.742] (-1800.593) (-1796.819) -- 0:00:16
964000 -- (-1810.142) (-1791.087) (-1806.679) [-1793.447] * [-1789.643] (-1799.907) (-1806.540) (-1807.026) -- 0:00:16
964500 -- [-1803.359] (-1795.751) (-1804.416) (-1806.405) * [-1798.033] (-1808.280) (-1797.989) (-1798.540) -- 0:00:16
965000 -- (-1808.131) (-1795.350) [-1796.310] (-1809.585) * (-1791.108) (-1802.462) [-1801.032] (-1788.517) -- 0:00:15
Average standard deviation of split frequencies: 0.005978
965500 -- (-1804.316) (-1798.949) (-1805.316) [-1800.133] * (-1807.835) [-1795.986] (-1815.677) (-1792.518) -- 0:00:15
966000 -- (-1804.814) [-1793.341] (-1794.147) (-1798.028) * [-1793.974] (-1790.110) (-1804.394) (-1796.790) -- 0:00:15
966500 -- (-1801.662) (-1800.010) (-1798.262) [-1790.263] * (-1801.861) [-1794.025] (-1800.295) (-1797.225) -- 0:00:15
967000 -- (-1796.798) (-1798.983) (-1802.422) [-1798.785] * (-1798.067) (-1806.974) [-1799.410] (-1791.608) -- 0:00:15
967500 -- (-1798.607) [-1799.708] (-1798.768) (-1797.767) * (-1799.169) (-1803.735) (-1798.145) [-1800.567] -- 0:00:14
968000 -- (-1796.228) (-1792.330) (-1806.667) [-1799.959] * (-1802.763) (-1808.861) [-1796.035] (-1799.631) -- 0:00:14
968500 -- [-1789.094] (-1799.956) (-1798.190) (-1797.015) * [-1794.121] (-1797.358) (-1794.236) (-1817.771) -- 0:00:14
969000 -- (-1803.814) [-1798.175] (-1798.383) (-1797.586) * (-1807.412) [-1791.771] (-1795.798) (-1814.140) -- 0:00:14
969500 -- (-1798.449) (-1793.702) (-1793.440) [-1800.686] * [-1792.068] (-1796.548) (-1792.039) (-1817.680) -- 0:00:13
970000 -- (-1794.525) (-1796.197) (-1805.818) [-1796.601] * (-1795.418) (-1796.651) (-1794.433) [-1795.781] -- 0:00:13
Average standard deviation of split frequencies: 0.005990
970500 -- (-1794.272) (-1802.235) (-1795.101) [-1798.596] * [-1794.685] (-1791.951) (-1794.274) (-1807.534) -- 0:00:13
971000 -- (-1803.297) [-1791.682] (-1798.546) (-1805.842) * (-1800.568) [-1798.328] (-1797.027) (-1803.774) -- 0:00:13
971500 -- [-1794.439] (-1796.431) (-1794.756) (-1799.036) * [-1801.063] (-1804.727) (-1799.122) (-1811.908) -- 0:00:12
972000 -- [-1796.109] (-1803.867) (-1802.047) (-1794.277) * (-1798.212) [-1796.909] (-1794.119) (-1814.603) -- 0:00:12
972500 -- [-1802.101] (-1798.691) (-1797.589) (-1803.922) * [-1795.798] (-1796.239) (-1807.496) (-1811.375) -- 0:00:12
973000 -- (-1797.882) (-1799.737) (-1799.732) [-1796.464] * (-1797.048) (-1802.375) [-1800.858] (-1813.248) -- 0:00:12
973500 -- (-1807.182) (-1790.175) (-1814.391) [-1791.273] * [-1797.683] (-1798.457) (-1795.411) (-1811.044) -- 0:00:12
974000 -- (-1805.786) (-1798.407) [-1802.503] (-1798.586) * (-1799.541) (-1810.880) (-1798.591) [-1797.674] -- 0:00:11
974500 -- (-1805.480) (-1806.658) [-1791.231] (-1799.607) * (-1795.725) (-1808.140) (-1803.720) [-1798.807] -- 0:00:11
975000 -- (-1801.407) (-1812.314) [-1788.880] (-1801.499) * (-1803.877) [-1796.669] (-1796.155) (-1805.257) -- 0:00:11
Average standard deviation of split frequencies: 0.006359
975500 -- (-1801.311) [-1802.224] (-1799.292) (-1815.161) * (-1801.369) [-1794.171] (-1798.416) (-1805.694) -- 0:00:11
976000 -- (-1794.294) (-1807.191) [-1801.394] (-1801.600) * (-1801.061) (-1798.438) (-1801.958) [-1793.190] -- 0:00:10
976500 -- (-1809.985) [-1789.954] (-1795.792) (-1813.630) * [-1790.390] (-1797.292) (-1802.194) (-1803.728) -- 0:00:10
977000 -- (-1805.943) [-1798.715] (-1796.630) (-1801.522) * (-1796.862) (-1803.584) (-1791.855) [-1800.304] -- 0:00:10
977500 -- (-1805.262) (-1804.666) (-1790.951) [-1798.640] * (-1801.778) (-1800.998) [-1804.913] (-1811.126) -- 0:00:10
978000 -- (-1798.536) (-1794.317) [-1788.825] (-1797.040) * (-1813.797) (-1792.987) [-1789.285] (-1799.836) -- 0:00:10
978500 -- (-1791.395) (-1804.742) (-1804.210) [-1792.287] * (-1813.138) (-1794.266) [-1792.961] (-1795.512) -- 0:00:09
979000 -- [-1801.961] (-1801.422) (-1796.632) (-1792.348) * (-1801.740) (-1806.999) [-1795.294] (-1791.727) -- 0:00:09
979500 -- [-1797.433] (-1800.801) (-1805.289) (-1799.204) * (-1805.814) (-1812.051) (-1808.265) [-1796.857] -- 0:00:09
980000 -- (-1798.094) [-1797.245] (-1800.411) (-1791.301) * (-1797.725) (-1817.102) [-1791.817] (-1801.415) -- 0:00:09
Average standard deviation of split frequencies: 0.005969
980500 -- (-1798.442) (-1799.555) (-1801.723) [-1798.512] * (-1796.291) (-1816.186) [-1796.263] (-1802.325) -- 0:00:08
981000 -- (-1804.267) (-1793.016) (-1808.826) [-1801.602] * (-1797.039) [-1804.816] (-1803.108) (-1810.100) -- 0:00:08
981500 -- (-1803.799) (-1789.480) [-1793.656] (-1796.828) * [-1792.236] (-1797.579) (-1810.536) (-1801.623) -- 0:00:08
982000 -- (-1791.498) [-1794.571] (-1806.652) (-1797.807) * [-1801.475] (-1804.990) (-1795.541) (-1794.625) -- 0:00:08
982500 -- (-1795.121) (-1798.881) [-1796.576] (-1809.354) * [-1806.315] (-1798.057) (-1797.172) (-1804.560) -- 0:00:07
983000 -- (-1803.419) [-1794.840] (-1806.237) (-1793.135) * [-1800.623] (-1798.170) (-1798.207) (-1810.622) -- 0:00:07
983500 -- (-1804.932) (-1801.374) [-1801.748] (-1809.165) * (-1789.368) (-1799.399) (-1791.954) [-1795.334] -- 0:00:07
984000 -- [-1799.795] (-1800.919) (-1796.935) (-1799.250) * (-1803.284) (-1799.984) [-1802.151] (-1811.521) -- 0:00:07
984500 -- (-1790.350) (-1800.033) [-1791.223] (-1796.044) * [-1793.038] (-1801.494) (-1797.091) (-1798.028) -- 0:00:07
985000 -- (-1795.486) (-1794.919) [-1800.065] (-1797.833) * [-1793.035] (-1806.599) (-1800.760) (-1799.534) -- 0:00:06
Average standard deviation of split frequencies: 0.005857
985500 -- (-1799.968) (-1800.993) [-1790.610] (-1792.249) * (-1797.856) (-1805.257) (-1793.073) [-1800.480] -- 0:00:06
986000 -- (-1800.225) [-1792.968] (-1793.218) (-1796.043) * (-1798.948) [-1800.236] (-1800.100) (-1801.553) -- 0:00:06
986500 -- (-1817.307) (-1792.136) [-1797.819] (-1794.059) * (-1803.504) [-1801.936] (-1797.444) (-1796.590) -- 0:00:06
987000 -- (-1801.122) [-1797.337] (-1801.471) (-1794.245) * [-1799.160] (-1796.997) (-1800.674) (-1804.149) -- 0:00:05
987500 -- (-1796.272) (-1793.658) (-1795.680) [-1797.787] * (-1790.751) [-1795.860] (-1811.800) (-1796.959) -- 0:00:05
988000 -- (-1798.733) (-1795.850) [-1798.241] (-1796.582) * (-1798.412) [-1800.559] (-1810.454) (-1798.235) -- 0:00:05
988500 -- (-1790.129) [-1798.361] (-1795.531) (-1811.941) * (-1800.410) [-1796.811] (-1796.269) (-1792.182) -- 0:00:05
989000 -- [-1794.978] (-1791.946) (-1801.784) (-1797.109) * (-1794.525) (-1799.558) [-1791.499] (-1799.639) -- 0:00:05
989500 -- (-1799.479) (-1789.991) [-1797.648] (-1791.650) * [-1800.207] (-1802.439) (-1796.465) (-1799.218) -- 0:00:04
990000 -- (-1802.934) [-1800.190] (-1793.725) (-1797.142) * (-1802.625) [-1802.972] (-1803.331) (-1807.510) -- 0:00:04
Average standard deviation of split frequencies: 0.006027
990500 -- (-1801.019) (-1798.337) (-1810.152) [-1791.705] * (-1798.868) (-1808.047) (-1803.178) [-1805.930] -- 0:00:04
991000 -- (-1797.189) (-1799.497) [-1800.179] (-1791.816) * [-1800.095] (-1801.779) (-1805.992) (-1799.574) -- 0:00:04
991500 -- (-1794.786) [-1802.797] (-1805.519) (-1794.802) * [-1807.972] (-1798.335) (-1806.556) (-1801.648) -- 0:00:03
992000 -- (-1805.487) (-1795.686) [-1793.548] (-1802.616) * (-1815.053) (-1808.844) (-1805.445) [-1806.421] -- 0:00:03
992500 -- (-1796.323) (-1804.714) (-1804.569) [-1792.606] * [-1800.904] (-1821.754) (-1804.496) (-1802.431) -- 0:00:03
993000 -- (-1795.003) (-1799.559) [-1790.200] (-1797.059) * (-1798.780) (-1798.087) [-1801.597] (-1810.057) -- 0:00:03
993500 -- (-1802.392) (-1802.048) [-1797.516] (-1801.697) * (-1798.903) (-1805.326) [-1803.753] (-1799.347) -- 0:00:02
994000 -- (-1798.543) (-1804.880) (-1801.427) [-1801.742] * (-1806.247) (-1802.978) (-1798.246) [-1806.650] -- 0:00:02
994500 -- [-1792.281] (-1801.337) (-1804.447) (-1796.294) * (-1802.331) [-1795.016] (-1801.233) (-1795.880) -- 0:00:02
995000 -- [-1793.031] (-1804.694) (-1796.060) (-1794.985) * (-1801.200) (-1804.879) [-1794.131] (-1790.099) -- 0:00:02
Average standard deviation of split frequencies: 0.006113
995500 -- (-1797.083) [-1790.608] (-1808.565) (-1793.611) * (-1800.515) (-1802.771) [-1795.351] (-1791.772) -- 0:00:02
996000 -- [-1802.880] (-1803.841) (-1796.831) (-1806.383) * [-1809.204] (-1795.767) (-1793.116) (-1801.265) -- 0:00:01
996500 -- (-1796.232) [-1795.280] (-1810.068) (-1801.571) * (-1797.736) (-1806.811) (-1806.552) [-1801.361] -- 0:00:01
997000 -- (-1800.910) (-1799.679) [-1794.831] (-1808.397) * (-1796.281) (-1795.997) [-1809.309] (-1802.293) -- 0:00:01
997500 -- (-1802.195) (-1798.635) [-1792.241] (-1806.010) * (-1795.348) (-1800.537) [-1804.022] (-1796.008) -- 0:00:01
998000 -- (-1806.057) [-1802.882] (-1796.185) (-1800.185) * (-1799.085) (-1801.599) (-1797.727) [-1799.109] -- 0:00:00
998500 -- (-1795.404) (-1797.909) (-1803.490) [-1799.535] * (-1801.207) (-1791.829) [-1794.248] (-1801.446) -- 0:00:00
999000 -- (-1800.749) (-1800.765) (-1796.321) [-1792.588] * (-1804.209) (-1802.229) (-1804.898) [-1798.321] -- 0:00:00
999500 -- (-1800.137) (-1803.690) (-1804.047) [-1795.259] * (-1803.718) [-1792.281] (-1798.323) (-1806.590) -- 0:00:00
1000000 -- (-1799.257) (-1794.754) (-1792.934) [-1791.831] * (-1806.115) (-1792.975) [-1807.583] (-1798.694) -- 0:00:00
Average standard deviation of split frequencies: 0.006320
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1799.256628 -- 14.688619
Chain 1 -- -1799.256628 -- 14.688619
Chain 2 -- -1794.753606 -- 11.766895
Chain 2 -- -1794.753593 -- 11.766895
Chain 3 -- -1792.933825 -- 10.865624
Chain 3 -- -1792.933820 -- 10.865624
Chain 4 -- -1791.830791 -- 15.052473
Chain 4 -- -1791.830790 -- 15.052473
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1806.115254 -- 13.817857
Chain 1 -- -1806.115254 -- 13.817857
Chain 2 -- -1792.974520 -- 14.116158
Chain 2 -- -1792.974529 -- 14.116158
Chain 3 -- -1807.583108 -- 19.485870
Chain 3 -- -1807.583106 -- 19.485870
Chain 4 -- -1798.694369 -- 11.513608
Chain 4 -- -1798.694369 -- 11.513608
Analysis completed in 7 mins 35 seconds
Analysis used 454.96 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1782.54
Likelihood of best state for "cold" chain of run 2 was -1783.25
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
40.2 % ( 30 %) Dirichlet(Revmat{all})
61.3 % ( 50 %) Slider(Revmat{all})
27.1 % ( 26 %) Dirichlet(Pi{all})
29.1 % ( 30 %) Slider(Pi{all})
32.2 % ( 24 %) Multiplier(Alpha{1,2})
41.1 % ( 20 %) Multiplier(Alpha{3})
49.3 % ( 25 %) Slider(Pinvar{all})
7.4 % ( 1 %) ExtSPR(Tau{all},V{all})
2.3 % ( 2 %) ExtTBR(Tau{all},V{all})
10.8 % ( 8 %) NNI(Tau{all},V{all})
9.1 % ( 5 %) ParsSPR(Tau{all},V{all})
26.6 % ( 30 %) Multiplier(V{all})
46.7 % ( 58 %) Nodeslider(V{all})
25.4 % ( 36 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
40.6 % ( 31 %) Dirichlet(Revmat{all})
59.7 % ( 49 %) Slider(Revmat{all})
26.8 % ( 29 %) Dirichlet(Pi{all})
29.2 % ( 22 %) Slider(Pi{all})
32.2 % ( 20 %) Multiplier(Alpha{1,2})
40.8 % ( 31 %) Multiplier(Alpha{3})
49.6 % ( 19 %) Slider(Pinvar{all})
7.4 % ( 4 %) ExtSPR(Tau{all},V{all})
2.3 % ( 3 %) ExtTBR(Tau{all},V{all})
10.5 % ( 10 %) NNI(Tau{all},V{all})
9.2 % ( 11 %) ParsSPR(Tau{all},V{all})
26.5 % ( 21 %) Multiplier(V{all})
46.6 % ( 49 %) Nodeslider(V{all})
25.1 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.75 0.55 0.38
2 | 166542 0.77 0.57
3 | 166404 166442 0.78
4 | 166217 167562 166833
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.75 0.54 0.38
2 | 166465 0.77 0.57
3 | 166210 167490 0.78
4 | 166622 166783 166430
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1794.36
| 2 2 |
| 2 1 1 1 |
| 1 1 1 1 2 2 2 2 |
| 1 121 2 2 2 2 11 2 |
| 2 2 1 2 2 2 1* 1 2 2 211|
| 12 1 2 2 1 1 *2 2* 1 1 1 1 1 |
|22 122 12 2112 2 1 11 1 1 12 2 * 2 1 2 2 |
|11 1*2 21 11 1 1 211 1 |
| 1 2 2 2 22 1 1 222 |
| 1 2 2 1 1 1 |
| 2 |
| 2 |
| |
| |
| 2|
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1800.81
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1790.96 -1809.44
2 -1790.54 -1807.98
--------------------------------------
TOTAL -1790.73 -1808.95
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.360324 0.022172 1.097790 1.672114 1.353018 1202.77 1276.11 1.000
r(A<->C){all} 0.099697 0.000529 0.057888 0.145736 0.097994 801.80 909.01 1.000
r(A<->G){all} 0.220806 0.001570 0.147453 0.300013 0.217351 743.81 774.80 1.001
r(A<->T){all} 0.017110 0.000296 0.000013 0.051406 0.011960 522.26 757.58 1.000
r(C<->G){all} 0.055933 0.000190 0.030834 0.084527 0.054713 1046.00 1050.16 1.000
r(C<->T){all} 0.572883 0.002536 0.472851 0.666363 0.573493 650.77 746.29 1.001
r(G<->T){all} 0.033571 0.000206 0.007509 0.061226 0.032221 995.13 1033.17 1.000
pi(A){all} 0.232541 0.000313 0.199698 0.268381 0.232665 933.09 993.88 1.000
pi(C){all} 0.286523 0.000303 0.250996 0.318808 0.286229 1212.98 1296.45 1.000
pi(G){all} 0.299230 0.000334 0.264494 0.336610 0.298622 1122.53 1160.52 1.000
pi(T){all} 0.181706 0.000218 0.153801 0.210788 0.181481 970.80 1099.16 1.000
alpha{1,2} 0.072469 0.000241 0.045571 0.104129 0.073167 958.46 1019.05 1.001
alpha{3} 3.430087 0.932108 1.761111 5.327696 3.287892 1203.73 1302.82 1.000
pinvar{all} 0.303055 0.002824 0.195675 0.400741 0.303969 1166.90 1331.58 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
12 -- C12
Key to taxon bipartitions (saved to file "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------------
1 -- .***********
2 -- .*..........
3 -- ..*.........
4 -- ...*........
5 -- ....*.......
6 -- .....*......
7 -- ......*.....
8 -- .......*....
9 -- ........*...
10 -- .........*..
11 -- ..........*.
12 -- ...........*
13 -- ..........**
14 -- ...**.......
15 -- .**.........
16 -- .....***....
17 -- .....***..**
18 -- .....*******
19 -- ...*********
20 -- .....**.....
21 -- .....***.***
22 -- .....****.**
23 -- ........**..
24 -- ......**....
------------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
13 2998 0.998668 0.000942 0.998001 0.999334 2
14 2974 0.990673 0.000000 0.990673 0.990673 2
15 2967 0.988341 0.006124 0.984011 0.992672 2
16 2956 0.984677 0.000942 0.984011 0.985343 2
17 2934 0.977348 0.000942 0.976682 0.978015 2
18 2898 0.965356 0.000942 0.964690 0.966023 2
19 2866 0.954697 0.009422 0.948035 0.961359 2
20 2360 0.786143 0.015075 0.775483 0.796802 2
21 1534 0.510993 0.009422 0.504330 0.517655 2
22 868 0.289141 0.012248 0.280480 0.297801 2
23 600 0.199867 0.002827 0.197868 0.201865 2
24 594 0.197868 0.016959 0.185876 0.209860 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.011848 0.000056 0.000060 0.026262 0.010525 1.001 2
length{all}[2] 0.010772 0.000042 0.000944 0.023314 0.009529 1.000 2
length{all}[3] 0.003591 0.000014 0.000001 0.010574 0.002454 1.000 2
length{all}[4] 0.035275 0.000190 0.009737 0.061840 0.033400 1.000 2
length{all}[5] 0.037694 0.000204 0.013486 0.065833 0.035695 1.000 2
length{all}[6] 0.089114 0.000709 0.045056 0.143578 0.085327 1.003 2
length{all}[7] 0.069249 0.000530 0.027850 0.113983 0.066664 1.000 2
length{all}[8] 0.026490 0.000210 0.002677 0.054687 0.024212 1.000 2
length{all}[9] 0.310605 0.004469 0.185740 0.438860 0.303360 1.001 2
length{all}[10] 0.217785 0.002604 0.123282 0.317138 0.212759 1.000 2
length{all}[11] 0.091186 0.000820 0.038438 0.145329 0.088234 1.000 2
length{all}[12] 0.099138 0.000889 0.045459 0.157914 0.096162 1.000 2
length{all}[13] 0.064534 0.000743 0.016488 0.119693 0.060645 1.000 2
length{all}[14] 0.033570 0.000241 0.006287 0.064931 0.031517 1.000 2
length{all}[15] 0.013710 0.000063 0.001730 0.029377 0.012443 1.000 2
length{all}[16] 0.037562 0.000388 0.005340 0.076120 0.035066 1.000 2
length{all}[17] 0.053013 0.000733 0.007213 0.106260 0.049900 1.000 2
length{all}[18] 0.068554 0.000938 0.010528 0.124950 0.065490 1.001 2
length{all}[19] 0.025872 0.000192 0.003247 0.054186 0.023782 1.000 2
length{all}[20] 0.029529 0.000256 0.002399 0.059153 0.027551 1.000 2
length{all}[21] 0.041312 0.000721 0.000439 0.090689 0.035788 0.999 2
length{all}[22] 0.033130 0.000547 0.000115 0.076474 0.028734 1.001 2
length{all}[23] 0.033252 0.000680 0.000413 0.082712 0.027579 0.999 2
length{all}[24] 0.020579 0.000173 0.000012 0.044846 0.018523 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006320
Maximum standard deviation of split frequencies = 0.016959
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
| /---------- C2 (2)
|-----------------------------99----------------------------+
| \---------- C3 (3)
|
| /---------- C4 (4)
+ /------------------------99-----------------------+
| | \---------- C5 (5)
| |
| | /---------- C6 (6)
| | /----79---+
| | | \---------- C7 (7)
| | /----98---+
\----95---+ | \-------------------- C8 (8)
| /----98---+
| | | /---------- C11 (11)
| | \--------100--------+
| /----51---+ \---------- C12 (12)
| | |
\----97---+ \---------------------------------------- C10 (10)
|
\-------------------------------------------------- C9 (9)
Phylogram (based on average branch lengths):
/-- C1 (1)
|
| /-- C2 (2)
|-+
| \- C3 (3)
|
| /------ C4 (4)
+ /-----+
| | \------- C5 (5)
| |
| | /--------------- C6 (6)
| | /----+
| | | \------------ C7 (7)
| | /------+
\---+ | \---- C8 (8)
| /--------+
| | | /---------------- C11 (11)
| | \----------+
| /------+ \------------------ C12 (12)
| | |
\-----------+ \--------------------------------------- C10 (10)
|
\-------------------------------------------------------- C9 (9)
|--------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (93 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 9 trees
95 % credible set contains 21 trees
99 % credible set contains 63 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 12 ls = 537
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Reading seq #12: C12
Sequences read..
Counting site patterns.. 0:00
146 patterns at 179 / 179 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11 12
528 bytes for distance
142496 bytes for conP
19856 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), ((4, 5), (((((6, 7), 8), (11, 12)), 10), 9))); MP score: 231
1 0.072877
2 0.051048
3 0.050853
4 0.050807
5 0.050796
6 0.050794
7 0.050794
8 0.050794
712480 bytes for conP, adjusted
0.019349 0.009858 0.021508 0.000000 0.034307 0.054880 0.043472 0.055330 0.098356 0.026531 0.045283 0.033789 0.028954 0.077034 0.087405 0.042034 0.090717 0.102945 0.103689 0.229969 0.334234 0.300000 1.300000
ntime & nrate & np: 21 2 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 23
lnL0 = -2236.914474
Iterating by ming2
Initial: fx= 2236.914474
x= 0.01935 0.00986 0.02151 0.00000 0.03431 0.05488 0.04347 0.05533 0.09836 0.02653 0.04528 0.03379 0.02895 0.07703 0.08741 0.04203 0.09072 0.10294 0.10369 0.22997 0.33423 0.30000 1.30000
1 h-m-p 0.0000 0.0000 491.2629 ++ 2236.913379 m 0.0000 28 | 1/23
2 h-m-p 0.0000 0.0000 1817.3047 +YYCYYCCC 2226.111291 7 0.0000 65 | 1/23
3 h-m-p 0.0001 0.0003 480.2695 +CYCCC 2205.333445 4 0.0002 99 | 1/23
4 h-m-p 0.0000 0.0001 2468.8866 ++ 2162.539584 m 0.0001 125 | 1/23
5 h-m-p 0.0000 0.0000 18156.4867 ++ 2111.478050 m 0.0000 151 | 1/23
6 h-m-p -0.0000 -0.0000 13722.6585
h-m-p: -4.54954550e-22 -2.27477275e-21 1.37226585e+04 2111.478050
.. | 1/23
7 h-m-p 0.0000 0.0009 5917.6682 YCYCCC 2102.515826 5 0.0000 208 | 1/23
8 h-m-p 0.0001 0.0008 631.8904 ++ 2046.442758 m 0.0008 234 | 1/23
9 h-m-p 0.0000 0.0000 9878.6529 YCYC 2043.143611 3 0.0000 264 | 1/23
10 h-m-p 0.0000 0.0001 621.0762 +YCYYCYCCC 2022.464623 8 0.0001 303 | 1/23
11 h-m-p 0.0000 0.0000 17742.9585 +CYYYC 1980.825742 4 0.0000 336 | 1/23
12 h-m-p 0.0000 0.0000 2348.4394 +CYYYCCC 1968.952495 6 0.0000 372 | 1/23
13 h-m-p 0.0000 0.0000 5611.8389 ++ 1945.216321 m 0.0000 398 | 1/23
14 h-m-p -0.0000 -0.0000 505.4461
h-m-p: -5.22626751e-21 -2.61313376e-20 5.05446088e+02 1945.216321
.. | 0/23
15 h-m-p 0.0000 0.0002 310820.3217 -YYCYYCCC 1920.271836 7 0.0000 459 | 0/23
16 h-m-p 0.0000 0.0000 755.2406 ++ 1920.149531 m 0.0000 485 | 1/23
17 h-m-p 0.0000 0.0001 2162.6018 ++ 1652.989740 m 0.0001 511 | 2/23
18 h-m-p 0.0000 0.0002 285.8387 +YYYYCYCCC 1645.035816 8 0.0002 549 | 2/23
19 h-m-p 0.0002 0.0008 286.2173 +CYCCC 1632.639166 4 0.0007 583 | 2/23
20 h-m-p 0.0000 0.0001 315.7603 ++ 1630.422498 m 0.0001 609 | 2/23
21 h-m-p 0.0002 0.0025 162.1009 +CCCCC 1624.574386 4 0.0011 644 | 2/23
22 h-m-p 0.0003 0.0014 114.6065 +YCCC 1622.453187 3 0.0008 676 | 2/23
23 h-m-p 0.0002 0.0011 76.1906 ++ 1620.425004 m 0.0011 702 | 2/23
24 h-m-p 0.0020 0.0102 37.8133 YCCC 1619.949090 3 0.0012 733 | 2/23
25 h-m-p 0.0016 0.0078 21.8080 YCC 1619.534031 2 0.0026 762 | 2/23
26 h-m-p 0.0015 0.0074 11.3530 CCC 1619.414065 2 0.0021 792 | 2/23
27 h-m-p 0.0021 0.0259 11.7353 CC 1619.312918 1 0.0020 820 | 2/23
28 h-m-p 0.0032 0.0231 7.4940 CCC 1619.216743 2 0.0027 850 | 2/23
29 h-m-p 0.0029 0.0394 6.9141 +YCCC 1618.814443 3 0.0080 882 | 2/23
30 h-m-p 0.0033 0.0163 5.6195 +YCYCC 1617.907295 4 0.0091 915 | 2/23
31 h-m-p 0.0014 0.0070 10.8325 YCCCC 1617.568818 4 0.0029 948 | 2/23
32 h-m-p 0.0051 0.0344 6.0925 CYC 1617.274417 2 0.0062 977 | 2/23
33 h-m-p 0.0053 0.0370 7.0664 ++ 1613.220281 m 0.0370 1003 | 2/23
34 h-m-p 0.0030 0.0152 64.3271 YCCCCC 1603.446588 5 0.0070 1038 | 2/23
35 h-m-p 0.0021 0.0106 25.8991 CCCCC 1601.266300 4 0.0037 1072 | 2/23
36 h-m-p 0.0030 0.0148 11.3054 YYC 1601.081671 2 0.0023 1100 | 2/23
37 h-m-p 0.0076 0.0684 3.3504 YC 1601.017394 1 0.0041 1127 | 2/23
38 h-m-p 0.0078 0.3245 1.7658 ++CCCCC 1595.803253 4 0.1752 1163 | 2/23
39 h-m-p 0.4602 2.3008 0.4047 YYC 1594.142204 2 0.4151 1191 | 2/23
40 h-m-p 0.4976 2.4879 0.2466 CCC 1593.456355 2 0.5350 1242 | 2/23
41 h-m-p 0.5974 2.9871 0.2077 CCCC 1592.978054 3 0.7299 1295 | 2/23
42 h-m-p 0.7716 5.4910 0.1965 CC 1592.587358 1 1.0065 1344 | 2/23
43 h-m-p 1.0746 5.3731 0.1617 YC 1592.472219 1 0.5404 1392 | 2/23
44 h-m-p 1.0276 8.0000 0.0850 YCC 1592.420091 2 0.7909 1442 | 2/23
45 h-m-p 1.6000 8.0000 0.0365 YC 1592.402991 1 1.0077 1490 | 2/23
46 h-m-p 1.6000 8.0000 0.0121 CC 1592.384710 1 2.4141 1539 | 2/23
47 h-m-p 1.6000 8.0000 0.0044 CC 1592.347104 1 2.1751 1588 | 2/23
48 h-m-p 0.3137 8.0000 0.0306 +C 1592.308343 0 1.2607 1636 | 2/23
49 h-m-p 1.1407 8.0000 0.0339 CC 1592.289249 1 1.4144 1685 | 2/23
50 h-m-p 1.6000 8.0000 0.0032 YC 1592.284581 1 1.2561 1733 | 2/23
51 h-m-p 0.7454 8.0000 0.0053 CC 1592.283825 1 1.1113 1782 | 2/23
52 h-m-p 1.6000 8.0000 0.0033 CC 1592.282814 1 2.3368 1831 | 2/23
53 h-m-p 1.6000 8.0000 0.0009 CC 1592.281505 1 1.9993 1880 | 2/23
54 h-m-p 1.6000 8.0000 0.0006 C 1592.281379 0 1.3012 1927 | 2/23
55 h-m-p 1.6000 8.0000 0.0002 C 1592.281350 0 1.9108 1974 | 2/23
56 h-m-p 1.6000 8.0000 0.0002 Y 1592.281348 0 1.1106 2021 | 2/23
57 h-m-p 1.6000 8.0000 0.0000 Y 1592.281347 0 0.9860 2068 | 2/23
58 h-m-p 1.6000 8.0000 0.0000 Y 1592.281347 0 0.8035 2115 | 2/23
59 h-m-p 1.6000 8.0000 0.0000 Y 1592.281347 0 0.9645 2162 | 2/23
60 h-m-p 1.6000 8.0000 0.0000 -------------N 1592.281347 0 0.0000 2222
Out..
lnL = -1592.281347
2223 lfun, 2223 eigenQcodon, 46683 P(t)
Time used: 0:17
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), ((4, 5), (((((6, 7), 8), (11, 12)), 10), 9))); MP score: 231
1 0.346445
2 0.121237
3 0.116716
4 0.116282
5 0.116268
6 0.116265
7 0.116265
8 0.116265
0.026485 0.010488 0.017035 0.000000 0.040831 0.051916 0.044390 0.065302 0.083679 0.026993 0.038839 0.043852 0.026265 0.079488 0.084433 0.039039 0.091331 0.106455 0.107371 0.205092 0.295755 3.131781 0.630989 0.207592
ntime & nrate & np: 21 2 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.635625
np = 24
lnL0 = -1830.394558
Iterating by ming2
Initial: fx= 1830.394558
x= 0.02649 0.01049 0.01703 0.00000 0.04083 0.05192 0.04439 0.06530 0.08368 0.02699 0.03884 0.04385 0.02627 0.07949 0.08443 0.03904 0.09133 0.10646 0.10737 0.20509 0.29575 3.13178 0.63099 0.20759
1 h-m-p 0.0000 0.0000 500.9726 ++ 1830.392965 m 0.0000 29 | 1/24
2 h-m-p 0.0000 0.0000 15129.2189 ++ 1663.054071 m 0.0000 56 | 2/24
3 h-m-p 0.0000 0.0000 57061.8745 ++ 1655.058944 m 0.0000 83 | 2/24
4 h-m-p 0.0000 0.0000 2365.9384 +YYCYYYC 1640.299912 6 0.0000 118 | 2/24
5 h-m-p 0.0000 0.0001 4907.7699 +YCCC 1622.839677 3 0.0000 151 | 2/24
6 h-m-p 0.0005 0.0025 77.6823 CYCCCC 1619.450231 5 0.0010 187 | 2/24
7 h-m-p 0.0003 0.0016 97.5086 YCCCC 1617.665331 4 0.0007 221 | 2/24
8 h-m-p 0.0002 0.0008 96.0805 +YCCC 1616.696070 3 0.0005 254 | 2/24
9 h-m-p 0.0007 0.0034 28.0134 CCCC 1616.356865 3 0.0011 287 | 2/24
10 h-m-p 0.0009 0.0047 25.9175 CYC 1616.196256 2 0.0009 317 | 2/24
11 h-m-p 0.0006 0.0030 23.4415 +YC 1615.952573 1 0.0020 346 | 2/24
12 h-m-p 0.0004 0.0019 18.0505 ++ 1615.825108 m 0.0019 373 | 3/24
13 h-m-p 0.0004 0.0018 18.8029 ++ 1615.573398 m 0.0018 400 | 4/24
14 h-m-p 0.0018 0.0091 18.6489 YCCC 1614.991847 3 0.0034 432 | 4/24
15 h-m-p 0.0038 0.0192 15.7846 CCC 1614.863325 2 0.0015 463 | 4/24
16 h-m-p 0.0025 0.0627 9.4068 CC 1614.774115 1 0.0036 492 | 4/24
17 h-m-p 0.0011 0.0177 31.0945 +YYC 1614.500198 2 0.0037 522 | 4/24
18 h-m-p 0.0025 0.0161 46.9623 CCCC 1614.129717 3 0.0033 555 | 4/24
19 h-m-p 0.0033 0.0620 47.8351 +CCY 1612.682530 2 0.0131 587 | 4/24
20 h-m-p 0.0036 0.0179 94.5075 CCCCC 1611.487967 4 0.0053 622 | 4/24
21 h-m-p 0.0031 0.0153 33.8947 CCC 1611.228858 2 0.0040 653 | 3/24
22 h-m-p 0.0035 0.0198 38.7804 -CC 1611.121067 1 0.0002 683 | 3/24
23 h-m-p 0.0021 0.0555 3.9579 YC 1611.075815 1 0.0040 711 | 3/24
24 h-m-p 0.0359 0.9097 0.4407 ++YYCCC 1607.944826 4 0.5079 746 | 3/24
25 h-m-p 0.0036 0.0179 19.8533 +YYCCCC 1603.834438 5 0.0114 803 | 3/24
26 h-m-p 0.1349 0.6745 0.5069 +YYCYCC 1600.383993 5 0.4743 838 | 3/24
27 h-m-p 0.0680 0.3400 2.0600 +YCYCCC 1596.131683 5 0.1887 895 | 3/24
28 h-m-p 0.1409 0.7047 2.2311 YCCC 1594.269499 3 0.3047 927 | 3/24
29 h-m-p 0.4073 2.3051 1.6688 YYCCC 1592.890035 4 0.4109 960 | 3/24
30 h-m-p 1.0497 5.2487 0.1750 YCCC 1592.542522 3 0.6629 992 | 3/24
31 h-m-p 0.7332 5.0133 0.1582 YC 1592.467386 1 0.5055 1041 | 3/24
32 h-m-p 1.6000 8.0000 0.0473 YC 1592.426838 1 0.9951 1090 | 3/24
33 h-m-p 1.3230 8.0000 0.0356 CCC 1592.337665 2 2.0962 1142 | 3/24
34 h-m-p 1.0813 5.4067 0.0224 CCCC 1592.240572 3 1.1357 1196 | 3/24
35 h-m-p 1.6000 8.0000 0.0081 CC 1592.214588 1 1.4038 1246 | 3/24
36 h-m-p 1.2353 8.0000 0.0092 CC 1592.206747 1 1.4583 1296 | 3/24
37 h-m-p 1.1613 8.0000 0.0116 CC 1592.198199 1 1.6371 1346 | 3/24
38 h-m-p 1.6000 8.0000 0.0059 YC 1592.182047 1 2.9356 1395 | 3/24
39 h-m-p 1.5704 8.0000 0.0111 CC 1592.171388 1 1.4167 1445 | 3/24
40 h-m-p 1.6000 8.0000 0.0039 YC 1592.169018 1 0.9794 1494 | 3/24
41 h-m-p 1.6000 8.0000 0.0007 YC 1592.168697 1 0.9514 1543 | 3/24
42 h-m-p 1.0269 8.0000 0.0006 C 1592.168674 0 0.8621 1591 | 3/24
43 h-m-p 1.6000 8.0000 0.0002 Y 1592.168673 0 0.9691 1639 | 3/24
44 h-m-p 1.6000 8.0000 0.0000 Y 1592.168673 0 1.1043 1687 | 3/24
45 h-m-p 1.6000 8.0000 0.0000 Y 1592.168673 0 1.2553 1735 | 3/24
46 h-m-p 1.6000 8.0000 0.0000 -Y 1592.168673 0 0.0434 1784 | 3/24
47 h-m-p 0.0502 8.0000 0.0000 ---C 1592.168673 0 0.0002 1835
Out..
lnL = -1592.168673
1836 lfun, 5508 eigenQcodon, 77112 P(t)
Time used: 0:46
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), ((4, 5), (((((6, 7), 8), (11, 12)), 10), 9))); MP score: 231
1 0.081035
2 0.041710
3 0.040722
4 0.040657
5 0.040637
6 0.040636
7 0.040636
8 0.040636
initial w for M2:NSpselection reset.
0.022477 0.010397 0.018396 0.000000 0.029001 0.052118 0.042739 0.057716 0.098440 0.029904 0.045374 0.034025 0.028417 0.081234 0.089694 0.035857 0.087566 0.107984 0.104775 0.241677 0.345599 3.130829 1.237723 0.153992 0.218428 2.873198
ntime & nrate & np: 21 3 26
Bounds (np=26):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.847858
np = 26
lnL0 = -1874.067539
Iterating by ming2
Initial: fx= 1874.067539
x= 0.02248 0.01040 0.01840 0.00000 0.02900 0.05212 0.04274 0.05772 0.09844 0.02990 0.04537 0.03403 0.02842 0.08123 0.08969 0.03586 0.08757 0.10798 0.10478 0.24168 0.34560 3.13083 1.23772 0.15399 0.21843 2.87320
1 h-m-p 0.0000 0.0000 474.6446 ++ 1874.065534 m 0.0000 31 | 1/26
2 h-m-p 0.0000 0.0001 1628.2135 ++ 1847.229898 m 0.0001 60 | 1/26
3 h-m-p 0.0000 0.0000 2752.9394
h-m-p: 2.54721382e-20 1.27360691e-19 2.75293942e+03 1847.229898
.. | 1/26
4 h-m-p 0.0000 0.0005 13813.2540 CYCYYCCC 1836.972613 7 0.0000 126 | 1/26
5 h-m-p 0.0001 0.0005 411.6854 ++ 1747.169398 m 0.0005 155 | 2/26
6 h-m-p 0.0000 0.0005 46190.5342 YCYCCC 1671.098469 5 0.0000 192 | 2/26
7 h-m-p 0.0004 0.0020 68.3293 +YYCYCC 1666.842224 5 0.0014 229 | 2/26
8 h-m-p 0.0015 0.0077 57.6588 +YYCCC 1660.149868 4 0.0052 265 | 2/26
9 h-m-p 0.0034 0.0170 46.3344 YCCCC 1656.338832 4 0.0066 301 | 2/26
10 h-m-p 0.0006 0.0029 68.0299 YCCCC 1655.393934 4 0.0013 337 | 2/26
11 h-m-p 0.0005 0.0027 78.8558 ++ 1653.447121 m 0.0027 366 | 3/26
12 h-m-p 0.0074 0.0400 25.3894 YC 1650.131397 1 0.0182 396 | 3/26
13 h-m-p 0.0076 0.0379 35.0465 CYCCC 1645.380887 4 0.0143 432 | 3/26
14 h-m-p 0.0053 0.0264 33.2837 YCCCC 1642.205558 4 0.0106 468 | 2/26
15 h-m-p 0.0019 0.0096 82.3780 YCCC 1640.642099 3 0.0033 502 | 2/26
16 h-m-p 0.0055 0.0273 45.5592 YCCCCC 1636.090139 5 0.0136 540 | 2/26
17 h-m-p 0.0019 0.0097 69.6849 YCCCC 1634.046139 4 0.0047 576 | 2/26
18 h-m-p 0.0109 0.0921 29.9300 +YCCC 1627.827598 3 0.0548 611 | 2/26
19 h-m-p 0.0162 0.1078 101.0746 CYCC 1620.384825 3 0.0201 645 | 2/26
20 h-m-p 0.0043 0.0217 39.2026 YCCCC 1618.966187 4 0.0093 681 | 2/26
21 h-m-p 0.0069 0.0345 18.0841 YCCCC 1617.931003 4 0.0156 717 | 2/26
22 h-m-p 0.0417 0.2153 6.7700 YCC 1617.248741 2 0.0342 749 | 2/26
23 h-m-p 0.0321 0.1657 7.2117 +YYCCC 1614.932944 4 0.1004 785 | 2/26
24 h-m-p 0.0128 0.0849 56.6841 YCCCCC 1611.027798 5 0.0239 823 | 2/26
25 h-m-p 0.0197 0.0986 12.1412 CCC 1610.175273 2 0.0240 856 | 2/26
26 h-m-p 0.0308 0.1540 3.3097 ++ 1607.612834 m 0.1540 885 | 2/26
27 h-m-p 0.0307 0.1535 10.5711 YCYCCC 1602.972500 5 0.0829 922 | 2/26
28 h-m-p 0.0227 0.1133 6.8155 YYC 1602.624266 2 0.0178 953 | 2/26
29 h-m-p 0.1377 1.7404 0.8824 +CYCCC 1600.361588 4 0.7146 990 | 2/26
30 h-m-p 0.1528 0.7639 1.2466 CYCCC 1599.576531 4 0.2219 1050 | 2/26
31 h-m-p 0.1937 0.9686 1.1789 CCCCC 1598.472415 4 0.2643 1087 | 2/26
32 h-m-p 0.3280 2.6996 0.9500 YCCC 1597.185300 3 0.6541 1121 | 2/26
33 h-m-p 0.1807 0.9036 1.5957 YCCCC 1596.096782 4 0.4189 1181 | 2/26
34 h-m-p 0.2941 3.2906 2.2732 CCC 1595.617278 2 0.2916 1214 | 2/26
35 h-m-p 0.2959 1.4793 1.7179 CYCCC 1595.040612 4 0.4483 1250 | 2/26
36 h-m-p 0.4078 2.2977 1.8883 YYYC 1594.672888 3 0.3828 1282 | 2/26
37 h-m-p 0.4649 3.3515 1.5550 CCCC 1594.367784 3 0.5089 1317 | 2/26
38 h-m-p 0.3221 1.6104 2.3152 YCC 1594.201481 2 0.2435 1349 | 2/26
39 h-m-p 0.2696 3.5465 2.0908 CCC 1594.030192 2 0.3751 1382 | 2/26
40 h-m-p 0.4074 2.7925 1.9246 CYY 1593.908589 2 0.3969 1414 | 2/26
41 h-m-p 0.4674 3.9831 1.6340 CCC 1593.803580 2 0.5495 1447 | 2/26
42 h-m-p 0.3651 3.3350 2.4595 CC 1593.715301 1 0.3651 1478 | 2/26
43 h-m-p 0.4577 3.7771 1.9619 CYC 1593.646485 2 0.4363 1510 | 2/26
44 h-m-p 0.4649 7.6668 1.8415 CYC 1593.579952 2 0.5357 1542 | 2/26
45 h-m-p 0.2245 3.4089 4.3943 CCCC 1593.521933 3 0.2603 1577 | 2/26
46 h-m-p 0.3384 4.2123 3.3798 CCC 1593.460602 2 0.3934 1610 | 2/26
47 h-m-p 0.2783 2.0903 4.7778 CCCC 1593.393585 3 0.3241 1645 | 2/26
48 h-m-p 0.2977 2.9049 5.2011 CCC 1593.321634 2 0.3076 1678 | 2/26
49 h-m-p 0.5055 8.0000 3.1653 CYC 1593.187469 2 0.6202 1710 | 2/26
50 h-m-p 0.2375 3.7794 8.2657 YCCC 1592.942211 3 0.5450 1744 | 2/26
51 h-m-p 0.3971 2.5885 11.3426 CCCC 1592.646807 3 0.5304 1779 | 2/26
52 h-m-p 0.3738 1.8692 8.4551 CC 1592.429583 1 0.3469 1810 | 2/26
53 h-m-p 0.3212 2.0226 9.1328 CCCC 1592.240056 3 0.3685 1845 | 2/26
54 h-m-p 1.6000 8.0000 1.5320 YCC 1592.201600 2 0.2731 1877 | 2/26
55 h-m-p 1.5287 7.7210 0.2737 YC 1592.179201 1 0.2443 1907 | 2/26
56 h-m-p 0.1148 8.0000 0.5826 YC 1592.174762 1 0.2867 1961 | 2/26
57 h-m-p 0.6766 8.0000 0.2469 YC 1592.172377 1 0.4300 2015 | 2/26
58 h-m-p 1.6000 8.0000 0.0586 -YC 1592.172217 1 0.1938 2070 | 2/26
59 h-m-p 0.5254 8.0000 0.0216 C 1592.172158 0 0.5101 2123 | 2/26
60 h-m-p 0.5619 8.0000 0.0196 Y 1592.172145 0 0.3033 2176 | 2/26
61 h-m-p 1.6000 8.0000 0.0017 Y 1592.172140 0 0.7628 2229 | 2/26
62 h-m-p 0.4436 8.0000 0.0030 Y 1592.172133 0 1.0634 2282 | 2/26
63 h-m-p 0.0905 8.0000 0.0351 +++Y 1592.172083 0 3.7453 2338 | 2/26
64 h-m-p 0.3464 8.0000 0.3796 +C 1592.171817 0 1.6731 2392 | 2/26
65 h-m-p 0.7500 8.0000 0.8468 +YC 1592.170020 1 4.4672 2447 | 2/26
66 h-m-p 1.0650 8.0000 3.5518 YC 1592.168943 1 0.6727 2501 | 2/26
67 h-m-p 0.6620 8.0000 3.6090 C 1592.168145 0 0.6105 2530 | 2/26
68 h-m-p 1.2198 8.0000 1.8063 C 1592.167711 0 1.2198 2559 | 2/26
69 h-m-p 0.8547 8.0000 2.5778 YC 1592.167271 1 1.8498 2589 | 2/26
70 h-m-p 1.6000 8.0000 2.5557 C 1592.167098 0 1.4129 2618 | 2/26
71 h-m-p 1.6000 8.0000 2.0308 C 1592.167005 0 1.6000 2647 | 2/26
72 h-m-p 1.3368 8.0000 2.4307 Y 1592.166949 0 2.2316 2676 | 2/26
73 h-m-p 1.6000 8.0000 2.2218 C 1592.166926 0 1.6000 2705 | 2/26
74 h-m-p 1.6000 8.0000 1.9902 C 1592.166916 0 1.9792 2734 | 2/26
75 h-m-p 1.6000 8.0000 2.3384 C 1592.166910 0 1.6000 2763 | 2/26
76 h-m-p 1.5262 8.0000 2.4514 C 1592.166908 0 1.8383 2792 | 2/26
77 h-m-p 1.6000 8.0000 2.3928 C 1592.166906 0 1.3076 2821 | 2/26
78 h-m-p 1.3043 8.0000 2.3988 C 1592.166906 0 1.7891 2850 | 2/26
79 h-m-p 1.6000 8.0000 2.0275 C 1592.166905 0 2.2528 2879 | 2/26
80 h-m-p 1.2206 8.0000 3.7420 Y 1592.166905 0 2.7053 2908 | 2/26
81 h-m-p 0.5906 8.0000 17.1409 Y 1592.166905 0 1.1621 2937 | 2/26
82 h-m-p 1.6000 8.0000 3.9148 Y 1592.166905 0 1.0997 2966 | 2/26
83 h-m-p 1.6000 8.0000 1.1907 ++ 1592.166905 m 8.0000 2995 | 2/26
84 h-m-p 0.7661 8.0000 12.4347 ----Y 1592.166905 0 0.0016 3028 | 2/26
85 h-m-p 1.6000 8.0000 0.0000 C 1592.166905 0 0.4000 3057 | 2/26
86 h-m-p 0.0162 8.0000 0.0005 ++C 1592.166905 0 0.2788 3112 | 2/26
87 h-m-p 0.1783 8.0000 0.0008 ++C 1592.166905 0 3.2795 3167 | 2/26
88 h-m-p 1.2052 8.0000 0.0022 Y 1592.166905 0 0.8332 3220 | 2/26
89 h-m-p 1.6000 8.0000 0.0010 C 1592.166905 0 0.3236 3273 | 2/26
90 h-m-p 0.2590 8.0000 0.0012 Y 1592.166905 0 0.2590 3326 | 2/26
91 h-m-p 0.3856 8.0000 0.0008 ---------------.. | 2/26
92 h-m-p 0.0160 8.0000 0.0005 --------C 1592.166905 0 0.0000 3453 | 2/26
93 h-m-p 0.0160 8.0000 0.0002 --C 1592.166905 0 0.0003 3508
Out..
lnL = -1592.166905
3509 lfun, 14036 eigenQcodon, 221067 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1668.871106 S = -1649.708482 -12.234508
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 146 patterns 2:07
did 20 / 146 patterns 2:07
did 30 / 146 patterns 2:08
did 40 / 146 patterns 2:08
did 50 / 146 patterns 2:08
did 60 / 146 patterns 2:08
did 70 / 146 patterns 2:08
did 80 / 146 patterns 2:08
did 90 / 146 patterns 2:08
did 100 / 146 patterns 2:08
did 110 / 146 patterns 2:08
did 120 / 146 patterns 2:08
did 130 / 146 patterns 2:08
did 140 / 146 patterns 2:08
did 146 / 146 patterns 2:08
Time used: 2:08
Model 3: discrete
TREE # 1
(1, (2, 3), ((4, 5), (((((6, 7), 8), (11, 12)), 10), 9))); MP score: 231
1 0.084829
2 0.042219
3 0.041408
4 0.041234
5 0.041212
6 0.041209
7 0.041208
8 0.041208
0.024768 0.013540 0.017469 0.000000 0.030432 0.049707 0.043793 0.056614 0.094094 0.030158 0.040585 0.032302 0.029322 0.080853 0.093947 0.040289 0.092292 0.107194 0.102459 0.237896 0.346206 3.130827 0.387814 0.891300 0.000050 0.000114 0.000208
ntime & nrate & np: 21 4 27
Bounds (np=27):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 16.436182
np = 27
lnL0 = -1596.429003
Iterating by ming2
Initial: fx= 1596.429003
x= 0.02477 0.01354 0.01747 0.00000 0.03043 0.04971 0.04379 0.05661 0.09409 0.03016 0.04059 0.03230 0.02932 0.08085 0.09395 0.04029 0.09229 0.10719 0.10246 0.23790 0.34621 3.13083 0.38781 0.89130 0.00005 0.00011 0.00021
1 h-m-p 0.0000 0.0000 719.2624 ++ 1596.426612 m 0.0000 32 | 1/27
2 h-m-p 0.0000 0.0000 593.7995 ++ 1596.380644 m 0.0000 62 | 2/27
3 h-m-p 0.0000 0.0000 345.3690 ++ 1596.317922 m 0.0000 92 | 3/27
4 h-m-p 0.0000 0.0000 244.4982 ++ 1596.270425 m 0.0000 122 | 4/27
5 h-m-p 0.0000 0.0017 58.9762 +++YCYCCC 1594.584823 5 0.0008 163 | 4/27
6 h-m-p 0.0010 0.0075 49.2560 YCCC 1594.146750 3 0.0005 198 | 4/27
7 h-m-p 0.0004 0.0019 40.7987 CYCCC 1593.697948 4 0.0007 235 | 4/27
8 h-m-p 0.0010 0.0081 27.4928 CCC 1593.454817 2 0.0009 269 | 4/27
9 h-m-p 0.0011 0.0082 21.2724 YCC 1593.348894 2 0.0007 302 | 4/27
10 h-m-p 0.0007 0.0063 22.4202 CC 1593.265139 1 0.0007 334 | 4/27
11 h-m-p 0.0011 0.0141 14.7325 CCC 1593.174939 2 0.0015 368 | 4/27
12 h-m-p 0.0012 0.0126 18.8108 CYC 1593.092439 2 0.0011 401 | 4/27
13 h-m-p 0.0008 0.0133 27.0801 YC 1592.918256 1 0.0017 432 | 4/27
14 h-m-p 0.0010 0.0098 44.3638 CCC 1592.717200 2 0.0012 466 | 4/27
15 h-m-p 0.0017 0.0085 27.4805 YCC 1592.613581 2 0.0011 499 | 4/27
16 h-m-p 0.0011 0.0109 26.8911 CC 1592.487123 1 0.0015 531 | 4/27
17 h-m-p 0.0020 0.0112 20.8770 YYC 1592.389879 2 0.0017 563 | 4/27
18 h-m-p 0.0015 0.0147 23.5750 YC 1592.348569 1 0.0007 594 | 4/27
19 h-m-p 0.0082 0.0522 2.1560 YC 1592.346255 1 0.0011 625 | 4/27
20 h-m-p 0.0011 0.1722 2.1848 CC 1592.344027 1 0.0014 657 | 4/27
21 h-m-p 0.0027 1.0459 1.1084 ++YC 1592.319570 1 0.0283 690 | 4/27
22 h-m-p 0.0024 0.0600 13.1562 CC 1592.296310 1 0.0022 722 | 4/27
23 h-m-p 0.0240 0.1200 1.0401 -YC 1592.294458 1 0.0025 754 | 4/27
24 h-m-p 0.0089 0.7216 0.2900 +CC 1592.268557 1 0.0460 787 | 4/27
25 h-m-p 0.0022 0.0706 6.0934 +YC 1592.193870 1 0.0057 842 | 4/27
26 h-m-p 0.5685 8.0000 0.0606 CC 1592.171514 1 0.8574 874 | 4/27
27 h-m-p 0.4317 8.0000 0.1204 YC 1592.167599 1 0.3209 928 | 4/27
28 h-m-p 1.6000 8.0000 0.0044 YC 1592.166919 1 1.1490 982 | 4/27
29 h-m-p 1.6000 8.0000 0.0004 Y 1592.166905 0 1.1434 1035 | 4/27
30 h-m-p 1.6000 8.0000 0.0000 Y 1592.166905 0 1.0883 1088 | 4/27
31 h-m-p 1.6000 8.0000 0.0000 Y 1592.166905 0 1.0493 1141 | 4/27
32 h-m-p 1.6000 8.0000 0.0000 Y 1592.166905 0 0.7124 1194 | 4/27
33 h-m-p 1.6000 8.0000 0.0000 --C 1592.166905 0 0.0250 1249
Out..
lnL = -1592.166905
1250 lfun, 5000 eigenQcodon, 78750 P(t)
Time used: 2:37
Model 7: beta
TREE # 1
(1, (2, 3), ((4, 5), (((((6, 7), 8), (11, 12)), 10), 9))); MP score: 231
1 0.087934
2 0.042636
3 0.037545
4 0.037231
5 0.037228
6 0.037227
7 0.037227
8 0.037227
0.021672 0.008964 0.015212 0.000000 0.027071 0.049761 0.043228 0.055706 0.096572 0.025873 0.042250 0.034000 0.028488 0.081681 0.091944 0.038282 0.091805 0.108040 0.106814 0.243454 0.352080 3.130828 0.275304 1.140227
ntime & nrate & np: 21 1 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 9.462335
np = 24
lnL0 = -1699.465296
Iterating by ming2
Initial: fx= 1699.465296
x= 0.02167 0.00896 0.01521 0.00000 0.02707 0.04976 0.04323 0.05571 0.09657 0.02587 0.04225 0.03400 0.02849 0.08168 0.09194 0.03828 0.09181 0.10804 0.10681 0.24345 0.35208 3.13083 0.27530 1.14023
1 h-m-p 0.0000 0.0000 430.0303 ++ 1699.464130 m 0.0000 29 | 1/24
2 h-m-p 0.0000 0.0001 1638.0337 ++ 1658.638722 m 0.0001 56 | 1/24
3 h-m-p 0.0000 0.0001 3097.7159 ++ 1613.124544 m 0.0001 83 | 2/24
4 h-m-p 0.0000 0.0002 352.5060 YCCC 1612.990595 3 0.0000 115 | 2/24
5 h-m-p 0.0000 0.0008 203.3531 +YCYC 1610.626378 3 0.0003 147 | 2/24
6 h-m-p 0.0004 0.0018 85.1423 CCCC 1609.789946 3 0.0003 180 | 2/24
7 h-m-p 0.0002 0.0008 125.7304 YCCCC 1608.623159 4 0.0003 214 | 2/24
8 h-m-p 0.0006 0.0031 58.7573 YCCCC 1607.180864 4 0.0014 248 | 2/24
9 h-m-p 0.0010 0.0051 71.8513 CCCC 1605.844547 3 0.0013 281 | 2/24
10 h-m-p 0.0006 0.0031 97.0745 CCCCC 1604.959794 4 0.0008 316 | 2/24
11 h-m-p 0.0016 0.0078 46.2435 YYCC 1604.346069 3 0.0014 347 | 2/24
12 h-m-p 0.0012 0.0060 54.1382 YYC 1603.886561 2 0.0011 376 | 2/24
13 h-m-p 0.0011 0.0127 51.9135 YCCC 1602.946029 3 0.0025 408 | 2/24
14 h-m-p 0.0016 0.0079 19.3979 YCC 1602.855298 2 0.0010 438 | 2/24
15 h-m-p 0.0022 0.0320 8.2042 YC 1602.815769 1 0.0017 466 | 2/24
16 h-m-p 0.0013 0.0258 10.8834 CC 1602.781107 1 0.0013 495 | 2/24
17 h-m-p 0.0031 0.0458 4.6710 YC 1602.769703 1 0.0014 523 | 2/24
18 h-m-p 0.0040 0.0791 1.6420 YC 1602.761531 1 0.0028 551 | 2/24
19 h-m-p 0.0062 0.2483 0.7566 +CCC 1602.660628 2 0.0218 583 | 2/24
20 h-m-p 0.0015 0.0128 11.3066 YCCC 1602.399836 3 0.0030 637 | 2/24
21 h-m-p 0.0015 0.0075 9.9822 YCC 1602.341072 2 0.0012 667 | 2/24
22 h-m-p 0.0084 0.0590 1.4779 YC 1602.327839 1 0.0041 695 | 2/24
23 h-m-p 0.0129 0.6055 0.4672 ++YCYCCC 1600.658684 5 0.2570 732 | 2/24
24 h-m-p 0.0078 0.0392 6.3125 CC 1600.624536 1 0.0017 783 | 2/24
25 h-m-p 0.0681 8.0000 0.1550 ++
QuantileBeta(0.15, 0.00500, 2.39893) = 1.071963e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.90314) = 8.507066e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20496) = 1.190732e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.19485) = 1.197641e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.17646) = 1.210409e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.17508) = 1.211382e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.14924) = 1.229815e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
C 1598.269684 4 2.7419 820
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17469) = 1.211658e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17481) = 1.211572e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17457) = 1.211743e-160 2000 rounds
| 2/24
26 h-m-p 0.6668 6.0744 0.6372
QuantileBeta(0.15, 0.00500, 2.39855) = 1.072171e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 3.07015) = 7.961660e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45352) = 1.042654e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.76183) = 9.030068e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49490) = 1.021473e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.62837) = 9.586225e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50120) = 1.018326e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.56478) = 9.875803e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50257) = 1.017645e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.53367) = 1.002389e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
C 1597.106369 4 0.9769 877
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.017589e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50268) = 1.053112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50281) = 1.017524e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50255) = 1.017653e-160 2000 rounds
| 2/24
27 h-m-p 0.2756 1.3779 1.0164
QuantileBeta(0.15, 0.00500, 2.68824) = 9.328548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24493) = 7.460688e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.85433) = 8.680797e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.86626) = 8.637668e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.05560) = 8.006398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88568) = 8.568421e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.97064) = 8.277939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88722) = 8.562979e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.92893) = 8.418062e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
C 1595.775970 4 0.5716 933
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.860576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561684e-161 2000 rounds
| 2/24
28 h-m-p 1.3367 6.6834 0.2794
QuantileBeta(0.15, 0.00500, 3.25983) = 7.420876e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.37656) = 5.298280e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.43134) = 6.991215e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.90395) = 6.028535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41446) = 7.031280e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.33714) = 7.220851e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41097) = 7.039633e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.37406) = 7.129096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
C 1594.449279 3 1.8790 966
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.039898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41086) = 7.285659e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41101) = 7.039537e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41071) = 7.040260e-161 2000 rounds
| 2/24
29 h-m-p 1.2604 8.0000 0.4165
QuantileBeta(0.15, 0.00500, 3.93449) = 5.975337e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50538) = 4.108466e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.16746) = 5.598377e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.67267) = 6.464248e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04888) = 5.784129e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
C 1593.668333 2 1.5351 1018
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.986486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04878) = 5.784281e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04845) = 5.784817e-161 2000 rounds
| 2/24
30 h-m-p 0.9400 6.6714 0.6802
QuantileBeta(0.15, 0.00500, 4.68557) = 4.909244e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59643) = 3.375299e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05286) = 4.515052e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 5.82465) = 3.862975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
C 1592.838935 1 1.4805 1069
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.516138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05176) = 4.673795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05195) = 4.515953e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.05158) = 4.516322e-161 2000 rounds
| 2/24
31 h-m-p 1.5982 7.9911 0.6193
QuantileBeta(0.15, 0.00500, 6.04093) = 3.712671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.00843) = 2.420050e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94807) = 3.775745e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 7.52468) = 2.930248e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.00946) = 3.733810e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
C 1592.390342 2 1.5487 1121
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.733267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01026) = 3.863594e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01047) = 3.733128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.01006) = 3.733406e-161 2000 rounds
| 2/24
32 h-m-p 1.6000 8.0000 0.4425
QuantileBeta(0.15, 0.00500, 6.71476) = 3.311200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.82825) = 2.472330e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68190) = 3.328758e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.34608) = 3.519441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336739e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.50658) = 3.425659e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
C 1592.251573 2 1.4910 1174
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.336912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66675) = 3.453403e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66697) = 3.336794e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66653) = 3.337030e-161 2000 rounds
| 2/24
33 h-m-p 1.6000 8.0000 0.3258
QuantileBeta(0.15, 0.00500, 7.18783) = 3.077517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.75105) = 2.495425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.03775) = 3.148000e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 7.02112) = 3.156009e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.84394) = 3.243943e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
C 1592.220408 2 1.0782 1226
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.157576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01788) = 3.267806e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01810) = 3.157467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.01765) = 3.157685e-161 2000 rounds
| 2/24
34 h-m-p 1.6000 8.0000 0.1436
QuantileBeta(0.15, 0.00500, 7.24671) = 3.050718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.93319) = 2.769511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17404) = 3.083862e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
C 1592.215735 1 1.0914 1276
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.083896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17396) = 3.191554e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17419) = 3.083791e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17373) = 3.084002e-161 2000 rounds
| 2/24
35 h-m-p 1.6000 8.0000 0.0168
QuantileBeta(0.15, 0.00500, 7.20077) = 3.071585e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.28120) = 3.035235e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19124) = 3.075950e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
C 1592.215592 1 1.0300 1326
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.075960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19122) = 3.183341e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19145) = 3.075855e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.19099) = 3.076065e-161 2000 rounds
| 2/24
36 h-m-p 1.6000 8.0000 0.0044
QuantileBeta(0.15, 0.00500, 7.19823) = 3.072750e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21925) = 3.063159e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 7.22625) = 3.059975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
Y 1592.215432 0 4.9008 1376
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.066148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21268) = 3.173186e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21291) = 3.066043e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.21245) = 3.066252e-161 2000 rounds
| 2/24
37 h-m-p 1.6000 8.0000 0.0014
QuantileBeta(0.15, 0.00500, 7.21487) = 3.065149e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22145) = 3.062156e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
+ 1592.213304 m 8.0000 1425
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.061160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22364) = 3.168024e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22387) = 3.061056e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.22341) = 3.061264e-161 2000 rounds
| 2/24
38 h-m-p 0.6560 8.0000 0.0172
QuantileBeta(0.15, 0.00500, 7.23213) = 3.057310e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.25759) = 3.045816e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 7.32714) = 3.014854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.25006) = 3.049206e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
C 1592.191194 1 2.0253 1476
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.049303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24984) = 3.155753e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.25007) = 3.049199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.24961) = 3.049407e-161 2000 rounds
| 2/24
39 h-m-p 0.5441 8.0000 0.0638
QuantileBeta(0.15, 0.00500, 7.21535) = 3.064933e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.11186) = 3.112798e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.74266) = 3.296440e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05015) = 3.142057e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.89640) = 3.217399e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04487) = 3.144585e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.97064) = 3.180576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
C 1592.166218 2 3.2493 1530
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.145077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04384) = 3.254871e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04407) = 3.144969e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.04362) = 3.145186e-161 2000 rounds
| 2/24
40 h-m-p 1.6000 8.0000 0.0140
QuantileBeta(0.15, 0.00500, 7.06603) = 3.134475e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.13258) = 3.103093e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05617) = 3.139178e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
C 1592.166098 1 0.8898 1580
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.139172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05618) = 3.248760e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05595) = 3.139280e-161 2000 rounds
| 2/24
41 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 7.05628) = 3.139122e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05660) = 3.138972e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
Y 1592.166097 0 0.9455 1629
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.139142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05624) = 3.248729e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05647) = 3.139034e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05602) = 3.139251e-161 2000 rounds
| 2/24
42 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 7.05629) = 3.139119e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05644) = 3.139049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
Y 1592.166097 0 0.9626 1678
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.139128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05627) = 3.248714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05650) = 3.139020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05604) = 3.139236e-161 2000 rounds
| 2/24
43 h-m-p 0.9981 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 7.05630) = 3.139114e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05639) = 3.139070e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
C 1592.166097 0 1.2544 1727
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.139110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05631) = 3.248695e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05654) = 3.139002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05608) = 3.139218e-161 2000 rounds
| 2/24
44 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 7.05634) = 3.139096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05643) = 3.139054e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 7.05646) = 3.139040e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
C 1592.166097 0 5.6036 1777
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.139061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05641) = 3.248644e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05664) = 3.138953e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05619) = 3.139169e-161 2000 rounds
| 2/24
45 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 7.05650) = 3.139020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05675) = 3.138899e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
+ 1592.166097 m 8.0000 1826
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.138859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05684) = 3.248435e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05706) = 3.138751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05661) = 3.138967e-161 2000 rounds
| 2/24
46 h-m-p 0.0377 8.0000 0.0112
QuantileBeta(0.15, 0.00500, 7.05726) = 3.138657e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.05853) = 3.138051e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 7.06360) = 3.135632e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 7.08389) = 3.125989e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 7.14661) = 3.096560e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
C 1592.166096 0 2.1310 1878
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.127479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08075) = 3.236659e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08097) = 3.127372e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.08052) = 3.127587e-161 2000 rounds
| 2/24
47 h-m-p 1.6000 8.0000 0.0113
QuantileBeta(0.15, 0.00500, 7.09879) = 3.118947e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.15292) = 3.093628e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
+ 1592.166091 m 8.0000 1927
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.085279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17096) = 3.192985e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17119) = 3.085173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.17074) = 3.085384e-161 2000 rounds
| 2/24
48 h-m-p 0.0275 8.0000 3.2808
QuantileBeta(0.15, 0.00500, 7.26118) = 3.044201e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.53183) = 2.927273e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.61444) = 2.537374e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 12.94485) = 1.655225e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 33.41757) = 5.043339e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.73288) = 6.815775e-162 2000 rounds
C 1592.165852 0 7.0395 1980
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 6.922545e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26650) = 7.164209e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.26652) = 6.922542e-162 2000 rounds
| 2/24
49 h-m-p 1.6000 8.0000 1.1766
QuantileBeta(0.15, 0.00500, 32.14899) = 5.245459e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.79644) = 4.451293e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
Y 1592.165822 0 1.1222 2007
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.628567e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58689) = 6.859968e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.58690) = 6.628564e-162 2000 rounds
| 2/24
50 h-m-p 1.1034 8.0000 1.1966
QuantileBeta(0.15, 0.00500, 32.90727) = 5.122742e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.86842) = 4.564863e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
+ 1592.165806 m 8.0000 2034
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.083126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15980) = 4.222754e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.15982) = 4.083124e-162 2000 rounds
| 2/24
51 h-m-p 0.8144 4.9209 11.7540
QuantileBeta(0.15, 0.00500, 50.73271) = 1.977693e-162 2000 rounds
++ 1592.165779 m 4.9209 2061 | 3/24
52 h-m-p 1.4218 8.0000 0.0004 Y 1592.165772 0 1.0046 2088 | 3/24
53 h-m-p 1.6000 8.0000 0.0000 Y 1592.165772 0 0.9760 2136 | 3/24
54 h-m-p 1.6000 8.0000 0.0000 C 1592.165772 0 1.3565 2184
Out..
lnL = -1592.165772
2185 lfun, 24035 eigenQcodon, 458850 P(t)
Time used: 6:05
Model 8: beta&w>1
TREE # 1
(1, (2, 3), ((4, 5), (((((6, 7), 8), (11, 12)), 10), 9))); MP score: 231
1 0.091986
2 0.051139
3 0.045537
4 0.044318
5 0.044208
6 0.044182
7 0.044178
8 0.044178
9 0.044178
initial w for M8:NSbetaw>1 reset.
0.021889 0.014608 0.019645 0.000000 0.029323 0.053226 0.045862 0.054116 0.096057 0.028236 0.042332 0.037131 0.027784 0.084265 0.091146 0.037765 0.087405 0.107148 0.102895 0.237700 0.341625 3.130819 0.900000 1.017971 1.440735 2.095350
ntime & nrate & np: 21 2 26
Bounds (np=26):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.091725
np = 26
lnL0 = -1839.532231
Iterating by ming2
Initial: fx= 1839.532231
x= 0.02189 0.01461 0.01965 0.00000 0.02932 0.05323 0.04586 0.05412 0.09606 0.02824 0.04233 0.03713 0.02778 0.08427 0.09115 0.03776 0.08740 0.10715 0.10289 0.23770 0.34163 3.13082 0.90000 1.01797 1.44073 2.09535
1 h-m-p 0.0000 0.0000 417.0533 ++ 1839.531030 m 0.0000 31 | 1/26
2 h-m-p 0.0000 0.0001 867.0796 +YCCYYC 1826.702408 5 0.0001 69 | 1/26
3 h-m-p 0.0000 0.0000 2461.8870 ++ 1809.111862 m 0.0000 98 | 2/26
4 h-m-p 0.0001 0.0006 455.5026 +CYCCCC 1798.386748 5 0.0004 137 | 2/26
5 h-m-p 0.0000 0.0001 1138.6789 ++ 1786.536874 m 0.0001 166 | 2/26
6 h-m-p 0.0000 0.0000 1928.0600
h-m-p: 1.62042779e-21 8.10213897e-21 1.92805998e+03 1786.536874
.. | 2/26
7 h-m-p 0.0000 0.0007 1318.4050 ++CYYCC 1757.155570 4 0.0001 230 | 2/26
8 h-m-p 0.0002 0.0009 210.5476 +CYYYC 1733.201323 4 0.0008 265 | 2/26
9 h-m-p 0.0001 0.0004 1195.9451 ++ 1675.390694 m 0.0004 294 | 2/26
10 h-m-p 0.0000 0.0000 1379.4073
h-m-p: 1.85102295e-20 9.25511473e-20 1.37940732e+03 1675.390694
.. | 2/26
11 h-m-p 0.0000 0.0005 363.1798 +++ 1651.575614 m 0.0005 350 | 1/26
12 h-m-p 0.0000 0.0000 8082.9433 CCC 1651.286128 2 0.0000 383 | 1/26
13 h-m-p 0.0000 0.0000 4212.9870 ++ 1621.592850 m 0.0000 412 | 2/26
14 h-m-p 0.0000 0.0000 15633.8858 YCYC 1615.937964 3 0.0000 445 | 2/26
15 h-m-p 0.0003 0.0016 108.2584 YCCC 1614.703852 3 0.0002 479 | 2/26
16 h-m-p 0.0001 0.0007 162.8439 YCYCCC 1612.645918 5 0.0003 516 | 2/26
17 h-m-p 0.0003 0.0015 66.2492 YCCCC 1611.760483 4 0.0006 552 | 2/26
18 h-m-p 0.0005 0.0024 36.2907 YCCC 1611.265173 3 0.0010 586 | 2/26
19 h-m-p 0.0004 0.0020 30.3946 YCC 1611.057906 2 0.0007 618 | 2/26
20 h-m-p 0.0004 0.0018 18.9175 +YC 1610.905210 1 0.0010 649 | 2/26
21 h-m-p 0.0001 0.0006 26.7092 ++ 1610.665395 m 0.0006 678 | 3/26
22 h-m-p 0.0013 0.0117 12.8919 CYC 1610.490138 2 0.0014 710 | 3/26
23 h-m-p 0.0007 0.0072 24.2177 YCCC 1610.055700 3 0.0017 744 | 3/26
24 h-m-p 0.0013 0.0125 31.9143 +
QuantileBeta(0.15, 0.00500, 2.15247) = 1.227482e-160 2000 rounds
YCYCCC 1605.558993 5 0.0086 782 | 3/26
25 h-m-p 0.0002 0.0010 285.6205
QuantileBeta(0.15, 0.00500, 2.23666) = 1.169576e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15587) = 1.225031e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.15879) = 1.222941e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.19772) = 1.195670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16850) = 1.216027e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.16898) = 1.215686e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.18335) = 1.205596e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16961) = 1.215237e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.17648) = 1.210398e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
C 1603.256548 5 0.0005 819
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215207e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16965) = 1.215208e-160 2000 rounds
| 3/26
26 h-m-p 0.0007 0.0033 40.9071
QuantileBeta(0.15, 0.00500, 2.18683) = 1.203178e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23836) = 1.168461e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18240) = 1.206257e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.18293) = 1.205888e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.18488) = 1.204532e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
C 1603.041519 2 0.0005 851
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205896e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18292) = 1.205897e-160 2000 rounds
| 3/26
27 h-m-p 0.0018 0.0257 11.5896
QuantileBeta(0.15, 0.00500, 2.18998) = 1.200996e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21117) = 1.186528e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18711) = 1.202984e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.18718) = 1.202934e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.18858) = 1.201964e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
C 1602.990850 2 0.0011 883
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202919e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18720) = 1.202920e-160 2000 rounds
| 3/26
28 h-m-p 0.0031 0.0581 4.0375
QuantileBeta(0.15, 0.00500, 2.18846) = 1.202050e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19223) = 1.199446e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18820) = 1.202230e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
C 1602.955051 1 0.0025 913
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202216e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18822) = 1.202217e-160 2000 rounds
| 3/26
29 h-m-p 0.0014 0.1233 7.4301
QuantileBeta(0.15, 0.00500, 2.18771) = 1.202566e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18620) = 1.203616e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.18014) = 1.207833e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.15592) = 1.224997e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17261) = 1.213118e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.17245) = 1.213236e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.16418) = 1.219089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17219) = 1.213419e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.16818) = 1.216247e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
C 1601.529768 3 0.0436 949
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213424e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17218) = 1.213425e-160 2000 rounds
| 3/26
30 h-m-p 0.0018 0.0089 91.6127
QuantileBeta(0.15, 0.00500, 2.16293) = 1.219983e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13517) = 1.240086e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15921) = 1.222640e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.14719) = 1.231302e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15902) = 1.222774e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.15310) = 1.227024e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
C 1600.539544 2 0.0025 982
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15901) = 1.222784e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15900) = 1.222785e-160 2000 rounds
| 3/26
31 h-m-p 0.0045 0.0226 26.1337
QuantileBeta(0.15, 0.00500, 2.14567) = 1.232407e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14821) = 1.230563e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.15361) = 1.226662e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14909) = 1.229925e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.15135) = 1.228291e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
C 1600.195806 2 0.0033 1015
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229888e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14914) = 1.229889e-160 2000 rounds
| 3/26
32 h-m-p 0.0023 0.0117 30.5227
QuantileBeta(0.15, 0.00500, 2.13673) = 1.238943e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13790) = 1.238086e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.14352) = 1.233974e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13863) = 1.237548e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.14107) = 1.235759e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
C 1599.976451 2 0.0020 1048
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237530e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13865) = 1.237531e-160 2000 rounds
| 3/26
33 h-m-p 0.0118 0.0589 3.4535
QuantileBeta(0.15, 0.00500, 2.13365) = 1.241207e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13594) = 1.239520e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.13580) = 1.239623e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.13473) = 1.240415e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13575) = 1.239665e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.13524) = 1.240040e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
C 1599.889990 3 0.0068 1082
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13575) = 1.239666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13574) = 1.239667e-160 2000 rounds
| 3/26
34 h-m-p 0.0028 0.1805 8.4127 ++CYCC 1597.683514 3 0.0536 1118 | 3/26
35 h-m-p 0.6133 3.5151 0.7359 CCYC 1597.154522 3 0.6057 1152 | 3/26
36 h-m-p 0.8740 4.5245 0.5100 CCC 1596.661891 2 0.7765 1208 | 3/26
37 h-m-p 0.8728 6.1240 0.4538 YCCC 1596.152321 3 1.4602 1265 | 3/26
38 h-m-p 0.8653 4.3263 0.3709 +YCYC 1595.504240 3 2.4140 1322 | 3/26
39 h-m-p 0.3783 1.8914 0.4046 YYCYYYC 1595.219707 6 0.8993 1382 | 3/26
40 h-m-p 0.5593 4.2428 0.6506 CCC 1594.974098 2 0.4453 1438 | 3/26
41 h-m-p 1.0260 8.0000 0.2824 YC 1594.564894 1 2.4804 1491 | 3/26
42 h-m-p 1.3935 7.7537 0.5026 CCCC 1594.065298 3 2.3264 1549 | 3/26
43 h-m-p 1.6000 8.0000 0.5321 YCCC 1593.608901 3 2.8312 1606 | 3/26
44 h-m-p 1.6000 8.0000 0.7894 YCCC 1593.062522 3 2.8611 1663 | 2/26
45 h-m-p 0.0004 0.0021 4823.2462 --YC 1593.062119 1 0.0000 1718 | 2/26
46 h-m-p 0.0245 0.2015 0.6631 ++ 1592.996832 m 0.2015 1747 | 2/26
47 h-m-p 0.0000 0.0000 1.4013
h-m-p: 0.00000000e+00 0.00000000e+00 1.40131239e+00 1592.996832
.. | 2/26
48 h-m-p 0.0000 0.0003 118.3829 ++YCCC 1592.291031 3 0.0001 1833 | 2/26
49 h-m-p 0.0000 0.0000 60.8903 ++ 1592.288410 m 0.0000 1862 | 3/26
50 h-m-p 0.0000 0.0000 1119.6595 YCC 1592.268852 2 0.0000 1894 | 3/26
51 h-m-p 0.0002 0.0042 10.1976 +YCC 1592.222038 2 0.0005 1927 | 3/26
52 h-m-p 0.0005 0.0080 10.8310 C 1592.216936 0 0.0001 1956 | 3/26
53 h-m-p 0.0002 0.0173 8.3256 +YC 1592.206415 1 0.0005 1987 | 3/26
54 h-m-p 0.0010 0.0231 4.4701 YC 1592.202601 1 0.0006 2017 | 3/26
55 h-m-p 0.0021 0.0660 1.2457 CC 1592.202110 1 0.0007 2048 | 3/26
56 h-m-p 0.0006 0.0816 1.5461 YC 1592.201512 1 0.0010 2078 | 3/26
57 h-m-p 0.0018 0.1546 0.8615 CC 1592.201360 1 0.0007 2109 | 3/26
58 h-m-p 0.0014 0.4769 0.4334 YC 1592.201310 1 0.0008 2162 | 3/26
59 h-m-p 0.0014 0.6980 0.3557 Y 1592.201282 0 0.0008 2214 | 3/26
60 h-m-p 0.0015 0.7652 0.2922 C 1592.201254 0 0.0014 2266 | 3/26
61 h-m-p 0.0022 1.0938 0.4075 YC 1592.201227 1 0.0012 2319 | 3/26
62 h-m-p 0.0032 1.5774 0.3577 C 1592.201176 0 0.0029 2371 | 3/26
63 h-m-p 0.0019 0.7821 0.5454 YC 1592.201076 1 0.0042 2424 | 3/26
64 h-m-p 0.0015 0.5202 1.4894 YC 1592.200854 1 0.0035 2477 | 3/26
65 h-m-p 0.0010 0.4309 5.1259 YC 1592.200370 1 0.0022 2507 | 3/26
66 h-m-p 0.0059 0.2805 1.9296 C 1592.200275 0 0.0012 2536 | 3/26
67 h-m-p 0.0227 3.0501 0.1013 -C 1592.200271 0 0.0014 2566 | 3/26
68 h-m-p 0.0160 8.0000 0.0207 ----C 1592.200271 0 0.0000 2622 | 3/26
69 h-m-p 0.0160 8.0000 0.0002 --------Y 1592.200271 0 0.0000 2682
Out..
lnL = -1592.200271
2683 lfun, 32196 eigenQcodon, 619773 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1684.448019 S = -1650.682508 -26.995019
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 146 patterns 10:04
did 20 / 146 patterns 10:05
did 30 / 146 patterns 10:05
did 40 / 146 patterns 10:05
did 50 / 146 patterns 10:05
did 60 / 146 patterns 10:05
did 70 / 146 patterns 10:05
did 80 / 146 patterns 10:06
did 90 / 146 patterns 10:06
did 100 / 146 patterns 10:06
did 110 / 146 patterns 10:06
did 120 / 146 patterns 10:06
did 130 / 146 patterns 10:07
did 140 / 146 patterns 10:07
did 146 / 146 patterns 10:07
Time used: 10:07
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=179
D_melanogaster_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
D_sechellia_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
D_simulans_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
D_yakuba_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
D_erecta_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
D_takahashii_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
D_biarmipes_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
D_suzukii_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
D_eugracilis_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
D_ficusphila_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
D_rhopaloa_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
D_elegans_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
**************************************************
D_melanogaster_Arl5-PA NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
D_sechellia_Arl5-PA NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
D_simulans_Arl5-PA NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
D_yakuba_Arl5-PA NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
D_erecta_Arl5-PA NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
D_takahashii_Arl5-PA NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
D_biarmipes_Arl5-PA NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
D_suzukii_Arl5-PA NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
D_eugracilis_Arl5-PA NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
D_ficusphila_Arl5-PA NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
D_rhopaloa_Arl5-PA NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
D_elegans_Arl5-PA NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
**************************************************
D_melanogaster_Arl5-PA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
D_sechellia_Arl5-PA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
D_simulans_Arl5-PA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
D_yakuba_Arl5-PA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
D_erecta_Arl5-PA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
D_takahashii_Arl5-PA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
D_biarmipes_Arl5-PA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
D_suzukii_Arl5-PA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
D_eugracilis_Arl5-PA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
D_ficusphila_Arl5-PA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
D_rhopaloa_Arl5-PA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
D_elegans_Arl5-PA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
**************************************************
D_melanogaster_Arl5-PA QWHIQACCALTGEGLYQGLEWIVQRIKNK
D_sechellia_Arl5-PA QWHIQACCALTGEGLYQGLEWIVQRIKNK
D_simulans_Arl5-PA QWHIQACCALTGEGLYQGLEWIVQRIKNK
D_yakuba_Arl5-PA QWHIQACCALTGEGLYQGLEWIVQRIKNK
D_erecta_Arl5-PA QWHIQACCALTGEGLYQGLEWIVQRIKNK
D_takahashii_Arl5-PA QWHIQACCALTGEGLYQGLEWIVQRIKNK
D_biarmipes_Arl5-PA QWHIQACCALTGEGLYQGLEWIVQRIKNK
D_suzukii_Arl5-PA QWHIQACCALTGEGLYQGLEWIVQRIKNK
D_eugracilis_Arl5-PA QWHIQACCALTGEGLYQGLEWIVQRIKNK
D_ficusphila_Arl5-PA QWHIQACCALTGEGLYQGLEWIVQRIKNK
D_rhopaloa_Arl5-PA QWHIQACCALTGEGLYQGLEWIVQRIKNK
D_elegans_Arl5-PA QWHIQACCALTGEGLYQGLEWIVQRIKNK
*****************************
>D_melanogaster_Arl5-PA ATGGGACTGTTATTATCGCGGCTCTGGCGGATGTTTGGCAACGAGGAGCA CAAGCTGGTGATGGTGGGTCTGGACAACGCGGGCAAAACCACCATCCTGT ACCAGTTCCTGATGAACGAAGTGGTCCACACAAGTCCCACGATCGGTTCC AACGTGGAGGAGGTCGTCTGGCGGAATATACACTTTCTTGTCTGGGATCT TGGTGGTCAGCAGAGTCTGCGCGCCGCTTGGAGCACCTACTACACGAACA CAGAGCTGGTGATCATGGTCATCGACTCCACGGACCGGGAACGGTTAGCT GTTACGCGGGAAGAGCTCTACCGGATGCTGCAACATGAGGATCTGAGCAA GGCCAGTTTGCTGGTCTATGCCAATAAGCAGGATCTCAAGGGCTCTATGT CGGCGGCGGAAATCTCACGACAACTGGACCTCACCTCCATCAAGAAGCAC CAATGGCACATCCAGGCCTGCTGTGCGCTCACCGGCGAAGGACTCTATCA AGGATTAGAGTGGATCGTGCAGCGCATCAAGAACAAA >D_sechellia_Arl5-PA ATGGGACTGTTATTATCGCGGCTCTGGCGGATGTTTGGCAACGAGGAACA CAAGCTGGTGATGGTGGGTCTGGACAACGCGGGCAAAACCACCATCCTGT ACCAGTTCCTGATGAATGAAGTGGTCCACACAAGTCCCACGATCGGTTCC AACGTGGAAGAGGTCGTCTGGCGGAATATACACTTCCTTGTCTGGGATCT TGGTGGTCAGCAGAGTCTGCGCGCCGCTTGGAGCACCTACTACACGAACA CAGAGCTGGTGATCATGGTCATCGACTCCACGGACCGGGAACGGTTAGCT GTTACGCGGGAAGAGCTCTACCGGATGCTGCAGCATGAGGATCTGAGCAA GGCCAGTTTGCTGGTCTATGCCAATAAGCAGGATCTCAAGGGCTCCATGT CGGCGGCGGAAATCTCACGACAACTGGACCTCACCTCCATCAAGAAGCAC CAGTGGCACATCCAGGCCTGCTGTGCGCTCACCGGCGAAGGACTCTATCA AGGATTAGAGTGGATCGTGCAGCGCATCAAGAACAAA >D_simulans_Arl5-PA ATGGGACTGTTATTATCGCGGCTCTGGCGGATGTTTGGCAACGAGGAGCA CAAGCTGGTGATGGTGGGTCTGGACAACGCGGGCAAAACCACCATCCTGT ACCAGTTCCTGATGAACGAAGTGGTCCACACAAGTCCCACGATCGGTTCC AACGTGGAAGAGGTCGTCTGGCGGAATATACACTTCCTTGTCTGGGATCT TGGTGGTCAGCAGAGTCTGCGCGCCGCTTGGAGCACCTACTACACGAACA CAGAGCTGGTGATCATGGTCATCGACTCCACGGACCGGGAACGGTTAGCT GTTACGCGGGAAGAGCTCTACCGGATGCTGCAGCATGAGGATCTGAGCAA GGCCAGTTTGCTGGTCTATGCCAATAAGCAGGATCTCAAGGGCTCCATGT CGGCGGCGGAAATCTCACGACAACTGGACCTCACCTCCATCAAGAAGCAC CAGTGGCACATCCAGGCCTGCTGTGCGCTCACCGGCGAAGGACTCTATCA AGGATTAGAGTGGATCGTGCAGCGCATCAAGAACAAA >D_yakuba_Arl5-PA ATGGGACTGTTATTATCGCGGCTTTGGCGGATGTTTGGCAACGAGGAGCA CAAGCTGGTGATGGTGGGTTTGGACAACGCAGGCAAAACGACCATCCTGT ACCAATTCCTGATGAACGAAGTGGTCCACACAAGTCCCACGATCGGTTCC AATGTAGAGGAGGTCGTCTGGCGGAATATACACTTTCTTGTCTGGGATCT TGGTGGTCAGCAGAGTCTCCGCGCCGCTTGGAGCACCTACTACACGAACA CAGAGCTGGTGATCATGGTCATCGACTCCACGGATCGGGAACGGTTAGCT GTGACGCGGGAAGAGCTCTACCGGATGCTGCAGCATGAGGATCTGAGCAA GGCGAGTCTGCTGGTCTATGCCAATAAACAAGACCTCAAGGGCTCCATGT CGGCAGCGGAAATCTCAAGACAACTGGACCTCACCTCCATCAAGAAGCAC CAATGGCACATTCAGGCCTGCTGTGCGCTCACCGGCGAAGGACTCTATCA AGGATTAGAGTGGATCGTCCAGCGCATCAAGAACAAA >D_erecta_Arl5-PA ATGGGACTGTTATTATCGCGGCTTTGGCGGATGTTTGGCAACGAGGAGCA CAAGCTGGTCATGGTGGGCTTGGACAACGCGGGCAAAACGACCATCCTGT ACCAATTCCTTATGAACGAAGTGGTCCACACAAGTCCCACGATCGGTTCC AATGTGGAGGAGGTCGTCTGGCGGAATATACACTTTCTTGTCTGGGATCT TGGTGGTCAGCAGAGCCTCCGCGCGGCTTGGAGCACCTACTATACGAACA CAGAGCTGGTGATCATGGTCATCGACTCCACGGACCGGGAACGGTTAGCT GTTACGCGGGAAGAGCTCTACAGGATGCTGCAGCATGAGGATCTGAGCAA GGCGAGTTTGCTGGTCTATGCCAATAAACAGGACCTCAAGGGCTCCATGT CGGCGGCGGAAATCTCAAGACAACTGGACCTCACCTCCATCAAGAAGCAC CAATGGCACATTCAGGCCTGCTGTGCGCTTACCGGCGAAGGACTCTATCA AGGATTAGAGTGGATCGTGCAGCGCATCAAGAACAAA >D_takahashii_Arl5-PA ATGGGACTACTATTATCGCGGCTGTGGCGGATGTTTGGCAACGAGGAGCA CAAGCTGGTGATGGTGGGCCTGGACAACGCGGGCAAGACGACCATCCTGT ACCAGTTCCTGATGAACGAGGTCGTCCACACGAGTCCCACGATCGGTTCG AATGTGGAGGAGGTCGTCTGGCGGAACATTCACTTCCTGGTCTGGGATTT GGGCGGTCAGCAGAGCCTGCGCGCCGCCTGGAGCACCTACTACACGAACA CAGAGCTGGTCATCATGGTCATAGACTCGACGGATCGGGAAAGGTTGGCT GTGACGCGGGAGGAGCTCTACCGGATGCTGCAGCACGAGGATCTCAGCAA GGCTAGCCTGCTGGTCTATGCCAACAAGCAGGACCTCAAGGGCTCCATGT CGGCGGCGGAGATATCGCGGCAACTGGACCTCACCTCCATCAAGAAGCAC CAGTGGCACATCCAGGCCTGCTGCGCGCTCACCGGCGAGGGACTCTACCA AGGACTCGAGTGGATTGTCCAGCGCATCAAGAACAAA >D_biarmipes_Arl5-PA ATGGGCCTGCTACTATCGCGGCTGTGGCGGATGTTCGGCAACGAGGAGCA CAAGCTGGTGATGGTGGGCCTGGACAACGCGGGCAAGACGACCATCCTGT ACCAGTTCCTGATGAACGAGGTCGTCCACACGAGTCCCACGATCGGCTCC AACGTGGAGGAGGTCGTCTGGCGGAACATTCACTTTCTGGTGTGGGACCT GGGCGGCCAGCAGAGCCTGCGCGCCGCCTGGAGCACCTACTACACGAACA CAGAGCTGGTGATCATGGTCATCGACTCCACGGATCGGGAAAGGCTGGCT GTCACGCGGGAGGAGCTCTACCGGATGCTGCAGCACGAGGATCTGAGCAA GGCCAGCCTGCTGGTCTATGCCAACAAGCAGGACCTGAAGGGCTCCATGT CGGCGGCGGAGATCTCGCGGCAACTGGACCTCACCTCCATCAAGAAGCAC CAGTGGCACATCCAGGCCTGCTGTGCGCTCACCGGCGAGGGCCTCTACCA GGGACTGGAGTGGATCGTACAGCGCATCAAGAACAAA >D_suzukii_Arl5-PA ATGGGACTGTTATTATCGCGGCTGTGGCGGATGTTTGGCAACGAGGAGCA CAAGCTGGTGATGGTGGGCCTGGACAACGCGGGCAAGACGACCATCCTGT ACCAGTTCCTGATGAACGAGGTCGTCCACACGAGTCCCACGATCGGTTCC AATGTGGAGGAGGTCGTCTGGCGGAATATCCACTTTCTGGTCTGGGACTT GGGCGGCCAGCAGAGCCTCCGCGCCGCCTGGAGCACCTACTACACGAACA CAGAGCTGGTGATCATGGTCATCGACTCCACGGACCGGGAAAGGCTGGCT GTCACGCGGGAGGAGCTCTACCGGATGCTGCAGCACGAGGATCTGAGCAA GGCCAGCCTGCTGGTGTATGCCAACAAGCAGGACCTCAAGGGCTCCATGT CGGCGGCGGAGATATCGCGGCAACTGGACCTCACCTCCATCAAGAAGCAT CAGTGGCACATCCAGGCCTGCTGTGCGCTCACCGGCGAAGGACTCTATCA GGGATTGGAGTGGATCGTGCAGCGCATCAAGAACAAA >D_eugracilis_Arl5-PA ATGGGATTGTTATTATCGCGGCTGTGGCGGATGTTTGGAAATGAGGAGCA TAAGCTGGTGATGGTGGGTCTGGACAATGCTGGAAAAACGACCATCCTGT ATCAGTTCCTGATGAATGAGGTGGTCCATACCAGTCCTACGATCGGTTCC AATGTGGAGGAGGTCGTTTGGCGAAATATACACTTTCTCGTTTGGGATCT CGGAGGCCAGCAGAGCCTGCGAGCTGCCTGGAGCACCTATTACACGAACA CAGAGCTGGTGATCATGGTCATCGACTCGACGGATCGGGAAAGGTTAGCT GTGACACGAGAAGAGCTCTACCGAATGCTACAGCACGAGGATCTGAGCAA GGCTAGCCTTCTGGTCTATGCCAACAAACAGGATCTTAAAGGTTCCATGT CGGCAGCAGAGATTTCAAGACAACTAGACCTCACATCCATCAAGAAGCAC CAGTGGCACATCCAAGCCTGCTGTGCGCTCACAGGCGAAGGACTCTACCA AGGATTGGAGTGGATCGTGCAGCGCATCAAGAACAAA >D_ficusphila_Arl5-PA ATGGGACTGCTATTATCGCGGCTCTGGCGGATGTTTGGGAACGAGGAGCA CAAGCTGGTGATGGTGGGATTGGACAACGCGGGCAAGACAACCATCCTGT ACCAGTTTTTAATGAACGAAGTGGTCCACACCAGTCCCACGATCGGCTCC AATGTTGAGGAGGTCGTCTGGCGAAATATTCACTTCCTCGTTTGGGATCT TGGAGGTCAGCAAAGCCTTCGTGCCGCTTGGAGCACTTACTACACGAACA CGGAGCTGGTGATCATGGTCATCGACTCGACGGATCGGGAAAGACTGGCT GTCACTCGGGAAGAGCTCTACCGGATGCTGCAGCACGAGGATCTGAGCAA GGCCAGTCTGCTAGTCTACGCCAACAAGCAGGACCTCAAGGGCTCAATGT CGGCGGCGGAAATATCCCGACAACTTGACCTCACCTCCATTAAGAAGCAC CAGTGGCACATCCAGGCCTGCTGTGCGCTTACCGGCGAAGGCCTGTATCA AGGACTGGAGTGGATCGTGCAGCGCATCAAGAACAAA >D_rhopaloa_Arl5-PA ATGGGACTGTTATTATCGCGGCTGTGGCGGATGTTTGGCAACGAGGAGCA CAAGTTGGTGATGGTGGGCCTGGACAACGCGGGCAAAACGACCATCCTTT ACCAGTTCCTCATGAACGAGGTGGTTCATACCAGTCCAACGATCGGTTCC AATGTGGAGGAGGTCGTTTGGCGGAATATCCACTTCCTGGTCTGGGATCT GGGCGGTCAGCAGAGCCTCCGAGCCGCCTGGAGCACTTACTACACGAACA CAGAGCTAGTGATCATGGTCATCGACTCCACGGATCGGGAAAGGCTGGCC GTTACGCGGGAGGAGCTATATCGGATGCTGCAGCACGAGGATCTGAGCAA GGCCAGTTTGCTGGTCTACGCCAACAAGCAGGACCTCAAGGGATCAATGT CGGCGGCGGAGATATCGCGGCAACTGGACCTTACCTCCATAAAAAAGCAC CAGTGGCACATCCAGGCCTGCTGCGCGCTAACCGGCGAAGGACTCTACCA AGGATTGGAGTGGATCGTGCAGCGCATCAAGAATAAA >D_elegans_Arl5-PA ATGGGACTGTTATTATCGCGACTGTGGCGGATGTTTGGCAACGAGGAGCA CAAGTTGGTGATGGTCGGTCTGGACAATGCGGGTAAAACGACTATCCTGT ACCAGTTCCTCATGAACGAGGTGGTCCACACCAGTCCCACGATCGGTTCC AATGTGGAGGAGGTCGTTTGGCGGAATATCCACTTCCTGGTCTGGGATCT GGGCGGTCAGCAGAGCCTCCGAGCCGCCTGGAGCACCTACTACACGAACA CAGAGCTGGTGATCATGGTCATCGACTCCACGGATCGGGAAAGGCTGGCC GTAACGCGGGAAGAGCTGTACCGAATGCTGCAGCACGAGGATCTGAGCAA GGCCAGCCTGCTGGTCTACGCCAACAAGCAGGACCTCAAGGGTTCCATGT CAGCGGCGGAAATATCGCGGCAACTGGACCTGACCTCTATCAAAAAGCAC CAGTGGCACATTCAGGCCTGCTGCGCGCTCACTGGCGAAGGACTCTACCA AGGACTGGAGTGGATAGTGCAGCGCATCAAGAACAAA
>D_melanogaster_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH QWHIQACCALTGEGLYQGLEWIVQRIKNK >D_sechellia_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH QWHIQACCALTGEGLYQGLEWIVQRIKNK >D_simulans_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH QWHIQACCALTGEGLYQGLEWIVQRIKNK >D_yakuba_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH QWHIQACCALTGEGLYQGLEWIVQRIKNK >D_erecta_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH QWHIQACCALTGEGLYQGLEWIVQRIKNK >D_takahashii_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH QWHIQACCALTGEGLYQGLEWIVQRIKNK >D_biarmipes_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH QWHIQACCALTGEGLYQGLEWIVQRIKNK >D_suzukii_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH QWHIQACCALTGEGLYQGLEWIVQRIKNK >D_eugracilis_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH QWHIQACCALTGEGLYQGLEWIVQRIKNK >D_ficusphila_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH QWHIQACCALTGEGLYQGLEWIVQRIKNK >D_rhopaloa_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH QWHIQACCALTGEGLYQGLEWIVQRIKNK >D_elegans_Arl5-PA MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH QWHIQACCALTGEGLYQGLEWIVQRIKNK
#NEXUS
[ID: 1537613268]
begin taxa;
dimensions ntax=12;
taxlabels
D_melanogaster_Arl5-PA
D_sechellia_Arl5-PA
D_simulans_Arl5-PA
D_yakuba_Arl5-PA
D_erecta_Arl5-PA
D_takahashii_Arl5-PA
D_biarmipes_Arl5-PA
D_suzukii_Arl5-PA
D_eugracilis_Arl5-PA
D_ficusphila_Arl5-PA
D_rhopaloa_Arl5-PA
D_elegans_Arl5-PA
;
end;
begin trees;
translate
1 D_melanogaster_Arl5-PA,
2 D_sechellia_Arl5-PA,
3 D_simulans_Arl5-PA,
4 D_yakuba_Arl5-PA,
5 D_erecta_Arl5-PA,
6 D_takahashii_Arl5-PA,
7 D_biarmipes_Arl5-PA,
8 D_suzukii_Arl5-PA,
9 D_eugracilis_Arl5-PA,
10 D_ficusphila_Arl5-PA,
11 D_rhopaloa_Arl5-PA,
12 D_elegans_Arl5-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.01052507,(2:0.009528963,3:0.002454186)0.988:0.01244282,((4:0.03340031,5:0.03569466)0.991:0.03151665,(((((6:0.08532709,7:0.06666424)0.786:0.02755102,8:0.02421231)0.985:0.03506643,(11:0.08823415,12:0.09616203)0.999:0.06064503)0.977:0.0498999,10:0.2127593)0.511:0.03578762,9:0.3033599)0.965:0.06548975)0.955:0.0237821);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.01052507,(2:0.009528963,3:0.002454186):0.01244282,((4:0.03340031,5:0.03569466):0.03151665,(((((6:0.08532709,7:0.06666424):0.02755102,8:0.02421231):0.03506643,(11:0.08823415,12:0.09616203):0.06064503):0.0498999,10:0.2127593):0.03578762,9:0.3033599):0.06548975):0.0237821);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1790.96 -1809.44
2 -1790.54 -1807.98
--------------------------------------
TOTAL -1790.73 -1808.95
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/14/Arl5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.360324 0.022172 1.097790 1.672114 1.353018 1202.77 1276.11 1.000
r(A<->C){all} 0.099697 0.000529 0.057888 0.145736 0.097994 801.80 909.01 1.000
r(A<->G){all} 0.220806 0.001570 0.147453 0.300013 0.217351 743.81 774.80 1.001
r(A<->T){all} 0.017110 0.000296 0.000013 0.051406 0.011960 522.26 757.58 1.000
r(C<->G){all} 0.055933 0.000190 0.030834 0.084527 0.054713 1046.00 1050.16 1.000
r(C<->T){all} 0.572883 0.002536 0.472851 0.666363 0.573493 650.77 746.29 1.001
r(G<->T){all} 0.033571 0.000206 0.007509 0.061226 0.032221 995.13 1033.17 1.000
pi(A){all} 0.232541 0.000313 0.199698 0.268381 0.232665 933.09 993.88 1.000
pi(C){all} 0.286523 0.000303 0.250996 0.318808 0.286229 1212.98 1296.45 1.000
pi(G){all} 0.299230 0.000334 0.264494 0.336610 0.298622 1122.53 1160.52 1.000
pi(T){all} 0.181706 0.000218 0.153801 0.210788 0.181481 970.80 1099.16 1.000
alpha{1,2} 0.072469 0.000241 0.045571 0.104129 0.073167 958.46 1019.05 1.001
alpha{3} 3.430087 0.932108 1.761111 5.327696 3.287892 1203.73 1302.82 1.000
pinvar{all} 0.303055 0.002824 0.195675 0.400741 0.303969 1166.90 1331.58 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/14/Arl5-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 12 ls = 179
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 1 1 2 2 1 | Ser TCT 1 0 0 0 0 0 | Tyr TAT 2 2 2 2 3 1 | Cys TGT 1 1 1 1 1 0
TTC 1 2 2 1 1 2 | TCC 3 4 4 4 4 2 | TAC 4 4 4 4 3 5 | TGC 1 1 1 1 1 2
Leu TTA 4 4 4 4 4 1 | TCA 1 1 1 1 1 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 2 2 | TCG 2 2 2 2 2 5 | TAG 0 0 0 0 0 0 | Trp TGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 3 5 0 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 0 | Arg CGT 0 0 0 0 0 0
CTC 6 6 6 6 5 7 | CCC 1 1 1 1 1 1 | CAC 5 5 5 5 5 6 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 2 | CCA 0 0 0 0 0 0 | Gln CAA 4 2 2 5 4 2 | CGA 1 1 1 0 0 0
CTG 11 11 11 10 8 12 | CCG 0 0 0 0 0 0 | CAG 6 8 8 5 6 8 | CGG 7 7 7 7 6 7
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 1 1 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 2 3 2 3 3 1 | Ser AGT 3 3 3 3 2 1
ATC 9 9 9 8 8 6 | ACC 5 5 5 4 4 4 | AAC 6 5 6 5 5 7 | AGC 2 2 2 2 3 4
ATA 1 1 1 1 1 2 | ACA 2 2 2 2 2 1 | Lys AAA 2 2 2 3 3 1 | Arg AGA 0 0 0 1 1 0
Met ATG 7 7 7 7 7 7 | ACG 4 4 4 5 5 6 | AAG 7 7 7 6 6 8 | AGG 0 0 0 0 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 0 1 0 | Ala GCT 2 2 2 2 2 2 | Asp GAT 3 3 3 3 2 3 | Gly GGT 4 4 4 4 3 2
GTC 6 6 6 7 7 9 | GCC 4 4 4 3 2 4 | GAC 4 4 4 4 5 4 | GGC 4 4 4 4 5 6
GTA 0 0 0 1 0 0 | GCA 0 0 0 2 0 0 | Glu GAA 5 7 6 5 5 1 | GGA 3 3 3 3 3 3
GTG 6 6 6 5 5 4 | GCG 4 4 4 3 6 4 | GAG 8 6 7 8 8 12 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 2 2 2 1 1 | Ser TCT 0 0 0 0 0 1 | Tyr TAT 1 2 3 1 1 0 | Cys TGT 1 1 1 1 0 0
TTC 2 1 1 1 2 2 | TCC 4 4 3 3 3 3 | TAC 5 4 3 5 5 6 | TGC 1 1 1 1 2 2
Leu TTA 0 2 3 2 2 2 | TCA 0 0 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 2 2 1 3 1 | TCG 3 3 3 3 3 2 | TAG 0 0 0 0 0 0 | Trp TGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 2 4 2 0 | Pro CCT 0 0 1 0 0 0 | His CAT 0 1 2 0 1 0 | Arg CGT 0 0 0 1 0 0
CTC 4 6 6 5 4 5 | CCC 1 1 0 1 0 1 | CAC 6 5 4 6 5 6 | CGC 2 2 1 1 1 1
CTA 2 0 2 2 3 0 | CCA 0 0 0 0 1 0 | Gln CAA 1 1 3 3 2 2 | CGA 0 0 4 2 1 3
CTG 18 14 9 10 10 16 | CCG 0 0 0 0 0 0 | CAG 9 9 7 7 8 8 | CGG 7 7 3 5 7 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 0 1 2 0 1 | Thr ACT 0 0 0 2 1 2 | Asn AAT 0 2 5 2 3 3 | Ser AGT 1 1 1 2 2 1
ATC 9 9 8 7 8 7 | ACC 4 4 3 4 4 3 | AAC 8 6 3 6 5 5 | AGC 4 4 4 3 3 4
ATA 0 1 1 1 2 2 | ACA 1 1 4 1 1 1 | Lys AAA 1 1 4 1 3 3 | Arg AGA 0 0 1 1 0 0
Met ATG 7 7 7 7 7 7 | ACG 6 6 4 4 5 5 | AAG 8 8 5 8 6 6 | AGG 1 1 1 0 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 2 2 3 1 | Ala GCT 1 1 4 2 0 0 | Asp GAT 2 1 4 3 3 3 | Gly GGT 0 1 3 1 2 5
GTC 7 7 4 6 4 6 | GCC 5 5 3 4 6 6 | GAC 5 6 3 4 4 4 | GGC 10 7 2 5 5 3
GTA 1 0 0 0 0 1 | GCA 0 0 2 0 0 0 | Glu GAA 1 2 3 5 2 4 | GGA 1 3 6 4 4 3
GTG 5 6 7 5 6 5 | GCG 4 4 1 4 4 4 | GAG 12 11 10 8 11 9 | GGG 0 0 0 1 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Arl5-PA
position 1: T:0.16201 C:0.25698 A:0.27933 G:0.30168
position 2: T:0.31844 C:0.16201 A:0.32961 G:0.18994
position 3: T:0.13408 C:0.35196 A:0.12849 G:0.38547
Average T:0.20484 C:0.25698 A:0.24581 G:0.29236
#2: D_sechellia_Arl5-PA
position 1: T:0.16201 C:0.25698 A:0.27933 G:0.30168
position 2: T:0.31844 C:0.16201 A:0.32961 G:0.18994
position 3: T:0.12849 C:0.35754 A:0.12849 G:0.38547
Average T:0.20298 C:0.25885 A:0.24581 G:0.29236
#3: D_simulans_Arl5-PA
position 1: T:0.16201 C:0.25698 A:0.27933 G:0.30168
position 2: T:0.31844 C:0.16201 A:0.32961 G:0.18994
position 3: T:0.12291 C:0.36313 A:0.12291 G:0.39106
Average T:0.20112 C:0.26071 A:0.24395 G:0.29423
#4: D_yakuba_Arl5-PA
position 1: T:0.16201 C:0.25140 A:0.28492 G:0.30168
position 2: T:0.31844 C:0.16201 A:0.32961 G:0.18994
position 3: T:0.13966 C:0.34078 A:0.15642 G:0.36313
Average T:0.20670 C:0.25140 A:0.25698 G:0.28492
#5: D_erecta_Arl5-PA
position 1: T:0.16760 C:0.24022 A:0.29050 G:0.30168
position 2: T:0.31844 C:0.16201 A:0.32961 G:0.18994
position 3: T:0.14525 C:0.34078 A:0.13408 G:0.37989
Average T:0.21043 C:0.24767 A:0.25140 G:0.29050
#6: D_takahashii_Arl5-PA
position 1: T:0.15084 C:0.26257 A:0.28492 G:0.30168
position 2: T:0.31844 C:0.16201 A:0.32961 G:0.18994
position 3: T:0.07263 C:0.39665 A:0.07263 G:0.45810
Average T:0.18063 C:0.27374 A:0.22905 G:0.31657
#7: D_biarmipes_Arl5-PA
position 1: T:0.13408 C:0.27933 A:0.28492 G:0.30168
position 2: T:0.31844 C:0.16201 A:0.32961 G:0.18994
position 3: T:0.04469 C:0.43017 A:0.04469 G:0.48045
Average T:0.16574 C:0.29050 A:0.21974 G:0.32402
#8: D_suzukii_Arl5-PA
position 1: T:0.15642 C:0.25698 A:0.28492 G:0.30168
position 2: T:0.31844 C:0.16201 A:0.32961 G:0.18994
position 3: T:0.06704 C:0.40223 A:0.06145 G:0.46927
Average T:0.18063 C:0.27374 A:0.22533 G:0.32030
#9: D_eugracilis_Arl5-PA
position 1: T:0.16201 C:0.24581 A:0.29050 G:0.30168
position 2: T:0.31844 C:0.16201 A:0.32961 G:0.18994
position 3: T:0.17318 C:0.27374 A:0.18994 G:0.36313
Average T:0.21788 C:0.22719 A:0.27002 G:0.28492
#10: D_ficusphila_Arl5-PA
position 1: T:0.15084 C:0.26257 A:0.28492 G:0.30168
position 2: T:0.31844 C:0.16201 A:0.32961 G:0.18994
position 3: T:0.13966 C:0.34637 A:0.12849 G:0.38547
Average T:0.20298 C:0.25698 A:0.24767 G:0.29236
#11: D_rhopaloa_Arl5-PA
position 1: T:0.16201 C:0.25140 A:0.28492 G:0.30168
position 2: T:0.31844 C:0.16201 A:0.32961 G:0.18994
position 3: T:0.10615 C:0.34078 A:0.12291 G:0.43017
Average T:0.19553 C:0.25140 A:0.24581 G:0.30726
#12: D_elegans_Arl5-PA
position 1: T:0.15084 C:0.26257 A:0.28492 G:0.30168
position 2: T:0.31844 C:0.16201 A:0.32961 G:0.18994
position 3: T:0.10056 C:0.35754 A:0.12291 G:0.41899
Average T:0.18994 C:0.26071 A:0.24581 G:0.30354
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 2 | Tyr Y TAT 20 | Cys C TGT 9
TTC 18 | TCC 41 | TAC 52 | TGC 15
Leu L TTA 32 | TCA 9 | *** * TAA 0 | *** * TGA 0
TTG 17 | TCG 32 | TAG 0 | Trp W TGG 72
------------------------------------------------------------------------------
Leu L CTT 22 | Pro P CCT 1 | His H CAT 9 | Arg R CGT 1
CTC 66 | CCC 10 | CAC 63 | CGC 20
CTA 11 | CCA 1 | Gln Q CAA 31 | CGA 13
CTG 140 | CCG 0 | CAG 89 | CGG 75
------------------------------------------------------------------------------
Ile I ATT 9 | Thr T ACT 5 | Asn N AAT 29 | Ser S AGT 23
ATC 97 | ACC 49 | AAC 67 | AGC 37
ATA 14 | ACA 20 | Lys K AAA 26 | Arg R AGA 4
Met M ATG 84 | ACG 58 | AAG 82 | AGG 7
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 20 | Asp D GAT 33 | Gly G GGT 33
GTC 75 | GCC 50 | GAC 51 | GGC 59
GTA 3 | GCA 4 | Glu E GAA 46 | GGA 39
GTG 66 | GCG 46 | GAG 110 | GGG 1
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15689 C:0.25698 A:0.28445 G:0.30168
position 2: T:0.31844 C:0.16201 A:0.32961 G:0.18994
position 3: T:0.11453 C:0.35847 A:0.11778 G:0.40922
Average T:0.19662 C:0.25916 A:0.24395 G:0.30028
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Arl5-PA
D_sechellia_Arl5-PA -1.0000 (0.0000 0.0571)
D_simulans_Arl5-PA -1.0000 (0.0000 0.0404)-1.0000 (0.0000 0.0159)
D_yakuba_Arl5-PA -1.0000 (0.0000 0.1872)-1.0000 (0.0000 0.2183)-1.0000 (0.0000 0.1974)
D_erecta_Arl5-PA -1.0000 (0.0000 0.1887)-1.0000 (0.0000 0.2199)-1.0000 (0.0000 0.1989)-1.0000 (0.0000 0.1399)
D_takahashii_Arl5-PA 0.0097 (0.0049 0.5068) 0.0100 (0.0049 0.4915) 0.0106 (0.0049 0.4619) 0.0093 (0.0049 0.5255) 0.0082 (0.0049 0.5977)
D_biarmipes_Arl5-PA -1.0000 (0.0000 0.4999)-1.0000 (0.0000 0.5152)-1.0000 (0.0000 0.4849)-1.0000 (0.0000 0.6003)-1.0000 (0.0000 0.6424)-1.0000 (0.0000 0.2451)
D_suzukii_Arl5-PA 0.0064 (0.0024 0.3802) 0.0062 (0.0024 0.3934) 0.0067 (0.0024 0.3673) 0.0054 (0.0024 0.4509) 0.0055 (0.0024 0.4406) 0.0103 (0.0024 0.2375)-1.0000 (0.0000 0.1836)
D_eugracilis_Arl5-PA 0.0034 (0.0024 0.7243) 0.0035 (0.0024 0.7039) 0.0035 (0.0024 0.7039)-1.0000 (0.0000 0.7088) 0.0029 (0.0024 0.8280) 0.0064 (0.0049 0.7635)-1.0000 (0.0000 0.8172) 0.0035 (0.0024 0.7026)
D_ficusphila_Arl5-PA -1.0000 (0.0000 0.5721)-1.0000 (0.0000 0.5721)-1.0000 (0.0000 0.5391)-1.0000 (0.0000 0.6468) 0.0038 (0.0024 0.6349) 0.0039 (0.0024 0.6219)-1.0000 (0.0000 0.5784) 0.0044 (0.0024 0.5545)-1.0000 (0.0000 1.0227)
D_rhopaloa_Arl5-PA -1.0000 (0.0000 0.5891)-1.0000 (0.0000 0.5891)-1.0000 (0.0000 0.5554)-1.0000 (0.0000 0.7254)-1.0000 (0.0000 0.6536) 0.0053 (0.0024 0.4611)-1.0000 (0.0000 0.5142)-1.0000 (0.0000 0.3667) 0.0028 (0.0024 0.8828) 0.0038 (0.0024 0.6412)
D_elegans_Arl5-PA -1.0000 (0.0000 0.6183)-1.0000 (0.0000 0.6008)-1.0000 (0.0000 0.5668)-1.0000 (0.0000 0.6405)-1.0000 (0.0000 0.6854)-1.0000 (0.0000 0.4572)-1.0000 (0.0000 0.5097)-1.0000 (0.0000 0.3895)-1.0000 (0.0000 0.7568) 0.0035 (0.0025 0.6915)-1.0000 (0.0000 0.3029)
Model 0: one-ratio
TREE # 1: (1, (2, 3), ((4, 5), (((((6, 7), 8), (11, 12)), 10), 9))); MP score: 231
lnL(ntime: 21 np: 23): -1592.281347 +0.000000
13..1 13..14 14..2 14..3 13..15 15..16 16..4 16..5 15..17 17..18 18..19 19..20 20..21 21..6 21..7 20..8 19..22 22..11 22..12 18..10 17..9
0.011548 0.016834 0.011102 0.000004 0.033182 0.039647 0.041044 0.052291 0.068394 0.034474 0.069437 0.060593 0.040164 0.117339 0.096008 0.038131 0.092532 0.114933 0.118549 0.285230 0.375090 3.131781 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.71653
(1: 0.011548, (2: 0.011102, 3: 0.000004): 0.016834, ((4: 0.041044, 5: 0.052291): 0.039647, (((((6: 0.117339, 7: 0.096008): 0.040164, 8: 0.038131): 0.060593, (11: 0.114933, 12: 0.118549): 0.092532): 0.069437, 10: 0.285230): 0.034474, 9: 0.375090): 0.068394): 0.033182);
(D_melanogaster_Arl5-PA: 0.011548, (D_sechellia_Arl5-PA: 0.011102, D_simulans_Arl5-PA: 0.000004): 0.016834, ((D_yakuba_Arl5-PA: 0.041044, D_erecta_Arl5-PA: 0.052291): 0.039647, (((((D_takahashii_Arl5-PA: 0.117339, D_biarmipes_Arl5-PA: 0.096008): 0.040164, D_suzukii_Arl5-PA: 0.038131): 0.060593, (D_rhopaloa_Arl5-PA: 0.114933, D_elegans_Arl5-PA: 0.118549): 0.092532): 0.069437, D_ficusphila_Arl5-PA: 0.285230): 0.034474, D_eugracilis_Arl5-PA: 0.375090): 0.068394): 0.033182);
Detailed output identifying parameters
kappa (ts/tv) = 3.13178
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.012 425.9 111.1 0.0001 0.0000 0.0186 0.0 2.1
13..14 0.017 425.9 111.1 0.0001 0.0000 0.0271 0.0 3.0
14..2 0.011 425.9 111.1 0.0001 0.0000 0.0179 0.0 2.0
14..3 0.000 425.9 111.1 0.0001 0.0000 0.0000 0.0 0.0
13..15 0.033 425.9 111.1 0.0001 0.0000 0.0534 0.0 5.9
15..16 0.040 425.9 111.1 0.0001 0.0000 0.0639 0.0 7.1
16..4 0.041 425.9 111.1 0.0001 0.0000 0.0661 0.0 7.3
16..5 0.052 425.9 111.1 0.0001 0.0000 0.0842 0.0 9.4
15..17 0.068 425.9 111.1 0.0001 0.0000 0.1102 0.0 12.2
17..18 0.034 425.9 111.1 0.0001 0.0000 0.0555 0.0 6.2
18..19 0.069 425.9 111.1 0.0001 0.0000 0.1118 0.0 12.4
19..20 0.061 425.9 111.1 0.0001 0.0000 0.0976 0.0 10.8
20..21 0.040 425.9 111.1 0.0001 0.0000 0.0647 0.0 7.2
21..6 0.117 425.9 111.1 0.0001 0.0000 0.1890 0.0 21.0
21..7 0.096 425.9 111.1 0.0001 0.0000 0.1546 0.0 17.2
20..8 0.038 425.9 111.1 0.0001 0.0000 0.0614 0.0 6.8
19..22 0.093 425.9 111.1 0.0001 0.0000 0.1491 0.0 16.6
22..11 0.115 425.9 111.1 0.0001 0.0000 0.1851 0.0 20.6
22..12 0.119 425.9 111.1 0.0001 0.0000 0.1910 0.0 21.2
18..10 0.285 425.9 111.1 0.0001 0.0000 0.4594 0.0 51.0
17..9 0.375 425.9 111.1 0.0001 0.0001 0.6042 0.0 67.1
tree length for dN: 0.0003
tree length for dS: 2.7650
Time used: 0:17
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), ((4, 5), (((((6, 7), 8), (11, 12)), 10), 9))); MP score: 231
lnL(ntime: 21 np: 24): -1592.168673 +0.000000
13..1 13..14 14..2 14..3 13..15 15..16 16..4 16..5 15..17 17..18 18..19 19..20 20..21 21..6 21..7 20..8 19..22 22..11 22..12 18..10 17..9
0.011548 0.016835 0.011103 0.000004 0.033185 0.039648 0.041047 0.052294 0.068389 0.034482 0.069460 0.060604 0.040168 0.117370 0.096034 0.038134 0.092561 0.114951 0.118576 0.285349 0.375272 3.130829 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.71701
(1: 0.011548, (2: 0.011103, 3: 0.000004): 0.016835, ((4: 0.041047, 5: 0.052294): 0.039648, (((((6: 0.117370, 7: 0.096034): 0.040168, 8: 0.038134): 0.060604, (11: 0.114951, 12: 0.118576): 0.092561): 0.069460, 10: 0.285349): 0.034482, 9: 0.375272): 0.068389): 0.033185);
(D_melanogaster_Arl5-PA: 0.011548, (D_sechellia_Arl5-PA: 0.011103, D_simulans_Arl5-PA: 0.000004): 0.016835, ((D_yakuba_Arl5-PA: 0.041047, D_erecta_Arl5-PA: 0.052294): 0.039648, (((((D_takahashii_Arl5-PA: 0.117370, D_biarmipes_Arl5-PA: 0.096034): 0.040168, D_suzukii_Arl5-PA: 0.038134): 0.060604, (D_rhopaloa_Arl5-PA: 0.114951, D_elegans_Arl5-PA: 0.118576): 0.092561): 0.069460, D_ficusphila_Arl5-PA: 0.285349): 0.034482, D_eugracilis_Arl5-PA: 0.375272): 0.068389): 0.033185);
Detailed output identifying parameters
kappa (ts/tv) = 3.13083
dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.012 425.9 111.1 0.0000 0.0000 0.0186 0.0 2.1
13..14 0.017 425.9 111.1 0.0000 0.0000 0.0271 0.0 3.0
14..2 0.011 425.9 111.1 0.0000 0.0000 0.0179 0.0 2.0
14..3 0.000 425.9 111.1 0.0000 0.0000 0.0000 0.0 0.0
13..15 0.033 425.9 111.1 0.0000 0.0000 0.0535 0.0 5.9
15..16 0.040 425.9 111.1 0.0000 0.0000 0.0639 0.0 7.1
16..4 0.041 425.9 111.1 0.0000 0.0000 0.0661 0.0 7.3
16..5 0.052 425.9 111.1 0.0000 0.0000 0.0843 0.0 9.4
15..17 0.068 425.9 111.1 0.0000 0.0000 0.1102 0.0 12.2
17..18 0.034 425.9 111.1 0.0000 0.0000 0.0556 0.0 6.2
18..19 0.069 425.9 111.1 0.0000 0.0000 0.1119 0.0 12.4
19..20 0.061 425.9 111.1 0.0000 0.0000 0.0977 0.0 10.8
20..21 0.040 425.9 111.1 0.0000 0.0000 0.0647 0.0 7.2
21..6 0.117 425.9 111.1 0.0000 0.0000 0.1891 0.0 21.0
21..7 0.096 425.9 111.1 0.0000 0.0000 0.1547 0.0 17.2
20..8 0.038 425.9 111.1 0.0000 0.0000 0.0614 0.0 6.8
19..22 0.093 425.9 111.1 0.0000 0.0000 0.1492 0.0 16.6
22..11 0.115 425.9 111.1 0.0000 0.0000 0.1852 0.0 20.6
22..12 0.119 425.9 111.1 0.0000 0.0000 0.1911 0.0 21.2
18..10 0.285 425.9 111.1 0.0000 0.0000 0.4598 0.0 51.1
17..9 0.375 425.9 111.1 0.0000 0.0000 0.6047 0.0 67.2
Time used: 0:46
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), ((4, 5), (((((6, 7), 8), (11, 12)), 10), 9))); MP score: 231
lnL(ntime: 21 np: 26): -1592.166905 +0.000000
13..1 13..14 14..2 14..3 13..15 15..16 16..4 16..5 15..17 17..18 18..19 19..20 20..21 21..6 21..7 20..8 19..22 22..11 22..12 18..10 17..9
0.011547 0.016835 0.011102 0.000004 0.033184 0.039646 0.041045 0.052292 0.068386 0.034480 0.069457 0.060602 0.040167 0.117366 0.096030 0.038132 0.092558 0.114947 0.118572 0.285338 0.375258 3.130827 1.000000 0.000000 0.000001 132.294420
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.71695
(1: 0.011547, (2: 0.011102, 3: 0.000004): 0.016835, ((4: 0.041045, 5: 0.052292): 0.039646, (((((6: 0.117366, 7: 0.096030): 0.040167, 8: 0.038132): 0.060602, (11: 0.114947, 12: 0.118572): 0.092558): 0.069457, 10: 0.285338): 0.034480, 9: 0.375258): 0.068386): 0.033184);
(D_melanogaster_Arl5-PA: 0.011547, (D_sechellia_Arl5-PA: 0.011102, D_simulans_Arl5-PA: 0.000004): 0.016835, ((D_yakuba_Arl5-PA: 0.041045, D_erecta_Arl5-PA: 0.052292): 0.039646, (((((D_takahashii_Arl5-PA: 0.117366, D_biarmipes_Arl5-PA: 0.096030): 0.040167, D_suzukii_Arl5-PA: 0.038132): 0.060602, (D_rhopaloa_Arl5-PA: 0.114947, D_elegans_Arl5-PA: 0.118572): 0.092558): 0.069457, D_ficusphila_Arl5-PA: 0.285338): 0.034480, D_eugracilis_Arl5-PA: 0.375258): 0.068386): 0.033184);
Detailed output identifying parameters
kappa (ts/tv) = 3.13083
dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 132.29442
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.012 425.9 111.1 0.0000 0.0000 0.0186 0.0 2.1
13..14 0.017 425.9 111.1 0.0000 0.0000 0.0271 0.0 3.0
14..2 0.011 425.9 111.1 0.0000 0.0000 0.0179 0.0 2.0
14..3 0.000 425.9 111.1 0.0000 0.0000 0.0000 0.0 0.0
13..15 0.033 425.9 111.1 0.0000 0.0000 0.0535 0.0 5.9
15..16 0.040 425.9 111.1 0.0000 0.0000 0.0639 0.0 7.1
16..4 0.041 425.9 111.1 0.0000 0.0000 0.0661 0.0 7.3
16..5 0.052 425.9 111.1 0.0000 0.0000 0.0843 0.0 9.4
15..17 0.068 425.9 111.1 0.0000 0.0000 0.1102 0.0 12.2
17..18 0.034 425.9 111.1 0.0000 0.0000 0.0556 0.0 6.2
18..19 0.069 425.9 111.1 0.0000 0.0000 0.1119 0.0 12.4
19..20 0.061 425.9 111.1 0.0000 0.0000 0.0977 0.0 10.8
20..21 0.040 425.9 111.1 0.0000 0.0000 0.0647 0.0 7.2
21..6 0.117 425.9 111.1 0.0000 0.0000 0.1891 0.0 21.0
21..7 0.096 425.9 111.1 0.0000 0.0000 0.1547 0.0 17.2
20..8 0.038 425.9 111.1 0.0000 0.0000 0.0614 0.0 6.8
19..22 0.093 425.9 111.1 0.0000 0.0000 0.1492 0.0 16.6
22..11 0.115 425.9 111.1 0.0000 0.0000 0.1852 0.0 20.6
22..12 0.119 425.9 111.1 0.0000 0.0000 0.1911 0.0 21.2
18..10 0.285 425.9 111.1 0.0000 0.0000 0.4598 0.0 51.1
17..9 0.375 425.9 111.1 0.0000 0.0000 0.6047 0.0 67.2
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Arl5-PA)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.102 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 2:08
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), ((4, 5), (((((6, 7), 8), (11, 12)), 10), 9))); MP score: 231
lnL(ntime: 21 np: 27): -1592.166905 +0.000000
13..1 13..14 14..2 14..3 13..15 15..16 16..4 16..5 15..17 17..18 18..19 19..20 20..21 21..6 21..7 20..8 19..22 22..11 22..12 18..10 17..9
0.011547 0.016835 0.011102 0.000004 0.033184 0.039646 0.041045 0.052292 0.068386 0.034480 0.069457 0.060602 0.040167 0.117366 0.096030 0.038132 0.092558 0.114947 0.118572 0.285338 0.375258 3.130828 0.225857 0.572002 0.000001 0.000001 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.71695
(1: 0.011547, (2: 0.011102, 3: 0.000004): 0.016835, ((4: 0.041045, 5: 0.052292): 0.039646, (((((6: 0.117366, 7: 0.096030): 0.040167, 8: 0.038132): 0.060602, (11: 0.114947, 12: 0.118572): 0.092558): 0.069457, 10: 0.285338): 0.034480, 9: 0.375258): 0.068386): 0.033184);
(D_melanogaster_Arl5-PA: 0.011547, (D_sechellia_Arl5-PA: 0.011102, D_simulans_Arl5-PA: 0.000004): 0.016835, ((D_yakuba_Arl5-PA: 0.041045, D_erecta_Arl5-PA: 0.052292): 0.039646, (((((D_takahashii_Arl5-PA: 0.117366, D_biarmipes_Arl5-PA: 0.096030): 0.040167, D_suzukii_Arl5-PA: 0.038132): 0.060602, (D_rhopaloa_Arl5-PA: 0.114947, D_elegans_Arl5-PA: 0.118572): 0.092558): 0.069457, D_ficusphila_Arl5-PA: 0.285338): 0.034480, D_eugracilis_Arl5-PA: 0.375258): 0.068386): 0.033184);
Detailed output identifying parameters
kappa (ts/tv) = 3.13083
dN/dS (w) for site classes (K=3)
p: 0.22586 0.57200 0.20214
w: 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.012 425.9 111.1 0.0000 0.0000 0.0186 0.0 2.1
13..14 0.017 425.9 111.1 0.0000 0.0000 0.0271 0.0 3.0
14..2 0.011 425.9 111.1 0.0000 0.0000 0.0179 0.0 2.0
14..3 0.000 425.9 111.1 0.0000 0.0000 0.0000 0.0 0.0
13..15 0.033 425.9 111.1 0.0000 0.0000 0.0535 0.0 5.9
15..16 0.040 425.9 111.1 0.0000 0.0000 0.0639 0.0 7.1
16..4 0.041 425.9 111.1 0.0000 0.0000 0.0661 0.0 7.3
16..5 0.052 425.9 111.1 0.0000 0.0000 0.0843 0.0 9.4
15..17 0.068 425.9 111.1 0.0000 0.0000 0.1102 0.0 12.2
17..18 0.034 425.9 111.1 0.0000 0.0000 0.0556 0.0 6.2
18..19 0.069 425.9 111.1 0.0000 0.0000 0.1119 0.0 12.4
19..20 0.061 425.9 111.1 0.0000 0.0000 0.0977 0.0 10.8
20..21 0.040 425.9 111.1 0.0000 0.0000 0.0647 0.0 7.2
21..6 0.117 425.9 111.1 0.0000 0.0000 0.1891 0.0 21.0
21..7 0.096 425.9 111.1 0.0000 0.0000 0.1547 0.0 17.2
20..8 0.038 425.9 111.1 0.0000 0.0000 0.0614 0.0 6.8
19..22 0.093 425.9 111.1 0.0000 0.0000 0.1492 0.0 16.6
22..11 0.115 425.9 111.1 0.0000 0.0000 0.1852 0.0 20.6
22..12 0.119 425.9 111.1 0.0000 0.0000 0.1911 0.0 21.2
18..10 0.285 425.9 111.1 0.0000 0.0000 0.4598 0.0 51.1
17..9 0.375 425.9 111.1 0.0000 0.0000 0.6047 0.0 67.2
Naive Empirical Bayes (NEB) analysis
Time used: 2:37
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), ((4, 5), (((((6, 7), 8), (11, 12)), 10), 9))); MP score: 231
lnL(ntime: 21 np: 24): -1592.165772 +0.000000
13..1 13..14 14..2 14..3 13..15 15..16 16..4 16..5 15..17 17..18 18..19 19..20 20..21 21..6 21..7 20..8 19..22 22..11 22..12 18..10 17..9
0.011547 0.016834 0.011102 0.000004 0.033184 0.039646 0.041045 0.052292 0.068386 0.034480 0.069458 0.060602 0.040167 0.117366 0.096030 0.038132 0.092558 0.114947 0.118572 0.285339 0.375259 3.130819 0.005000 99.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.71695
(1: 0.011547, (2: 0.011102, 3: 0.000004): 0.016834, ((4: 0.041045, 5: 0.052292): 0.039646, (((((6: 0.117366, 7: 0.096030): 0.040167, 8: 0.038132): 0.060602, (11: 0.114947, 12: 0.118572): 0.092558): 0.069458, 10: 0.285339): 0.034480, 9: 0.375259): 0.068386): 0.033184);
(D_melanogaster_Arl5-PA: 0.011547, (D_sechellia_Arl5-PA: 0.011102, D_simulans_Arl5-PA: 0.000004): 0.016834, ((D_yakuba_Arl5-PA: 0.041045, D_erecta_Arl5-PA: 0.052292): 0.039646, (((((D_takahashii_Arl5-PA: 0.117366, D_biarmipes_Arl5-PA: 0.096030): 0.040167, D_suzukii_Arl5-PA: 0.038132): 0.060602, (D_rhopaloa_Arl5-PA: 0.114947, D_elegans_Arl5-PA: 0.118572): 0.092558): 0.069458, D_ficusphila_Arl5-PA: 0.285339): 0.034480, D_eugracilis_Arl5-PA: 0.375259): 0.068386): 0.033184);
Detailed output identifying parameters
kappa (ts/tv) = 3.13082
Parameters in M7 (beta):
p = 0.00500 q = 99.00000
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.012 425.9 111.1 0.0000 0.0000 0.0186 0.0 2.1
13..14 0.017 425.9 111.1 0.0000 0.0000 0.0271 0.0 3.0
14..2 0.011 425.9 111.1 0.0000 0.0000 0.0179 0.0 2.0
14..3 0.000 425.9 111.1 0.0000 0.0000 0.0000 0.0 0.0
13..15 0.033 425.9 111.1 0.0000 0.0000 0.0535 0.0 5.9
15..16 0.040 425.9 111.1 0.0000 0.0000 0.0639 0.0 7.1
16..4 0.041 425.9 111.1 0.0000 0.0000 0.0661 0.0 7.3
16..5 0.052 425.9 111.1 0.0000 0.0000 0.0843 0.0 9.4
15..17 0.068 425.9 111.1 0.0000 0.0000 0.1102 0.0 12.2
17..18 0.034 425.9 111.1 0.0000 0.0000 0.0556 0.0 6.2
18..19 0.069 425.9 111.1 0.0000 0.0000 0.1119 0.0 12.4
19..20 0.061 425.9 111.1 0.0000 0.0000 0.0977 0.0 10.8
20..21 0.040 425.9 111.1 0.0000 0.0000 0.0647 0.0 7.2
21..6 0.117 425.9 111.1 0.0000 0.0000 0.1891 0.0 21.0
21..7 0.096 425.9 111.1 0.0000 0.0000 0.1548 0.0 17.2
20..8 0.038 425.9 111.1 0.0000 0.0000 0.0614 0.0 6.8
19..22 0.093 425.9 111.1 0.0000 0.0000 0.1492 0.0 16.6
22..11 0.115 425.9 111.1 0.0000 0.0000 0.1852 0.0 20.6
22..12 0.119 425.9 111.1 0.0000 0.0000 0.1911 0.0 21.2
18..10 0.285 425.9 111.1 0.0000 0.0000 0.4598 0.0 51.1
17..9 0.375 425.9 111.1 0.0000 0.0000 0.6047 0.0 67.2
Time used: 6:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), ((4, 5), (((((6, 7), 8), (11, 12)), 10), 9))); MP score: 231
lnL(ntime: 21 np: 26): -1592.200271 +0.000000
13..1 13..14 14..2 14..3 13..15 15..16 16..4 16..5 15..17 17..18 18..19 19..20 20..21 21..6 21..7 20..8 19..22 22..11 22..12 18..10 17..9
0.011646 0.017119 0.011062 0.000004 0.033798 0.040296 0.041743 0.053210 0.069585 0.034978 0.070652 0.061668 0.040904 0.119399 0.097631 0.038812 0.094096 0.116857 0.120688 0.290339 0.381681 3.130210 0.999990 0.005000 0.742865 10.859948
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.74617
(1: 0.011646, (2: 0.011062, 3: 0.000004): 0.017119, ((4: 0.041743, 5: 0.053210): 0.040296, (((((6: 0.119399, 7: 0.097631): 0.040904, 8: 0.038812): 0.061668, (11: 0.116857, 12: 0.120688): 0.094096): 0.070652, 10: 0.290339): 0.034978, 9: 0.381681): 0.069585): 0.033798);
(D_melanogaster_Arl5-PA: 0.011646, (D_sechellia_Arl5-PA: 0.011062, D_simulans_Arl5-PA: 0.000004): 0.017119, ((D_yakuba_Arl5-PA: 0.041743, D_erecta_Arl5-PA: 0.053210): 0.040296, (((((D_takahashii_Arl5-PA: 0.119399, D_biarmipes_Arl5-PA: 0.097631): 0.040904, D_suzukii_Arl5-PA: 0.038812): 0.061668, (D_rhopaloa_Arl5-PA: 0.116857, D_elegans_Arl5-PA: 0.120688): 0.094096): 0.070652, D_ficusphila_Arl5-PA: 0.290339): 0.034978, D_eugracilis_Arl5-PA: 0.381681): 0.069585): 0.033798);
Detailed output identifying parameters
kappa (ts/tv) = 3.13021
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 0.74287
(p1 = 0.00001) w = 10.85995
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00006 10.85995
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.012 425.9 111.1 0.0001 0.0000 0.0188 0.0 2.1
13..14 0.017 425.9 111.1 0.0001 0.0000 0.0276 0.0 3.1
14..2 0.011 425.9 111.1 0.0001 0.0000 0.0178 0.0 2.0
14..3 0.000 425.9 111.1 0.0001 0.0000 0.0000 0.0 0.0
13..15 0.034 425.9 111.1 0.0001 0.0000 0.0544 0.0 6.0
15..16 0.040 425.9 111.1 0.0001 0.0000 0.0649 0.0 7.2
16..4 0.042 425.9 111.1 0.0001 0.0000 0.0672 0.0 7.5
16..5 0.053 425.9 111.1 0.0001 0.0000 0.0857 0.0 9.5
15..17 0.070 425.9 111.1 0.0001 0.0000 0.1121 0.0 12.5
17..18 0.035 425.9 111.1 0.0001 0.0000 0.0563 0.0 6.3
18..19 0.071 425.9 111.1 0.0001 0.0000 0.1138 0.0 12.6
19..20 0.062 425.9 111.1 0.0001 0.0000 0.0993 0.0 11.0
20..21 0.041 425.9 111.1 0.0001 0.0000 0.0659 0.0 7.3
21..6 0.119 425.9 111.1 0.0001 0.0000 0.1923 0.0 21.4
21..7 0.098 425.9 111.1 0.0001 0.0000 0.1573 0.0 17.5
20..8 0.039 425.9 111.1 0.0001 0.0000 0.0625 0.0 6.9
19..22 0.094 425.9 111.1 0.0001 0.0000 0.1516 0.0 16.8
22..11 0.117 425.9 111.1 0.0001 0.0000 0.1882 0.0 20.9
22..12 0.121 425.9 111.1 0.0001 0.0000 0.1944 0.0 21.6
18..10 0.290 425.9 111.1 0.0001 0.0001 0.4677 0.0 51.9
17..9 0.382 425.9 111.1 0.0001 0.0001 0.6148 0.0 68.3
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Arl5-PA)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.015 0.138 0.846
ws: 0.103 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 10:07
Model 1: NearlyNeutral -1592.168673 Model 2: PositiveSelection -1592.166905 Model 0: one-ratio -1592.281347 Model 3: discrete -1592.166905 Model 7: beta -1592.165772 Model 8: beta&w>1 -1592.200271 Model 0 vs 1 0.22534800000039468 Model 2 vs 1 0.003535999999712658 Model 8 vs 7 0.06899799999973766
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
