--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Wed Nov 02 17:16:00 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/138/CG40498-PG/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/138/CG40498-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG40498-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/138/CG40498-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1673.07         -1687.34
2      -1673.46         -1684.86
--------------------------------------
TOTAL    -1673.24         -1686.72
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/138/CG40498-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG40498-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/138/CG40498-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.189930    0.000768    0.136953    0.243548    0.187167   1471.22   1486.11    1.000
r(A<->C){all}   0.164116    0.001956    0.086390    0.258961    0.160821    765.81    837.64    1.000
r(A<->G){all}   0.219458    0.002259    0.135138    0.322599    0.216367    611.54    671.61    1.000
r(A<->T){all}   0.142109    0.001271    0.077792    0.213210    0.139190    969.63   1055.25    1.005
r(C<->G){all}   0.080269    0.001196    0.021028    0.149713    0.075856    783.94    877.05    1.000
r(C<->T){all}   0.319622    0.003428    0.209735    0.437835    0.317864    711.37    717.29    1.000
r(G<->T){all}   0.074427    0.000829    0.027968    0.138208    0.071746    919.62    953.41    1.000
pi(A){all}      0.303263    0.000231    0.272063    0.331717    0.303511   1212.59   1240.49    1.000
pi(C){all}      0.186379    0.000171    0.162459    0.213672    0.186142   1073.43   1208.51    1.000
pi(G){all}      0.230838    0.000200    0.205147    0.260606    0.230763   1161.62   1198.58    1.000
pi(T){all}      0.279520    0.000241    0.249752    0.311025    0.279042   1097.98   1156.44    1.000
alpha{1,2}      0.078341    0.005209    0.000117    0.201160    0.062561   1254.73   1377.86    1.001
alpha{3}        1.672875    0.580233    0.432120    3.174350    1.550703   1110.63   1305.82    1.000
pinvar{all}     0.306774    0.019725    0.032432    0.544579    0.318108   1120.89   1129.14    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1612.34319
Model 2: PositiveSelection	-1609.229767
Model 0: one-ratio	-1619.591069
Model 3: discrete	-1609.229767
Model 7: beta	-1613.242351
Model 8: beta&w>1	-1609.254657


Model 0 vs 1	14.495758000000023

Model 2 vs 1	6.226846000000023

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PG)

            Pr(w>1)     post mean +- SE for w

    63 T      0.879         4.631
   212 S      1.000**       5.254
   252 L      0.889         4.681
   259 L      0.878         4.624

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PG)

            Pr(w>1)     post mean +- SE for w

    63 T      0.759         3.433 +- 2.310
   212 S      0.947         4.067 +- 2.183
   252 L      0.770         3.496 +- 2.328
   259 L      0.742         3.318 +- 2.253


Model 8 vs 7	7.975388000000294

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PG)

            Pr(w>1)     post mean +- SE for w

    63 T      0.870         4.605
   212 S      1.000**       5.278
   252 L      0.880         4.658
   259 L      0.867         4.593

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PG)

            Pr(w>1)     post mean +- SE for w

    63 T      0.831         2.904 +- 1.917
   212 S      0.980*        3.277 +- 1.766
   252 L      0.835         2.926 +- 1.925
   259 L      0.835         2.887 +- 1.882

>C1
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KLLLRRESLNDAISITRI
>C2
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C3
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRREFLSDAISITRI
>C4
MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C5
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C6
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
KQLLRRESTNDAINITRI
>C7
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
KLLLRRESINDAINITRI
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=268 

C1              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
C2              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
C3              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
C4              MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
C5              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
C6              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
C7              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
                ****.******************************************:**

C1              KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C2              KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C3              KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C4              KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C5              KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C6              KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C7              KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
                ******:.**.*.*************************************

C1              MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
C2              MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
C3              MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
C4              MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
C5              MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
C6              MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
C7              MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
                ***::**************************:******************

C1              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
C2              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
C3              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
C4              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
C5              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
C6              RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
C7              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
                ***************:*********************  **********.

C1              SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
C2              SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
C3              SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
C4              SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
C5              SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
C6              SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
C7              SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
                *:***.**.** ******:**:********.:*****.******:*****

C1              KLLLRRESLNDAISITRI
C2              KQLLRRESLSDAISITRI
C3              KQLLRREFLSDAISITRI
C4              KQLLRRESLSDAISITRI
C5              KQLLRRESLSDAISITRI
C6              KQLLRRESTNDAINITRI
C7              KLLLRRESINDAINITRI
                * *****  .***.****




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [11256]--->[11256]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/138/CG40498-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.379 Mb, Max= 30.771 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KLLLRRESLNDAISITRI
>C2
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C3
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRREFLSDAISITRI
>C4
MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C5
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C6
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
KQLLRRESTNDAINITRI
>C7
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
KLLLRRESINDAINITRI

FORMAT of file /tmp/tmp1252986693734737745aln Not Supported[FATAL:T-COFFEE]
>C1
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KLLLRRESLNDAISITRI
>C2
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C3
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRREFLSDAISITRI
>C4
MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C5
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C6
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
KQLLRRESTNDAINITRI
>C7
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
KLLLRRESINDAINITRI
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:268 S:100 BS:268
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# PW_SEQ_DISTANCES 
BOT	    0    1	 96.27 C1	 C2	 96.27
TOP	    1    0	 96.27 C2	 C1	 96.27
BOT	    0    2	 95.90 C1	 C3	 95.90
TOP	    2    0	 95.90 C3	 C1	 95.90
BOT	    0    3	 95.90 C1	 C4	 95.90
TOP	    3    0	 95.90 C4	 C1	 95.90
BOT	    0    4	 95.90 C1	 C5	 95.90
TOP	    4    0	 95.90 C5	 C1	 95.90
BOT	    0    5	 93.28 C1	 C6	 93.28
TOP	    5    0	 93.28 C6	 C1	 93.28
BOT	    0    6	 95.90 C1	 C7	 95.90
TOP	    6    0	 95.90 C7	 C1	 95.90
BOT	    1    2	 99.63 C2	 C3	 99.63
TOP	    2    1	 99.63 C3	 C2	 99.63
BOT	    1    3	 99.63 C2	 C4	 99.63
TOP	    3    1	 99.63 C4	 C2	 99.63
BOT	    1    4	 98.88 C2	 C5	 98.88
TOP	    4    1	 98.88 C5	 C2	 98.88
BOT	    1    5	 93.66 C2	 C6	 93.66
TOP	    5    1	 93.66 C6	 C2	 93.66
BOT	    1    6	 94.78 C2	 C7	 94.78
TOP	    6    1	 94.78 C7	 C2	 94.78
BOT	    2    3	 99.25 C3	 C4	 99.25
TOP	    3    2	 99.25 C4	 C3	 99.25
BOT	    2    4	 98.51 C3	 C5	 98.51
TOP	    4    2	 98.51 C5	 C3	 98.51
BOT	    2    5	 93.28 C3	 C6	 93.28
TOP	    5    2	 93.28 C6	 C3	 93.28
BOT	    2    6	 94.40 C3	 C7	 94.40
TOP	    6    2	 94.40 C7	 C3	 94.40
BOT	    3    4	 98.51 C4	 C5	 98.51
TOP	    4    3	 98.51 C5	 C4	 98.51
BOT	    3    5	 93.28 C4	 C6	 93.28
TOP	    5    3	 93.28 C6	 C4	 93.28
BOT	    3    6	 94.40 C4	 C7	 94.40
TOP	    6    3	 94.40 C7	 C4	 94.40
BOT	    4    5	 93.28 C5	 C6	 93.28
TOP	    5    4	 93.28 C6	 C5	 93.28
BOT	    4    6	 94.40 C5	 C7	 94.40
TOP	    6    4	 94.40 C7	 C5	 94.40
BOT	    5    6	 95.15 C6	 C7	 95.15
TOP	    6    5	 95.15 C7	 C6	 95.15
AVG	 0	 C1	  *	 95.52
AVG	 1	 C2	  *	 97.14
AVG	 2	 C3	  *	 96.83
AVG	 3	 C4	  *	 96.83
AVG	 4	 C5	  *	 96.58
AVG	 5	 C6	  *	 93.66
AVG	 6	 C7	  *	 94.84
TOT	 TOT	  *	 95.91
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
C2              ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
C3              ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
C4              ATGCATTCAGTTAGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
C5              ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
C6              ATGCATTCCGTGGGCATTCATTCGGCAATGGCGATCAAAAGGCAACGGAA
C7              ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
                ********.** .********** **************************

C1              ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGCTATAGCACGCAAA
C2              ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
C3              ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
C4              ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
C5              ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
C6              ACGTCGAGATGAACAGAAAAGGGCTCGAGAAAGACGTTATAGCACGCAAA
C7              ACGTCGTGATGAACAAAAAAGGGCTCGGGAAAGACGCTATAGCACGCAAA
                ******:********.******** **.******** *************

C1              GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
C2              GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
C3              GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
C4              GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
C5              GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
C6              GTTCTGAGAGCGGAGAAACATTTCATTCTCCAACAGGATCCCTGAGACGA
C7              GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCTGTGAGACGA
                *******.***** **************************  ****.***

C1              AAATACCACCATCCTCGTAATGCAGTTAGTTCTGGCACCGGAATGCTTGA
C2              AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
C3              AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
C4              AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
C5              AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
C6              AAATATCACCATCCTCGTCATCCAGTTAGTCCCGGCCCCGGAATGCTTGA
C7              AAATATCACCACCCTCGGCATGCAGTTAGTCCCGGCACCGGAATGCTTGA
                ***** ***** ***** .** ******** * ***.* ***********

C1              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C2              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C3              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C4              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C5              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C6              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C7              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
                **************************************************

C1              TTGTGTTTGGAGTTTTTCTTTGCGGTGCTGGTATTATTCCAGACGAAACT
C2              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
C3              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
C4              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
C5              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
C6              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
C7              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
                ************************* ************************

C1              ATGTCATGGAACGTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTTAC
C2              ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
C3              ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
C4              ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
C5              ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
C6              ATGTCATGGAACGTATTTAGCTCAAGCTCTGCCTGGTGGAATGAAGTTAC
C7              ATGTCATGGAACGTATTTAGCTCAAGCTCAGCATGGTGGAATGAAGTTAC
                ***********  ****************:**.**************:**

C1              TTGCACAGGTTTATTTTCTCTGGGATTGGGACTGTTTTTACTAATTTTAA
C2              TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
C3              TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
C4              TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
C5              TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAGTTTTAA
C6              ATGCACAGGCTTATTTTCTCTTGGACTGGGACTGTTTTTACTTATTTTAA
C7              TTGCACAGGATTATTTTCCCTTGGACTGGGACTGTTTTTACTAATTTTAA
                :******** ******** ** *** ****************:.******

C1              ACTGTCTTATAAGCCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C2              ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C3              ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C4              ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C5              ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C6              ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C7              ACTGTCTTATAAGTCGAAAGGAGGAGGAGGATCTTGAAGACTATGTACAA
                ************* *****.**************************.***

C1              CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
C2              CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
C3              CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
C4              CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
C5              CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
C6              CGTCAACTAACTAGATCTCGATCTGGACACCGACTTGAAAGAGATATTGA
C7              CGTCAACTAACTCGATCTCGATCTGGACACCGACTTGAAAGAGATGTTGA
                ************.*******.************************.****

C1              AACTGGTGTTTTGACAACGCGCCATGCTCGCAAAGCTGTTGCCTTACAAA
C2              AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
C3              AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
C4              AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
C5              AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
C6              AACTGGTGTTTTGACAACGCGACATGCTCGAAAAGCTGTTGCTTTACAAA
C7              AACTGGTGTTTTGACAACGCGCCATGCTCGAAAAGCGGTTGCTTTACAAA
                *********************.*****:**.***** ***** *******

C1              AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTTGTAAATTGCGGC
C2              AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
C3              AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
C4              AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
C5              AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
C6              AGGGCGGACGTAATATATCTCCTACAGATGTTTCCGTCGTAAATTGTGGC
C7              AGGGTGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCAGT
                **** *******:**:.******************** ******** .* 

C1              TCTTCAGAGAATATGAGCAATGGAACGATAGTCAGCCATAATGTTTTAAA
C2              TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
C3              TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
C4              TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
C5              TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
C6              TCTGCAGAAAATATGTGCAATGGACCGATAGTTAACCATAATGTTTTAAA
C7              TCTGCTGAAAATATGTGCAATGGACCGATAGTTGGCCATAATGTCTTAAA
                *** *:**.******:********.******* . ********* *****

C1              CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
C2              CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
C3              CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
C4              CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
C5              CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATGCTTATT
C6              CAGCACTGATGCAATCCTCGAAAAAATTGTGGAGGAAGATACAACTTATT
C7              CAGCTCTGATGCTTTCCTCGAAAAAATTGTGGAGGAAGATACTACTTATT
                *** :*******::**** *****************.****.:.******

C1              TAAACGACCGCAGCTCCGGAATATCTCCAATTGATTTAGAAAATGATAAG
C2              TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
C3              TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
C4              TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
C5              TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
C6              TAAACGACCGTAACTCTGGAATATCTCCGATTGAATTAGAAAATGATAAG
C7              TAAACGACCGTAGCTCTGGAATATCTCCGATTGATTTAGAAAATGATAAG
                ********** *.*** ***********.*****:***************

C1              AAACTGCTTTTAAGAAGAGAATCTCTAAATGACGCAATCAGTATAACACG
C2              AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
C3              AAACAGCTCTTAAGAAGAGAATTTCTAAGTGACGCAATCAGTATAACGCG
C4              AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
C5              AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
C6              AAGCAATTATTAAGAAGAGAATCTACGAATGACGCAATCAATATTACACG
C7              AAGCTGTTATTAAGAAGAGAATCTATAAATGACGCAATCAATATAACACG
                **.*:. * ************* *. .*.***********.***:**.**

C1              TATT
C2              TATT
C3              TATT
C4              TATT
C5              TATT
C6              TATT
C7              TATT
                ****



>C1
ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGCTATAGCACGCAAA
GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATACCACCATCCTCGTAATGCAGTTAGTTCTGGCACCGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGTGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAACGTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTTAC
TTGCACAGGTTTATTTTCTCTGGGATTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGCCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCTCGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTTGTAAATTGCGGC
TCTTCAGAGAATATGAGCAATGGAACGATAGTCAGCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
TAAACGACCGCAGCTCCGGAATATCTCCAATTGATTTAGAAAATGATAAG
AAACTGCTTTTAAGAAGAGAATCTCTAAATGACGCAATCAGTATAACACG
TATT
>C2
ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
TATT
>C3
ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAACAGCTCTTAAGAAGAGAATTTCTAAGTGACGCAATCAGTATAACGCG
TATT
>C4
ATGCATTCAGTTAGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
TATT
>C5
ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAGTTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATGCTTATT
TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
TATT
>C6
ATGCATTCCGTGGGCATTCATTCGGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAGAAAAGGGCTCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAGAGCGGAGAAACATTTCATTCTCCAACAGGATCCCTGAGACGA
AAATATCACCATCCTCGTCATCCAGTTAGTCCCGGCCCCGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAACGTATTTAGCTCAAGCTCTGCCTGGTGGAATGAAGTTAC
ATGCACAGGCTTATTTTCTCTTGGACTGGGACTGTTTTTACTTATTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTAGATCTCGATCTGGACACCGACTTGAAAGAGATATTGA
AACTGGTGTTTTGACAACGCGACATGCTCGAAAAGCTGTTGCTTTACAAA
AGGGCGGACGTAATATATCTCCTACAGATGTTTCCGTCGTAAATTGTGGC
TCTGCAGAAAATATGTGCAATGGACCGATAGTTAACCATAATGTTTTAAA
CAGCACTGATGCAATCCTCGAAAAAATTGTGGAGGAAGATACAACTTATT
TAAACGACCGTAACTCTGGAATATCTCCGATTGAATTAGAAAATGATAAG
AAGCAATTATTAAGAAGAGAATCTACGAATGACGCAATCAATATTACACG
TATT
>C7
ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGTGATGAACAAAAAAGGGCTCGGGAAAGACGCTATAGCACGCAAA
GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCTGTGAGACGA
AAATATCACCACCCTCGGCATGCAGTTAGTCCCGGCACCGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAACGTATTTAGCTCAAGCTCAGCATGGTGGAATGAAGTTAC
TTGCACAGGATTATTTTCCCTTGGACTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGTCGAAAGGAGGAGGAGGATCTTGAAGACTATGTACAA
CGTCAACTAACTCGATCTCGATCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCTCGAAAAGCGGTTGCTTTACAAA
AGGGTGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCAGT
TCTGCTGAAAATATGTGCAATGGACCGATAGTTGGCCATAATGTCTTAAA
CAGCTCTGATGCTTTCCTCGAAAAAATTGTGGAGGAAGATACTACTTATT
TAAACGACCGTAGCTCTGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAGCTGTTATTAAGAAGAGAATCTATAAATGACGCAATCAATATAACACG
TATT
>C1
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KLLLRRESLNDAISITRI
>C2
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C3
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRREFLSDAISITRI
>C4
MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C5
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C6
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
KQLLRRESTNDAINITRI
>C7
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
KLLLRRESINDAINITRI


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/138/CG40498-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 7 taxa and 804 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Taxon 7 -> C7
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1478106605
      Setting output file names to "/opt/ADOPS/138/CG40498-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1668901198
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 2453559921
      Seed = 329992635
      Swapseed = 1478106605
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 21 unique site patterns
      Division 2 has 14 unique site patterns
      Division 3 has 38 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2401.842642 -- -24.557203
         Chain 2 -- -2426.295359 -- -24.557203
         Chain 3 -- -2385.846410 -- -24.557203
         Chain 4 -- -2423.777792 -- -24.557203

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2331.477397 -- -24.557203
         Chain 2 -- -2420.657796 -- -24.557203
         Chain 3 -- -2374.029094 -- -24.557203
         Chain 4 -- -2420.734829 -- -24.557203


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2401.843] (-2426.295) (-2385.846) (-2423.778) * [-2331.477] (-2420.658) (-2374.029) (-2420.735) 
        500 -- (-1699.877) (-1701.950) [-1695.876] (-1700.429) * (-1703.864) (-1702.290) (-1702.364) [-1690.315] -- 0:00:00
       1000 -- (-1686.555) (-1689.116) [-1686.612] (-1685.432) * (-1686.982) [-1684.066] (-1700.359) (-1679.769) -- 0:00:00
       1500 -- [-1682.689] (-1691.885) (-1680.169) (-1685.454) * (-1688.652) [-1685.406] (-1698.015) (-1686.055) -- 0:00:00
       2000 -- (-1677.304) (-1686.208) (-1682.035) [-1680.203] * (-1681.274) (-1682.895) (-1694.095) [-1681.927] -- 0:00:00
       2500 -- (-1681.302) (-1681.752) (-1684.025) [-1680.003] * (-1679.339) [-1677.638] (-1687.209) (-1682.075) -- 0:06:39
       3000 -- [-1677.411] (-1690.128) (-1686.766) (-1677.503) * (-1682.912) (-1686.579) (-1686.266) [-1674.051] -- 0:05:32
       3500 -- (-1676.880) (-1684.209) (-1684.121) [-1673.282] * [-1671.877] (-1687.396) (-1687.083) (-1672.499) -- 0:04:44
       4000 -- (-1680.376) (-1683.369) (-1684.596) [-1683.910] * (-1677.270) (-1681.216) (-1676.599) [-1676.384] -- 0:04:09
       4500 -- [-1677.102] (-1689.917) (-1683.910) (-1675.676) * (-1683.999) (-1684.704) [-1676.313] (-1678.382) -- 0:03:41
       5000 -- (-1675.037) (-1687.514) (-1682.390) [-1674.896] * (-1676.832) (-1688.756) (-1679.094) [-1675.842] -- 0:03:19

      Average standard deviation of split frequencies: 0.078567

       5500 -- [-1673.508] (-1681.005) (-1676.183) (-1676.438) * (-1681.413) (-1679.744) (-1675.433) [-1680.438] -- 0:03:00
       6000 -- (-1679.584) (-1680.856) [-1678.404] (-1676.496) * [-1679.648] (-1683.858) (-1679.100) (-1682.483) -- 0:02:45
       6500 -- (-1677.869) (-1681.792) (-1680.976) [-1677.894] * (-1678.188) (-1680.276) (-1680.953) [-1680.749] -- 0:02:32
       7000 -- [-1676.522] (-1672.766) (-1673.675) (-1671.082) * (-1684.717) (-1682.527) [-1678.087] (-1683.980) -- 0:02:21
       7500 -- (-1678.985) (-1677.022) [-1673.635] (-1674.588) * [-1671.970] (-1678.653) (-1677.905) (-1675.869) -- 0:04:24
       8000 -- (-1680.442) (-1684.249) [-1670.326] (-1680.506) * (-1671.758) (-1676.964) (-1677.583) [-1677.015] -- 0:04:08
       8500 -- (-1678.256) [-1676.634] (-1676.495) (-1680.296) * (-1675.211) (-1677.911) [-1680.268] (-1684.893) -- 0:03:53
       9000 -- [-1672.113] (-1678.870) (-1673.990) (-1675.934) * (-1679.532) [-1675.933] (-1681.789) (-1674.478) -- 0:03:40
       9500 -- (-1682.624) [-1677.832] (-1682.161) (-1674.214) * (-1678.663) (-1672.342) [-1677.649] (-1675.763) -- 0:03:28
      10000 -- (-1676.367) (-1676.775) [-1681.066] (-1674.295) * (-1677.478) (-1676.906) (-1677.291) [-1681.123] -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      10500 -- (-1681.147) (-1678.240) (-1686.174) [-1679.309] * [-1674.622] (-1674.549) (-1674.634) (-1677.487) -- 0:03:08
      11000 -- (-1676.048) (-1677.353) [-1675.345] (-1679.010) * [-1676.834] (-1688.629) (-1674.112) (-1677.290) -- 0:02:59
      11500 -- (-1675.737) (-1683.985) [-1672.203] (-1681.157) * (-1679.583) [-1682.123] (-1677.811) (-1682.567) -- 0:02:51
      12000 -- (-1675.453) (-1681.602) [-1674.962] (-1680.849) * (-1675.123) (-1680.800) (-1685.344) [-1675.650] -- 0:04:07
      12500 -- [-1672.064] (-1683.248) (-1679.746) (-1676.281) * (-1684.209) (-1676.908) (-1678.777) [-1673.466] -- 0:03:57
      13000 -- [-1676.515] (-1684.789) (-1677.313) (-1675.909) * [-1678.106] (-1678.354) (-1687.430) (-1676.780) -- 0:03:47
      13500 -- [-1679.286] (-1680.918) (-1690.951) (-1680.192) * (-1684.178) (-1681.122) (-1683.719) [-1673.450] -- 0:03:39
      14000 -- (-1681.614) (-1682.407) (-1684.445) [-1685.511] * (-1679.248) (-1674.444) [-1687.764] (-1674.241) -- 0:03:31
      14500 -- (-1676.843) [-1681.541] (-1685.522) (-1677.874) * (-1675.700) (-1674.841) [-1676.182] (-1676.222) -- 0:03:23
      15000 -- (-1674.054) (-1677.575) (-1680.698) [-1689.913] * (-1683.180) [-1677.007] (-1676.429) (-1684.754) -- 0:03:17

      Average standard deviation of split frequencies: 0.058926

      15500 -- [-1684.240] (-1675.191) (-1676.754) (-1683.533) * (-1677.987) [-1676.035] (-1675.769) (-1692.641) -- 0:03:10
      16000 -- (-1681.051) (-1676.906) [-1688.946] (-1673.598) * (-1678.432) [-1680.134] (-1676.810) (-1687.655) -- 0:03:04
      16500 -- [-1678.154] (-1675.721) (-1681.484) (-1671.392) * (-1685.335) [-1676.244] (-1676.835) (-1695.858) -- 0:02:58
      17000 -- [-1677.916] (-1671.611) (-1685.361) (-1687.976) * [-1676.492] (-1680.704) (-1680.600) (-1690.344) -- 0:03:51
      17500 -- (-1677.133) (-1671.704) (-1682.036) [-1687.183] * [-1680.481] (-1679.260) (-1685.701) (-1691.686) -- 0:03:44
      18000 -- (-1677.955) [-1674.751] (-1680.689) (-1686.387) * [-1679.451] (-1673.922) (-1683.075) (-1684.123) -- 0:03:38
      18500 -- [-1674.196] (-1679.358) (-1686.848) (-1680.974) * (-1680.619) (-1680.775) [-1681.900] (-1685.804) -- 0:03:32
      19000 -- (-1682.078) [-1674.410] (-1687.224) (-1676.863) * (-1680.439) [-1679.287] (-1677.648) (-1682.008) -- 0:03:26
      19500 -- (-1679.580) (-1674.227) [-1676.271] (-1674.795) * (-1679.994) (-1682.588) [-1683.939] (-1677.933) -- 0:03:21
      20000 -- [-1678.203] (-1679.239) (-1686.017) (-1672.994) * [-1675.193] (-1676.622) (-1685.361) (-1679.186) -- 0:03:16

      Average standard deviation of split frequencies: 0.060826

      20500 -- (-1675.367) (-1675.056) [-1685.573] (-1674.215) * (-1678.176) (-1683.019) [-1676.534] (-1677.740) -- 0:03:11
      21000 -- (-1678.610) [-1683.332] (-1689.252) (-1674.868) * [-1672.103] (-1673.827) (-1681.071) (-1685.443) -- 0:03:06
      21500 -- (-1677.225) (-1680.190) (-1679.088) [-1674.203] * (-1678.006) [-1676.781] (-1686.178) (-1680.461) -- 0:03:47
      22000 -- [-1678.683] (-1683.535) (-1675.025) (-1677.850) * (-1680.421) (-1676.592) [-1678.461] (-1679.852) -- 0:03:42
      22500 -- (-1675.308) (-1675.468) (-1679.031) [-1673.351] * (-1678.612) (-1676.762) [-1678.552] (-1678.232) -- 0:03:37
      23000 -- (-1670.777) [-1672.830] (-1672.187) (-1681.936) * (-1677.869) (-1676.720) [-1675.139] (-1681.566) -- 0:03:32
      23500 -- (-1683.394) (-1679.099) [-1677.691] (-1675.201) * (-1676.846) (-1675.475) [-1675.781] (-1679.748) -- 0:03:27
      24000 -- [-1672.084] (-1677.359) (-1674.598) (-1673.852) * (-1675.614) (-1679.402) [-1678.722] (-1682.070) -- 0:03:23
      24500 -- (-1676.326) (-1677.299) [-1681.696] (-1674.523) * (-1678.416) (-1679.686) [-1671.147] (-1685.101) -- 0:03:19
      25000 -- [-1672.888] (-1682.894) (-1678.337) (-1683.502) * (-1674.098) [-1680.894] (-1682.252) (-1678.734) -- 0:03:15

      Average standard deviation of split frequencies: 0.066480

      25500 -- (-1680.447) [-1676.849] (-1680.190) (-1685.557) * [-1680.477] (-1683.308) (-1678.828) (-1678.491) -- 0:03:11
      26000 -- (-1679.689) (-1676.031) (-1679.931) [-1681.849] * (-1675.440) [-1676.248] (-1675.143) (-1674.503) -- 0:03:44
      26500 -- (-1687.296) (-1686.852) [-1681.306] (-1675.972) * (-1675.539) (-1676.171) [-1680.328] (-1680.256) -- 0:03:40
      27000 -- [-1679.012] (-1674.752) (-1678.290) (-1681.245) * (-1688.037) [-1678.663] (-1679.981) (-1675.810) -- 0:03:36
      27500 -- (-1682.016) [-1675.687] (-1674.702) (-1676.116) * (-1683.237) (-1684.047) (-1676.276) [-1678.870] -- 0:03:32
      28000 -- (-1684.599) (-1671.855) [-1676.091] (-1685.102) * [-1672.452] (-1676.286) (-1677.150) (-1683.543) -- 0:03:28
      28500 -- (-1677.575) (-1675.722) (-1675.123) [-1682.878] * (-1680.925) (-1672.655) [-1678.830] (-1685.767) -- 0:03:24
      29000 -- (-1675.348) (-1675.414) (-1683.671) [-1673.290] * (-1675.121) (-1678.540) (-1679.058) [-1675.740] -- 0:03:20
      29500 -- (-1677.722) [-1679.957] (-1688.678) (-1678.907) * [-1678.315] (-1680.088) (-1679.318) (-1678.147) -- 0:03:17
      30000 -- (-1682.488) (-1684.356) (-1687.415) [-1676.066] * (-1676.851) (-1679.907) [-1676.292] (-1678.729) -- 0:03:14

      Average standard deviation of split frequencies: 0.046116

      30500 -- [-1678.242] (-1676.701) (-1672.559) (-1690.349) * (-1675.243) [-1687.881] (-1679.349) (-1682.184) -- 0:03:10
      31000 -- (-1675.746) (-1680.283) [-1676.092] (-1673.200) * (-1680.732) [-1674.833] (-1674.090) (-1677.168) -- 0:03:38
      31500 -- (-1676.239) (-1677.522) (-1682.227) [-1675.450] * (-1682.569) (-1677.907) (-1680.757) [-1674.809] -- 0:03:35
      32000 -- (-1678.307) (-1679.595) [-1678.464] (-1674.601) * (-1689.709) [-1673.057] (-1678.818) (-1676.318) -- 0:03:31
      32500 -- (-1678.311) (-1687.744) (-1672.260) [-1673.291] * (-1684.068) (-1676.089) (-1677.485) [-1673.795] -- 0:03:28
      33000 -- (-1678.523) (-1678.624) (-1679.298) [-1676.427] * (-1680.708) (-1674.740) (-1677.125) [-1676.531] -- 0:03:25
      33500 -- (-1675.783) (-1680.735) [-1674.716] (-1678.847) * (-1687.103) (-1679.169) (-1680.569) [-1677.688] -- 0:03:21
      34000 -- (-1671.606) (-1682.741) [-1675.729] (-1676.197) * (-1688.145) (-1682.840) [-1675.670] (-1686.304) -- 0:03:18
      34500 -- [-1677.953] (-1681.933) (-1678.159) (-1678.831) * (-1684.902) (-1686.164) [-1680.986] (-1676.463) -- 0:03:15
      35000 -- (-1680.564) (-1674.324) [-1674.429] (-1677.573) * (-1683.420) (-1677.894) [-1678.653] (-1689.265) -- 0:03:13

      Average standard deviation of split frequencies: 0.039284

      35500 -- (-1686.135) (-1672.053) (-1678.135) [-1679.623] * (-1678.296) (-1684.372) (-1690.979) [-1680.635] -- 0:03:37
      36000 -- (-1675.398) (-1676.193) [-1679.588] (-1678.073) * (-1686.949) (-1675.153) [-1684.582] (-1685.529) -- 0:03:34
      36500 -- (-1676.545) (-1678.944) [-1679.103] (-1679.680) * [-1686.719] (-1677.598) (-1681.876) (-1687.000) -- 0:03:31
      37000 -- (-1682.486) (-1683.024) (-1684.265) [-1675.061] * (-1683.115) (-1676.219) [-1675.128] (-1683.228) -- 0:03:28
      37500 -- [-1676.703] (-1682.201) (-1682.621) (-1689.609) * (-1680.475) [-1675.103] (-1681.287) (-1687.990) -- 0:03:25
      38000 -- (-1677.524) (-1675.890) (-1682.296) [-1675.929] * (-1675.969) (-1675.381) [-1674.548] (-1683.002) -- 0:03:22
      38500 -- [-1675.542] (-1674.812) (-1683.508) (-1674.765) * [-1678.546] (-1680.869) (-1671.559) (-1674.722) -- 0:03:19
      39000 -- (-1681.274) [-1677.720] (-1682.124) (-1679.527) * (-1675.533) [-1676.842] (-1670.032) (-1692.194) -- 0:03:17
      39500 -- (-1675.786) (-1679.087) [-1684.436] (-1683.233) * (-1678.222) [-1680.539] (-1678.845) (-1682.374) -- 0:03:14
      40000 -- (-1680.595) (-1677.205) [-1678.741] (-1684.143) * (-1672.414) (-1680.116) [-1676.991] (-1679.275) -- 0:03:12

      Average standard deviation of split frequencies: 0.046368

      40500 -- (-1688.129) (-1670.077) (-1683.218) [-1677.670] * (-1677.750) [-1680.948] (-1676.763) (-1678.676) -- 0:03:33
      41000 -- (-1685.728) (-1672.989) (-1679.582) [-1677.420] * (-1681.655) (-1677.250) [-1674.402] (-1679.303) -- 0:03:30
      41500 -- (-1686.632) [-1676.706] (-1680.573) (-1680.233) * (-1682.603) [-1672.014] (-1675.442) (-1681.048) -- 0:03:27
      42000 -- (-1685.459) (-1676.889) [-1675.099] (-1678.244) * (-1683.971) [-1670.995] (-1671.306) (-1687.933) -- 0:03:25
      42500 -- (-1682.090) (-1686.299) (-1683.240) [-1681.198] * (-1677.000) (-1674.478) [-1678.857] (-1681.018) -- 0:03:22
      43000 -- (-1676.995) [-1681.040] (-1681.842) (-1675.311) * (-1676.682) (-1676.124) [-1673.167] (-1677.587) -- 0:03:20
      43500 -- (-1671.278) [-1673.099] (-1687.921) (-1676.164) * (-1682.709) [-1670.464] (-1678.108) (-1677.330) -- 0:03:17
      44000 -- (-1680.818) [-1687.328] (-1681.252) (-1674.978) * (-1681.081) (-1674.069) [-1676.169] (-1682.310) -- 0:03:15
      44500 -- [-1681.842] (-1683.761) (-1674.180) (-1678.173) * (-1677.596) [-1672.189] (-1676.172) (-1679.512) -- 0:03:13
      45000 -- [-1679.268] (-1691.926) (-1677.911) (-1676.066) * (-1678.728) (-1676.218) (-1675.615) [-1678.050] -- 0:03:32

      Average standard deviation of split frequencies: 0.044408

      45500 -- (-1677.657) [-1673.695] (-1680.369) (-1680.306) * (-1693.620) [-1674.831] (-1675.760) (-1678.956) -- 0:03:29
      46000 -- (-1681.738) [-1679.195] (-1681.252) (-1671.081) * [-1683.699] (-1682.223) (-1681.504) (-1672.361) -- 0:03:27
      46500 -- (-1677.072) [-1677.682] (-1683.016) (-1679.235) * (-1679.957) [-1683.369] (-1684.820) (-1676.101) -- 0:03:25
      47000 -- (-1685.391) (-1677.370) (-1684.909) [-1674.338] * (-1673.977) (-1677.057) (-1686.127) [-1679.645] -- 0:03:22
      47500 -- (-1679.088) (-1673.422) [-1677.182] (-1675.075) * (-1684.843) (-1677.543) [-1679.409] (-1672.174) -- 0:03:20
      48000 -- [-1679.152] (-1678.875) (-1677.130) (-1677.216) * (-1679.894) [-1674.869] (-1682.717) (-1675.488) -- 0:03:18
      48500 -- [-1685.930] (-1681.486) (-1679.760) (-1680.933) * [-1679.587] (-1678.650) (-1696.152) (-1673.184) -- 0:03:16
      49000 -- (-1688.772) (-1688.381) [-1674.046] (-1676.819) * (-1680.539) [-1676.880] (-1688.909) (-1685.666) -- 0:03:14
      49500 -- (-1684.187) (-1687.515) (-1675.413) [-1674.327] * (-1685.410) (-1689.576) [-1678.603] (-1681.887) -- 0:03:31
      50000 -- (-1671.261) (-1688.884) (-1678.951) [-1675.131] * (-1686.549) (-1680.587) (-1684.264) [-1682.196] -- 0:03:29

      Average standard deviation of split frequencies: 0.034115

      50500 -- (-1673.936) (-1678.230) [-1679.823] (-1679.791) * [-1680.531] (-1677.751) (-1682.656) (-1676.414) -- 0:03:26
      51000 -- (-1677.940) [-1673.724] (-1676.247) (-1680.091) * (-1680.484) [-1684.849] (-1677.802) (-1680.481) -- 0:03:24
      51500 -- (-1672.217) (-1678.651) [-1677.842] (-1679.042) * (-1680.980) (-1683.277) [-1682.027] (-1681.926) -- 0:03:22
      52000 -- (-1673.365) (-1681.884) (-1681.390) [-1677.641] * [-1678.026] (-1679.331) (-1678.221) (-1685.363) -- 0:03:20
      52500 -- [-1686.493] (-1676.851) (-1674.157) (-1676.008) * (-1680.419) (-1677.732) [-1671.895] (-1680.290) -- 0:03:18
      53000 -- (-1680.594) (-1682.175) (-1679.388) [-1671.597] * (-1682.383) (-1673.610) [-1674.361] (-1681.938) -- 0:03:16
      53500 -- (-1680.499) (-1677.221) (-1682.015) [-1673.144] * (-1678.883) (-1683.294) (-1677.365) [-1681.113] -- 0:03:14
      54000 -- [-1678.329] (-1678.551) (-1689.640) (-1679.234) * (-1672.408) (-1683.311) (-1682.910) [-1676.662] -- 0:03:30
      54500 -- (-1676.304) [-1675.087] (-1678.731) (-1675.881) * (-1677.657) (-1686.963) [-1679.949] (-1673.066) -- 0:03:28
      55000 -- (-1672.781) (-1685.647) [-1679.326] (-1679.881) * (-1689.053) (-1676.841) (-1675.315) [-1677.255] -- 0:03:26

      Average standard deviation of split frequencies: 0.035075

      55500 -- [-1679.264] (-1682.096) (-1684.638) (-1680.527) * (-1674.912) (-1676.218) [-1676.943] (-1677.875) -- 0:03:24
      56000 -- (-1679.860) (-1677.202) [-1679.448] (-1683.966) * (-1679.294) (-1676.316) [-1676.724] (-1680.285) -- 0:03:22
      56500 -- (-1680.895) (-1681.859) [-1677.318] (-1685.278) * [-1675.761] (-1679.056) (-1681.793) (-1677.418) -- 0:03:20
      57000 -- (-1674.805) [-1677.879] (-1673.122) (-1682.637) * (-1690.028) [-1676.106] (-1684.420) (-1676.507) -- 0:03:18
      57500 -- (-1678.479) (-1683.289) [-1671.991] (-1679.488) * [-1681.493] (-1680.000) (-1682.114) (-1682.187) -- 0:03:16
      58000 -- (-1677.357) (-1679.727) [-1674.699] (-1677.344) * [-1676.651] (-1678.469) (-1679.186) (-1681.328) -- 0:03:14
      58500 -- (-1679.812) (-1672.733) [-1679.491] (-1675.961) * [-1682.240] (-1679.710) (-1683.251) (-1680.588) -- 0:03:13
      59000 -- (-1675.730) (-1683.656) [-1681.316] (-1683.622) * [-1671.575] (-1676.872) (-1681.348) (-1678.374) -- 0:03:27
      59500 -- (-1680.840) (-1686.460) [-1679.857] (-1671.311) * (-1683.229) (-1679.927) [-1675.836] (-1678.772) -- 0:03:25
      60000 -- (-1683.775) (-1683.465) (-1675.114) [-1672.881] * (-1676.498) (-1679.770) [-1676.004] (-1676.741) -- 0:03:23

      Average standard deviation of split frequencies: 0.032377

      60500 -- (-1678.661) [-1680.795] (-1675.955) (-1680.908) * (-1673.400) (-1676.082) [-1672.424] (-1679.792) -- 0:03:21
      61000 -- (-1679.405) [-1676.999] (-1678.162) (-1672.651) * [-1677.225] (-1673.789) (-1689.050) (-1670.726) -- 0:03:20
      61500 -- (-1677.033) (-1683.919) [-1676.290] (-1676.133) * (-1676.911) (-1689.130) (-1679.318) [-1680.775] -- 0:03:18
      62000 -- (-1675.154) (-1679.945) (-1684.465) [-1677.158] * (-1676.067) [-1674.842] (-1677.048) (-1682.407) -- 0:03:16
      62500 -- (-1676.334) (-1685.956) (-1680.727) [-1678.097] * (-1681.983) [-1676.144] (-1685.514) (-1680.043) -- 0:03:15
      63000 -- (-1680.899) (-1675.885) (-1678.929) [-1674.685] * (-1681.109) (-1675.348) [-1673.557] (-1680.627) -- 0:03:13
      63500 -- (-1675.578) [-1675.973] (-1678.223) (-1678.675) * (-1680.927) (-1689.168) (-1671.878) [-1682.556] -- 0:03:26
      64000 -- (-1681.051) [-1673.654] (-1680.239) (-1679.959) * (-1680.482) (-1672.624) [-1675.351] (-1680.471) -- 0:03:24
      64500 -- (-1683.517) [-1674.491] (-1683.084) (-1679.916) * (-1684.753) [-1678.506] (-1676.875) (-1677.097) -- 0:03:23
      65000 -- (-1671.225) (-1679.949) (-1681.554) [-1679.025] * (-1685.452) (-1679.997) (-1682.461) [-1674.863] -- 0:03:21

      Average standard deviation of split frequencies: 0.022618

      65500 -- (-1684.078) [-1677.324] (-1677.662) (-1684.689) * (-1681.402) [-1671.893] (-1678.307) (-1674.720) -- 0:03:19
      66000 -- (-1685.890) [-1678.398] (-1675.811) (-1672.659) * (-1680.004) [-1674.823] (-1675.947) (-1683.089) -- 0:03:18
      66500 -- (-1680.390) (-1677.019) (-1682.058) [-1672.779] * [-1673.661] (-1674.951) (-1678.547) (-1696.705) -- 0:03:16
      67000 -- (-1681.305) (-1678.410) (-1677.661) [-1681.675] * [-1671.807] (-1685.129) (-1685.313) (-1677.104) -- 0:03:14
      67500 -- (-1686.964) (-1681.341) (-1675.605) [-1678.463] * (-1671.920) (-1684.820) (-1691.763) [-1673.883] -- 0:03:13
      68000 -- [-1677.575] (-1686.309) (-1679.320) (-1681.318) * (-1674.157) [-1673.319] (-1682.982) (-1681.653) -- 0:03:25
      68500 -- (-1676.149) (-1686.906) (-1675.652) [-1678.666] * [-1672.717] (-1674.211) (-1683.834) (-1683.668) -- 0:03:23
      69000 -- (-1691.222) (-1680.206) [-1675.267] (-1683.548) * (-1673.688) (-1676.656) [-1682.943] (-1682.287) -- 0:03:22
      69500 -- (-1678.186) (-1677.065) (-1683.929) [-1679.214] * (-1683.351) (-1676.812) [-1678.641] (-1679.195) -- 0:03:20
      70000 -- [-1685.916] (-1677.915) (-1684.234) (-1681.085) *