--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -702.76 -716.40
2 -702.66 -716.61
--------------------------------------
TOTAL -702.71 -716.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.137393 0.000841 0.087589 0.194158 0.133804 1307.60 1308.66 1.000
r(A<->C){all} 0.142286 0.002998 0.044625 0.249193 0.137594 430.20 562.85 1.003
r(A<->G){all} 0.210637 0.004747 0.076129 0.340388 0.207005 245.15 412.78 1.000
r(A<->T){all} 0.028591 0.000523 0.000004 0.073265 0.023683 694.86 826.32 1.000
r(C<->G){all} 0.148601 0.004434 0.033493 0.285143 0.140371 434.30 500.51 1.000
r(C<->T){all} 0.387468 0.006249 0.239433 0.543175 0.385884 596.50 648.24 1.002
r(G<->T){all} 0.082417 0.002116 0.004493 0.169092 0.075106 474.85 475.02 1.000
pi(A){all} 0.294301 0.000559 0.249635 0.342100 0.293692 1185.29 1301.92 1.000
pi(C){all} 0.221310 0.000426 0.182477 0.262909 0.220691 1085.78 1217.21 1.000
pi(G){all} 0.189537 0.000415 0.153118 0.231896 0.188226 1291.42 1296.07 1.000
pi(T){all} 0.294852 0.000519 0.251185 0.341108 0.294366 1040.47 1197.48 1.000
alpha{1,2} 0.489825 0.397422 0.000011 1.774339 0.259484 1180.05 1220.48 1.000
alpha{3} 1.666101 1.300541 0.167183 4.075566 1.402344 1232.98 1312.37 1.000
pinvar{all} 0.302286 0.031765 0.000090 0.614808 0.292308 874.34 946.77 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
-- Starting log on Wed Oct 26 22:52:39 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=10, Len=119
C1 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C2 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C3 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C5 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C6 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C7 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C8 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C9 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C10 MDYVSLLNQFWQKQIKFYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
**************** ****.****************************
C1 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C2 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C3 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C4 TIKFYEYSAQATECTKALAKQDAARIICQQLQAAGLLNGMELQFRSCFAD
C5 TIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFAD
C6 TIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFAD
C7 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C8 TIKFYEYSAQATECTKASAKQDAARLICQQLQAAGLLNGMELRFRSSAFD
C9 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFD
C10 TIKLYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFD
***:************* *******:** *:**********:***. *
C1 IFGQNRYDASKSYFFSKTA
C2 IFGQNRYDASKSYFFSKTA
C3 IFGQNRYDASKSYFFSKTA
C4 IFGKNRYDASKSYFFSKTT
C5 IFGKNRYDASKSYFFSKTT
C6 IFGKNRYDASKSYFFSKTT
C7 IFGQNRYDASKSYFFSKTA
C8 IFGQNRYDASKSYFFSKTA
C9 IFGQNRYDASKSYFFSKTA
C10 IFGQNRYDASKSYFFSKTA
***:**************:
-- Starting log on Wed Oct 26 22:53:26 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.08 sec, SCORE=997, Nseq=10, Len=119
C1 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C2 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C3 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C5 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C6 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C7 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C8 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C9 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C10 MDYVSLLNQFWQKQIKFYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
**************** ****.****************************
C1 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C2 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C3 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C4 TIKFYEYSAQATECTKALAKQDAARIICQQLQAAGLLNGMELQFRSCFAD
C5 TIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFAD
C6 TIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFAD
C7 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C8 TIKFYEYSAQATECTKASAKQDAARLICQQLQAAGLLNGMELRFRSSAFD
C9 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFD
C10 TIKLYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFD
***:************* *******:** *:**********:***. *
C1 IFGQNRYDASKSYFFSKTA
C2 IFGQNRYDASKSYFFSKTA
C3 IFGQNRYDASKSYFFSKTA
C4 IFGKNRYDASKSYFFSKTT
C5 IFGKNRYDASKSYFFSKTT
C6 IFGKNRYDASKSYFFSKTT
C7 IFGQNRYDASKSYFFSKTA
C8 IFGQNRYDASKSYFFSKTA
C9 IFGQNRYDASKSYFFSKTA
C10 IFGQNRYDASKSYFFSKTA
***:**************:
-- Starting log on Wed Oct 26 22:52:39 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=10, Len=119
C1 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C2 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C3 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C5 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C6 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C7 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C8 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C9 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C10 MDYVSLLNQFWQKQIKFYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
**************** ****.****************************
C1 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C2 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C3 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C4 TIKFYEYSAQATECTKALAKQDAARIICQQLQAAGLLNGMELQFRSCFAD
C5 TIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFAD
C6 TIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFAD
C7 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C8 TIKFYEYSAQATECTKASAKQDAARLICQQLQAAGLLNGMELRFRSSAFD
C9 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFD
C10 TIKLYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFD
***:************* *******:** *:**********:***. *
C1 IFGQNRYDASKSYFFSKTA
C2 IFGQNRYDASKSYFFSKTA
C3 IFGQNRYDASKSYFFSKTA
C4 IFGKNRYDASKSYFFSKTT
C5 IFGKNRYDASKSYFFSKTT
C6 IFGKNRYDASKSYFFSKTT
C7 IFGQNRYDASKSYFFSKTA
C8 IFGQNRYDASKSYFFSKTA
C9 IFGQNRYDASKSYFFSKTA
C10 IFGQNRYDASKSYFFSKTA
***:**************:
-- Starting log on Wed Oct 26 23:09:31 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/gapped_alignment/fubar,B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 10 taxa and 357 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C10
Taxon 3 -> C2
Taxon 4 -> C3
Taxon 5 -> C4
Taxon 6 -> C5
Taxon 7 -> C6
Taxon 8 -> C7
Taxon 9 -> C8
Taxon 10 -> C9
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666825773
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 91487799
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1426307477
Seed = 1374467779
Swapseed = 1666825773
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 11 unique site patterns
Division 2 has 12 unique site patterns
Division 3 has 16 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1049.497040 -- 35.653401
Chain 2 -- -1060.939564 -- 35.653401
Chain 3 -- -1082.784436 -- 35.653401
Chain 4 -- -1055.799409 -- 35.653401
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -971.587365 -- 35.653401
Chain 2 -- -1053.615027 -- 35.653401
Chain 3 -- -832.328779 -- 35.653401
Chain 4 -- -1080.859548 -- 35.653401
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1049.497] (-1060.940) (-1082.784) (-1055.799) * [-971.587] (-1053.615) (-832.329) (-1080.860)
1000 -- (-717.243) [-716.177] (-714.733) (-730.290) * (-720.698) [-710.990] (-717.732) (-715.417) -- 0:16:39
2000 -- (-715.116) (-722.979) [-714.578] (-712.180) * (-717.161) [-709.351] (-706.058) (-713.064) -- 0:08:19
3000 -- [-711.303] (-711.407) (-722.306) (-710.625) * (-713.135) [-708.162] (-714.073) (-711.193) -- 0:05:32
4000 -- [-711.495] (-722.769) (-713.141) (-714.681) * [-715.847] (-713.132) (-710.547) (-705.043) -- 0:04:09
5000 -- (-707.175) (-709.941) (-708.516) [-702.302] * (-707.799) (-708.134) [-710.396] (-706.102) -- 0:06:38
Average standard deviation of split frequencies: 0.058926
6000 -- [-709.260] (-706.831) (-711.793) (-720.090) * [-708.315] (-710.070) (-711.755) (-720.292) -- 0:05:31
7000 -- [-710.879] (-711.217) (-710.195) (-716.246) * [-709.273] (-707.477) (-717.003) (-714.875) -- 0:04:43
8000 -- (-713.279) (-709.449) (-716.447) [-711.192] * (-714.336) (-709.243) (-713.414) [-709.950] -- 0:04:08
9000 -- (-714.498) (-715.323) (-710.741) [-713.589] * (-712.110) (-704.004) (-710.312) [-706.377] -- 0:05:30
10000 -- [-713.453] (-712.966) (-712.909) (-712.925) * (-703.743) (-708.150) (-714.787) [-703.146] -- 0:04:57
Average standard deviation of split frequencies: 0.070711
11000 -- (-715.046) [-714.079] (-707.119) (-714.000) * (-709.994) [-709.188] (-701.276) (-704.698) -- 0:04:29
12000 -- [-712.554] (-715.163) (-717.999) (-711.365) * (-714.227) [-704.677] (-706.404) (-720.318) -- 0:04:07
13000 -- (-711.685) [-700.775] (-710.851) (-711.909) * [-716.472] (-708.918) (-708.371) (-712.486) -- 0:03:47
14000 -- (-711.948) (-707.334) [-705.732] (-710.573) * [-709.349] (-708.061) (-710.654) (-708.141) -- 0:04:41
15000 -- (-703.793) [-705.230] (-711.133) (-706.775) * (-713.789) (-712.462) [-708.230] (-707.961) -- 0:04:22
Average standard deviation of split frequencies: 0.047140
16000 -- (-712.439) (-709.699) [-712.242] (-709.231) * [-712.639] (-719.437) (-707.617) (-709.748) -- 0:04:06
17000 -- [-711.685] (-702.478) (-710.302) (-714.846) * (-717.657) (-715.464) (-716.899) [-702.028] -- 0:03:51
18000 -- [-707.028] (-714.125) (-703.138) (-714.267) * (-708.221) (-712.157) (-708.866) [-709.891] -- 0:04:32
19000 -- [-703.383] (-706.578) (-714.405) (-714.443) * [-703.935] (-713.038) (-715.264) (-714.652) -- 0:04:18
20000 -- (-702.552) [-713.994] (-718.528) (-711.500) * (-708.162) [-699.315] (-704.190) (-709.158) -- 0:04:05
Average standard deviation of split frequencies: 0.062347
21000 -- [-702.605] (-709.409) (-707.862) (-725.793) * (-705.840) [-698.728] (-704.938) (-715.698) -- 0:03:53
22000 -- (-700.706) (-723.078) [-703.467] (-704.577) * (-710.079) (-707.320) [-703.727] (-706.330) -- 0:03:42
23000 -- (-709.094) [-709.494] (-704.060) (-703.759) * [-702.418] (-705.409) (-704.771) (-704.621) -- 0:04:14
24000 -- (-703.716) [-718.583] (-708.547) (-715.402) * [-708.445] (-710.374) (-712.005) (-710.573) -- 0:04:04
25000 -- (-714.812) (-719.018) (-716.200) [-704.470] * (-712.741) (-706.741) (-706.937) [-705.243] -- 0:03:54
Average standard deviation of split frequencies: 0.054393
26000 -- (-710.661) (-707.932) (-713.974) [-710.148] * (-720.144) (-704.642) [-711.802] (-703.346) -- 0:03:44
27000 -- [-701.344] (-716.489) (-717.740) (-714.148) * (-722.223) (-711.235) (-703.961) [-706.958] -- 0:04:12
28000 -- [-707.145] (-709.151) (-713.738) (-710.952) * (-713.873) (-707.580) (-704.900) [-704.351] -- 0:04:03
29000 -- (-707.028) (-704.128) (-719.489) [-703.452] * (-711.031) [-705.806] (-712.451) (-712.105) -- 0:03:54
30000 -- (-720.930) [-710.474] (-718.789) (-707.235) * (-720.454) (-721.081) (-718.164) [-710.133] -- 0:03:46
Average standard deviation of split frequencies: 0.039967
31000 -- (-716.478) (-709.465) (-716.788) [-707.011] * (-716.515) [-706.393] (-709.784) (-717.286) -- 0:04:10
32000 -- [-708.844] (-713.297) (-708.047) (-715.617) * (-721.993) [-707.882] (-711.189) (-713.933) -- 0:04:02
33000 -- (-712.883) (-715.702) (-707.344) [-709.735] * (-712.444) (-710.410) [-705.604] (-713.312) -- 0:03:54
34000 -- (-711.343) [-709.706] (-708.708) (-716.101) * (-710.502) (-713.606) [-712.733] (-701.592) -- 0:03:47
35000 -- (-713.732) (-713.754) (-710.408) [-708.984] * (-705.027) (-711.670) (-713.191) [-707.252] -- 0:03:40
Average standard deviation of split frequencies: 0.035792
36000 -- (-707.400) (-706.073) [-701.494] (-712.584) * (-703.894) (-710.821) (-711.133) [-708.962] -- 0:04:01
37000 -- (-715.237) (-699.790) (-705.417) [-705.612] * [-706.193] (-721.972) (-708.265) (-707.816) -- 0:03:54
38000 -- (-707.648) (-705.481) (-705.042) [-707.098] * (-707.983) (-714.312) [-706.761] (-709.023) -- 0:03:47
39000 -- (-709.714) (-700.851) [-702.120] (-710.255) * (-708.068) [-705.230] (-705.645) (-708.408) -- 0:03:41
40000 -- (-707.893) (-708.221) [-703.792] (-711.634) * (-709.352) (-706.165) [-710.385] (-701.328) -- 0:04:00
Average standard deviation of split frequencies: 0.030139
41000 -- (-703.933) (-705.925) (-709.733) [-701.893] * [-717.047] (-712.286) (-717.810) (-704.592) -- 0:03:53
42000 -- [-704.826] (-710.502) (-710.698) (-710.880) * (-707.825) (-704.845) (-709.226) [-699.474] -- 0:03:48
43000 -- (-704.936) (-714.969) [-709.970] (-706.914) * (-713.282) (-711.571) (-712.623) [-706.259] -- 0:03:42
44000 -- (-716.008) (-709.931) [-709.257] (-709.801) * (-706.386) (-701.860) (-712.191) [-718.811] -- 0:03:59
45000 -- (-718.295) (-708.682) (-720.702) [-700.297] * (-709.784) (-706.257) (-712.560) [-703.512] -- 0:03:53
Average standard deviation of split frequencies: 0.019813
46000 -- (-717.046) [-705.363] (-721.569) (-708.449) * (-720.569) (-712.950) (-712.037) [-707.765] -- 0:03:48
47000 -- [-706.825] (-704.376) (-708.166) (-710.130) * (-707.139) [-711.317] (-710.417) (-716.318) -- 0:03:43
48000 -- (-711.674) (-710.763) [-706.581] (-712.673) * (-706.734) (-717.417) [-707.835] (-706.781) -- 0:03:38
49000 -- (-717.339) (-704.455) (-706.949) [-710.917] * [-702.758] (-716.020) (-713.118) (-711.382) -- 0:03:52
50000 -- (-721.769) (-712.139) (-712.209) [-710.007] * (-712.406) (-715.894) (-712.199) [-715.962] -- 0:03:48
Average standard deviation of split frequencies: 0.019849
51000 -- (-709.431) [-700.816] (-707.472) (-716.050) * (-707.157) [-705.617] (-708.992) (-708.248) -- 0:03:43
52000 -- (-704.330) (-711.864) (-714.149) [-707.774] * [-704.018] (-713.671) (-700.586) (-714.417) -- 0:03:38
53000 -- (-710.955) (-712.733) (-712.955) [-711.386] * [-702.221] (-708.767) (-720.578) (-723.103) -- 0:03:52
54000 -- [-705.691] (-702.804) (-705.581) (-717.739) * [-708.474] (-702.555) (-706.771) (-712.783) -- 0:03:47
55000 -- (-710.400) [-708.893] (-711.057) (-707.912) * (-709.745) (-706.426) [-705.895] (-708.620) -- 0:03:43
Average standard deviation of split frequencies: 0.015152
56000 -- (-708.292) (-703.118) [-713.200] (-711.805) * [-711.153] (-713.289) (-710.908) (-721.146) -- 0:03:39
57000 -- (-708.206) [-701.872] (-712.494) (-715.333) * (-713.208) (-714.441) (-708.880) [-710.279] -- 0:03:51
58000 -- (-723.006) (-716.819) (-715.528) [-704.745] * (-714.680) (-715.338) [-705.040] (-710.915) -- 0:03:47
59000 -- (-713.614) [-708.505] (-721.408) (-722.173) * (-718.646) [-712.549] (-704.320) (-714.055) -- 0:03:43
60000 -- (-713.392) [-711.191] (-715.757) (-703.919) * [-704.594] (-715.016) (-708.645) (-708.602) -- 0:03:39
Average standard deviation of split frequencies: 0.014505
61000 -- (-713.515) [-710.758] (-717.814) (-710.863) * [-702.172] (-705.768) (-712.970) (-704.550) -- 0:03:50
62000 -- (-716.688) (-709.751) [-713.886] (-710.725) * [-703.697] (-715.277) (-704.661) (-723.912) -- 0:03:46
63000 -- (-707.398) (-721.661) [-715.859] (-708.164) * (-706.789) (-708.656) [-705.961] (-714.622) -- 0:03:43
64000 -- [-703.196] (-709.710) (-716.704) (-704.421) * (-708.248) (-715.284) (-714.745) [-703.822] -- 0:03:39
65000 -- [-710.158] (-720.917) (-724.102) (-702.896) * [-704.712] (-703.917) (-707.737) (-709.025) -- 0:03:35
Average standard deviation of split frequencies: 0.014285
66000 -- (-717.185) (-720.118) [-713.635] (-707.982) * (-707.012) [-704.808] (-705.154) (-708.423) -- 0:03:46
67000 -- (-714.175) [-711.116] (-714.532) (-717.564) * [-704.317] (-711.121) (-702.517) (-713.057) -- 0:03:42
68000 -- (-704.855) [-716.239] (-711.377) (-711.973) * (-714.987) [-708.689] (-711.237) (-719.663) -- 0:03:39
69000 -- [-706.390] (-708.129) (-718.448) (-710.512) * (-698.705) (-719.634) [-702.642] (-714.782) -- 0:03:35
70000 -- (-712.764) (-719.683) (-710.520) [-706.106] * (-708.762) (-717.142) [-704.254] (-701.202) -- 0:03:45
Average standard deviation of split frequencies: 0.012897
71000 -- (-705.059) [-706.475] (-710.363) (-713.768) * [-704.012] (-712.754) (-703.870) (-711.192) -- 0:03:42
72000 -- (-710.921) (-714.110) (-719.583) [-706.938] * [-707.280] (-706.842) (-710.887) (-714.532) -- 0:03:39
73000 -- (-708.530) (-716.453) (-708.848) [-706.858] * (-711.451) (-719.871) [-704.468] (-709.339) -- 0:03:35
74000 -- (-712.440) [-717.747] (-712.302) (-717.601) * [-708.442] (-715.177) (-715.008) (-707.628) -- 0:03:45
75000 -- (-714.547) (-710.910) (-713.052) [-704.861] * (-710.309) [-719.051] (-714.478) (-713.639) -- 0:03:42
Average standard deviation of split frequencies: 0.014886
76000 -- (-705.979) [-713.415] (-707.023) (-711.477) * (-709.613) (-710.801) [-713.012] (-714.493) -- 0:03:38
77000 -- (-721.985) (-706.820) [-712.110] (-710.724) * (-714.617) (-709.970) [-708.272] (-707.865) -- 0:03:35
78000 -- (-718.764) (-712.137) [-706.588] (-710.799) * [-711.877] (-706.121) (-717.005) (-707.744) -- 0:03:44
79000 -- [-703.165] (-713.268) (-714.162) (-716.508) * (-717.513) (-705.390) [-706.746] (-710.204) -- 0:03:41
80000 -- (-709.715) (-715.713) [-703.874] (-708.762) * [-710.364] (-713.626) (-707.340) (-709.938) -- 0:03:38
Average standard deviation of split frequencies: 0.014415
81000 -- (-708.466) (-710.223) [-701.082] (-711.446) * (-703.511) (-713.765) (-702.778) [-706.426] -- 0:03:35
82000 -- (-709.610) (-707.613) [-705.415] (-709.598) * [-710.389] (-709.522) (-711.450) (-712.532) -- 0:03:43
83000 -- (-716.347) [-709.469] (-703.925) (-718.013) * (-723.575) (-707.910) (-714.096) [-704.120] -- 0:03:40
84000 -- (-720.647) [-710.851] (-714.004) (-705.460) * (-724.449) (-713.473) (-709.433) [-710.116] -- 0:03:38
85000 -- (-711.532) (-708.748) (-705.355) [-710.931] * (-707.603) (-715.223) (-707.020) [-709.364] -- 0:03:35
Average standard deviation of split frequencies: 0.016079
86000 -- (-713.067) [-708.886] (-713.484) (-706.278) * [-702.400] (-718.377) (-712.072) (-709.180) -- 0:03:32
87000 -- (-719.440) [-706.344] (-707.867) (-710.686) * (-714.438) (-713.988) (-709.213) [-707.481] -- 0:03:40
88000 -- (-704.957) [-712.989] (-713.708) (-718.384) * (-710.182) (-710.063) (-701.723) [-704.591] -- 0:03:37
89000 -- (-716.190) [-709.365] (-707.897) (-711.401) * (-707.733) (-708.750) (-707.684) [-711.144] -- 0:03:34
90000 -- (-717.016) (-712.843) [-711.917] (-714.190) * (-712.912) (-716.542) [-710.404] (-713.214) -- 0:03:32
Average standard deviation of split frequencies: 0.016638
91000 -- (-713.786) (-709.674) (-706.367) [-717.792] * (-712.305) (-719.998) [-706.160] (-705.586) -- 0:03:39
92000 -- (-713.153) [-702.915] (-713.200) (-716.957) * [-710.690] (-714.293) (-706.196) (-708.363) -- 0:03:37
93000 -- (-721.930) [-711.641] (-714.724) (-706.174) * (-710.371) [-705.003] (-716.328) (-709.382) -- 0:03:34
94000 -- [-703.964] (-720.227) (-714.438) (-705.900) * (-713.433) (-709.724) (-708.098) [-706.246] -- 0:03:32
95000 -- (-713.446) (-713.492) (-709.491) [-708.788] * (-704.799) (-707.223) [-706.302] (-709.626) -- 0:03:29
Average standard deviation of split frequencies: 0.017023
96000 -- [-705.545] (-718.439) (-710.716) (-709.100) * (-710.463) (-711.176) [-702.661] (-710.161) -- 0:03:36
97000 -- (-707.653) [-705.768] (-709.761) (-710.415) * (-710.963) [-707.766] (-705.863) (-706.145) -- 0:03:34
98000 -- (-711.150) [-706.373] (-716.181) (-709.768) * (-711.166) [-710.165] (-706.464) (-712.207) -- 0:03:31
99000 -- (-710.985) (-711.510) [-708.616] (-707.677) * (-707.229) [-701.873] (-710.929) (-722.494) -- 0:03:29
100000 -- [-708.546] (-708.049) (-711.080) (-710.653) * [-707.221] (-708.639) (-708.855) (-707.709) -- 0:03:36
Average standard deviation of split frequencies: 0.016546
101000 -- (-710.217) (-718.241) (-704.106) [-712.106] * [-703.125] (-706.323) (-713.286) (-711.080) -- 0:03:33
102000 -- (-709.735) (-710.800) [-700.636] (-703.164) * [-711.554] (-713.939) (-719.079) (-717.606) -- 0:03:31
103000 -- [-705.700] (-715.964) (-700.810) (-709.466) * [-707.752] (-704.485) (-710.736) (-704.896) -- 0:03:29
104000 -- (-703.574) (-711.811) (-708.340) [-711.460] * (-713.057) [-714.373] (-718.068) (-706.563) -- 0:03:26
105000 -- (-708.092) (-710.063) [-709.840] (-716.352) * (-716.900) [-711.708] (-708.465) (-712.933) -- 0:03:33
Average standard deviation of split frequencies: 0.013342
106000 -- (-709.314) [-707.240] (-706.783) (-710.030) * (-710.153) (-719.342) [-711.410] (-706.594) -- 0:03:30
107000 -- (-704.614) [-704.672] (-712.435) (-707.012) * (-713.932) [-703.631] (-717.977) (-700.685) -- 0:03:28
108000 -- [-703.964] (-707.859) (-712.771) (-704.148) * (-721.264) (-709.704) (-707.821) [-707.007] -- 0:03:26
109000 -- [-700.710] (-714.425) (-710.840) (-718.926) * (-706.254) (-709.910) (-710.850) [-708.661] -- 0:03:32
110000 -- [-705.940] (-711.544) (-709.434) (-710.761) * (-714.217) (-702.370) (-706.607) [-704.347] -- 0:03:30
Average standard deviation of split frequencies: 0.013631
111000 -- (-705.422) (-708.582) [-717.420] (-708.638) * (-709.143) [-699.866] (-716.922) (-702.443) -- 0:03:28
112000 -- [-706.805] (-709.589) (-712.853) (-705.339) * (-705.468) (-704.854) [-705.129] (-717.568) -- 0:03:26
113000 -- [-704.284] (-718.038) (-712.389) (-711.782) * (-706.484) (-704.012) [-708.230] (-709.949) -- 0:03:31
114000 -- (-711.043) (-715.514) [-702.277] (-707.835) * (-707.311) [-703.336] (-706.611) (-707.334) -- 0:03:29
115000 -- (-708.010) [-706.516] (-705.248) (-707.544) * (-705.777) (-717.691) (-705.807) [-702.785] -- 0:03:27
Average standard deviation of split frequencies: 0.014630
116000 -- (-713.492) (-711.535) (-704.731) [-710.656] * (-709.292) (-711.675) (-711.582) [-704.728] -- 0:03:25
117000 -- (-713.404) (-717.744) (-711.861) [-714.870] * (-710.559) [-708.945] (-710.952) (-717.765) -- 0:03:23
118000 -- (-706.320) (-723.075) [-705.229] (-711.567) * (-702.301) [-705.034] (-712.209) (-704.630) -- 0:03:29
119000 -- (-708.067) (-710.428) [-709.305] (-704.766) * (-708.754) (-705.904) (-720.362) [-706.016] -- 0:03:27
120000 -- [-713.794] (-717.908) (-707.338) (-714.299) * [-703.303] (-710.584) (-724.207) (-710.917) -- 0:03:25
Average standard deviation of split frequencies: 0.013283
121000 -- (-719.939) (-720.498) [-713.352] (-714.146) * (-712.198) (-708.752) (-702.436) [-709.005] -- 0:03:23
122000 -- [-707.385] (-720.142) (-714.793) (-712.611) * (-712.059) (-709.150) (-715.182) [-705.956] -- 0:03:28
123000 -- [-707.349] (-714.814) (-715.007) (-710.003) * [-705.049] (-722.117) (-711.820) (-711.404) -- 0:03:26
124000 -- (-709.509) [-721.219] (-712.472) (-705.165) * (-710.131) (-713.927) [-711.753] (-716.718) -- 0:03:24
125000 -- [-702.968] (-716.434) (-708.232) (-710.100) * (-709.480) [-706.762] (-711.435) (-717.412) -- 0:03:23
Average standard deviation of split frequencies: 0.015713
126000 -- (-709.194) (-711.093) (-708.189) [-706.448] * (-715.469) (-718.128) [-700.773] (-713.254) -- 0:03:21
127000 -- [-711.155] (-706.975) (-705.852) (-716.200) * [-704.370] (-719.467) (-712.295) (-714.041) -- 0:03:26
128000 -- [-706.480] (-705.670) (-712.676) (-712.080) * [-708.459] (-717.675) (-716.358) (-712.636) -- 0:03:24
129000 -- [-710.823] (-714.052) (-705.633) (-715.312) * [-703.375] (-713.983) (-713.129) (-706.458) -- 0:03:22
130000 -- [-707.599] (-713.371) (-706.377) (-712.257) * [-706.725] (-709.888) (-705.797) (-723.031) -- 0:03:20
Average standard deviation of split frequencies: 0.014912
131000 -- [-706.087] (-713.182) (-715.107) (-705.937) * (-707.096) (-711.001) (-715.161) [-704.968] -- 0:03:25
132000 -- [-704.655] (-697.298) (-708.148) (-713.412) * (-707.202) (-713.780) [-712.300] (-722.540) -- 0:03:23
133000 -- (-707.504) (-704.352) (-708.479) [-710.137] * (-710.226) [-710.334] (-711.229) (-705.243) -- 0:03:22
134000 -- [-705.841] (-704.323) (-707.962) (-709.934) * [-707.715] (-705.985) (-706.047) (-714.544) -- 0:03:20
135000 -- [-709.345] (-701.922) (-715.021) (-707.059) * (-709.826) (-716.512) (-717.193) [-705.701] -- 0:03:25
Average standard deviation of split frequencies: 0.013865
136000 -- (-709.612) (-714.783) [-705.978] (-712.597) * (-708.187) [-709.161] (-712.256) (-706.690) -- 0:03:23
137000 -- (-714.772) [-708.612] (-707.917) (-713.585) * (-703.638) (-714.306) (-719.214) [-705.234] -- 0:03:21
138000 -- (-708.098) (-715.144) [-701.690] (-713.341) * (-707.517) (-723.267) [-712.030] (-717.049) -- 0:03:19
139000 -- (-712.676) [-707.163] (-702.554) (-707.958) * (-717.100) (-714.147) [-713.752] (-715.906) -- 0:03:18
140000 -- (-701.779) (-704.177) [-712.329] (-709.610) * (-715.332) [-709.610] (-707.623) (-713.697) -- 0:03:22
Average standard deviation of split frequencies: 0.012735
141000 -- [-711.387] (-704.693) (-705.676) (-710.339) * [-700.703] (-715.280) (-709.427) (-707.178) -- 0:03:21
142000 -- (-716.485) (-711.920) (-715.431) [-707.161] * [-704.051] (-705.916) (-711.387) (-708.626) -- 0:03:19
143000 -- (-715.769) [-711.442] (-701.228) (-706.408) * [-704.114] (-714.451) (-702.421) (-717.860) -- 0:03:17
144000 -- (-708.932) [-706.005] (-704.805) (-713.940) * [-705.016] (-709.232) (-706.471) (-707.311) -- 0:03:22
145000 -- [-715.414] (-702.949) (-708.524) (-714.452) * (-707.302) [-710.631] (-708.116) (-707.738) -- 0:03:20
Average standard deviation of split frequencies: 0.015283
146000 -- (-715.121) (-714.264) [-708.027] (-716.838) * (-701.369) (-714.057) (-711.884) [-704.865] -- 0:03:18
147000 -- (-717.015) (-708.194) (-705.139) [-710.097] * (-700.983) (-717.385) [-706.986] (-708.822) -- 0:03:17
148000 -- (-716.369) (-713.252) (-710.502) [-699.712] * (-706.308) [-716.019] (-711.934) (-707.441) -- 0:03:15
149000 -- (-720.496) [-707.216] (-706.726) (-707.602) * (-705.270) (-709.215) [-704.692] (-704.542) -- 0:03:19
150000 -- (-717.437) (-716.532) [-707.171] (-713.326) * [-711.879] (-708.771) (-711.102) (-710.059) -- 0:03:18
Average standard deviation of split frequencies: 0.015227
151000 -- (-722.085) (-718.534) [-713.429] (-709.250) * (-709.228) (-712.405) [-709.255] (-714.674) -- 0:03:16
152000 -- (-723.319) (-710.894) [-709.122] (-707.490) * [-707.968] (-717.577) (-728.184) (-719.260) -- 0:03:15
153000 -- (-713.422) [-709.839] (-715.399) (-707.902) * (-720.865) (-716.415) (-716.070) [-709.198] -- 0:03:19
154000 -- (-703.896) (-707.159) (-706.633) [-707.248] * [-710.285] (-712.117) (-709.379) (-713.890) -- 0:03:17
155000 -- [-708.587] (-703.601) (-709.943) (-705.312) * (-714.438) [-709.093] (-723.504) (-715.584) -- 0:03:16
Average standard deviation of split frequencies: 0.015512
156000 -- (-706.736) (-708.510) [-705.411] (-717.784) * (-714.426) (-710.242) [-712.352] (-715.301) -- 0:03:14
157000 -- (-708.070) (-715.429) (-715.426) [-708.420] * (-709.432) (-709.246) [-706.472] (-716.396) -- 0:03:18
158000 -- (-708.370) (-712.530) (-713.837) [-707.060] * (-705.308) (-705.992) (-711.166) [-710.895] -- 0:03:17
159000 -- (-712.460) (-708.666) [-705.757] (-716.119) * (-710.781) (-715.989) [-705.502] (-715.389) -- 0:03:15
160000 -- (-708.053) (-703.637) [-709.408] (-721.092) * (-711.119) [-710.356] (-711.517) (-707.471) -- 0:03:14
Average standard deviation of split frequencies: 0.017604
161000 -- (-704.812) [-700.787] (-705.157) (-709.973) * (-708.472) [-702.298] (-716.846) (-706.074) -- 0:03:12
162000 -- [-705.973] (-713.805) (-718.585) (-711.852) * (-709.715) (-710.656) (-709.863) [-707.486] -- 0:03:16
163000 -- (-705.008) (-713.100) [-704.611] (-711.093) * (-707.274) (-702.527) (-706.937) [-710.288] -- 0:03:15
164000 -- (-713.006) (-704.824) (-714.598) [-703.055] * (-709.091) (-710.171) (-719.031) [-702.909] -- 0:03:13
165000 -- [-708.042] (-703.871) (-707.340) (-708.057) * [-707.972] (-709.830) (-712.042) (-715.476) -- 0:03:12
Average standard deviation of split frequencies: 0.014956
166000 -- (-703.309) (-706.195) (-709.321) [-709.194] * [-708.137] (-709.326) (-716.469) (-708.714) -- 0:03:15
167000 -- (-710.633) [-705.073] (-710.410) (-713.295) * (-719.197) (-706.832) (-709.772) [-709.047] -- 0:03:14
168000 -- (-710.124) (-711.338) [-708.079] (-710.120) * (-714.080) (-721.827) (-708.723) [-699.995] -- 0:03:13
169000 -- (-714.950) (-704.849) (-708.113) [-709.389] * (-717.186) (-716.581) [-705.816] (-707.573) -- 0:03:11
170000 -- [-710.517] (-706.162) (-707.281) (-711.692) * (-707.447) (-715.418) [-702.808] (-708.270) -- 0:03:15
Average standard deviation of split frequencies: 0.011601
171000 -- (-713.245) (-707.915) [-704.104] (-710.459) * (-719.474) (-707.486) (-707.058) [-709.821] -- 0:03:13
172000 -- (-712.768) (-714.594) (-705.018) [-706.864] * (-712.115) [-711.348] (-713.082) (-712.512) -- 0:03:12
173000 -- (-713.152) [-711.688] (-703.696) (-718.098) * (-711.818) (-708.713) [-707.396] (-706.368) -- 0:03:11
174000 -- (-712.112) (-709.694) [-702.542] (-705.840) * (-715.314) (-710.105) (-707.588) [-702.376] -- 0:03:09
175000 -- (-711.601) (-706.527) (-707.065) [-706.972] * (-713.421) (-707.298) [-710.669] (-703.580) -- 0:03:13
Average standard deviation of split frequencies: 0.012499
176000 -- (-707.178) (-711.966) [-707.281] (-706.609) * (-707.673) (-712.502) (-710.006) [-710.034] -- 0:03:11
177000 -- [-708.269] (-715.691) (-715.295) (-710.512) * [-710.875] (-722.565) (-709.435) (-704.810) -- 0:03:10
178000 -- (-711.338) (-707.740) [-704.183] (-707.438) * (-702.394) (-724.453) [-705.196] (-714.666) -- 0:03:09
179000 -- (-713.002) (-712.617) (-704.313) [-712.385] * [-704.537] (-709.108) (-715.547) (-709.333) -- 0:03:12
180000 -- (-710.685) (-721.989) (-709.319) [-707.820] * [-713.638] (-707.590) (-715.095) (-715.284) -- 0:03:11
Average standard deviation of split frequencies: 0.012350
181000 -- (-708.789) (-704.533) [-708.073] (-713.887) * (-712.676) [-704.527] (-707.324) (-716.880) -- 0:03:10
182000 -- (-710.757) (-710.911) [-706.103] (-704.172) * (-714.183) [-713.221] (-706.580) (-710.721) -- 0:03:08
183000 -- (-714.724) (-715.289) (-714.359) [-704.226] * (-710.744) [-712.850] (-708.159) (-715.981) -- 0:03:07
184000 -- (-717.500) (-706.462) [-710.980] (-711.588) * (-717.209) (-706.510) (-702.470) [-708.356] -- 0:03:10
185000 -- (-707.505) (-714.380) [-712.154] (-713.967) * (-716.193) (-706.276) [-705.653] (-703.194) -- 0:03:09
Average standard deviation of split frequencies: 0.012841
186000 -- (-712.139) (-719.131) [-713.224] (-714.978) * (-710.928) (-712.656) [-713.424] (-714.894) -- 0:03:08
187000 -- (-704.536) (-719.951) [-712.149] (-700.051) * (-706.775) (-714.393) (-713.526) [-700.366] -- 0:03:06
188000 -- [-705.208] (-706.602) (-710.524) (-715.101) * (-716.803) (-722.260) (-708.856) [-706.739] -- 0:03:10
189000 -- [-703.856] (-706.039) (-705.553) (-711.403) * (-709.290) [-710.168] (-711.008) (-706.349) -- 0:03:08
190000 -- (-702.553) [-708.103] (-710.268) (-711.842) * [-704.982] (-717.834) (-705.360) (-716.354) -- 0:03:07
Average standard deviation of split frequencies: 0.010714
191000 -- (-704.535) (-702.212) (-701.590) [-710.101] * (-713.573) (-717.448) [-706.863] (-710.759) -- 0:03:06
192000 -- (-714.081) (-711.985) [-704.982] (-710.793) * [-704.361] (-714.126) (-706.021) (-709.141) -- 0:03:09
193000 -- (-709.599) (-702.565) (-709.529) [-707.241] * (-703.002) (-720.235) [-705.655] (-707.594) -- 0:03:08
194000 -- (-709.002) (-710.819) [-699.031] (-715.608) * [-705.216] (-717.637) (-716.835) (-708.978) -- 0:03:06
195000 -- (-711.598) [-700.328] (-713.443) (-711.980) * [-704.745] (-729.297) (-710.731) (-705.928) -- 0:03:05
Average standard deviation of split frequencies: 0.011064
196000 -- (-709.437) (-708.173) (-715.849) [-711.360] * (-707.793) [-708.109] (-717.939) (-709.864) -- 0:03:04
197000 -- [-711.579] (-712.780) (-703.315) (-711.477) * (-708.406) (-709.062) (-713.675) [-714.140] -- 0:03:07
198000 -- [-721.112] (-714.502) (-712.429) (-714.412) * (-713.751) [-707.963] (-708.045) (-714.808) -- 0:03:06
199000 -- (-713.847) (-707.922) (-714.939) [-714.137] * (-724.400) (-706.763) (-712.976) [-713.902] -- 0:03:05
200000 -- (-722.156) (-718.211) [-713.973] (-705.896) * (-702.675) [-704.437] (-711.954) (-708.183) -- 0:03:04
Average standard deviation of split frequencies: 0.011120
201000 -- (-712.391) [-710.366] (-718.389) (-706.661) * (-712.267) [-705.448] (-714.975) (-706.372) -- 0:03:06
202000 -- (-713.063) [-705.594] (-715.055) (-707.245) * (-704.577) (-716.109) (-716.254) [-708.092] -- 0:03:05
203000 -- [-706.761] (-709.581) (-707.609) (-712.365) * (-710.017) (-709.965) [-706.082] (-705.296) -- 0:03:04
204000 -- [-707.118] (-714.659) (-708.253) (-710.780) * (-701.331) (-703.165) [-700.321] (-707.150) -- 0:03:03
205000 -- [-709.038] (-714.107) (-708.284) (-725.034) * [-706.392] (-712.543) (-704.835) (-718.675) -- 0:03:06
Average standard deviation of split frequencies: 0.010069
206000 -- [-703.513] (-708.935) (-709.329) (-721.248) * [-704.475] (-709.400) (-709.164) (-726.850) -- 0:03:05
207000 -- (-705.339) (-709.739) (-712.037) [-718.771] * (-704.381) (-711.236) (-709.395) [-705.286] -- 0:03:03
208000 -- (-704.792) (-708.090) (-714.882) [-708.991] * (-709.003) (-705.028) (-706.443) [-706.119] -- 0:03:02
209000 -- [-702.650] (-708.784) (-710.143) (-705.321) * (-704.551) [-714.395] (-710.244) (-707.646) -- 0:03:01
210000 -- [-701.917] (-712.208) (-715.743) (-704.954) * (-708.046) (-715.933) [-714.278] (-713.686) -- 0:03:04
Average standard deviation of split frequencies: 0.010890
211000 -- (-709.096) [-706.920] (-723.631) (-705.058) * (-710.880) [-709.259] (-703.064) (-710.992) -- 0:03:03
212000 -- (-712.108) [-710.350] (-714.926) (-710.651) * [-700.900] (-705.100) (-711.228) (-717.575) -- 0:03:02
213000 -- (-715.150) [-706.004] (-710.900) (-711.746) * [-706.463] (-715.801) (-716.138) (-707.865) -- 0:03:01
214000 -- (-712.443) [-704.695] (-716.770) (-706.879) * [-701.938] (-716.601) (-708.824) (-723.447) -- 0:03:03
215000 -- (-707.482) (-713.702) [-714.921] (-715.368) * [-707.065] (-717.436) (-706.053) (-715.740) -- 0:03:02
Average standard deviation of split frequencies: 0.010039
216000 -- (-709.353) (-714.539) [-713.556] (-705.062) * (-712.124) [-701.650] (-712.365) (-714.886) -- 0:03:01
217000 -- [-711.187] (-715.585) (-709.931) (-712.812) * (-712.659) [-709.973] (-708.228) (-721.764) -- 0:03:00
218000 -- [-707.390] (-714.949) (-716.859) (-704.764) * (-704.579) (-713.229) (-704.999) [-706.735] -- 0:03:02
219000 -- (-710.575) (-705.687) (-716.601) [-706.282] * [-707.749] (-702.840) (-706.626) (-709.694) -- 0:03:01
220000 -- (-710.834) (-711.945) [-707.695] (-713.363) * [-700.590] (-714.672) (-704.848) (-712.418) -- 0:03:00
Average standard deviation of split frequencies: 0.010824
221000 -- (-712.784) (-706.752) (-709.747) [-706.444] * (-708.414) [-717.033] (-714.941) (-709.066) -- 0:02:59
222000 -- (-713.902) (-709.293) [-714.983] (-709.982) * (-707.828) (-711.936) (-710.088) [-708.487] -- 0:02:58
223000 -- (-708.638) (-710.349) (-721.509) [-706.724] * (-708.396) (-708.042) [-708.005] (-716.720) -- 0:03:01
224000 -- [-704.276] (-707.148) (-712.565) (-714.121) * [-709.792] (-705.827) (-711.508) (-710.671) -- 0:03:00
225000 -- [-704.293] (-707.517) (-715.163) (-712.801) * (-702.143) (-712.293) [-706.498] (-713.582) -- 0:02:59
Average standard deviation of split frequencies: 0.010846
226000 -- (-711.062) (-715.626) (-710.486) [-705.468] * (-705.040) (-712.548) (-706.666) [-707.522] -- 0:02:58
227000 -- [-711.607] (-709.851) (-721.386) (-706.547) * (-704.474) (-710.318) (-707.202) [-712.094] -- 0:03:00
228000 -- (-705.955) (-711.148) [-707.677] (-706.670) * (-709.235) (-715.315) (-708.571) [-707.100] -- 0:02:59
229000 -- (-709.192) (-708.030) (-719.787) [-709.339] * (-718.064) (-707.502) [-704.021] (-705.428) -- 0:02:58
230000 -- (-703.823) (-712.848) [-702.498] (-713.297) * [-711.246] (-721.390) (-708.848) (-711.597) -- 0:02:57
Average standard deviation of split frequencies: 0.010491
231000 -- (-707.747) (-712.423) (-713.966) [-708.200] * (-707.445) (-717.247) (-703.353) [-707.633] -- 0:02:59
232000 -- [-708.230] (-716.701) (-705.774) (-705.353) * (-708.598) [-706.833] (-711.647) (-710.341) -- 0:02:58
233000 -- (-708.399) (-706.880) [-707.132] (-708.510) * (-716.153) [-716.708] (-710.044) (-709.246) -- 0:02:57
234000 -- (-715.841) (-717.985) [-710.598] (-711.213) * (-709.615) (-707.605) [-709.534] (-709.657) -- 0:02:56
235000 -- [-706.644] (-712.830) (-708.944) (-715.166) * [-708.737] (-724.838) (-710.660) (-703.314) -- 0:02:55
Average standard deviation of split frequencies: 0.011585
236000 -- (-705.276) (-704.377) [-711.342] (-711.112) * (-703.499) (-706.990) (-703.861) [-711.366] -- 0:02:58
237000 -- [-709.718] (-712.200) (-712.365) (-711.358) * (-709.968) [-698.358] (-710.151) (-707.725) -- 0:02:57
238000 -- (-705.895) [-704.798] (-714.800) (-703.076) * (-709.635) [-713.376] (-706.956) (-706.214) -- 0:02:56
239000 -- (-708.866) (-711.039) [-709.050] (-716.514) * (-710.453) (-706.184) [-702.645] (-710.588) -- 0:02:55
240000 -- (-724.843) (-708.671) (-697.996) [-707.274] * [-708.947] (-709.449) (-708.295) (-712.891) -- 0:02:57
Average standard deviation of split frequencies: 0.012536
241000 -- [-704.113] (-714.682) (-710.176) (-715.213) * (-702.963) [-709.271] (-708.033) (-712.057) -- 0:02:56
242000 -- (-703.904) (-710.226) [-705.151] (-708.751) * [-706.710] (-706.815) (-710.389) (-711.132) -- 0:02:55
243000 -- (-712.937) (-708.152) (-712.081) [-713.092] * (-718.321) (-715.612) [-706.005] (-709.340) -- 0:02:54
244000 -- (-708.826) (-713.519) [-704.896] (-707.902) * (-720.523) (-706.846) (-714.320) [-716.133] -- 0:02:56
245000 -- [-705.439] (-712.924) (-713.544) (-713.663) * (-709.844) (-714.178) [-701.557] (-711.421) -- 0:02:55
Average standard deviation of split frequencies: 0.014308
246000 -- [-710.749] (-710.066) (-717.235) (-712.501) * (-704.513) (-710.409) (-710.560) [-707.281] -- 0:02:54
247000 -- (-712.235) [-703.446] (-706.483) (-716.244) * [-713.056] (-715.209) (-714.081) (-705.681) -- 0:02:53
248000 -- (-712.760) (-702.696) [-713.108] (-706.681) * (-717.577) (-702.350) [-704.301] (-711.418) -- 0:02:52
249000 -- (-703.399) (-716.957) [-709.769] (-712.861) * (-711.033) (-710.846) [-712.781] (-709.784) -- 0:02:54
250000 -- [-705.873] (-711.385) (-721.574) (-712.306) * [-710.406] (-710.073) (-707.402) (-717.333) -- 0:02:54
Average standard deviation of split frequencies: 0.014418
251000 -- (-714.220) (-710.397) (-710.473) [-707.101] * [-712.318] (-705.647) (-708.053) (-710.685) -- 0:02:53
252000 -- (-713.973) (-705.756) (-709.099) [-706.716] * [-701.701] (-703.368) (-708.876) (-705.096) -- 0:02:52
253000 -- (-719.755) (-706.107) (-711.590) [-704.464] * (-705.236) (-701.589) (-711.639) [-700.557] -- 0:02:54
254000 -- (-709.800) (-717.480) (-714.137) [-706.634] * (-708.041) (-706.704) (-719.165) [-704.605] -- 0:02:53
255000 -- (-705.075) (-713.385) (-712.322) [-704.377] * [-708.299] (-708.773) (-709.540) (-703.113) -- 0:02:52
Average standard deviation of split frequencies: 0.014854
256000 -- (-706.241) (-712.304) [-714.859] (-710.395) * (-709.661) (-714.267) (-709.490) [-709.304] -- 0:02:51
257000 -- [-703.486] (-713.327) (-706.357) (-718.905) * (-707.861) [-711.560] (-705.188) (-704.186) -- 0:02:50
258000 -- (-709.927) [-705.954] (-710.964) (-715.456) * [-708.238] (-712.991) (-709.344) (-702.293) -- 0:02:52
259000 -- [-702.164] (-708.391) (-711.907) (-706.315) * (-704.400) (-725.219) (-707.526) [-707.235] -- 0:02:51
260000 -- (-710.432) (-722.293) [-710.654] (-709.515) * (-708.927) (-712.605) (-713.023) [-702.682] -- 0:02:50
Average standard deviation of split frequencies: 0.014829
261000 -- (-713.589) [-708.412] (-705.639) (-716.540) * (-702.158) (-708.216) (-714.972) [-709.065] -- 0:02:49
262000 -- [-711.884] (-719.747) (-708.035) (-709.242) * [-703.347] (-715.413) (-709.206) (-711.552) -- 0:02:51
263000 -- (-707.093) (-711.427) (-708.855) [-703.808] * (-706.536) (-712.092) [-705.690] (-712.632) -- 0:02:50
264000 -- [-707.597] (-708.349) (-703.479) (-712.195) * (-711.897) (-711.461) (-710.326) [-708.937] -- 0:02:50
265000 -- (-712.538) [-710.393] (-711.234) (-714.289) * (-709.209) [-707.566] (-706.182) (-718.273) -- 0:02:49
Average standard deviation of split frequencies: 0.012878
266000 -- [-707.331] (-709.001) (-714.854) (-705.805) * (-714.646) (-701.514) [-713.466] (-712.880) -- 0:02:51
267000 -- (-707.246) (-716.576) [-718.565] (-712.195) * (-710.966) (-717.332) (-712.181) [-709.370] -- 0:02:50
268000 -- (-707.420) (-716.234) [-705.502] (-707.569) * (-704.265) (-707.349) [-710.302] (-713.575) -- 0:02:49
269000 -- [-706.708] (-725.130) (-713.564) (-709.436) * [-702.718] (-709.489) (-704.095) (-704.119) -- 0:02:48
270000 -- (-715.393) (-708.806) [-709.068] (-725.512) * [-708.491] (-709.349) (-708.155) (-711.924) -- 0:02:50
Average standard deviation of split frequencies: 0.012656
271000 -- (-713.805) (-711.911) (-711.215) [-708.316] * (-715.239) [-706.216] (-707.616) (-710.628) -- 0:02:49
272000 -- (-718.484) (-711.213) [-713.405] (-716.216) * [-705.333] (-713.608) (-705.302) (-708.208) -- 0:02:48
273000 -- (-712.302) (-704.982) (-704.782) [-701.513] * (-717.339) [-708.588] (-706.125) (-704.570) -- 0:02:47
274000 -- [-703.886] (-710.980) (-708.425) (-704.845) * (-725.346) (-708.821) [-710.846] (-710.598) -- 0:02:46
275000 -- (-710.451) [-708.129] (-706.184) (-704.713) * (-707.753) [-701.801] (-713.531) (-707.893) -- 0:02:48
Average standard deviation of split frequencies: 0.011614
276000 -- [-712.263] (-705.232) (-707.477) (-706.214) * [-706.319] (-704.635) (-710.315) (-706.203) -- 0:02:47
277000 -- [-710.207] (-705.650) (-717.762) (-715.130) * (-708.773) (-710.043) (-710.914) [-703.727] -- 0:02:47
278000 -- (-714.614) (-711.636) (-712.269) [-708.415] * (-702.344) (-715.837) [-704.362] (-710.464) -- 0:02:46
279000 -- (-706.111) (-712.144) [-712.880] (-709.486) * (-702.278) [-709.931] (-721.848) (-707.036) -- 0:02:47
280000 -- (-706.502) [-706.316] (-718.257) (-706.995) * (-707.951) [-708.144] (-712.443) (-708.333) -- 0:02:47
Average standard deviation of split frequencies: 0.012205
281000 -- (-706.197) [-708.267] (-715.899) (-715.732) * (-720.066) (-706.247) (-717.023) [-704.525] -- 0:02:46
282000 -- [-710.488] (-710.481) (-709.469) (-707.641) * (-708.412) [-705.877] (-715.074) (-726.093) -- 0:02:45
283000 -- (-718.091) [-701.858] (-707.945) (-706.442) * [-705.285] (-714.602) (-709.123) (-717.016) -- 0:02:47
284000 -- [-705.594] (-712.652) (-712.670) (-706.027) * [-706.082] (-716.473) (-711.137) (-722.265) -- 0:02:46
285000 -- (-713.650) [-708.626] (-707.359) (-709.920) * [-707.988] (-711.691) (-702.406) (-719.950) -- 0:02:45
Average standard deviation of split frequencies: 0.011648
286000 -- (-721.573) [-705.016] (-710.109) (-704.212) * [-709.706] (-711.183) (-704.363) (-711.184) -- 0:02:44
287000 -- [-709.331] (-713.612) (-720.107) (-713.813) * (-713.040) (-719.528) (-708.122) [-703.347] -- 0:02:46
288000 -- [-705.898] (-704.285) (-711.251) (-710.208) * (-709.030) (-710.442) (-712.604) [-717.012] -- 0:02:45
289000 -- (-712.431) (-718.162) (-714.791) [-706.281] * (-707.859) [-709.221] (-711.276) (-707.605) -- 0:02:44
290000 -- [-705.666] (-707.894) (-712.984) (-714.027) * (-704.132) (-711.800) (-710.986) [-711.520] -- 0:02:44
Average standard deviation of split frequencies: 0.013515
291000 -- (-716.750) [-710.048] (-712.307) (-706.455) * [-707.292] (-705.441) (-714.878) (-705.452) -- 0:02:43
292000 -- (-714.349) (-710.899) [-713.270] (-708.783) * [-704.513] (-709.574) (-712.039) (-711.351) -- 0:02:44
293000 -- [-703.078] (-729.210) (-714.029) (-708.011) * [-709.955] (-700.958) (-712.296) (-711.560) -- 0:02:44
294000 -- (-712.647) [-709.615] (-714.885) (-707.519) * [-707.541] (-706.220) (-704.239) (-716.221) -- 0:02:43
295000 -- (-707.021) [-716.460] (-712.637) (-714.318) * (-705.265) (-704.773) [-697.663] (-710.821) -- 0:02:42
Average standard deviation of split frequencies: 0.012528
296000 -- (-716.537) [-711.750] (-706.634) (-716.230) * (-712.083) [-706.752] (-712.534) (-710.567) -- 0:02:44
297000 -- [-707.083] (-709.517) (-712.080) (-715.788) * [-712.786] (-705.355) (-710.761) (-714.772) -- 0:02:43
298000 -- (-717.709) [-716.249] (-706.616) (-714.139) * [-707.709] (-714.341) (-699.558) (-701.897) -- 0:02:42
299000 -- (-705.998) (-715.192) (-714.005) [-706.047] * (-703.904) (-713.023) [-709.368] (-708.072) -- 0:02:41
300000 -- (-709.366) (-709.495) [-717.546] (-710.555) * (-709.400) (-715.331) [-700.479] (-707.682) -- 0:02:43
Average standard deviation of split frequencies: 0.012438
301000 -- [-706.632] (-712.325) (-714.119) (-713.413) * (-710.432) (-706.541) (-706.695) [-704.998] -- 0:02:42
302000 -- (-714.366) (-711.486) (-717.157) [-708.230] * (-708.700) [-700.237] (-719.949) (-707.683) -- 0:02:41
303000 -- [-705.885] (-710.582) (-710.733) (-705.445) * (-708.679) [-704.073] (-716.715) (-715.356) -- 0:02:41
304000 -- (-712.774) [-703.515] (-712.439) (-709.645) * [-716.990] (-709.715) (-712.877) (-709.330) -- 0:02:40
305000 -- (-717.070) [-706.613] (-704.458) (-710.885) * [-713.697] (-715.237) (-719.336) (-713.446) -- 0:02:41
Average standard deviation of split frequencies: 0.013043
306000 -- [-712.796] (-719.877) (-706.790) (-711.935) * [-705.005] (-709.894) (-703.405) (-708.282) -- 0:02:41
307000 -- (-709.638) [-705.303] (-711.136) (-708.166) * (-711.662) [-703.518] (-708.181) (-712.070) -- 0:02:40
308000 -- (-708.286) (-727.740) [-702.671] (-710.299) * (-713.421) [-707.631] (-715.534) (-708.876) -- 0:02:39
309000 -- (-708.108) (-713.742) [-709.188] (-715.006) * (-712.541) (-703.597) [-707.331] (-707.675) -- 0:02:41
310000 -- [-707.007] (-712.815) (-711.467) (-702.002) * (-705.490) (-716.375) (-716.029) [-706.799] -- 0:02:40
Average standard deviation of split frequencies: 0.012847
311000 -- [-704.406] (-709.173) (-709.188) (-706.104) * (-715.768) [-710.207] (-717.111) (-710.722) -- 0:02:39
312000 -- (-707.116) (-701.404) (-706.957) [-703.496] * (-710.473) (-705.962) [-706.393] (-711.822) -- 0:02:38
313000 -- (-716.090) (-708.417) (-712.968) [-711.273] * (-709.382) [-705.881] (-703.747) (-720.977) -- 0:02:40
314000 -- (-705.705) [-707.658] (-721.917) (-713.087) * (-714.710) [-705.480] (-709.764) (-721.552) -- 0:02:39
315000 -- [-703.582] (-716.876) (-716.533) (-702.539) * (-712.381) (-715.346) [-712.297] (-712.160) -- 0:02:38
Average standard deviation of split frequencies: 0.012630
316000 -- [-707.004] (-711.051) (-710.509) (-717.700) * (-707.865) (-709.353) [-711.221] (-730.269) -- 0:02:38
317000 -- [-710.448] (-709.278) (-705.609) (-709.916) * (-704.621) (-706.248) (-718.661) [-708.974] -- 0:02:37
318000 -- (-710.333) (-705.932) (-713.737) [-705.457] * (-711.149) (-703.993) (-711.121) [-706.078] -- 0:02:38
319000 -- (-706.048) (-712.597) [-702.894] (-708.283) * (-711.959) [-699.522] (-704.946) (-710.375) -- 0:02:37
320000 -- (-709.415) (-712.708) [-712.894] (-711.976) * (-715.919) (-701.039) [-703.534] (-705.317) -- 0:02:37
Average standard deviation of split frequencies: 0.010977
321000 -- (-708.492) (-708.789) (-710.443) [-714.118] * (-720.913) [-701.949] (-705.570) (-705.767) -- 0:02:36
322000 -- [-706.811] (-707.769) (-708.955) (-706.050) * (-713.446) [-703.990] (-716.475) (-706.903) -- 0:02:37
323000 -- (-709.361) (-708.856) [-712.065] (-712.790) * (-716.212) [-710.337] (-709.282) (-708.667) -- 0:02:37
324000 -- (-709.912) (-708.903) (-717.138) [-710.950] * (-705.167) (-710.596) [-711.798] (-719.764) -- 0:02:36
325000 -- (-702.682) (-709.787) [-706.116] (-711.809) * [-702.923] (-713.022) (-712.430) (-713.018) -- 0:02:35
Average standard deviation of split frequencies: 0.010604
326000 -- [-710.019] (-715.841) (-712.162) (-707.409) * [-713.353] (-724.520) (-720.498) (-709.250) -- 0:02:35
327000 -- (-709.710) [-710.855] (-708.034) (-704.496) * (-701.951) [-712.823] (-708.672) (-707.094) -- 0:02:36
328000 -- (-702.398) (-716.559) (-722.357) [-707.652] * (-703.575) (-720.340) [-708.554] (-711.497) -- 0:02:35
329000 -- (-710.824) [-702.302] (-710.996) (-708.679) * [-704.407] (-715.848) (-710.543) (-714.162) -- 0:02:35
330000 -- [-702.053] (-708.292) (-714.278) (-712.878) * (-706.748) [-714.845] (-708.980) (-711.663) -- 0:02:34
Average standard deviation of split frequencies: 0.010930
331000 -- [-706.970] (-701.449) (-714.752) (-712.795) * (-707.151) (-712.444) [-701.851] (-710.793) -- 0:02:35
332000 -- (-706.980) (-714.398) [-704.974] (-715.435) * (-717.497) [-700.413] (-704.242) (-725.195) -- 0:02:34
333000 -- (-711.719) (-707.500) [-712.371] (-709.917) * (-711.056) (-708.620) (-705.976) [-719.966] -- 0:02:34
334000 -- (-708.464) [-707.036] (-709.958) (-703.514) * (-705.701) (-708.236) [-709.585] (-708.334) -- 0:02:33
335000 -- [-708.981] (-708.390) (-706.963) (-705.492) * [-711.676] (-708.539) (-709.972) (-705.387) -- 0:02:34
Average standard deviation of split frequencies: 0.010850
336000 -- [-703.234] (-709.901) (-712.775) (-704.473) * (-707.211) (-712.030) (-711.368) [-710.258] -- 0:02:34
337000 -- [-704.426] (-711.933) (-698.434) (-709.810) * (-716.418) (-709.373) [-705.988] (-704.111) -- 0:02:33
338000 -- [-705.985] (-712.480) (-709.377) (-719.701) * (-711.541) (-719.016) (-709.248) [-702.710] -- 0:02:32
339000 -- [-708.838] (-712.503) (-707.109) (-709.148) * (-714.251) (-709.981) [-701.003] (-705.723) -- 0:02:34
340000 -- [-704.300] (-715.009) (-709.216) (-719.630) * [-712.999] (-709.305) (-707.444) (-716.143) -- 0:02:33
Average standard deviation of split frequencies: 0.011624
341000 -- (-711.957) [-705.577] (-719.120) (-707.891) * (-712.044) [-711.736] (-706.537) (-711.395) -- 0:02:32
342000 -- (-704.875) (-713.748) [-706.531] (-708.427) * (-709.362) (-715.702) (-709.627) [-710.437] -- 0:02:31
343000 -- [-714.360] (-706.157) (-707.414) (-717.103) * (-708.335) (-713.112) [-708.734] (-706.096) -- 0:02:31
344000 -- (-706.754) (-712.382) [-702.031] (-706.592) * (-704.820) [-712.300] (-709.569) (-705.130) -- 0:02:32
345000 -- (-725.723) (-717.219) [-712.193] (-711.508) * (-704.488) (-702.514) [-702.795] (-714.533) -- 0:02:31
Average standard deviation of split frequencies: 0.011626
346000 -- (-716.453) (-719.749) (-698.591) [-714.514] * (-701.127) (-709.351) (-719.664) [-711.238] -- 0:02:31
347000 -- (-709.213) (-706.113) (-720.636) [-700.000] * (-704.255) (-709.244) (-711.077) [-702.225] -- 0:02:30
348000 -- (-710.383) [-710.814] (-718.233) (-708.792) * (-706.646) (-709.551) (-714.602) [-707.876] -- 0:02:31
349000 -- (-710.921) (-712.890) (-720.481) [-711.218] * (-710.619) [-716.326] (-713.059) (-706.442) -- 0:02:31
350000 -- [-710.739] (-716.574) (-710.839) (-707.224) * [-704.614] (-722.915) (-714.032) (-706.287) -- 0:02:30
Average standard deviation of split frequencies: 0.011651
351000 -- (-717.377) [-708.007] (-710.603) (-717.911) * (-715.822) [-703.877] (-707.475) (-707.192) -- 0:02:29
352000 -- (-702.648) [-708.872] (-711.092) (-708.957) * [-700.998] (-705.705) (-718.733) (-723.997) -- 0:02:30
353000 -- (-709.693) [-706.864] (-715.494) (-710.319) * (-706.753) (-705.211) [-710.796] (-709.722) -- 0:02:30
354000 -- (-712.303) (-719.003) (-715.193) [-714.314] * (-712.489) (-705.032) (-716.840) [-706.292] -- 0:02:29
355000 -- [-705.147] (-711.753) (-716.972) (-704.376) * (-720.543) (-715.460) [-707.348] (-710.948) -- 0:02:28
Average standard deviation of split frequencies: 0.012182
356000 -- (-706.041) [-716.157] (-702.060) (-715.415) * (-707.234) [-702.118] (-714.325) (-717.921) -- 0:02:30
357000 -- (-707.762) [-705.469] (-705.568) (-709.062) * (-716.574) (-712.397) (-711.450) [-705.015] -- 0:02:29
358000 -- (-706.681) (-719.486) [-705.634] (-711.081) * (-708.067) (-706.587) [-702.939] (-713.118) -- 0:02:28
359000 -- [-710.289] (-713.798) (-710.235) (-709.348) * (-712.045) (-704.662) [-702.879] (-708.255) -- 0:02:28
360000 -- [-705.617] (-717.879) (-714.647) (-711.620) * (-712.092) [-705.709] (-714.250) (-706.281) -- 0:02:27
Average standard deviation of split frequencies: 0.013158
361000 -- [-702.194] (-713.347) (-719.584) (-708.018) * (-711.516) [-711.117] (-709.460) (-711.602) -- 0:02:28
362000 -- (-717.930) (-713.061) (-712.140) [-717.712] * [-711.509] (-719.595) (-709.638) (-711.321) -- 0:02:28
363000 -- (-706.832) (-721.108) [-707.384] (-704.333) * (-707.282) [-708.451] (-714.797) (-702.882) -- 0:02:27
364000 -- (-706.359) (-714.011) (-706.099) [-709.283] * (-702.415) (-710.569) (-715.867) [-713.255] -- 0:02:26
365000 -- [-705.633] (-714.426) (-715.826) (-708.737) * (-702.894) (-705.203) (-713.934) [-703.608] -- 0:02:27
Average standard deviation of split frequencies: 0.012365
366000 -- (-708.504) (-711.079) (-704.975) [-714.638] * (-714.110) [-705.295] (-708.948) (-709.433) -- 0:02:27
367000 -- (-710.268) [-706.145] (-709.110) (-712.531) * (-709.307) (-703.261) [-704.468] (-705.901) -- 0:02:26
368000 -- (-707.920) (-708.805) (-711.465) [-708.523] * (-710.442) [-703.057] (-713.415) (-713.779) -- 0:02:25
369000 -- [-708.317] (-711.905) (-715.033) (-707.993) * [-707.073] (-702.764) (-707.329) (-708.019) -- 0:02:27
370000 -- (-701.462) (-714.070) (-706.901) [-709.866] * (-706.185) [-702.311] (-709.590) (-708.198) -- 0:02:26
Average standard deviation of split frequencies: 0.012803
371000 -- (-705.251) (-708.201) [-711.919] (-704.039) * (-709.132) [-707.321] (-711.345) (-715.113) -- 0:02:25
372000 -- (-705.668) (-706.591) [-707.961] (-710.577) * (-708.219) (-703.060) [-704.717] (-714.735) -- 0:02:25
373000 -- (-706.781) (-710.465) (-713.433) [-703.712] * (-708.106) (-709.902) [-706.950] (-717.711) -- 0:02:24
374000 -- (-718.615) (-709.365) (-712.050) [-707.765] * (-706.191) (-707.709) [-707.506] (-713.533) -- 0:02:25
375000 -- (-707.961) (-709.111) [-709.174] (-721.756) * (-709.236) [-707.474] (-708.935) (-707.048) -- 0:02:25
Average standard deviation of split frequencies: 0.012119
376000 -- (-708.217) (-704.772) [-704.930] (-715.709) * (-707.965) [-709.826] (-702.396) (-717.132) -- 0:02:24
377000 -- (-707.943) [-704.217] (-711.573) (-715.760) * [-708.417] (-716.029) (-710.291) (-708.581) -- 0:02:23
378000 -- (-713.604) (-707.909) [-704.667] (-715.246) * (-707.960) (-715.324) (-710.537) [-704.724] -- 0:02:24
379000 -- (-706.793) [-702.593] (-708.894) (-711.298) * (-709.908) (-707.965) [-704.823] (-705.764) -- 0:02:24
380000 -- (-713.089) [-707.537] (-711.224) (-711.224) * (-709.546) (-716.478) (-707.393) [-704.539] -- 0:02:23
Average standard deviation of split frequencies: 0.011888
381000 -- (-702.035) (-706.760) (-704.893) [-710.769] * (-706.022) (-704.119) [-705.172] (-710.955) -- 0:02:22
382000 -- (-702.496) [-708.993] (-705.791) (-711.553) * (-712.206) (-704.331) (-707.282) [-704.782] -- 0:02:23
383000 -- [-712.492] (-708.867) (-700.651) (-710.211) * (-711.306) (-714.752) [-719.238] (-701.521) -- 0:02:23
384000 -- (-710.240) (-712.430) [-705.003] (-707.661) * (-712.485) [-711.671] (-712.072) (-707.239) -- 0:02:22
385000 -- (-708.189) [-699.564] (-703.651) (-708.544) * (-707.387) (-711.955) (-707.850) [-703.093] -- 0:02:22
Average standard deviation of split frequencies: 0.012050
386000 -- (-707.503) (-712.824) (-719.449) [-713.421] * [-719.008] (-713.844) (-708.696) (-709.681) -- 0:02:21
387000 -- [-703.799] (-710.687) (-707.119) (-708.139) * (-710.678) (-708.935) [-701.467] (-711.881) -- 0:02:22
388000 -- (-711.245) [-712.334] (-711.526) (-708.459) * (-714.780) [-698.475] (-717.233) (-707.640) -- 0:02:21
389000 -- (-718.615) [-711.334] (-707.842) (-723.980) * (-709.057) (-710.623) (-711.807) [-705.345] -- 0:02:21
390000 -- (-705.324) (-709.145) (-717.006) [-708.323] * (-704.576) (-705.842) (-710.964) [-708.204] -- 0:02:20
Average standard deviation of split frequencies: 0.011745
391000 -- [-712.307] (-712.727) (-707.873) (-707.945) * (-711.243) (-708.141) [-704.596] (-712.982) -- 0:02:21
392000 -- (-711.478) [-706.123] (-714.978) (-713.734) * (-711.397) (-709.034) [-708.865] (-708.400) -- 0:02:21
393000 -- (-706.256) (-704.818) [-707.004] (-704.422) * (-714.095) [-712.880] (-705.386) (-707.007) -- 0:02:20
394000 -- [-709.847] (-709.293) (-707.399) (-711.610) * (-720.865) (-710.602) [-704.783] (-708.108) -- 0:02:19
395000 -- (-705.661) (-709.442) [-702.842] (-711.389) * (-704.982) (-718.493) (-706.121) [-709.125] -- 0:02:20
Average standard deviation of split frequencies: 0.011825
396000 -- [-709.286] (-709.192) (-715.298) (-708.932) * [-712.204] (-717.727) (-713.933) (-709.982) -- 0:02:20
397000 -- (-715.810) (-710.163) [-709.784] (-710.790) * (-712.122) [-722.729] (-707.308) (-714.356) -- 0:02:19
398000 -- (-711.581) [-710.565] (-710.000) (-706.317) * [-706.070] (-713.531) (-713.415) (-706.005) -- 0:02:19
399000 -- (-710.702) (-709.919) [-704.891] (-717.977) * (-709.865) [-713.486] (-716.026) (-707.197) -- 0:02:18
400000 -- [-705.563] (-708.948) (-705.518) (-708.545) * (-718.495) [-709.015] (-711.880) (-708.517) -- 0:02:19
Average standard deviation of split frequencies: 0.012236
401000 -- (-704.592) [-699.974] (-707.813) (-706.025) * (-717.287) (-709.056) [-704.692] (-704.185) -- 0:02:18
402000 -- (-701.596) (-713.567) (-718.118) [-712.667] * (-705.019) (-715.360) (-711.772) [-701.064] -- 0:02:18
403000 -- (-709.219) (-723.349) [-708.962] (-721.099) * (-706.495) (-709.534) [-701.607] (-704.672) -- 0:02:17
404000 -- (-712.669) (-716.819) (-705.453) [-706.040] * (-708.549) (-708.741) (-713.118) [-710.556] -- 0:02:18
405000 -- (-720.520) (-709.147) (-718.434) [-705.668] * (-705.653) (-708.093) (-715.430) [-709.149] -- 0:02:18
Average standard deviation of split frequencies: 0.011921
406000 -- (-708.419) (-710.634) [-705.001] (-710.311) * (-709.038) [-706.364] (-717.726) (-711.796) -- 0:02:17
407000 -- (-714.273) (-715.667) (-707.304) [-715.126] * (-714.100) [-707.578] (-705.832) (-706.716) -- 0:02:16
408000 -- (-716.466) (-713.808) (-710.884) [-707.743] * (-713.702) (-710.876) (-709.220) [-708.888] -- 0:02:17
409000 -- (-705.290) [-711.897] (-715.578) (-706.422) * (-718.532) [-708.004] (-715.294) (-707.501) -- 0:02:17
410000 -- (-707.544) [-712.983] (-710.563) (-704.331) * (-702.898) (-712.085) (-710.116) [-705.490] -- 0:02:16
Average standard deviation of split frequencies: 0.012091
411000 -- (-705.768) (-719.395) [-705.575] (-700.374) * (-713.377) (-720.057) (-704.238) [-710.508] -- 0:02:16
412000 -- (-707.160) (-709.421) (-714.819) [-710.637] * (-703.803) (-714.146) (-706.571) [-705.670] -- 0:02:15
413000 -- (-712.721) (-709.085) [-702.830] (-710.804) * [-709.559] (-706.442) (-708.768) (-709.770) -- 0:02:16
414000 -- (-713.209) (-711.335) (-719.747) [-709.370] * (-713.747) (-706.469) (-706.263) [-707.606] -- 0:02:15
415000 -- (-713.916) [-711.649] (-703.708) (-704.106) * (-706.805) (-706.464) [-706.622] (-708.956) -- 0:02:15
Average standard deviation of split frequencies: 0.011936
416000 -- (-712.623) (-705.325) (-704.940) [-706.736] * (-713.979) [-705.867] (-704.511) (-711.238) -- 0:02:14
417000 -- (-712.182) (-712.819) (-711.215) [-707.599] * [-707.261] (-709.104) (-708.411) (-708.014) -- 0:02:15
418000 -- (-700.572) (-721.452) [-711.337] (-707.857) * (-710.647) (-705.364) [-709.112] (-712.289) -- 0:02:15
419000 -- (-706.019) (-716.318) [-702.342] (-708.365) * (-713.087) (-715.308) [-709.841] (-721.242) -- 0:02:14
420000 -- (-710.090) (-708.119) (-705.073) [-708.614] * (-716.951) [-711.838] (-711.615) (-716.665) -- 0:02:13
Average standard deviation of split frequencies: 0.011804
421000 -- (-708.711) [-708.919] (-710.969) (-704.496) * (-709.060) (-704.148) (-713.522) [-710.421] -- 0:02:14
422000 -- (-708.363) (-713.676) (-708.506) [-705.526] * (-713.516) (-712.678) [-709.567] (-716.197) -- 0:02:14
423000 -- (-702.587) (-707.041) [-706.651] (-714.662) * (-707.868) (-706.949) (-710.001) [-709.871] -- 0:02:13
424000 -- (-711.249) (-708.990) [-707.075] (-719.487) * (-710.347) [-707.793] (-714.576) (-716.820) -- 0:02:13
425000 -- (-705.151) [-705.108] (-716.702) (-716.910) * (-708.285) (-710.302) (-708.374) [-705.038] -- 0:02:13
Average standard deviation of split frequencies: 0.011877
426000 -- [-710.047] (-716.384) (-714.696) (-720.809) * [-701.415] (-703.392) (-706.945) (-713.905) -- 0:02:13
427000 -- (-709.571) [-699.261] (-713.577) (-705.882) * (-709.466) (-712.569) (-720.485) [-705.400] -- 0:02:12
428000 -- (-705.979) (-713.144) [-710.661] (-706.975) * [-707.169] (-712.722) (-713.705) (-710.807) -- 0:02:12
429000 -- (-710.334) (-713.525) [-706.603] (-702.580) * (-710.531) (-723.635) (-705.001) [-708.195] -- 0:02:13
430000 -- (-719.020) (-706.854) (-709.021) [-704.961] * (-709.018) (-709.742) (-707.748) [-714.771] -- 0:02:12
Average standard deviation of split frequencies: 0.012113
431000 -- (-721.008) (-708.036) (-708.060) [-711.614] * (-702.460) (-720.586) (-705.869) [-702.793] -- 0:02:12
432000 -- [-703.376] (-708.042) (-712.181) (-709.235) * (-706.280) (-709.671) [-715.446] (-706.016) -- 0:02:11
433000 -- (-709.873) (-709.118) (-714.396) [-707.798] * (-704.904) [-709.694] (-713.726) (-705.146) -- 0:02:10
434000 -- (-717.704) (-707.649) [-705.064] (-707.798) * (-701.441) (-712.722) [-709.720] (-707.120) -- 0:02:11
435000 -- (-713.803) [-712.661] (-708.979) (-708.685) * (-716.160) [-708.781] (-705.050) (-710.875) -- 0:02:11
Average standard deviation of split frequencies: 0.012037
436000 -- (-715.223) (-706.210) (-706.766) [-702.503] * (-706.560) [-712.668] (-714.943) (-711.763) -- 0:02:10
437000 -- (-711.533) (-712.081) [-707.076] (-711.094) * (-719.802) (-708.616) (-707.747) [-707.772] -- 0:02:10
438000 -- [-703.328] (-721.165) (-706.743) (-708.339) * (-712.380) [-715.018] (-713.602) (-704.396) -- 0:02:10
439000 -- [-708.464] (-730.212) (-710.460) (-710.830) * (-710.689) (-715.935) (-725.600) [-714.856] -- 0:02:10
440000 -- (-712.811) (-712.910) (-706.092) [-714.189] * (-705.416) [-705.257] (-710.319) (-716.296) -- 0:02:09
Average standard deviation of split frequencies: 0.012124
441000 -- (-708.492) (-712.888) [-712.195] (-713.091) * (-703.672) [-704.281] (-706.650) (-710.440) -- 0:02:09
442000 -- [-707.460] (-705.852) (-715.950) (-710.963) * (-710.643) (-715.795) [-707.283] (-711.251) -- 0:02:10
443000 -- (-710.762) (-711.280) (-716.629) [-711.888] * (-709.469) (-709.890) (-709.686) [-705.972] -- 0:02:09
444000 -- [-711.278] (-710.904) (-714.249) (-708.785) * [-706.214] (-710.178) (-713.280) (-704.119) -- 0:02:08
445000 -- (-708.808) [-709.074] (-710.764) (-713.086) * [-715.656] (-713.269) (-713.977) (-703.889) -- 0:02:08
Average standard deviation of split frequencies: 0.011908
446000 -- [-710.025] (-712.404) (-705.131) (-714.080) * [-706.301] (-716.326) (-717.776) (-701.844) -- 0:02:07
447000 -- (-710.018) (-712.661) (-708.387) [-704.689] * (-711.666) (-713.987) [-709.149] (-719.994) -- 0:02:08
448000 -- [-712.601] (-710.033) (-713.919) (-711.503) * (-700.928) [-712.404] (-705.460) (-710.093) -- 0:02:08
449000 -- (-702.415) (-704.566) [-710.373] (-711.209) * [-705.590] (-716.895) (-707.347) (-710.859) -- 0:02:07
450000 -- (-707.889) [-702.576] (-708.257) (-710.530) * [-707.607] (-708.341) (-709.079) (-707.656) -- 0:02:07
Average standard deviation of split frequencies: 0.012413
451000 -- (-706.206) [-702.587] (-706.348) (-707.433) * (-709.124) (-706.081) [-707.439] (-716.380) -- 0:02:07
452000 -- [-713.288] (-712.174) (-714.188) (-707.398) * (-711.464) [-710.246] (-711.679) (-709.898) -- 0:02:07
453000 -- (-707.648) (-707.342) (-704.857) [-709.151] * (-710.947) (-712.049) (-712.672) [-705.996] -- 0:02:06
454000 -- (-708.713) (-711.061) (-714.556) [-709.332] * (-714.954) (-706.977) [-707.112] (-709.152) -- 0:02:06
455000 -- (-704.718) [-714.851] (-704.970) (-710.956) * (-703.284) [-708.719] (-711.250) (-703.683) -- 0:02:05
Average standard deviation of split frequencies: 0.011923
456000 -- (-708.708) (-709.489) (-704.628) [-706.689] * (-709.723) [-711.184] (-709.576) (-704.782) -- 0:02:06
457000 -- (-711.194) (-718.122) (-707.804) [-713.569] * (-703.730) [-705.597] (-715.243) (-712.981) -- 0:02:05
458000 -- (-704.268) (-721.777) (-721.234) [-711.478] * (-710.558) (-708.789) [-705.526] (-711.666) -- 0:02:05
459000 -- [-701.162] (-725.569) (-720.623) (-710.502) * (-713.158) (-703.952) [-708.267] (-708.939) -- 0:02:04
460000 -- [-708.798] (-710.152) (-703.638) (-712.563) * (-709.967) [-710.610] (-710.138) (-708.780) -- 0:02:05
Average standard deviation of split frequencies: 0.011120
461000 -- (-711.533) [-704.238] (-711.697) (-709.898) * (-704.621) (-718.059) (-707.122) [-711.782] -- 0:02:05
462000 -- (-720.888) [-712.057] (-703.673) (-714.613) * (-708.222) [-714.704] (-713.389) (-710.886) -- 0:02:04
463000 -- (-713.228) (-713.152) (-711.337) [-710.369] * (-717.832) [-706.688] (-703.823) (-709.571) -- 0:02:04
464000 -- (-709.675) [-706.927] (-702.813) (-716.092) * (-714.691) (-715.592) [-706.777] (-714.944) -- 0:02:04
465000 -- (-706.221) (-709.096) [-706.936] (-709.437) * [-707.241] (-708.189) (-702.674) (-708.095) -- 0:02:04
Average standard deviation of split frequencies: 0.010521
466000 -- (-707.375) (-711.750) (-704.110) [-709.071] * (-706.925) (-705.858) (-708.741) [-709.851] -- 0:02:03
467000 -- (-715.811) (-701.017) (-714.503) [-708.717] * (-716.486) (-712.764) (-707.728) [-715.589] -- 0:02:03
468000 -- [-698.483] (-709.784) (-709.673) (-725.518) * (-713.612) [-717.375] (-710.816) (-702.387) -- 0:02:03
469000 -- (-713.805) (-714.932) [-706.748] (-714.110) * (-706.772) (-716.805) (-715.535) [-700.182] -- 0:02:03
470000 -- [-709.502] (-714.545) (-710.480) (-707.651) * [-708.931] (-720.561) (-704.560) (-711.431) -- 0:02:02
Average standard deviation of split frequencies: 0.009214
471000 -- (-710.715) [-702.448] (-725.754) (-719.294) * (-708.848) (-716.767) (-706.245) [-705.446] -- 0:02:02
472000 -- (-712.852) [-708.889] (-713.535) (-713.734) * (-708.518) (-714.999) (-704.859) [-709.134] -- 0:02:01
473000 -- (-709.488) (-716.140) (-726.786) [-707.329] * (-714.207) (-708.798) (-711.630) [-710.136] -- 0:02:02
474000 -- (-703.948) [-710.247] (-716.214) (-706.429) * (-710.299) (-708.399) (-719.059) [-708.866] -- 0:02:02
475000 -- (-707.377) [-708.650] (-711.196) (-708.758) * [-701.731] (-707.823) (-716.175) (-705.401) -- 0:02:01
Average standard deviation of split frequencies: 0.008913
476000 -- (-713.182) (-707.080) [-705.784] (-706.903) * (-707.145) [-713.102] (-716.665) (-705.166) -- 0:02:01
477000 -- (-712.552) [-703.509] (-710.099) (-711.743) * (-707.829) [-705.632] (-715.418) (-705.107) -- 0:02:01
478000 -- [-706.282] (-726.480) (-707.149) (-706.620) * (-717.985) (-706.921) [-713.589] (-713.105) -- 0:02:01
479000 -- (-713.381) (-703.546) [-710.720] (-709.112) * [-712.487] (-709.449) (-725.123) (-709.578) -- 0:02:00
480000 -- (-713.188) [-705.050] (-715.574) (-704.287) * [-706.691] (-706.880) (-712.091) (-702.394) -- 0:02:00
Average standard deviation of split frequencies: 0.009153
481000 -- (-712.079) (-708.902) (-724.128) [-708.067] * (-715.040) (-713.206) [-716.907] (-711.750) -- 0:02:00
482000 -- [-708.398] (-709.582) (-710.681) (-715.250) * (-724.277) (-711.866) (-704.037) [-704.605] -- 0:02:00
483000 -- [-708.150] (-717.114) (-710.748) (-699.257) * (-711.609) (-705.087) (-708.272) [-720.200] -- 0:01:59
484000 -- (-708.966) (-710.807) (-709.001) [-705.066] * (-713.027) (-709.023) (-710.097) [-710.163] -- 0:01:59
485000 -- (-701.917) [-709.181] (-705.939) (-725.671) * (-710.918) [-716.894] (-711.193) (-717.942) -- 0:01:58
Average standard deviation of split frequencies: 0.009506
486000 -- (-714.379) (-714.170) (-707.001) [-709.451] * (-702.557) [-711.428] (-710.323) (-711.519) -- 0:01:59
487000 -- (-721.283) (-706.766) [-706.792] (-711.670) * (-699.262) [-705.005] (-710.872) (-718.369) -- 0:01:59
488000 -- (-712.909) [-707.797] (-714.672) (-707.866) * (-700.770) [-705.989] (-711.788) (-714.930) -- 0:01:58
489000 -- [-709.276] (-707.646) (-711.434) (-719.899) * [-709.142] (-708.869) (-711.398) (-711.960) -- 0:01:58
490000 -- (-708.156) [-716.266] (-706.080) (-704.542) * (-711.651) (-705.781) [-706.404] (-717.111) -- 0:01:58
Average standard deviation of split frequencies: 0.009992
491000 -- [-701.293] (-713.081) (-708.375) (-705.444) * [-700.425] (-715.758) (-703.591) (-717.204) -- 0:01:58
492000 -- [-703.398] (-711.082) (-711.360) (-706.638) * (-709.418) (-717.297) [-702.702] (-713.668) -- 0:01:57
493000 -- (-708.309) (-704.227) (-715.682) [-708.701] * [-704.584] (-715.475) (-707.373) (-711.522) -- 0:01:57
494000 -- (-712.912) (-708.787) [-700.985] (-709.274) * (-704.353) (-709.978) (-709.614) [-706.447] -- 0:01:57
495000 -- (-715.086) (-709.723) (-703.390) [-706.388] * (-705.481) [-705.378] (-715.407) (-701.307) -- 0:01:57
Average standard deviation of split frequencies: 0.009631
496000 -- (-711.388) (-717.718) [-699.638] (-709.263) * (-713.492) (-708.791) (-698.602) [-705.651] -- 0:01:56
497000 -- [-706.352] (-709.511) (-707.046) (-707.960) * (-711.121) [-706.750] (-711.298) (-709.429) -- 0:01:56
498000 -- (-707.722) [-701.933] (-716.853) (-712.760) * (-709.480) (-705.534) [-708.574] (-702.306) -- 0:01:55
499000 -- [-703.541] (-707.087) (-714.584) (-707.571) * (-707.900) (-715.384) [-705.553] (-707.174) -- 0:01:56
500000 -- (-706.176) (-706.441) [-704.153] (-703.119) * (-703.203) (-710.444) [-707.821] (-710.299) -- 0:01:56
Average standard deviation of split frequencies: 0.008976
501000 -- (-712.748) (-712.786) (-716.763) [-700.497] * (-717.617) (-709.227) [-702.569] (-706.863) -- 0:01:55
502000 -- (-705.013) [-705.634] (-705.693) (-702.372) * [-704.963] (-716.002) (-710.965) (-705.248) -- 0:01:55
503000 -- (-714.290) (-710.831) [-709.512] (-699.730) * (-709.411) (-708.132) [-715.559] (-708.883) -- 0:01:55
504000 -- (-714.965) [-706.995] (-712.873) (-710.829) * (-711.893) (-719.062) [-709.880] (-714.286) -- 0:01:55
505000 -- (-715.003) [-705.552] (-712.354) (-717.913) * (-709.412) (-717.786) [-706.314] (-708.187) -- 0:01:54
Average standard deviation of split frequencies: 0.008757
506000 -- (-712.689) (-707.626) (-714.165) [-709.680] * (-707.058) (-707.401) (-715.953) [-703.263] -- 0:01:54
507000 -- (-711.284) (-704.970) [-712.501] (-705.641) * (-714.303) [-712.354] (-712.497) (-717.606) -- 0:01:53
508000 -- (-708.690) [-711.422] (-712.486) (-719.785) * (-712.138) (-709.061) (-712.711) [-704.808] -- 0:01:54
509000 -- [-704.719] (-713.045) (-710.128) (-713.781) * (-713.096) (-711.059) (-712.478) [-707.636] -- 0:01:53
510000 -- (-714.740) (-716.394) (-701.766) [-709.664] * [-706.564] (-712.807) (-711.431) (-714.030) -- 0:01:53
Average standard deviation of split frequencies: 0.008739
511000 -- (-720.019) (-715.012) [-707.035] (-713.889) * (-715.238) [-702.690] (-706.995) (-715.299) -- 0:01:52
512000 -- (-709.045) (-712.013) [-707.569] (-722.324) * (-714.395) [-705.950] (-712.855) (-715.824) -- 0:01:53
513000 -- (-704.557) [-704.191] (-707.109) (-719.662) * (-721.128) [-708.775] (-717.672) (-707.305) -- 0:01:52
514000 -- (-706.784) (-717.994) [-706.238] (-724.827) * (-702.340) (-715.558) (-711.841) [-709.480] -- 0:01:52
515000 -- (-707.031) [-712.805] (-714.101) (-708.667) * (-711.008) (-707.170) (-717.826) [-714.681] -- 0:01:52
Average standard deviation of split frequencies: 0.009379
516000 -- (-709.881) (-707.942) (-713.435) [-707.175] * (-715.999) (-715.234) [-705.195] (-709.279) -- 0:01:52
517000 -- (-713.335) (-712.797) [-710.828] (-703.803) * (-716.338) (-707.257) [-707.171] (-709.992) -- 0:01:52
518000 -- [-704.712] (-710.673) (-717.297) (-713.462) * (-714.623) (-712.598) (-713.341) [-721.645] -- 0:01:51
519000 -- (-709.719) (-713.276) (-702.295) [-709.886] * [-704.154] (-710.874) (-710.165) (-707.426) -- 0:01:51
520000 -- (-707.769) [-704.850] (-705.626) (-707.549) * [-701.232] (-713.109) (-707.883) (-708.637) -- 0:01:50
Average standard deviation of split frequencies: 0.008873
521000 -- (-711.176) (-708.935) (-715.899) [-713.373] * (-717.802) (-707.677) (-710.540) [-706.975] -- 0:01:51
522000 -- [-703.858] (-706.370) (-707.677) (-709.230) * (-712.388) [-706.387] (-714.119) (-714.125) -- 0:01:50
523000 -- (-705.512) [-706.258] (-721.249) (-705.255) * [-713.081] (-708.135) (-710.224) (-709.820) -- 0:01:50
524000 -- (-712.419) [-707.031] (-713.734) (-709.339) * [-715.097] (-711.186) (-708.327) (-704.786) -- 0:01:49
525000 -- (-707.698) [-705.261] (-709.334) (-713.942) * (-715.373) (-704.414) [-711.750] (-704.868) -- 0:01:50
Average standard deviation of split frequencies: 0.008962
526000 -- (-706.348) [-711.353] (-701.475) (-714.540) * (-710.213) (-706.265) (-709.199) [-704.964] -- 0:01:49
527000 -- (-719.929) (-709.088) [-708.931] (-708.304) * [-715.478] (-712.312) (-703.714) (-718.337) -- 0:01:49
528000 -- [-713.656] (-714.879) (-708.289) (-711.124) * (-708.037) (-709.401) [-705.681] (-717.692) -- 0:01:49
529000 -- (-709.829) (-709.523) (-709.866) [-707.467] * (-709.090) (-712.231) [-704.852] (-709.668) -- 0:01:49
530000 -- (-714.187) (-712.971) [-704.984] (-715.601) * (-713.648) (-705.515) (-711.117) [-712.304] -- 0:01:49
Average standard deviation of split frequencies: 0.008706
531000 -- (-716.796) (-704.011) (-714.771) [-715.940] * (-706.172) [-715.218] (-711.415) (-708.320) -- 0:01:48
532000 -- (-712.426) (-707.668) [-710.955] (-706.748) * [-710.990] (-706.226) (-712.488) (-709.300) -- 0:01:48
533000 -- (-708.922) (-712.915) (-713.540) [-710.084] * (-704.578) (-713.502) (-716.588) [-704.787] -- 0:01:48
534000 -- (-710.516) [-702.371] (-722.248) (-709.596) * (-716.165) (-713.476) [-714.481] (-718.798) -- 0:01:48
535000 -- [-704.640] (-707.807) (-719.207) (-703.734) * (-711.072) (-712.011) [-709.378] (-717.877) -- 0:01:47
Average standard deviation of split frequencies: 0.009968
536000 -- (-712.362) [-699.184] (-716.062) (-710.771) * (-711.465) [-707.202] (-713.087) (-715.641) -- 0:01:47
537000 -- (-708.505) (-708.811) (-713.991) [-701.353] * (-708.455) (-706.430) (-714.002) [-703.497] -- 0:01:47
538000 -- (-707.116) (-708.466) [-704.154] (-712.482) * (-704.700) (-715.308) (-716.344) [-701.978] -- 0:01:47
539000 -- (-709.500) (-710.124) [-708.920] (-702.583) * (-711.450) (-709.462) (-717.841) [-706.700] -- 0:01:46
540000 -- (-703.031) (-715.291) (-710.376) [-701.096] * [-704.197] (-706.929) (-710.684) (-712.774) -- 0:01:46
Average standard deviation of split frequencies: 0.009533
541000 -- [-705.920] (-708.821) (-702.360) (-713.867) * (-712.716) (-712.490) [-715.175] (-715.262) -- 0:01:46
542000 -- (-708.429) (-715.651) [-701.185] (-708.747) * [-709.815] (-713.207) (-712.185) (-715.091) -- 0:01:46
543000 -- (-704.428) (-706.492) [-712.809] (-708.242) * (-711.120) (-706.053) (-710.149) [-707.893] -- 0:01:46
544000 -- [-700.172] (-710.455) (-706.552) (-704.967) * [-703.131] (-707.114) (-706.951) (-708.741) -- 0:01:45
545000 -- (-708.488) (-707.543) (-715.348) [-701.129] * [-712.098] (-714.188) (-709.907) (-718.897) -- 0:01:46
Average standard deviation of split frequencies: 0.009843
546000 -- (-713.247) [-710.052] (-709.260) (-706.168) * (-713.352) (-704.094) [-707.962] (-707.585) -- 0:01:45
547000 -- (-721.770) (-718.315) (-715.666) [-708.174] * (-706.772) (-709.305) (-704.880) [-703.444] -- 0:01:45
548000 -- [-719.080] (-708.156) (-711.612) (-709.380) * [-707.481] (-712.471) (-708.779) (-702.841) -- 0:01:44
549000 -- (-718.702) (-706.942) (-710.816) [-709.379] * (-708.614) [-719.612] (-706.283) (-709.669) -- 0:01:44
550000 -- (-720.685) (-710.238) [-704.547] (-706.106) * (-708.507) (-712.089) [-703.708] (-716.844) -- 0:01:44
Average standard deviation of split frequencies: 0.009645
551000 -- (-714.282) (-708.802) (-705.927) [-710.083] * (-710.105) [-710.529] (-714.801) (-721.702) -- 0:01:44
552000 -- (-718.363) [-709.430] (-703.297) (-711.738) * (-711.722) (-714.332) [-709.672] (-718.153) -- 0:01:43
553000 -- (-709.168) [-705.362] (-705.767) (-717.886) * (-705.557) [-711.245] (-705.045) (-708.281) -- 0:01:43
554000 -- (-717.673) (-703.970) [-705.258] (-715.537) * (-725.211) (-714.212) (-709.914) [-708.493] -- 0:01:43
555000 -- (-714.844) (-710.012) [-705.423] (-706.666) * (-717.939) (-703.790) (-703.005) [-709.168] -- 0:01:43
Average standard deviation of split frequencies: 0.009326
556000 -- [-713.946] (-713.830) (-704.489) (-714.541) * (-711.512) [-711.150] (-724.206) (-706.950) -- 0:01:43
557000 -- [-715.260] (-713.440) (-711.592) (-709.989) * (-703.609) (-708.366) [-708.430] (-711.033) -- 0:01:42
558000 -- (-721.180) (-711.319) (-706.841) [-709.696] * (-712.897) (-710.998) (-707.917) [-703.424] -- 0:01:42
559000 -- (-711.499) (-706.272) (-712.269) [-705.594] * [-706.737] (-708.027) (-711.118) (-706.918) -- 0:01:42
560000 -- [-700.827] (-722.885) (-705.573) (-709.460) * (-712.445) (-709.803) [-713.131] (-710.277) -- 0:01:42
Average standard deviation of split frequencies: 0.009753
561000 -- (-707.153) (-714.683) (-715.467) [-703.887] * [-708.176] (-707.177) (-712.912) (-708.570) -- 0:01:41
562000 -- [-717.231] (-713.418) (-709.325) (-711.938) * (-713.786) (-711.543) [-719.218] (-708.645) -- 0:01:41
563000 -- (-711.190) (-711.137) [-705.388] (-715.236) * (-709.257) (-710.361) (-712.283) [-709.155] -- 0:01:41
564000 -- (-708.121) (-715.083) (-713.629) [-710.575] * [-713.877] (-711.751) (-718.057) (-706.640) -- 0:01:41
565000 -- (-711.134) (-711.457) [-707.076] (-709.417) * [-713.786] (-713.915) (-704.826) (-707.461) -- 0:01:40
Average standard deviation of split frequencies: 0.009328
566000 -- (-710.224) (-709.108) (-707.630) [-701.633] * (-713.352) (-707.669) (-711.188) [-704.557] -- 0:01:40
567000 -- [-707.688] (-711.821) (-709.324) (-719.911) * (-713.102) [-706.135] (-709.970) (-713.760) -- 0:01:40
568000 -- (-712.688) (-710.458) [-714.881] (-710.287) * (-708.914) (-710.063) [-706.054] (-706.163) -- 0:01:40
569000 -- (-707.884) [-708.892] (-707.177) (-701.866) * [-706.030] (-707.268) (-714.765) (-709.508) -- 0:01:39
570000 -- [-708.560] (-709.727) (-708.929) (-716.004) * (-710.461) [-712.650] (-711.423) (-707.841) -- 0:01:39
Average standard deviation of split frequencies: 0.008536
571000 -- (-702.322) (-709.599) [-705.515] (-714.464) * (-710.303) (-715.552) (-711.594) [-706.516] -- 0:01:39
572000 -- (-725.249) (-705.971) (-712.403) [-709.743] * [-709.939] (-715.151) (-714.479) (-705.487) -- 0:01:39
573000 -- [-706.165] (-709.390) (-712.838) (-705.031) * [-703.261] (-703.068) (-707.589) (-712.387) -- 0:01:39
574000 -- [-709.894] (-707.150) (-716.489) (-703.723) * (-722.325) (-718.575) (-707.933) [-701.162] -- 0:01:38
575000 -- [-709.064] (-710.834) (-704.116) (-708.482) * (-709.045) [-713.905] (-712.789) (-717.298) -- 0:01:38
Average standard deviation of split frequencies: 0.008348
576000 -- [-703.080] (-713.099) (-708.611) (-710.830) * (-704.606) (-714.231) [-717.519] (-717.282) -- 0:01:38
577000 -- [-703.047] (-713.385) (-712.146) (-724.437) * (-707.838) (-713.363) [-710.487] (-711.779) -- 0:01:38
578000 -- (-703.490) (-707.270) [-704.995] (-708.135) * (-718.566) (-705.505) [-708.709] (-708.798) -- 0:01:37
579000 -- (-714.276) [-709.261] (-702.602) (-715.144) * (-704.960) [-701.962] (-704.930) (-711.026) -- 0:01:37
580000 -- (-719.950) (-712.071) [-709.224] (-713.532) * [-705.285] (-706.430) (-710.102) (-723.376) -- 0:01:37
Average standard deviation of split frequencies: 0.007685
581000 -- (-710.289) (-706.648) (-707.019) [-705.650] * (-714.199) (-710.039) [-709.155] (-706.871) -- 0:01:37
582000 -- (-713.746) [-701.977] (-707.185) (-700.086) * (-714.094) (-704.565) (-705.127) [-705.362] -- 0:01:36
583000 -- (-707.206) (-705.543) (-718.604) [-708.181] * (-707.348) (-700.960) (-713.341) [-704.917] -- 0:01:36
584000 -- (-711.939) (-713.376) [-708.866] (-712.011) * [-704.460] (-716.228) (-704.309) (-707.745) -- 0:01:36
585000 -- (-712.516) [-706.684] (-709.824) (-710.974) * (-711.479) [-719.396] (-709.843) (-705.678) -- 0:01:36
Average standard deviation of split frequencies: 0.007562
586000 -- [-710.058] (-706.807) (-713.166) (-714.843) * [-707.835] (-710.270) (-711.277) (-711.747) -- 0:01:36
587000 -- (-702.189) [-714.026] (-721.255) (-714.527) * [-706.932] (-703.381) (-710.044) (-700.051) -- 0:01:35
588000 -- [-703.490] (-713.622) (-708.284) (-709.114) * (-715.825) (-710.755) (-713.622) [-704.360] -- 0:01:35
589000 -- (-707.375) (-722.374) (-710.302) [-710.132] * (-708.182) (-708.846) [-705.469] (-704.972) -- 0:01:35
590000 -- (-709.177) (-717.166) [-709.563] (-714.227) * [-702.555] (-707.037) (-710.508) (-711.731) -- 0:01:35
Average standard deviation of split frequencies: 0.007928
591000 -- [-710.799] (-714.058) (-722.512) (-710.006) * (-712.775) (-707.395) (-712.462) [-702.292] -- 0:01:34
592000 -- (-707.304) (-716.042) (-718.832) [-707.476] * (-716.290) (-706.518) (-709.494) [-706.493] -- 0:01:34
593000 -- (-715.857) [-710.272] (-715.567) (-713.558) * (-723.025) [-713.858] (-713.314) (-708.062) -- 0:01:34
594000 -- [-707.635] (-714.854) (-713.605) (-721.236) * [-710.170] (-705.742) (-710.621) (-704.795) -- 0:01:34
595000 -- (-720.347) (-711.784) [-714.771] (-716.519) * (-711.816) (-712.928) [-708.845] (-714.643) -- 0:01:33
Average standard deviation of split frequencies: 0.008648
596000 -- [-719.425] (-710.815) (-707.042) (-713.287) * [-712.715] (-716.563) (-710.860) (-700.759) -- 0:01:33
597000 -- (-709.364) (-710.930) (-709.708) [-703.438] * (-707.420) (-707.446) (-711.214) [-706.129] -- 0:01:33
598000 -- (-716.978) (-717.453) [-709.171] (-703.272) * (-709.403) (-709.366) (-713.034) [-710.436] -- 0:01:33
599000 -- (-705.520) [-708.441] (-712.936) (-713.416) * (-705.753) [-709.276] (-709.032) (-706.073) -- 0:01:33
600000 -- [-704.444] (-712.509) (-712.973) (-710.546) * (-716.658) [-699.658] (-708.181) (-715.938) -- 0:01:32
Average standard deviation of split frequencies: 0.007900
601000 -- (-712.657) (-711.286) (-717.658) [-712.986] * (-721.248) (-713.626) (-703.393) [-700.505] -- 0:01:32
602000 -- (-706.574) (-713.196) (-718.437) [-705.547] * (-705.387) [-705.971] (-713.174) (-707.274) -- 0:01:32
603000 -- (-706.112) [-708.095] (-713.325) (-706.255) * (-710.560) (-716.671) (-708.874) [-709.015] -- 0:01:32
604000 -- [-705.502] (-712.386) (-716.659) (-702.537) * [-705.054] (-711.207) (-706.909) (-705.457) -- 0:01:31
605000 -- (-714.943) (-712.042) [-707.310] (-713.867) * [-710.553] (-707.981) (-711.572) (-708.446) -- 0:01:31
Average standard deviation of split frequencies: 0.007727
606000 -- [-711.406] (-718.097) (-710.165) (-710.504) * (-710.951) (-720.390) [-706.632] (-702.373) -- 0:01:31
607000 -- [-707.567] (-709.086) (-714.761) (-717.451) * (-710.842) (-722.264) [-709.691] (-714.373) -- 0:01:31
608000 -- (-707.514) (-709.441) (-708.967) [-710.966] * [-704.593] (-707.479) (-721.128) (-707.582) -- 0:01:30
609000 -- [-711.433] (-704.701) (-712.782) (-711.847) * (-717.980) (-704.183) (-706.914) [-706.394] -- 0:01:30
610000 -- [-701.261] (-716.192) (-716.394) (-704.872) * (-714.706) (-707.352) [-707.672] (-702.774) -- 0:01:30
Average standard deviation of split frequencies: 0.007617
611000 -- (-713.539) (-714.911) (-710.866) [-712.153] * (-708.466) (-705.416) [-714.765] (-711.492) -- 0:01:30
612000 -- (-716.062) (-715.364) [-701.221] (-712.284) * (-713.330) (-709.668) (-704.952) [-712.974] -- 0:01:30
613000 -- (-706.483) (-719.784) [-703.446] (-716.095) * [-706.228] (-709.886) (-706.449) (-709.150) -- 0:01:29
614000 -- [-707.527] (-711.603) (-705.737) (-712.003) * (-709.978) [-709.403] (-716.354) (-705.662) -- 0:01:29
615000 -- [-713.364] (-708.944) (-702.984) (-713.537) * (-707.382) (-714.118) (-714.214) [-705.869] -- 0:01:29
Average standard deviation of split frequencies: 0.007245
616000 -- (-719.616) (-704.313) (-706.215) [-716.626] * (-716.484) [-706.025] (-705.895) (-713.668) -- 0:01:29
617000 -- (-705.886) (-717.074) (-718.289) [-706.981] * (-701.647) (-704.864) [-703.713] (-711.222) -- 0:01:28
618000 -- (-714.639) [-709.611] (-704.228) (-708.274) * (-714.286) (-705.033) [-712.696] (-708.504) -- 0:01:28
619000 -- [-709.253] (-710.060) (-714.801) (-704.882) * (-701.410) [-714.900] (-720.210) (-707.235) -- 0:01:28
620000 -- (-712.750) (-714.005) [-711.000] (-712.709) * (-708.095) (-723.526) (-718.643) [-707.075] -- 0:01:28
Average standard deviation of split frequencies: 0.007443
621000 -- (-718.980) (-712.713) (-701.863) [-703.270] * (-701.307) [-712.206] (-703.580) (-709.327) -- 0:01:27
622000 -- (-713.981) [-704.434] (-706.398) (-701.091) * (-716.341) [-710.254] (-715.362) (-704.549) -- 0:01:27
623000 -- [-718.939] (-718.331) (-710.789) (-704.501) * (-708.940) (-710.378) [-705.412] (-705.316) -- 0:01:27
624000 -- (-723.251) (-706.747) [-709.020] (-709.474) * (-711.648) (-716.331) (-710.481) [-709.215] -- 0:01:27
625000 -- (-708.172) (-704.821) (-708.906) [-708.021] * [-709.230] (-706.017) (-708.077) (-705.632) -- 0:01:27
Average standard deviation of split frequencies: 0.007631
626000 -- (-713.241) [-704.609] (-711.617) (-712.635) * (-727.356) (-709.667) [-705.282] (-714.666) -- 0:01:26
627000 -- [-704.865] (-712.340) (-725.151) (-705.598) * (-705.450) (-707.740) [-702.484] (-712.864) -- 0:01:26
628000 -- (-712.368) (-715.562) [-706.066] (-715.385) * (-711.303) [-715.488] (-714.682) (-708.072) -- 0:01:26
629000 -- [-708.489] (-713.669) (-712.645) (-714.037) * (-708.352) (-708.861) (-716.412) [-704.075] -- 0:01:26
630000 -- [-706.799] (-712.195) (-710.286) (-710.000) * (-720.865) (-710.417) (-728.905) [-707.972] -- 0:01:25
Average standard deviation of split frequencies: 0.007525
631000 -- (-707.860) (-712.847) (-709.028) [-710.002] * (-712.231) (-705.700) [-711.686] (-708.983) -- 0:01:25
632000 -- (-714.151) (-713.291) [-709.139] (-712.608) * (-704.912) [-716.200] (-707.053) (-709.542) -- 0:01:25
633000 -- (-715.445) (-710.380) [-714.830] (-708.129) * (-707.162) (-713.246) (-713.526) [-706.916] -- 0:01:25
634000 -- (-706.053) (-707.191) (-712.426) [-705.714] * (-707.904) (-714.329) (-713.273) [-704.889] -- 0:01:24
635000 -- (-709.177) [-705.969] (-708.976) (-709.239) * [-699.432] (-710.958) (-706.919) (-713.059) -- 0:01:24
Average standard deviation of split frequencies: 0.008252
636000 -- (-716.150) (-709.170) [-705.721] (-714.476) * (-698.752) (-705.321) [-703.572] (-710.700) -- 0:01:24
637000 -- [-703.453] (-712.440) (-708.405) (-708.338) * [-703.539] (-707.324) (-710.343) (-714.972) -- 0:01:24
638000 -- (-712.463) (-714.360) [-701.800] (-708.856) * (-711.717) (-717.641) (-709.879) [-701.975] -- 0:01:23
639000 -- [-700.179] (-701.032) (-711.301) (-702.450) * (-719.461) [-702.933] (-713.438) (-706.832) -- 0:01:23
640000 -- [-706.895] (-704.561) (-704.530) (-701.364) * [-707.702] (-708.365) (-707.416) (-706.322) -- 0:01:23
Average standard deviation of split frequencies: 0.007652
641000 -- (-702.253) (-709.749) [-717.574] (-704.545) * (-711.101) (-710.022) [-713.160] (-708.076) -- 0:01:23
642000 -- (-701.337) (-717.801) [-706.970] (-703.315) * (-709.720) [-705.655] (-711.564) (-708.598) -- 0:01:23
643000 -- [-706.663] (-712.868) (-711.682) (-708.624) * (-701.303) [-709.296] (-706.279) (-715.146) -- 0:01:22
644000 -- (-707.275) (-709.515) [-704.823] (-712.600) * (-707.732) (-709.865) (-711.149) [-714.804] -- 0:01:22
645000 -- [-711.405] (-707.905) (-709.070) (-715.939) * (-709.859) (-705.957) [-709.695] (-710.512) -- 0:01:22
Average standard deviation of split frequencies: 0.007151
646000 -- (-703.549) [-708.105] (-706.100) (-709.023) * (-704.619) (-706.804) [-716.933] (-712.910) -- 0:01:22
647000 -- (-708.207) (-710.441) (-703.815) [-707.385] * (-709.833) (-715.646) [-707.312] (-715.961) -- 0:01:21
648000 -- (-713.511) (-715.971) [-703.726] (-707.335) * (-722.342) (-707.566) [-709.651] (-717.564) -- 0:01:21
649000 -- (-711.710) [-708.642] (-706.111) (-706.676) * (-716.356) (-704.874) [-707.330] (-709.018) -- 0:01:21
650000 -- [-703.407] (-711.547) (-709.315) (-704.132) * (-716.944) [-710.976] (-711.140) (-727.429) -- 0:01:21
Average standard deviation of split frequencies: 0.007680
651000 -- (-716.725) [-712.264] (-709.176) (-712.899) * (-715.701) (-705.689) (-709.286) [-708.677] -- 0:01:20
652000 -- (-706.775) [-702.987] (-715.688) (-713.835) * (-714.215) (-716.616) (-711.840) [-706.194] -- 0:01:20
653000 -- (-711.740) (-717.782) (-701.844) [-708.512] * (-715.200) (-708.979) [-706.750] (-712.100) -- 0:01:20
654000 -- [-711.193] (-717.212) (-703.978) (-711.484) * (-712.558) (-718.284) (-719.187) [-715.435] -- 0:01:20
655000 -- [-710.477] (-709.290) (-710.381) (-723.977) * [-707.553] (-701.921) (-716.600) (-710.857) -- 0:01:20
Average standard deviation of split frequencies: 0.007809
656000 -- (-704.756) (-709.136) [-710.335] (-716.777) * (-710.247) (-710.262) (-708.289) [-703.816] -- 0:01:19
657000 -- (-715.455) (-705.529) [-708.275] (-708.168) * (-712.233) (-713.663) [-709.209] (-710.051) -- 0:01:19
658000 -- (-731.408) (-710.738) (-702.718) [-709.727] * (-703.718) (-720.310) (-718.461) [-702.779] -- 0:01:19
659000 -- (-720.183) [-704.579] (-709.340) (-706.687) * (-710.804) [-704.100] (-712.425) (-710.168) -- 0:01:19
660000 -- (-721.093) (-708.025) (-709.543) [-710.937] * (-710.142) [-704.683] (-705.379) (-720.004) -- 0:01:18
Average standard deviation of split frequencies: 0.007421
661000 -- (-718.337) (-706.249) (-706.739) [-701.361] * (-709.546) (-702.078) [-706.750] (-713.617) -- 0:01:18
662000 -- (-716.433) [-709.676] (-708.008) (-713.481) * (-711.015) (-706.042) [-710.750] (-708.192) -- 0:01:18
663000 -- (-708.021) (-720.464) (-704.654) [-708.896] * (-714.817) (-711.281) (-705.015) [-707.319] -- 0:01:18
664000 -- (-711.023) (-715.370) [-709.097] (-703.449) * (-719.922) (-711.533) [-706.662] (-709.760) -- 0:01:17
665000 -- (-710.775) [-706.293] (-706.546) (-714.956) * [-703.196] (-708.563) (-713.862) (-723.301) -- 0:01:17
Average standard deviation of split frequencies: 0.007267
666000 -- (-708.900) [-707.047] (-709.204) (-703.268) * (-712.169) (-710.582) (-709.183) [-702.737] -- 0:01:17
667000 -- (-704.303) (-709.853) [-708.625] (-714.418) * (-707.814) (-711.507) [-702.340] (-710.192) -- 0:01:17
668000 -- (-706.432) (-712.455) (-709.806) [-706.165] * (-713.932) (-707.167) (-706.910) [-713.201] -- 0:01:17
669000 -- [-708.020] (-716.191) (-707.339) (-712.704) * (-709.225) (-708.100) [-714.450] (-711.009) -- 0:01:16
670000 -- [-705.672] (-712.110) (-710.505) (-705.909) * (-702.093) (-710.815) [-706.970] (-705.442) -- 0:01:16
Average standard deviation of split frequencies: 0.006982
671000 -- [-702.295] (-716.464) (-709.041) (-709.069) * (-720.820) (-711.524) (-708.402) [-717.551] -- 0:01:16
672000 -- [-703.931] (-708.058) (-707.692) (-704.501) * (-718.307) (-717.812) (-714.901) [-716.980] -- 0:01:16
673000 -- (-709.641) (-716.368) [-707.636] (-718.334) * (-706.237) (-702.943) (-716.966) [-707.326] -- 0:01:15
674000 -- (-707.573) (-714.130) [-704.678] (-714.853) * [-704.891] (-708.942) (-719.429) (-717.255) -- 0:01:15
675000 -- (-713.386) (-713.266) (-713.424) [-712.482] * (-701.894) (-706.903) [-709.390] (-717.270) -- 0:01:15
Average standard deviation of split frequencies: 0.006462
676000 -- (-710.021) [-708.986] (-707.187) (-707.444) * [-706.005] (-712.942) (-711.423) (-717.896) -- 0:01:15
677000 -- (-709.794) (-702.677) [-711.352] (-712.189) * (-706.823) (-705.298) [-706.921] (-709.989) -- 0:01:14
678000 -- (-714.362) (-703.473) (-713.822) [-705.762] * (-706.254) (-711.659) (-714.885) [-708.765] -- 0:01:14
679000 -- (-708.655) (-711.598) (-717.659) [-712.372] * (-706.989) (-705.376) [-712.298] (-711.318) -- 0:01:14
680000 -- (-704.643) (-706.085) [-704.154] (-719.603) * [-702.324] (-705.431) (-724.498) (-711.412) -- 0:01:14
Average standard deviation of split frequencies: 0.006325
681000 -- (-712.275) [-709.995] (-717.802) (-714.684) * (-713.002) [-706.893] (-711.120) (-709.528) -- 0:01:14
682000 -- [-710.627] (-718.950) (-710.205) (-709.982) * (-713.908) [-714.771] (-711.725) (-712.287) -- 0:01:13
683000 -- [-709.168] (-713.307) (-712.227) (-705.007) * [-707.310] (-710.918) (-715.639) (-709.973) -- 0:01:13
684000 -- (-704.146) (-706.110) (-706.771) [-705.341] * (-709.377) (-709.975) (-704.395) [-714.257] -- 0:01:13
685000 -- [-706.292] (-706.478) (-721.540) (-706.487) * [-703.220] (-709.510) (-708.406) (-711.601) -- 0:01:13
Average standard deviation of split frequencies: 0.006001
686000 -- (-715.657) (-710.230) (-710.280) [-711.339] * (-711.636) (-715.295) [-708.841] (-710.646) -- 0:01:12
687000 -- (-709.635) [-705.680] (-706.434) (-712.339) * [-712.326] (-714.094) (-711.421) (-709.158) -- 0:01:12
688000 -- (-707.619) (-710.898) (-712.920) [-705.998] * (-719.328) (-709.304) [-705.544] (-710.102) -- 0:01:12
689000 -- (-709.357) [-706.232] (-711.540) (-707.002) * (-710.422) (-710.945) (-711.747) [-707.912] -- 0:01:12
690000 -- [-716.085] (-704.151) (-710.284) (-714.121) * [-703.688] (-721.133) (-705.568) (-708.391) -- 0:01:11
Average standard deviation of split frequencies: 0.005779
691000 -- (-710.078) (-705.242) [-715.474] (-722.343) * (-708.290) (-716.834) [-706.319] (-717.830) -- 0:01:11
692000 -- (-705.712) (-708.409) (-708.296) [-713.222] * [-707.693] (-711.007) (-727.590) (-709.005) -- 0:01:11
693000 -- (-722.236) (-715.987) (-705.044) [-714.208] * (-710.673) [-711.331] (-708.063) (-720.189) -- 0:01:11
694000 -- [-710.918] (-714.412) (-712.092) (-711.300) * (-707.390) [-708.082] (-703.234) (-711.322) -- 0:01:10
695000 -- (-713.421) [-708.373] (-711.816) (-718.237) * (-733.653) [-706.549] (-707.107) (-709.571) -- 0:01:10
Average standard deviation of split frequencies: 0.006186
696000 -- [-707.538] (-715.141) (-716.097) (-704.484) * [-708.955] (-713.861) (-709.916) (-711.696) -- 0:01:10
697000 -- (-712.123) [-708.675] (-718.300) (-708.957) * (-714.343) (-705.918) [-714.480] (-708.416) -- 0:01:10
698000 -- (-707.789) (-703.448) (-711.155) [-709.406] * (-712.885) [-708.100] (-701.852) (-710.067) -- 0:01:10
699000 -- (-706.640) [-708.848] (-706.792) (-713.015) * (-718.581) (-706.140) [-708.580] (-709.468) -- 0:01:09
700000 -- (-709.718) [-709.739] (-711.626) (-709.644) * [-707.049] (-715.475) (-715.018) (-716.990) -- 0:01:09
Average standard deviation of split frequencies: 0.005696
701000 -- (-709.814) (-715.730) [-707.533] (-723.996) * (-713.862) (-707.567) [-709.979] (-715.661) -- 0:01:09
702000 -- (-706.014) [-713.811] (-709.702) (-717.904) * [-714.153] (-709.450) (-710.718) (-709.002) -- 0:01:09
703000 -- [-701.940] (-707.601) (-700.915) (-711.206) * [-707.949] (-712.201) (-713.895) (-715.512) -- 0:01:08
704000 -- (-708.566) (-708.847) (-710.288) [-704.001] * [-706.337] (-712.466) (-714.330) (-709.566) -- 0:01:08
705000 -- (-710.844) [-705.499] (-707.833) (-716.019) * (-712.315) [-707.689] (-708.360) (-708.109) -- 0:01:08
Average standard deviation of split frequencies: 0.005787
706000 -- [-708.170] (-718.039) (-708.239) (-712.417) * (-710.484) (-708.348) (-713.777) [-712.481] -- 0:01:08
707000 -- [-706.664] (-706.786) (-716.066) (-710.018) * (-711.974) (-707.195) [-707.741] (-708.048) -- 0:01:07
708000 -- (-708.587) (-712.018) [-707.622] (-714.190) * (-721.925) [-702.837] (-708.433) (-705.362) -- 0:01:08
709000 -- (-709.033) [-702.462] (-709.525) (-706.700) * (-717.231) [-705.172] (-710.254) (-714.929) -- 0:01:07
710000 -- (-706.264) [-706.911] (-710.412) (-710.321) * (-724.564) [-702.885] (-708.470) (-711.200) -- 0:01:07
Average standard deviation of split frequencies: 0.005882
711000 -- [-705.532] (-709.173) (-708.630) (-712.441) * [-711.281] (-715.908) (-705.735) (-709.568) -- 0:01:07
712000 -- (-704.421) (-710.290) [-701.982] (-710.424) * (-711.551) (-712.642) [-702.260] (-711.061) -- 0:01:06
713000 -- (-712.090) (-709.975) (-703.736) [-701.852] * (-710.121) (-710.385) [-705.247] (-704.748) -- 0:01:06
714000 -- (-708.973) (-708.522) (-707.429) [-706.385] * (-713.422) [-705.277] (-709.455) (-715.597) -- 0:01:06
715000 -- (-712.972) (-706.473) [-722.732] (-711.702) * (-715.020) (-715.051) [-704.805] (-707.051) -- 0:01:06
Average standard deviation of split frequencies: 0.006189
716000 -- [-709.575] (-714.802) (-721.425) (-716.811) * (-702.441) [-704.309] (-709.050) (-706.118) -- 0:01:05
717000 -- (-710.196) [-710.339] (-707.924) (-706.724) * (-707.162) (-708.160) (-701.749) [-709.904] -- 0:01:05
718000 -- (-704.775) [-705.316] (-704.895) (-712.531) * [-712.239] (-714.152) (-710.566) (-704.773) -- 0:01:05
719000 -- (-706.172) (-709.413) (-704.116) [-702.878] * (-711.845) (-720.143) (-710.432) [-705.876] -- 0:01:05
720000 -- (-716.865) (-706.064) (-708.842) [-703.834] * [-709.182] (-707.605) (-711.589) (-713.517) -- 0:01:04
Average standard deviation of split frequencies: 0.006018
721000 -- (-716.230) (-713.816) (-707.098) [-708.384] * [-709.962] (-716.073) (-709.498) (-713.290) -- 0:01:04
722000 -- (-712.987) [-700.486] (-714.384) (-703.375) * (-708.376) [-708.331] (-706.543) (-723.874) -- 0:01:04
723000 -- (-712.571) (-710.348) (-719.722) [-707.644] * (-715.674) [-713.830] (-711.338) (-711.558) -- 0:01:04
724000 -- (-709.042) (-716.449) (-708.818) [-705.040] * [-709.538] (-704.986) (-704.093) (-722.253) -- 0:01:04
725000 -- (-715.388) (-708.823) [-710.470] (-710.206) * [-704.869] (-714.879) (-704.868) (-717.803) -- 0:01:03
Average standard deviation of split frequencies: 0.006320
726000 -- [-710.135] (-715.537) (-710.378) (-708.525) * [-707.526] (-712.794) (-722.071) (-712.803) -- 0:01:03
727000 -- [-710.343] (-704.132) (-705.384) (-708.782) * [-707.904] (-722.809) (-714.842) (-715.244) -- 0:01:03
728000 -- (-706.748) (-708.352) (-703.286) [-707.997] * (-718.141) (-711.507) [-707.125] (-711.160) -- 0:01:03
729000 -- (-714.906) [-706.493] (-709.314) (-710.643) * (-708.882) (-723.484) (-708.680) [-708.246] -- 0:01:02
730000 -- [-705.551] (-717.170) (-715.694) (-710.089) * (-714.791) (-715.694) [-702.770] (-711.810) -- 0:01:02
Average standard deviation of split frequencies: 0.005936
731000 -- (-710.782) [-705.316] (-713.268) (-713.717) * (-713.697) (-720.108) [-706.787] (-711.847) -- 0:01:02
732000 -- [-704.677] (-714.137) (-719.237) (-717.277) * [-703.196] (-716.970) (-705.960) (-710.118) -- 0:01:02
733000 -- (-703.490) [-713.324] (-715.398) (-714.134) * (-707.616) (-716.498) (-708.811) [-701.107] -- 0:01:01
734000 -- (-710.428) [-705.967] (-712.108) (-702.472) * (-708.081) (-726.912) [-710.796] (-713.803) -- 0:01:01
735000 -- (-714.068) [-709.291] (-713.717) (-710.081) * (-715.190) [-706.275] (-710.391) (-703.669) -- 0:01:01
Average standard deviation of split frequencies: 0.005508
736000 -- (-709.501) (-711.900) (-718.560) [-711.789] * (-714.901) [-712.817] (-708.653) (-705.337) -- 0:01:01
737000 -- [-703.715] (-708.409) (-710.311) (-709.210) * (-717.312) (-707.007) (-708.301) [-702.097] -- 0:01:01
738000 -- (-706.769) [-711.582] (-710.696) (-702.315) * (-711.039) (-711.778) (-706.291) [-705.487] -- 0:01:00
739000 -- (-701.154) (-713.314) [-706.941] (-707.952) * [-712.035] (-716.538) (-719.641) (-710.173) -- 0:01:00
740000 -- (-712.848) (-714.866) (-708.840) [-710.985] * [-706.514] (-707.340) (-711.737) (-716.808) -- 0:01:00
Average standard deviation of split frequencies: 0.005346
741000 -- (-713.757) (-710.331) [-711.071] (-707.410) * [-710.007] (-721.408) (-706.797) (-709.651) -- 0:01:00
742000 -- (-713.643) [-709.771] (-716.414) (-714.038) * (-719.206) (-702.632) [-701.991] (-714.288) -- 0:00:59
743000 -- [-719.618] (-706.109) (-714.378) (-713.967) * [-711.306] (-714.723) (-715.711) (-708.710) -- 0:00:59
744000 -- (-703.513) (-711.523) [-704.735] (-720.066) * (-704.732) (-713.157) [-712.993] (-709.425) -- 0:00:59
745000 -- (-716.701) [-709.155] (-709.453) (-705.446) * (-710.079) (-709.002) (-717.299) [-709.739] -- 0:00:59
Average standard deviation of split frequencies: 0.005350
746000 -- (-712.966) (-707.050) (-709.959) [-710.923] * (-717.773) (-710.922) (-718.562) [-703.516] -- 0:00:58
747000 -- (-714.209) (-711.329) [-705.773] (-709.958) * (-712.605) (-710.060) (-709.223) [-707.859] -- 0:00:58
748000 -- (-708.743) (-712.648) (-706.887) [-721.145] * (-713.790) (-708.335) [-710.870] (-711.808) -- 0:00:58
749000 -- (-717.955) (-715.584) (-704.798) [-716.419] * (-709.946) (-704.522) (-710.418) [-711.059] -- 0:00:58
750000 -- (-707.995) [-706.323] (-698.919) (-707.873) * (-719.626) (-718.381) (-709.359) [-703.234] -- 0:00:58
Average standard deviation of split frequencies: 0.005108
751000 -- (-713.830) (-711.895) (-704.004) [-706.911] * (-708.161) (-706.519) [-709.358] (-707.464) -- 0:00:57
752000 -- [-702.095] (-717.556) (-709.589) (-713.382) * (-714.134) (-717.478) (-705.477) [-705.705] -- 0:00:57
753000 -- [-708.290] (-703.697) (-714.186) (-706.109) * (-709.509) (-714.485) (-717.044) [-710.245] -- 0:00:57
754000 -- (-710.606) (-713.614) (-703.501) [-707.553] * (-705.872) [-709.436] (-709.278) (-711.279) -- 0:00:57
755000 -- (-713.486) (-707.459) (-705.142) [-708.868] * (-713.696) (-719.330) [-708.076] (-704.496) -- 0:00:56
Average standard deviation of split frequencies: 0.005113
756000 -- [-703.163] (-716.723) (-715.213) (-705.558) * [-711.027] (-724.547) (-720.881) (-709.243) -- 0:00:56
757000 -- (-707.614) [-704.064] (-704.006) (-714.350) * (-706.414) [-707.246] (-711.385) (-701.037) -- 0:00:56
758000 -- (-707.341) (-717.379) [-705.843] (-715.756) * [-711.058] (-705.404) (-711.773) (-718.920) -- 0:00:56
759000 -- [-704.705] (-709.755) (-709.965) (-706.670) * [-711.003] (-714.303) (-703.914) (-711.769) -- 0:00:55
760000 -- (-702.815) (-707.652) [-706.421] (-712.271) * (-709.570) (-709.292) [-709.086] (-714.965) -- 0:00:55
Average standard deviation of split frequencies: 0.004793
761000 -- (-711.994) [-710.270] (-704.958) (-713.275) * [-705.751] (-710.049) (-709.579) (-709.020) -- 0:00:55
762000 -- [-702.785] (-713.263) (-705.853) (-707.163) * (-708.702) [-709.013] (-716.074) (-712.848) -- 0:00:55
763000 -- (-709.058) [-705.358] (-704.460) (-713.126) * (-716.534) [-703.765] (-715.945) (-708.680) -- 0:00:54
764000 -- (-704.109) (-705.842) (-708.191) [-716.700] * (-708.818) (-709.279) (-710.055) [-710.748] -- 0:00:54
765000 -- (-711.059) (-720.264) [-711.178] (-715.463) * [-705.433] (-707.811) (-709.188) (-715.059) -- 0:00:54
Average standard deviation of split frequencies: 0.004964
766000 -- [-707.524] (-710.576) (-716.521) (-707.224) * (-708.117) (-712.293) (-724.287) [-708.447] -- 0:00:54
767000 -- [-708.258] (-709.667) (-718.785) (-712.146) * (-713.602) (-707.128) (-708.765) [-712.615] -- 0:00:54
768000 -- (-717.822) (-708.434) (-715.276) [-705.021] * (-705.932) (-712.106) [-701.508] (-715.900) -- 0:00:53
769000 -- [-710.799] (-716.234) (-711.059) (-715.083) * (-708.081) (-705.495) [-699.269] (-715.685) -- 0:00:53
770000 -- (-705.650) [-703.490] (-710.339) (-712.205) * (-702.619) (-708.306) (-706.247) [-708.257] -- 0:00:53
Average standard deviation of split frequencies: 0.005179
771000 -- (-707.665) (-708.788) (-709.798) [-709.847] * [-707.194] (-707.494) (-721.043) (-716.790) -- 0:00:53
772000 -- [-703.805] (-707.793) (-713.305) (-714.926) * (-708.611) (-706.765) [-705.142] (-711.150) -- 0:00:52
773000 -- (-712.387) (-707.328) (-714.222) [-712.202] * (-716.014) (-708.568) [-707.983] (-718.245) -- 0:00:52
774000 -- [-708.242] (-719.773) (-712.478) (-711.445) * (-720.636) (-703.418) (-718.492) [-716.236] -- 0:00:52
775000 -- (-703.112) [-704.838] (-716.469) (-717.259) * (-714.890) (-706.602) [-708.630] (-730.419) -- 0:00:52
Average standard deviation of split frequencies: 0.004900
776000 -- (-720.886) (-705.045) (-709.044) [-708.437] * [-709.407] (-705.882) (-706.142) (-721.911) -- 0:00:51
777000 -- [-704.336] (-708.415) (-714.640) (-716.274) * (-715.104) (-706.026) [-712.052] (-714.189) -- 0:00:51
778000 -- (-705.215) [-703.922] (-723.435) (-710.185) * (-711.695) (-705.843) (-715.300) [-705.344] -- 0:00:51
779000 -- (-704.625) [-705.027] (-712.513) (-713.748) * (-718.668) [-707.584] (-705.995) (-712.047) -- 0:00:51
780000 -- (-724.001) (-705.521) [-709.012] (-714.780) * (-709.841) [-706.941] (-709.930) (-707.840) -- 0:00:51
Average standard deviation of split frequencies: 0.005596
781000 -- (-712.409) (-710.722) [-703.716] (-713.375) * (-718.468) (-708.325) (-703.350) [-708.564] -- 0:00:50
782000 -- (-706.200) [-710.370] (-708.292) (-715.123) * (-703.799) (-709.242) [-703.784] (-707.963) -- 0:00:50
783000 -- (-710.189) (-709.878) (-709.793) [-715.426] * (-704.545) (-712.858) (-706.157) [-714.971] -- 0:00:50
784000 -- (-704.081) (-708.314) (-715.188) [-706.910] * (-710.808) (-718.391) (-703.638) [-711.457] -- 0:00:50
785000 -- [-714.044] (-712.136) (-708.746) (-711.336) * (-713.370) (-721.001) [-709.388] (-718.359) -- 0:00:49
Average standard deviation of split frequencies: 0.005678
786000 -- [-701.996] (-703.802) (-713.666) (-706.804) * (-711.365) [-712.517] (-712.837) (-707.980) -- 0:00:49
787000 -- [-699.677] (-703.065) (-724.700) (-705.040) * (-726.945) [-707.727] (-716.239) (-717.696) -- 0:00:49
788000 -- (-715.853) [-701.363] (-710.891) (-710.741) * (-713.170) (-707.267) (-708.190) [-704.972] -- 0:00:49
789000 -- [-704.566] (-706.021) (-708.319) (-705.618) * (-715.155) (-707.025) (-701.001) [-708.979] -- 0:00:48
790000 -- (-715.143) [-706.981] (-713.389) (-703.414) * (-704.717) (-711.725) (-708.150) [-705.164] -- 0:00:48
Average standard deviation of split frequencies: 0.005763
791000 -- (-713.065) (-708.682) [-713.417] (-705.537) * (-708.311) (-706.800) [-698.188] (-709.291) -- 0:00:48
792000 -- (-704.309) [-709.154] (-714.666) (-704.501) * (-708.923) (-708.766) (-707.628) [-703.741] -- 0:00:48
793000 -- (-709.473) [-705.649] (-713.237) (-713.955) * [-710.906] (-716.003) (-723.169) (-719.814) -- 0:00:48
794000 -- (-711.402) (-715.909) (-708.214) [-713.723] * (-713.966) (-708.374) [-709.311] (-717.442) -- 0:00:47
795000 -- (-709.825) (-707.920) [-708.052] (-701.903) * (-704.650) (-707.704) [-708.237] (-718.302) -- 0:00:47
Average standard deviation of split frequencies: 0.005922
796000 -- (-709.115) [-704.106] (-708.286) (-701.990) * (-712.652) (-705.820) [-706.000] (-716.623) -- 0:00:47
797000 -- (-715.570) (-707.974) (-704.360) [-702.910] * [-706.446] (-708.944) (-710.550) (-713.170) -- 0:00:47
798000 -- (-706.978) [-706.391] (-716.551) (-706.550) * (-711.183) (-706.999) [-703.367] (-710.117) -- 0:00:46
799000 -- (-715.331) (-705.598) [-706.898] (-706.587) * (-724.665) (-708.039) [-708.189] (-712.194) -- 0:00:46
800000 -- (-725.557) [-707.555] (-705.243) (-708.201) * [-707.226] (-717.681) (-711.964) (-705.818) -- 0:00:46
Average standard deviation of split frequencies: 0.005770
801000 -- (-702.648) (-712.171) (-706.124) [-712.145] * (-712.506) (-714.747) [-709.177] (-705.851) -- 0:00:46
802000 -- (-710.568) (-711.352) (-715.735) [-704.615] * (-712.193) [-710.226] (-710.737) (-704.816) -- 0:00:45
803000 -- (-713.607) [-709.123] (-714.628) (-710.526) * [-714.459] (-710.802) (-709.448) (-709.957) -- 0:00:45
804000 -- (-705.064) [-704.202] (-708.055) (-704.871) * (-712.397) [-707.504] (-700.429) (-700.481) -- 0:00:45
805000 -- (-710.952) (-706.087) [-703.052] (-710.167) * (-711.430) [-701.254] (-707.635) (-711.471) -- 0:00:45
Average standard deviation of split frequencies: 0.005966
806000 -- (-713.781) (-711.104) [-703.939] (-712.372) * (-710.269) (-708.115) [-703.491] (-708.958) -- 0:00:45
807000 -- (-712.802) (-709.614) (-707.424) [-702.298] * [-709.611] (-706.699) (-704.741) (-713.821) -- 0:00:44
808000 -- (-712.200) (-720.153) (-714.055) [-709.263] * (-713.212) (-713.431) [-714.932] (-719.715) -- 0:00:44
809000 -- (-703.826) (-708.933) [-715.365] (-717.550) * (-719.414) (-711.903) (-711.216) [-722.631] -- 0:00:44
810000 -- (-714.639) [-709.278] (-701.150) (-708.224) * [-712.139] (-708.234) (-715.935) (-708.822) -- 0:00:44
Average standard deviation of split frequencies: 0.006590
811000 -- (-708.919) (-715.852) [-705.273] (-712.080) * (-723.498) (-710.637) (-705.585) [-702.100] -- 0:00:43
812000 -- (-708.598) (-707.308) [-702.893] (-707.097) * (-715.985) (-715.563) (-711.419) [-705.460] -- 0:00:43
813000 -- (-714.873) (-706.804) [-710.161] (-711.229) * (-718.907) [-710.903] (-709.795) (-710.940) -- 0:00:43
814000 -- (-703.609) (-710.466) [-709.384] (-705.271) * (-713.392) [-709.332] (-709.061) (-706.638) -- 0:00:43
815000 -- [-705.735] (-718.218) (-716.378) (-703.295) * (-713.479) [-705.104] (-713.138) (-709.830) -- 0:00:42
Average standard deviation of split frequencies: 0.006855
816000 -- (-704.484) (-705.059) [-708.281] (-708.189) * (-706.336) (-707.931) (-715.649) [-704.964] -- 0:00:42
817000 -- (-713.115) (-706.046) [-702.230] (-717.845) * (-712.271) (-715.557) (-711.663) [-708.519] -- 0:00:42
818000 -- (-708.999) [-705.731] (-714.700) (-705.635) * (-709.705) (-706.200) [-708.094] (-710.907) -- 0:00:42
819000 -- [-717.590] (-705.944) (-706.439) (-709.576) * (-707.106) (-712.261) [-708.604] (-710.347) -- 0:00:41
820000 -- (-702.750) (-708.556) [-703.860] (-710.604) * [-708.291] (-713.990) (-708.490) (-715.049) -- 0:00:41
Average standard deviation of split frequencies: 0.006280
821000 -- (-710.176) (-708.776) (-704.095) [-710.978] * (-705.373) (-716.538) (-709.117) [-721.597] -- 0:00:41
822000 -- (-707.957) [-708.857] (-709.774) (-720.165) * (-720.448) [-711.549] (-711.084) (-706.574) -- 0:00:41
823000 -- (-705.046) (-727.185) (-709.840) [-713.403] * (-712.791) (-708.979) [-710.777] (-708.491) -- 0:00:41
824000 -- (-715.147) [-706.969] (-705.140) (-710.150) * (-714.488) [-710.127] (-713.301) (-713.012) -- 0:00:40
825000 -- [-708.291] (-712.680) (-706.814) (-715.304) * (-711.566) (-710.446) [-710.029] (-705.670) -- 0:00:40
Average standard deviation of split frequencies: 0.006240
826000 -- [-707.920] (-711.641) (-721.191) (-709.295) * (-709.714) (-706.635) (-712.361) [-703.065] -- 0:00:40
827000 -- [-712.831] (-710.354) (-708.703) (-713.061) * [-718.348] (-705.691) (-713.423) (-708.068) -- 0:00:40
828000 -- (-721.487) (-706.171) [-702.286] (-710.295) * (-711.214) [-707.582] (-707.077) (-718.899) -- 0:00:39
829000 -- (-709.463) (-706.011) (-703.580) [-707.919] * (-713.414) [-705.104] (-706.010) (-711.361) -- 0:00:39
830000 -- [-707.747] (-706.550) (-711.155) (-703.010) * [-709.344] (-711.652) (-705.314) (-707.863) -- 0:00:39
Average standard deviation of split frequencies: 0.006205
831000 -- (-704.970) [-707.569] (-712.988) (-708.681) * (-715.819) (-712.335) (-708.662) [-706.000] -- 0:00:39
832000 -- (-708.955) (-721.508) (-702.437) [-704.433] * (-711.549) [-701.680] (-715.839) (-705.673) -- 0:00:38
833000 -- (-720.278) (-702.602) [-701.894] (-716.752) * [-708.857] (-704.321) (-705.701) (-703.481) -- 0:00:38
834000 -- (-712.918) (-710.558) [-713.393] (-710.893) * (-705.937) [-702.749] (-709.083) (-714.074) -- 0:00:38
835000 -- (-708.282) (-718.338) (-716.341) [-712.082] * (-710.427) (-710.149) [-710.707] (-707.382) -- 0:00:38
Average standard deviation of split frequencies: 0.006503
836000 -- [-705.132] (-705.744) (-712.837) (-709.856) * (-699.938) [-702.128] (-705.385) (-712.818) -- 0:00:38
837000 -- (-709.438) [-705.067] (-717.316) (-706.047) * (-703.298) (-713.876) (-711.272) [-706.093] -- 0:00:37
838000 -- (-720.499) [-711.547] (-709.259) (-705.043) * (-714.621) (-709.281) (-706.673) [-711.520] -- 0:00:37
839000 -- (-702.631) [-704.637] (-708.674) (-708.592) * [-705.521] (-703.838) (-706.420) (-718.191) -- 0:00:37
840000 -- [-709.774] (-707.492) (-706.200) (-711.613) * (-707.436) (-713.080) [-706.524] (-714.419) -- 0:00:37
Average standard deviation of split frequencies: 0.005458
841000 -- (-711.808) [-701.380] (-712.235) (-712.565) * (-707.544) [-705.339] (-717.227) (-712.568) -- 0:00:36
842000 -- [-703.330] (-714.985) (-709.783) (-707.235) * [-703.908] (-709.058) (-709.564) (-709.141) -- 0:00:36
843000 -- (-709.404) (-706.872) [-707.753] (-708.005) * [-702.336] (-715.157) (-710.361) (-706.443) -- 0:00:36
844000 -- (-715.646) (-707.257) (-703.913) [-708.511] * (-707.949) (-711.173) [-706.602] (-714.091) -- 0:00:36
845000 -- [-706.054] (-714.493) (-707.086) (-709.848) * [-710.541] (-710.629) (-714.089) (-719.211) -- 0:00:35
Average standard deviation of split frequencies: 0.005461
846000 -- (-712.793) [-705.112] (-717.132) (-709.420) * (-704.471) (-706.503) (-710.938) [-710.786] -- 0:00:35
847000 -- (-709.662) (-702.636) [-704.232] (-714.952) * [-706.935] (-710.744) (-709.779) (-710.689) -- 0:00:35
848000 -- [-706.887] (-704.832) (-727.005) (-707.521) * (-713.318) [-706.018] (-715.690) (-708.448) -- 0:00:35
849000 -- (-711.427) [-704.134] (-707.976) (-711.504) * [-713.109] (-709.093) (-718.345) (-711.775) -- 0:00:35
850000 -- (-713.963) (-704.813) (-703.664) [-703.780] * (-718.038) [-707.847] (-711.751) (-712.851) -- 0:00:34
Average standard deviation of split frequencies: 0.005283
851000 -- [-707.327] (-718.239) (-708.094) (-715.552) * (-710.373) [-702.241] (-718.209) (-711.328) -- 0:00:34
852000 -- (-709.813) (-712.160) (-711.380) [-708.072] * (-704.063) [-702.356] (-716.779) (-714.327) -- 0:00:34
853000 -- (-704.247) (-711.898) [-707.588] (-714.359) * (-711.090) (-713.235) (-710.079) [-705.606] -- 0:00:34
854000 -- (-715.283) (-710.143) (-706.032) [-706.737] * (-722.316) (-711.489) (-709.778) [-709.552] -- 0:00:33
855000 -- (-709.770) (-713.930) [-712.607] (-725.404) * [-707.530] (-704.856) (-713.066) (-721.491) -- 0:00:33
Average standard deviation of split frequencies: 0.005507
856000 -- (-711.578) (-717.855) (-703.401) [-702.688] * [-712.966] (-709.718) (-714.675) (-701.171) -- 0:00:33
857000 -- [-705.125] (-713.153) (-714.612) (-709.259) * (-708.917) (-714.028) (-710.820) [-707.365] -- 0:00:33
858000 -- [-713.926] (-711.068) (-713.004) (-713.098) * [-699.876] (-715.712) (-715.048) (-707.175) -- 0:00:32
859000 -- [-706.453] (-704.856) (-706.864) (-710.696) * [-711.642] (-708.069) (-721.390) (-705.925) -- 0:00:32
860000 -- (-703.795) [-707.420] (-706.913) (-716.935) * (-712.817) [-708.628] (-703.830) (-715.145) -- 0:00:32
Average standard deviation of split frequencies: 0.005623
861000 -- (-712.409) [-701.574] (-710.255) (-715.818) * [-707.584] (-709.530) (-707.343) (-707.021) -- 0:00:32
862000 -- (-704.624) (-711.675) (-706.903) [-710.822] * (-719.570) [-711.894] (-704.561) (-717.838) -- 0:00:32
863000 -- (-714.032) [-708.422] (-710.564) (-724.275) * (-706.970) (-711.017) (-715.224) [-704.252] -- 0:00:31
864000 -- (-710.074) (-707.215) (-706.138) [-707.611] * [-706.281] (-715.832) (-710.120) (-709.010) -- 0:00:31
865000 -- [-715.561] (-713.270) (-711.512) (-706.735) * (-710.783) (-704.871) [-703.671] (-715.381) -- 0:00:31
Average standard deviation of split frequencies: 0.006024
866000 -- (-711.674) (-705.934) [-705.656] (-717.007) * (-714.691) (-713.466) (-706.076) [-711.430] -- 0:00:31
867000 -- (-713.780) [-707.994] (-706.208) (-712.937) * (-716.820) (-707.121) [-706.738] (-712.506) -- 0:00:30
868000 -- (-713.945) (-704.019) [-709.556] (-708.456) * (-711.815) (-713.138) [-708.178] (-717.239) -- 0:00:30
869000 -- (-709.148) [-704.018] (-706.420) (-712.528) * (-715.225) (-706.284) [-707.742] (-711.220) -- 0:00:30
870000 -- (-722.170) (-706.533) (-713.588) [-708.360] * (-709.793) (-711.474) [-718.467] (-713.588) -- 0:00:30
Average standard deviation of split frequencies: 0.006389
871000 -- (-714.222) (-710.172) [-710.213] (-709.491) * (-707.930) (-711.197) [-707.734] (-719.581) -- 0:00:29
872000 -- [-704.072] (-710.528) (-703.583) (-703.182) * (-710.197) (-707.136) [-712.175] (-704.971) -- 0:00:29
873000 -- [-707.294] (-701.631) (-711.115) (-720.434) * [-703.018] (-713.084) (-710.077) (-717.380) -- 0:00:29
874000 -- (-712.814) (-712.791) [-709.740] (-715.569) * [-716.052] (-706.502) (-713.741) (-708.273) -- 0:00:29
875000 -- [-709.202] (-707.425) (-709.303) (-707.772) * (-707.564) [-707.734] (-717.882) (-714.205) -- 0:00:29
Average standard deviation of split frequencies: 0.006206
876000 -- (-708.480) [-701.632] (-710.022) (-716.530) * (-719.843) (-710.666) (-712.890) [-704.828] -- 0:00:28
877000 -- (-705.407) (-708.472) (-715.496) [-707.935] * (-715.538) (-705.777) [-710.359] (-715.354) -- 0:00:28
878000 -- (-708.695) (-708.203) (-715.349) [-709.639] * (-711.870) [-708.693] (-715.249) (-704.071) -- 0:00:28
879000 -- (-706.592) (-710.898) (-709.463) [-711.710] * (-703.491) [-707.722] (-708.894) (-703.181) -- 0:00:28
880000 -- [-708.630] (-705.388) (-714.910) (-706.627) * (-710.581) (-708.095) (-700.544) [-709.480] -- 0:00:27
Average standard deviation of split frequencies: 0.006031
881000 -- [-705.266] (-711.372) (-734.040) (-706.462) * (-711.808) [-711.248] (-701.236) (-708.804) -- 0:00:27
882000 -- [-714.267] (-703.380) (-718.047) (-713.574) * [-715.535] (-712.139) (-701.494) (-714.832) -- 0:00:27
883000 -- (-708.810) (-710.827) [-710.502] (-705.829) * (-715.141) (-709.764) (-705.249) [-706.170] -- 0:00:27
884000 -- [-709.663] (-705.959) (-717.259) (-713.183) * [-709.336] (-711.875) (-704.914) (-710.575) -- 0:00:26
885000 -- [-711.096] (-714.187) (-720.754) (-713.191) * (-712.408) (-712.443) (-713.228) [-702.477] -- 0:00:26
Average standard deviation of split frequencies: 0.005746
886000 -- [-704.780] (-716.862) (-706.317) (-706.463) * (-703.533) (-711.565) [-704.271] (-711.700) -- 0:00:26
887000 -- (-717.180) [-705.866] (-710.847) (-715.627) * (-709.244) (-713.960) (-703.247) [-708.869] -- 0:00:26
888000 -- (-713.342) [-709.328] (-710.258) (-711.811) * [-703.935] (-712.235) (-710.726) (-707.695) -- 0:00:25
889000 -- (-709.940) [-711.626] (-714.750) (-715.029) * (-706.350) (-721.926) [-704.179] (-705.973) -- 0:00:25
890000 -- [-713.210] (-708.822) (-710.761) (-718.892) * (-722.754) (-709.570) (-720.051) [-705.168] -- 0:00:25
Average standard deviation of split frequencies: 0.005575
891000 -- [-702.689] (-708.557) (-712.519) (-711.238) * [-702.845] (-712.467) (-702.229) (-711.978) -- 0:00:25
892000 -- (-716.557) [-704.867] (-710.506) (-721.649) * (-709.290) (-716.335) (-706.635) [-711.019] -- 0:00:25
893000 -- (-708.999) [-706.698] (-711.311) (-707.145) * (-711.069) [-707.700] (-718.395) (-711.580) -- 0:00:24
894000 -- (-710.315) (-710.735) (-708.861) [-700.887] * (-718.017) [-706.617] (-711.181) (-713.291) -- 0:00:24
895000 -- [-712.788] (-715.319) (-706.516) (-711.888) * (-728.360) (-713.934) [-709.176] (-715.984) -- 0:00:24
Average standard deviation of split frequencies: 0.005472
896000 -- [-710.844] (-713.761) (-709.473) (-713.920) * (-712.460) (-709.356) (-706.646) [-703.800] -- 0:00:24
897000 -- (-716.990) (-713.301) [-707.730] (-711.469) * (-707.729) (-704.235) (-717.515) [-707.176] -- 0:00:23
898000 -- [-705.781] (-711.537) (-713.727) (-707.841) * (-712.334) (-709.522) [-708.800] (-714.367) -- 0:00:23
899000 -- (-701.692) [-713.719] (-717.625) (-707.012) * (-709.004) [-709.683] (-718.552) (-714.285) -- 0:00:23
900000 -- (-709.018) [-709.107] (-708.564) (-715.186) * (-702.053) (-717.707) [-710.160] (-714.707) -- 0:00:23
Average standard deviation of split frequencies: 0.005653
901000 -- (-722.842) (-711.412) (-713.884) [-707.843] * (-708.116) (-708.191) (-718.120) [-709.945] -- 0:00:22
902000 -- [-706.811] (-709.414) (-716.891) (-712.613) * (-711.103) (-709.451) (-706.267) [-707.683] -- 0:00:22
903000 -- (-716.384) (-713.361) (-705.358) [-706.705] * (-712.147) (-704.370) (-715.766) [-703.978] -- 0:00:22
904000 -- (-717.453) (-706.623) (-707.230) [-704.740] * (-709.936) (-718.801) (-706.937) [-705.024] -- 0:00:22
905000 -- [-708.061] (-715.446) (-706.199) (-713.503) * (-709.540) (-703.761) (-707.613) [-715.463] -- 0:00:22
Average standard deviation of split frequencies: 0.005862
906000 -- (-717.379) (-709.722) [-706.845] (-714.429) * (-704.375) (-710.040) [-706.349] (-712.979) -- 0:00:21
907000 -- (-708.807) (-714.384) (-718.879) [-701.875] * (-706.939) [-702.981] (-713.663) (-708.716) -- 0:00:21
908000 -- (-713.162) (-707.536) (-706.525) [-706.278] * [-701.537] (-713.979) (-707.340) (-723.540) -- 0:00:21
909000 -- (-702.373) (-708.208) [-708.559] (-710.096) * (-714.322) (-712.495) [-710.048] (-716.710) -- 0:00:21
910000 -- (-707.943) (-709.509) [-712.163] (-717.253) * (-706.529) [-708.902] (-703.884) (-715.093) -- 0:00:20
Average standard deviation of split frequencies: 0.005936
911000 -- (-710.779) (-708.049) (-716.889) [-709.366] * (-709.569) (-708.317) (-705.888) [-708.301] -- 0:00:20
912000 -- (-709.638) (-703.617) (-718.050) [-703.630] * (-714.080) [-704.079] (-707.584) (-709.425) -- 0:00:20
913000 -- (-720.171) (-717.900) (-711.037) [-709.725] * [-704.788] (-712.958) (-710.720) (-710.266) -- 0:00:20
914000 -- (-711.496) (-707.177) [-707.561] (-709.701) * (-708.161) (-721.409) (-715.242) [-711.223] -- 0:00:19
915000 -- [-704.620] (-719.230) (-714.749) (-709.005) * (-701.253) (-717.779) [-709.125] (-706.031) -- 0:00:19
Average standard deviation of split frequencies: 0.006210
916000 -- (-706.128) (-712.070) (-703.276) [-710.708] * (-711.983) (-710.443) [-714.511] (-712.023) -- 0:00:19
917000 -- (-713.724) [-705.949] (-703.831) (-721.365) * (-708.022) [-707.532] (-711.913) (-719.037) -- 0:00:19
918000 -- [-707.351] (-708.917) (-716.761) (-710.260) * (-715.491) (-705.207) [-715.153] (-713.080) -- 0:00:19
919000 -- (-705.956) (-700.345) (-718.234) [-710.831] * (-723.354) (-714.443) (-708.646) [-716.707] -- 0:00:18
920000 -- (-711.455) (-712.141) [-705.191] (-703.162) * [-709.088] (-707.904) (-705.187) (-705.707) -- 0:00:18
Average standard deviation of split frequencies: 0.006690
921000 -- (-709.413) (-709.970) [-714.244] (-707.789) * [-705.177] (-706.297) (-706.090) (-713.700) -- 0:00:18
922000 -- (-709.301) (-704.081) (-710.460) [-706.388] * (-709.088) (-704.019) (-713.671) [-721.543] -- 0:00:18
923000 -- (-710.958) (-708.837) [-702.695] (-704.033) * (-708.716) (-706.455) [-704.257] (-724.883) -- 0:00:17
924000 -- (-707.260) [-711.383] (-706.025) (-716.875) * (-704.042) [-701.929] (-708.253) (-715.364) -- 0:00:17
925000 -- (-704.148) (-707.051) [-710.806] (-713.381) * [-707.608] (-709.162) (-710.194) (-703.016) -- 0:00:17
Average standard deviation of split frequencies: 0.006482
926000 -- (-710.579) [-707.325] (-708.384) (-706.688) * [-705.189] (-715.801) (-712.316) (-711.133) -- 0:00:17
927000 -- (-707.933) (-718.676) (-711.878) [-710.110] * (-703.618) (-708.641) [-700.757] (-710.345) -- 0:00:16
928000 -- (-715.432) (-714.256) [-703.899] (-707.207) * (-713.593) (-712.949) [-709.744] (-710.351) -- 0:00:16
929000 -- (-710.340) (-713.541) [-712.254] (-710.851) * (-707.576) (-709.194) [-708.812] (-712.545) -- 0:00:16
930000 -- (-714.486) (-718.517) (-711.382) [-707.850] * (-702.877) (-711.334) [-705.001] (-702.584) -- 0:00:16
Average standard deviation of split frequencies: 0.006348
931000 -- (-709.878) [-706.839] (-711.999) (-711.096) * (-713.446) (-709.039) [-710.478] (-704.255) -- 0:00:16
932000 -- (-709.860) (-711.069) (-709.738) [-706.355] * [-705.767] (-708.956) (-709.586) (-707.125) -- 0:00:15
933000 -- (-702.857) [-704.229] (-710.844) (-720.682) * [-705.548] (-714.171) (-715.867) (-704.497) -- 0:00:15
934000 -- [-707.868] (-713.587) (-709.554) (-708.282) * (-712.862) [-708.608] (-707.830) (-718.258) -- 0:00:15
935000 -- (-714.487) (-712.255) (-710.048) [-702.337] * (-704.410) (-710.179) [-708.830] (-713.148) -- 0:00:15
Average standard deviation of split frequencies: 0.006312
936000 -- (-716.884) (-704.391) (-708.177) [-705.812] * (-701.843) (-709.934) (-710.079) [-710.728] -- 0:00:14
937000 -- [-712.087] (-709.662) (-706.280) (-702.794) * (-708.508) (-704.534) (-704.162) [-705.441] -- 0:00:14
938000 -- [-707.978] (-707.948) (-711.157) (-706.057) * (-708.083) (-709.719) (-714.327) [-706.616] -- 0:00:14
939000 -- (-705.365) (-701.510) [-702.817] (-706.607) * (-711.037) (-712.846) (-708.464) [-709.953] -- 0:00:14
940000 -- (-717.466) (-708.585) (-705.710) [-711.968] * [-706.530] (-714.004) (-714.496) (-700.048) -- 0:00:13
Average standard deviation of split frequencies: 0.006080
941000 -- (-710.204) (-711.342) [-708.964] (-711.773) * [-706.881] (-711.789) (-711.455) (-707.559) -- 0:00:13
942000 -- [-709.046] (-716.706) (-711.949) (-706.906) * (-722.499) (-707.878) (-706.729) [-707.781] -- 0:00:13
943000 -- [-708.317] (-705.357) (-707.127) (-707.967) * (-713.917) (-711.258) (-709.822) [-706.317] -- 0:00:13
944000 -- [-702.322] (-709.072) (-710.758) (-711.368) * (-711.658) (-717.177) [-701.055] (-702.630) -- 0:00:12
945000 -- (-729.799) (-718.871) (-715.079) [-705.635] * (-709.712) (-712.028) (-706.223) [-710.302] -- 0:00:12
Average standard deviation of split frequencies: 0.006113
946000 -- (-709.998) (-710.846) [-707.726] (-704.896) * (-711.611) [-701.447] (-712.378) (-707.541) -- 0:00:12
947000 -- (-714.046) [-709.780] (-709.501) (-708.850) * (-719.163) (-708.740) [-703.294] (-710.561) -- 0:00:12
948000 -- (-706.126) [-707.553] (-714.540) (-707.098) * (-709.790) (-711.319) [-700.772] (-710.814) -- 0:00:12
949000 -- [-718.219] (-710.491) (-715.013) (-705.055) * [-704.541] (-710.052) (-713.408) (-714.602) -- 0:00:11
950000 -- (-707.659) (-706.562) [-718.535] (-704.055) * [-709.875] (-717.449) (-710.039) (-709.378) -- 0:00:11
Average standard deviation of split frequencies: 0.006149
951000 -- [-716.282] (-713.595) (-705.390) (-718.756) * (-710.266) (-706.067) [-703.871] (-708.895) -- 0:00:11
952000 -- (-723.230) [-706.680] (-706.133) (-714.893) * (-716.701) (-711.695) (-709.691) [-708.530] -- 0:00:11
953000 -- [-703.654] (-705.714) (-715.951) (-705.155) * (-716.135) (-706.205) [-703.233] (-712.012) -- 0:00:10
954000 -- (-718.643) (-715.973) [-705.477] (-708.697) * (-705.649) (-712.453) [-709.469] (-704.737) -- 0:00:10
955000 -- (-714.224) (-714.334) (-707.308) [-710.416] * (-707.088) (-723.889) (-707.989) [-703.592] -- 0:00:10
Average standard deviation of split frequencies: 0.005884
956000 -- (-708.561) (-711.449) (-711.810) [-710.235] * (-711.468) (-708.780) (-704.009) [-710.427] -- 0:00:10
957000 -- (-714.839) (-718.706) [-704.242] (-715.302) * (-707.569) [-719.167] (-708.431) (-709.339) -- 0:00:09
958000 -- (-708.164) (-704.852) (-713.153) [-705.757] * (-703.966) [-704.882] (-717.241) (-703.031) -- 0:00:09
959000 -- (-717.419) (-712.057) (-709.966) [-705.790] * [-706.715] (-704.556) (-705.478) (-707.551) -- 0:00:09
960000 -- [-702.740] (-713.658) (-708.586) (-719.367) * (-712.878) [-699.143] (-710.859) (-702.825) -- 0:00:09
Average standard deviation of split frequencies: 0.005823
961000 -- (-710.093) (-710.593) (-708.567) [-708.447] * [-703.216] (-701.465) (-714.560) (-706.205) -- 0:00:09
962000 -- [-705.678] (-706.861) (-711.056) (-709.216) * (-708.451) [-710.557] (-710.194) (-705.145) -- 0:00:08
963000 -- [-705.457] (-711.426) (-710.761) (-707.460) * [-705.527] (-705.881) (-717.243) (-704.506) -- 0:00:08
964000 -- (-708.447) (-706.995) (-705.796) [-705.314] * (-711.338) (-703.841) [-702.367] (-706.272) -- 0:00:08
965000 -- (-704.498) (-710.505) (-712.639) [-710.492] * (-710.790) (-705.071) (-711.619) [-708.129] -- 0:00:08
Average standard deviation of split frequencies: 0.005856
966000 -- [-701.626] (-703.539) (-708.716) (-707.665) * (-708.134) (-713.726) [-711.850] (-711.121) -- 0:00:07
967000 -- [-715.210] (-706.416) (-710.951) (-708.637) * [-707.621] (-711.511) (-705.234) (-713.180) -- 0:00:07
968000 -- (-715.773) (-704.079) (-716.529) [-704.384] * (-714.046) (-709.698) [-704.021] (-711.036) -- 0:00:07
969000 -- (-720.951) (-710.770) [-705.742] (-707.084) * [-704.433] (-713.930) (-711.158) (-702.394) -- 0:00:07
970000 -- (-707.073) [-715.518] (-706.304) (-716.253) * (-712.352) (-708.248) (-712.229) [-707.807] -- 0:00:06
Average standard deviation of split frequencies: 0.005536
971000 -- [-709.181] (-709.129) (-710.211) (-720.782) * (-716.090) [-711.324] (-702.321) (-712.088) -- 0:00:06
972000 -- (-709.131) (-704.869) [-712.981] (-708.599) * (-707.222) (-714.974) (-707.623) [-713.306] -- 0:00:06
973000 -- [-709.354] (-719.749) (-704.944) (-710.543) * (-705.473) [-701.809] (-710.052) (-708.639) -- 0:00:06
974000 -- [-706.498] (-717.708) (-710.052) (-722.421) * (-710.171) [-704.432] (-713.501) (-719.234) -- 0:00:06
975000 -- (-714.974) (-713.200) [-714.623] (-711.475) * (-706.768) [-711.279] (-711.111) (-713.815) -- 0:00:05
Average standard deviation of split frequencies: 0.005635
976000 -- (-707.478) (-710.632) [-705.793] (-713.528) * (-708.449) (-710.926) (-709.934) [-704.765] -- 0:00:05
977000 -- (-712.411) (-710.570) [-712.053] (-704.296) * [-702.773] (-705.203) (-714.624) (-716.907) -- 0:00:05
978000 -- (-708.585) (-711.017) (-708.984) [-708.472] * (-712.674) [-713.696] (-708.249) (-709.601) -- 0:00:05
979000 -- (-710.472) (-715.883) [-711.576] (-711.820) * (-716.301) (-712.810) (-715.905) [-708.294] -- 0:00:04
980000 -- (-702.912) (-709.125) (-704.238) [-702.736] * (-713.363) [-705.776] (-710.711) (-703.923) -- 0:00:04
Average standard deviation of split frequencies: 0.005448
981000 -- [-703.139] (-713.938) (-708.650) (-714.911) * (-718.588) [-707.293] (-714.060) (-706.868) -- 0:00:04
982000 -- (-709.358) (-709.080) [-710.625] (-710.428) * [-707.406] (-715.273) (-717.313) (-717.799) -- 0:00:04
983000 -- [-703.264] (-708.965) (-706.302) (-710.205) * [-708.400] (-709.556) (-713.863) (-702.113) -- 0:00:03
984000 -- (-712.955) (-713.125) (-707.353) [-707.168] * (-716.003) [-710.563] (-717.885) (-710.679) -- 0:00:03
985000 -- [-709.565] (-704.766) (-711.446) (-709.891) * [-707.855] (-711.889) (-709.800) (-707.666) -- 0:00:03
Average standard deviation of split frequencies: 0.005450
986000 -- (-705.738) [-704.622] (-705.217) (-711.803) * [-707.006] (-705.997) (-708.852) (-707.212) -- 0:00:03
987000 -- [-708.772] (-705.543) (-713.453) (-711.795) * [-702.682] (-708.740) (-712.106) (-712.687) -- 0:00:03
988000 -- (-704.233) (-712.278) [-704.105] (-710.440) * (-705.720) [-707.032] (-701.982) (-711.397) -- 0:00:02
989000 -- [-709.499] (-709.166) (-710.700) (-718.746) * (-711.005) [-707.794] (-709.889) (-708.761) -- 0:00:02
990000 -- (-708.950) (-712.133) [-707.269] (-714.974) * [-703.734] (-707.419) (-706.159) (-715.838) -- 0:00:02
Average standard deviation of split frequencies: 0.005996
991000 -- (-713.177) (-710.998) [-709.783] (-711.171) * (-708.321) [-711.834] (-713.859) (-708.904) -- 0:00:02
992000 -- [-714.433] (-712.998) (-707.216) (-716.963) * (-707.843) (-720.481) (-704.606) [-708.722] -- 0:00:01
993000 -- (-702.319) [-710.048] (-710.501) (-707.699) * (-711.489) (-708.636) [-707.701] (-710.144) -- 0:00:01
994000 -- (-715.900) [-714.860] (-712.414) (-713.207) * (-709.153) [-713.426] (-706.325) (-710.946) -- 0:00:01
995000 -- (-718.773) (-714.095) (-707.507) [-704.021] * (-711.584) (-727.165) (-716.615) [-703.685] -- 0:00:01
Average standard deviation of split frequencies: 0.005995
996000 -- [-713.943] (-712.702) (-707.016) (-704.938) * [-711.019] (-712.926) (-714.761) (-705.141) -- 0:00:00
997000 -- (-712.798) (-712.186) (-714.015) [-704.674] * (-715.622) (-715.340) [-707.073] (-718.207) -- 0:00:00
998000 -- (-712.159) [-707.249] (-708.154) (-699.645) * (-708.783) (-709.527) (-709.609) [-707.745] -- 0:00:00
999000 -- [-707.021] (-713.853) (-713.857) (-708.346) * (-711.618) [-702.617] (-708.493) (-714.483) -- 0:00:00
1000000 -- (-707.298) (-715.394) [-703.220] (-709.291) * (-713.134) (-706.963) (-707.531) [-703.477] -- 0:00:00
Average standard deviation of split frequencies: 0.006093
Analysis completed in 3 mins 52 seconds
Analysis used 231.00 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -695.78
Likelihood of best state for "cold" chain of run 2 was -696.08
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
66.9 % ( 68 %) Dirichlet(Revmat{all})
82.6 % ( 80 %) Slider(Revmat{all})
35.5 % ( 30 %) Dirichlet(Pi{all})
36.3 % ( 24 %) Slider(Pi{all})
80.0 % ( 63 %) Multiplier(Alpha{1,2})
69.7 % ( 46 %) Multiplier(Alpha{3})
89.9 % ( 82 %) Slider(Pinvar{all})
29.5 % ( 33 %) ExtSPR(Tau{all},V{all})
18.4 % ( 24 %) ExtTBR(Tau{all},V{all})
30.2 % ( 33 %) NNI(Tau{all},V{all})
26.8 % ( 32 %) ParsSPR(Tau{all},V{all})
27.4 % ( 30 %) Multiplier(V{all})
60.1 % ( 61 %) Nodeslider(V{all})
26.5 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
67.1 % ( 58 %) Dirichlet(Revmat{all})
82.5 % ( 79 %) Slider(Revmat{all})
36.2 % ( 26 %) Dirichlet(Pi{all})
36.0 % ( 30 %) Slider(Pi{all})
79.7 % ( 63 %) Multiplier(Alpha{1,2})
70.3 % ( 46 %) Multiplier(Alpha{3})
89.9 % ( 84 %) Slider(Pinvar{all})
29.7 % ( 28 %) ExtSPR(Tau{all},V{all})
18.3 % ( 18 %) ExtTBR(Tau{all},V{all})
30.5 % ( 34 %) NNI(Tau{all},V{all})
26.8 % ( 21 %) ParsSPR(Tau{all},V{all})
27.3 % ( 19 %) Multiplier(V{all})
59.9 % ( 55 %) Nodeslider(V{all})
26.5 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.73 0.51 0.34
2 | 166906 0.75 0.54
3 | 166484 166610 0.77
4 | 167059 166757 166184
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.73 0.51 0.34
2 | 166379 0.75 0.54
3 | 166883 166351 0.76
4 | 167166 166477 166744
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -705.73
| 1 1 2 |
| 2 |
| 2 1 |
| 1 *2 1 2 1 1 1 2 2 1|
| 2 *21 2 1 2 21 2 1 |
| 1 2 2 1 1 2 2 2 |
|2 2 1 1 1 22 1 11 1 221* 2 |
| 1 21 1 2 *1 11 2 2 12 1 1 1 12|
|1 2211 2 21 22 11 1 2 1 21 |
| 2 1 1 1 2 1 1 2 2 2 22 2 |
| 2 1 1 2 1 1 2 1 |
| 2 2 2 |
| 2 1 1 2 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -710.01
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -703.14 -716.85
2 -702.89 -716.72
--------------------------------------
TOTAL -703.01 -716.79
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.137219 0.000772 0.090181 0.195560 0.134036 1436.03 1468.52 1.000
r(A<->C){all} 0.142139 0.003068 0.040991 0.252309 0.136241 591.71 638.09 1.003
r(A<->G){all} 0.206596 0.004824 0.081293 0.345350 0.200527 456.56 562.42 1.003
r(A<->T){all} 0.028771 0.000585 0.000036 0.076125 0.022590 785.50 852.35 1.000
r(C<->G){all} 0.148260 0.004604 0.029413 0.279059 0.139649 413.33 495.43 1.003
r(C<->T){all} 0.392365 0.006646 0.229704 0.538297 0.390546 392.22 419.16 1.001
r(G<->T){all} 0.081868 0.002216 0.004432 0.172873 0.075473 588.69 662.94 1.001
pi(A){all} 0.293170 0.000538 0.245984 0.336636 0.292772 1125.72 1157.47 1.000
pi(C){all} 0.221540 0.000430 0.182696 0.262546 0.220899 1350.15 1383.80 1.000
pi(G){all} 0.189728 0.000397 0.151014 0.227417 0.189401 1159.85 1242.47 1.000
pi(T){all} 0.295562 0.000555 0.253335 0.346935 0.295035 1146.35 1263.27 1.000
alpha{1,2} 0.476700 0.413951 0.000421 1.646622 0.255969 942.23 945.72 1.000
alpha{3} 1.643649 1.358839 0.072987 3.952693 1.351692 1227.17 1330.42 1.000
pinvar{all} 0.298424 0.030799 0.004085 0.608310 0.284593 963.29 1033.08 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C10
3 -- C2
4 -- C3
5 -- C4
6 -- C5
7 -- C6
8 -- C7
9 -- C8
10 -- C9
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
----------------
1 -- .*********
2 -- .*........
3 -- ..*.......
4 -- ...*......
5 -- ....*.....
6 -- .....*....
7 -- ......*...
8 -- .......*..
9 -- ........*.
10 -- .........*
11 -- ....***...
12 -- .*..***.**
13 -- .*..***...
14 -- .....**...
15 -- .*..***.*.
16 -- .*..******
17 -- ..**......
18 -- .*.****.**
19 -- .*.*******
20 -- .**.******
21 -- .******.**
22 -- ..*....*..
23 -- ..**...*..
24 -- ...*...*..
25 -- .**.***.**
----------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 2995 0.997668 0.000471 0.997335 0.998001 2
13 2962 0.986676 0.000000 0.986676 0.986676 2
14 2949 0.982345 0.000471 0.982012 0.982678 2
15 2813 0.937042 0.008951 0.930713 0.943371 2
16 620 0.206529 0.003769 0.203864 0.209194 2
17 618 0.205863 0.009422 0.199201 0.212525 2
18 616 0.205197 0.002827 0.203198 0.207195 2
19 610 0.203198 0.007537 0.197868 0.208528 2
20 603 0.200866 0.007066 0.195869 0.205863 2
21 598 0.199201 0.014133 0.189207 0.209194 2
22 596 0.198534 0.000000 0.198534 0.198534 2
23 584 0.194537 0.010364 0.187209 0.201865 2
24 577 0.192205 0.008009 0.186542 0.197868 2
25 575 0.191539 0.018373 0.178548 0.204530 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.002143 0.000005 0.000001 0.006342 0.001503 1.001 2
length{all}[2] 0.004047 0.000014 0.000000 0.011461 0.003041 1.000 2
length{all}[3] 0.002128 0.000005 0.000000 0.006249 0.001462 1.000 2
length{all}[4] 0.002119 0.000005 0.000000 0.006565 0.001421 1.003 2
length{all}[5] 0.009568 0.000031 0.000513 0.020045 0.008677 1.000 2
length{all}[6] 0.002305 0.000006 0.000001 0.007135 0.001562 1.000 2
length{all}[7] 0.002298 0.000005 0.000001 0.006999 0.001592 1.000 2
length{all}[8] 0.002130 0.000005 0.000000 0.006620 0.001430 1.000 2
length{all}[9] 0.004449 0.000011 0.000011 0.010688 0.003697 1.000 2
length{all}[10] 0.002171 0.000005 0.000001 0.006652 0.001463 1.000 2
length{all}[11] 0.067418 0.000333 0.036057 0.105358 0.065376 1.000 2
length{all}[12] 0.006575 0.000016 0.000546 0.014359 0.005732 1.000 2
length{all}[13] 0.011772 0.000033 0.001797 0.022838 0.010856 1.000 2
length{all}[14] 0.009622 0.000033 0.000826 0.020478 0.008660 1.000 2
length{all}[15] 0.004443 0.000011 0.000025 0.011086 0.003599 1.000 2
length{all}[16] 0.002140 0.000005 0.000007 0.006278 0.001478 0.999 2
length{all}[17] 0.002128 0.000004 0.000007 0.005802 0.001584 1.008 2
length{all}[18] 0.002382 0.000006 0.000001 0.007394 0.001674 1.000 2
length{all}[19] 0.002153 0.000005 0.000002 0.006286 0.001433 1.000 2
length{all}[20] 0.002163 0.000005 0.000002 0.006336 0.001404 1.006 2
length{all}[21] 0.002180 0.000005 0.000001 0.007110 0.001429 1.000 2
length{all}[22] 0.002280 0.000006 0.000001 0.006448 0.001565 1.001 2
length{all}[23] 0.002242 0.000004 0.000002 0.006658 0.001667 0.999 2
length{all}[24] 0.002095 0.000005 0.000000 0.006703 0.001384 1.001 2
length{all}[25] 0.002213 0.000005 0.000010 0.006435 0.001529 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006093
Maximum standard deviation of split frequencies = 0.018373
Average PSRF for parameter values (excluding NA and >10.0) = 1.001
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (3)
|
|----------------------------------------------------------------------- C3 (4)
|
|----------------------------------------------------------------------- C7 (8)
|
+ /----------------------------------- C10 (2)
| |
| /-----99----+ /------------------------ C4 (5)
| | | |
| | \----100---+ /------------ C5 (6)
| /-----94----+ \-----98----+
| | | \------------ C6 (7)
| | |
\----100----+ \----------------------------------------------- C8 (9)
|
\----------------------------------------------------------- C9 (10)
Phylogram (based on average branch lengths):
/- C1 (1)
|
|- C2 (3)
|
|- C3 (4)
|
|- C7 (8)
|
+ /-- C10 (2)
| |
| /-------+ /------- C4 (5)
| | | |
| | \------------------------------------------------+ /- C5 (6)
| /--+ \------+
| | | \- C6 (7)
| | |
\---+ \--- C8 (9)
|
\- C9 (10)
|--------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 8 trees
90 % credible set contains 15 trees
95 % credible set contains 31 trees
99 % credible set contains 75 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
Running FUBAR...
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\
***************** TYPES OF STANDARD ANALYSES *****************
(1) Selection Analyses
(2) Evolutionary Hypothesis Testing
(3) Relative evolutionary rate inference
(4) Coevolutionary analysis
(5) Basic Analyses
(6) Codon Selection Analyses
(7) Compartmentalization
(8) Data File Tools
(9) Miscellaneous
(10) Model Comparison
(11) Kernel Analysis Tools
(12) Molecular Clock
(13) Phylogeny Reconstruction
(14) Positive Selection
(15) Recombination
(16) Selection/Recombination
(17) Relative Rate
(18) Relative Ratio
(19) Substitution Rates
Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' *****************
(1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution).
(2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood).
(3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting).
(4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection).
(5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification).
(6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood).
(7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation).
Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types):
Analysis Description
--------------------
Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a
coding sequence alignment to determine whether some sites have been
subject to pervasive purifying or diversifying selection. v2.1
introduces two more methods for estimating the posterior distribution of
grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation
Bayes approximation (fastest). Please note that a FUBAR analysis
generates a cache and a results JSON file in the same directory as
directory as the original alignment. HyPhy needs to have write
privileges to this directory. For example if the original file is in
/home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there
will also exist FUBAR-generated files
/home/sergei/FUBAR/data/pol.nex.FUBAR.json,
/home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide
checkpointing so that a partially completed analysis can be restarted.
- __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree
(one per partition)
- __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring
selection (2013), Mol Biol Evol. 30(5):1196-205
- __Written by__: Sergei L Kosakovsky Pond
- __Contact Information__: spond@temple.edu
- __Analysis Version__: 2.1
####Choose Genetic Code
1. [**Universal**] Universal code. (Genebank transl_table=1).
2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2).
3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3).
4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4).
5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5).
6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6).
7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9).
8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10).
9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12).
10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13).
11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14).
12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15).
13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16).
14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21).
15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22).
16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23).
17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24).
18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25).
19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26).
>Please choose an option (or press q to cancel selection):
>Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`)
>A tree was found in the data file: `(C1,C2,C3,C7,(((C10,(C4,(C5,C6))),C8),C9))`
>Would you like to use it (y/n)?
>Loaded a multiple sequence alignment with **10** sequences, **119** codons, and **1** partitions from `/data//pss_subsets/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/fubar/results/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1.fna`
> FUBAR will write cache and result files to _/data//pss_subsets/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/fubar/results/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/fubar/results/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1.fna.FUBAR.json_, respectively
> Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer):
####Posterior estimation method
1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation)
2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed)
3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default)
>Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5):
### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model
* Log(L) = -695.64, AIC-c = 1437.59 (23 estimated parameters)
* Tree length (expected substitutions/site) for partition 1 : 0.116
### Computing the phylogenetic likelihood function on the grid
* Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid
* Best scaling achieved for
* synonymous rate = 1.227
* non-synonymous rate = 0.714
* Computing conditional site likelihoods on a 20 x 20 rate grid
### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights
* Using the following settings
* Dirichlet alpha : 0.5
### Tabulating site-level results
----
## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=10, Len=119
B04f_NS3b_ABN10841_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
B07f_NS3b_ABN10859_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
BtTp_GX2012_NA_AIA62354_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
CZ01_orf4a_AWH65879_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
CZ07_orf4a_AWH65890_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
HKU4_1_B04f_NS3b_YP_001039955_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
LMH1f_NS3b_ABN10868_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
SM3A_NA_QQD78085_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
B04f_NS3b_ABN10841_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU40 MDYVSLLNQFWQKQIKFYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
**************** ****.****************************
B04f_NS3b_ABN10841_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
B07f_NS3b_ABN10859_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
BtTp_GX2012_NA_AIA62354_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 TIKFYEYSAQATECTKALAKQDAARIICQQLQAAGLLNGMELQFRSCFAD
CZ01_orf4a_AWH65879_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 TIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFAD
CZ07_orf4a_AWH65890_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 TIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFAD
HKU4_1_B04f_NS3b_YP_001039955_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
LMH1f_NS3b_ABN10868_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 TIKFYEYSAQATECTKASAKQDAARLICQQLQAAGLLNGMELRFRSSAFD
SM3A_NA_QQD78085_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFD
B04f_NS3b_ABN10841_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU40 TIKLYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFD
***:************* *******:** *:**********:***. *
B04f_NS3b_ABN10841_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 IFGQNRYDASKSYFFSKTA
B07f_NS3b_ABN10859_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 IFGQNRYDASKSYFFSKTA
B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 IFGQNRYDASKSYFFSKTA
BtTp_GX2012_NA_AIA62354_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 IFGKNRYDASKSYFFSKTT
CZ01_orf4a_AWH65879_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 IFGKNRYDASKSYFFSKTT
CZ07_orf4a_AWH65890_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 IFGKNRYDASKSYFFSKTT
HKU4_1_B04f_NS3b_YP_001039955_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 IFGQNRYDASKSYFFSKTA
LMH1f_NS3b_ABN10868_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 IFGQNRYDASKSYFFSKTA
SM3A_NA_QQD78085_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 IFGQNRYDASKSYFFSKTA
B04f_NS3b_ABN10841_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU40 IFGQNRYDASKSYFFSKTA
***:**************:
>B04f_NS3b_ABN10841_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTCTTATAAAGAGACTCCTAGTCAGTATCATTACCTGTATCCACCCAGGTTTTTCTATAAACCTGTTTTGGGTAATTTACAGCACCCTACCAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCATCAGCAAAACAAGATGCAGCTAGACTTATCTGTGAACAGTTACAAGCTGCTGGACTACTCAATGGAATGGAGCTCCGATTCCGTAGTTCTGCCTCCGACATCTTCGGACAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGGCA >B07f_NS3b_ABN10859_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTCTTATAAAGAGACTCCTAGTCAGTATCATTACCTGTATCCACCCAGGTTTTTCTATAAACCTGTTTTGGGTAATTTACAGCACCCTACCAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCATCAGCAAAACAAGATGCAGCTAGACTTATCTGTGAACAGTTACAAGCTGCTGGACTACTCAATGGAATGGAGCTCCGATTCCGTAGTTCTGCCTCCGACATCTTCGGACAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGGCA >B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTCTTATAAAGAGACTCCTAGTCAGTATCATTACCTGTATCCACCCAGGTTTTTCTATAAACCTGTTTTGGGTAATTTACAGCACCCTACCAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCATCAGCAAAACAAGATGCAGCTAGACTTATCTGTGAACAGTTACAAGCTGCTGGACTACTCAATGGAATGGAGCTCCGATTCCGTAGTTCTGCCTCCGACATCTTCGGACAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGGCA >BtTp_GX2012_NA_AIA62354_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTTCTATAAAGAGACTAGTAGTCAGTACCATTACCTGTATCCACCCAGGTTCTTTTACAAACCTGTTTTAGGTAATTTACAGCACCCTACTAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCTTTAGCAAAACAAGATGCAGCCAGAATTATCTGTCAGCAATTGCAGGCTGCTGGACTCCTCAATGGAATGGAGCTCCAGTTCCGTAGCTGCTTTGCTGACATCTTCGGAAAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGACA >CZ01_orf4a_AWH65879_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTTCTATAAAGAGACTAGTAGTCAGTACCATTACCTGTATCCACCCAGGTTCTTTTACAAACCTGTTTTAGGTAATTTACAGCACCCTACTAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCTTCAGCAAAACAAGATGCAGCCAGAATTATATGTGCA---TTGCATGCTGCTGGACTCCTCAATGGAATGGAGCTCCAGTTCCGTAGCTGCTTTGCTGACATCTTCGGAAAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGACA >CZ07_orf4a_AWH65890_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTTCTATAAAGAGACTAGTAGTCAGTACCATTACCTGTATCCACCCAGGTTCTTTTACAAACCTGTTTTAGGTAATTTACAGCACCCTACTAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCTTCAGCAAAACAAGATGCAGCCAGAATTATATGTGCA---TTGCATGCTGCTGGACTCCTCAATGGAATGGAGCTCCAGTTCCGTAGCTGCTTTGCTGACATCTTCGGAAAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGACA >HKU4_1_B04f_NS3b_YP_001039955_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTCTTATAAAGAGACTCCTAGTCAGTATCATTACCTGTATCCACCCAGGTTTTTCTATAAACCTGTTTTGGGTAATTTACAGCACCCTACCAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCATCAGCAAAACAAGATGCAGCTAGACTTATCTGTGAACAGTTACAAGCTGCTGGACTACTCAATGGAATGGAGCTCCGATTCCGTAGTTCTGCCTCCGACATCTTCGGACAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGGCA >LMH1f_NS3b_ABN10868_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTCTTATAAAGAGACTCCTAGTCAGTATCATTACCTGTATCCACCCAGGTTTTTCTATAAACCTGTTTTAGGTAATTTACAGCACCCTACCAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCATCAGCAAAACAAGATGCAGCTAGACTTATCTGTCAACAGTTACAAGCTGCTGGACTCCTCAATGGAATGGAGCTCCGATTCCGTAGTTCTGCCTTCGACATCTTCGGACAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGGCA >SM3A_NA_QQD78085_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTCTTATAAAGAGACTCCTAGTCAGTATCATTACCTGTATCCACCCAGGTTTTTCTATAAACCTGTTTTGGGTAATTTACAGCACCCTACCAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCATCAGCAAAACAAGATGCAGCTAGACTTATCTGTGAACAGTTACAAGCTGCTGGACTCCTCAATGGAATGGAGCTCCGATTCCGTAGTTCTGCCTTCGACATCTTCGGACAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGGCA >SZ140324_orf4a_AWH65901_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTTTTATAAAGAGACTCCTAGTCAGTACCATTACCTGTATCCACCCAGGTTTTTCTATAAACCTGTTTTAGGTAATTTACAGCACCCTACTAAGTGGTGTTGTACTATTAAACTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCATCAGCAAAACAAGATGCAGCTAGACTTATCTGTGAACAGTTACAAGCTGCTGGACTCCTCAATGGAATGGAGCTCCGATTCCGTAGTTCTGCTTTCGACATCTTCGGACAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGGCA
>B04f_NS3b_ABN10841_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD IFGQNRYDASKSYFFSKTA >B07f_NS3b_ABN10859_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD IFGQNRYDASKSYFFSKTA >B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD IFGQNRYDASKSYFFSKTA >BtTp_GX2012_NA_AIA62354_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC TIKFYEYSAQATECTKALAKQDAARIICQQLQAAGLLNGMELQFRSCFAD IFGKNRYDASKSYFFSKTT >CZ01_orf4a_AWH65879_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC TIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFAD IFGKNRYDASKSYFFSKTT >CZ07_orf4a_AWH65890_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC TIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFAD IFGKNRYDASKSYFFSKTT >HKU4_1_B04f_NS3b_YP_001039955_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD IFGQNRYDASKSYFFSKTA >LMH1f_NS3b_ABN10868_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC TIKFYEYSAQATECTKASAKQDAARLICQQLQAAGLLNGMELRFRSSAFD IFGQNRYDASKSYFFSKTA >SM3A_NA_QQD78085_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFD IFGQNRYDASKSYFFSKTA >SZ140324_orf4a_AWH65901_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKFYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC TIKLYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFD IFGQNRYDASKSYFFSKTA
Reading sequence file /data//pss_subsets/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/fubar/fasta/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1
Found 10 sequences of length 357
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 4.5%
Found 32 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 7
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 23 polymorphic sites
**p-Value(s)**
----------
NSS: 2.13e-01 (1000 permutations)
Max Chi^2: 5.00e-02 (1000 permutations)
PHI (Permutation): 2.11e-01 (1000 permutations)
PHI (Normal): 1.80e-01
#NEXUS
[ID: 1426307477]
begin taxa;
dimensions ntax=10;
taxlabels
B04f_NS3b_ABN10841_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
SZ140324_orf4a_AWH65901_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4
B07f_NS3b_ABN10859_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
BtTp_GX2012_NA_AIA62354_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4
CZ01_orf4a_AWH65879_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4
CZ07_orf4a_AWH65890_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4
HKU4_1_B04f_NS3b_YP_001039955_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
LMH1f_NS3b_ABN10868_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
SM3A_NA_QQD78085_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4
;
end;
begin trees;
translate
1 B04f_NS3b_ABN10841_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
2 SZ140324_orf4a_AWH65901_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4,
3 B07f_NS3b_ABN10859_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
4 B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
5 BtTp_GX2012_NA_AIA62354_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
6 CZ01_orf4a_AWH65879_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4,
7 CZ07_orf4a_AWH65890_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4,
8 HKU4_1_B04f_NS3b_YP_001039955_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
9 LMH1f_NS3b_ABN10868_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
10 SM3A_NA_QQD78085_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:1.503299e-03,3:1.462247e-03,4:1.420974e-03,8:1.430100e-03,(((2:3.040563e-03,(5:8.677269e-03,(6:1.561700e-03,7:1.592073e-03)0.982:8.660488e-03)1.000:6.537649e-02)0.987:1.085638e-02,9:3.697059e-03)0.937:3.599009e-03,10:1.463362e-03)0.998:5.732123e-03);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:1.503299e-03,3:1.462247e-03,4:1.420974e-03,8:1.430100e-03,(((2:3.040563e-03,(5:8.677269e-03,(6:1.561700e-03,7:1.592073e-03):8.660488e-03):6.537649e-02):1.085638e-02,9:3.697059e-03):3.599009e-03,10:1.463362e-03):5.732123e-03);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -702.76 -716.40
2 -702.66 -716.61
--------------------------------------
TOTAL -702.71 -716.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.137393 0.000841 0.087589 0.194158 0.133804 1307.60 1308.66 1.000
r(A<->C){all} 0.142286 0.002998 0.044625 0.249193 0.137594 430.20 562.85 1.003
r(A<->G){all} 0.210637 0.004747 0.076129 0.340388 0.207005 245.15 412.78 1.000
r(A<->T){all} 0.028591 0.000523 0.000004 0.073265 0.023683 694.86 826.32 1.000
r(C<->G){all} 0.148601 0.004434 0.033493 0.285143 0.140371 434.30 500.51 1.000
r(C<->T){all} 0.387468 0.006249 0.239433 0.543175 0.385884 596.50 648.24 1.002
r(G<->T){all} 0.082417 0.002116 0.004493 0.169092 0.075106 474.85 475.02 1.000
pi(A){all} 0.294301 0.000559 0.249635 0.342100 0.293692 1185.29 1301.92 1.000
pi(C){all} 0.221310 0.000426 0.182477 0.262909 0.220691 1085.78 1217.21 1.000
pi(G){all} 0.189537 0.000415 0.153118 0.231896 0.188226 1291.42 1296.07 1.000
pi(T){all} 0.294852 0.000519 0.251185 0.341108 0.294366 1040.47 1197.48 1.000
alpha{1,2} 0.489825 0.397422 0.000011 1.774339 0.259484 1180.05 1220.48 1.000
alpha{3} 1.666101 1.300541 0.167183 4.075566 1.402344 1232.98 1312.37 1.000
pinvar{all} 0.302286 0.031765 0.000090 0.614808 0.292308 874.34 946.77 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C2,C3,C7,(((C10,(C4,(C5,C6))),C8),C9))` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **10** sequences, **119** codons, and **1** partitions from `/data//pss_subsets/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/fubar/results/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/fubar/results/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/fubar/results/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -695.64, AIC-c = 1437.59 (23 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.116 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 1.227 * non-synonymous rate = 0.714 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results ---- ## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
