--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -661.20 -675.31
2 -661.42 -674.82
--------------------------------------
TOTAL -661.31 -675.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.244417 0.001925 0.166413 0.333500 0.241348 1347.97 1379.67 1.000
r(A<->C){all} 0.130756 0.002910 0.034473 0.232751 0.124507 547.35 611.46 1.001
r(A<->G){all} 0.151664 0.003032 0.051761 0.257343 0.147630 536.08 614.59 1.001
r(A<->T){all} 0.107938 0.001444 0.037894 0.183019 0.103776 501.22 658.85 1.000
r(C<->G){all} 0.194736 0.004460 0.070312 0.322834 0.190441 595.91 620.68 1.000
r(C<->T){all} 0.305273 0.004349 0.185833 0.437422 0.303200 678.59 692.81 1.000
r(G<->T){all} 0.109632 0.001903 0.035757 0.201501 0.104854 426.53 570.62 1.000
pi(A){all} 0.256399 0.000603 0.211168 0.305750 0.255863 1142.95 1208.62 1.000
pi(C){all} 0.196613 0.000483 0.153181 0.240209 0.196081 862.43 1000.99 1.000
pi(G){all} 0.176108 0.000482 0.133979 0.217289 0.175082 1074.12 1168.91 1.000
pi(T){all} 0.370880 0.000760 0.321745 0.426653 0.369967 1141.06 1180.20 1.000
alpha{1,2} 0.660894 0.486095 0.001693 2.010291 0.442134 1107.58 1143.40 1.001
alpha{3} 1.954139 1.360016 0.304380 4.298999 1.691177 1110.77 1305.88 1.000
pinvar{all} 0.187144 0.017825 0.000136 0.440395 0.162519 955.53 1021.50 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
-- Starting log on Wed Oct 26 22:52:41 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=10, Len=91
C1 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C2 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C3 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C4 MVSFNVTAILLVLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C5 ---MNVTAILLQNVANAFSNPLYVPEHCVGMPGTLFQACIRQTMVDTTGM
C6 ---MNVTAILLQNVANAFSNPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C7 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C8 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C9 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C10 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSATLFQACIRQTMVDTTGM
:*.***:* :*****:******** **..*****************
C1 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C2 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C3 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C4 YTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV
C5 YTNSAMSYDGTTIPFDIHGIVHEDHYTDTKPTPLSDVGFSV
C6 YTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV
C7 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C8 YTNSAMSHDGITIPFDRDGIVHEEHYTETNPTPLSDVGFSV
C9 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C10 YTNSDMSHDGITIPFDRDGIVHEEHYTETNPTPLFDAGFSV
**** **:** ***** .*****:***:*:**** *.****
-- Starting log on Wed Oct 26 22:53:24 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.08 sec, SCORE=996, Nseq=10, Len=91
C1 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C2 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C3 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C4 MVSFNVTAILLVLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C5 ---MNVTAILLQNVANAFSNPLYVPEHCVGMPGTLFQACIRQTMVDTTGM
C6 ---MNVTAILLQNVANAFSNPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C7 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C8 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C9 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C10 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSATLFQACIRQTMVDTTGM
:*.***:* :*****:******** **..*****************
C1 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C2 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C3 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C4 YTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV
C5 YTNSAMSYDGTTIPFDIHGIVHEDHYTDTKPTPLSDVGFSV
C6 YTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV
C7 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C8 YTNSAMSHDGITIPFDRDGIVHEEHYTETNPTPLSDVGFSV
C9 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C10 YTNSDMSHDGITIPFDRDGIVHEEHYTETNPTPLFDAGFSV
**** **:** ***** .*****:***:*:**** *.****
-- Starting log on Wed Oct 26 22:52:41 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=10, Len=91
C1 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C2 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C3 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C4 MVSFNVTAILLVLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C5 ---MNVTAILLQNVANAFSNPLYVPEHCVGMPGTLFQACIRQTMVDTTGM
C6 ---MNVTAILLQNVANAFSNPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C7 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C8 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C9 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C10 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSATLFQACIRQTMVDTTGM
:*.***:* :*****:******** **..*****************
C1 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C2 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C3 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C4 YTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV
C5 YTNSAMSYDGTTIPFDIHGIVHEDHYTDTKPTPLSDVGFSV
C6 YTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV
C7 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C8 YTNSAMSHDGITIPFDRDGIVHEEHYTETNPTPLSDVGFSV
C9 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C10 YTNSDMSHDGITIPFDRDGIVHEEHYTETNPTPLFDAGFSV
**** **:** ***** .*****:***:*:**** *.****
-- Starting log on Wed Oct 26 23:06:01 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/gapped_alignment/fubar,B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 10 taxa and 273 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C10
Taxon 3 -> C2
Taxon 4 -> C3
Taxon 5 -> C4
Taxon 6 -> C5
Taxon 7 -> C6
Taxon 8 -> C7
Taxon 9 -> C8
Taxon 10 -> C9
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666825564
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 520974034
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1938929574
Seed = 31175006
Swapseed = 1666825564
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 16 unique site patterns
Division 2 has 15 unique site patterns
Division 3 has 29 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -956.577873 -- 35.653401
Chain 2 -- -1023.877308 -- 35.653401
Chain 3 -- -1027.559481 -- 35.653401
Chain 4 -- -1059.815658 -- 35.653401
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -997.968083 -- 35.653401
Chain 2 -- -1014.985740 -- 35.653401
Chain 3 -- -965.025031 -- 35.653401
Chain 4 -- -1048.726579 -- 35.653401
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-956.578] (-1023.877) (-1027.559) (-1059.816) * [-997.968] (-1014.986) (-965.025) (-1048.727)
1000 -- (-676.165) [-671.111] (-672.250) (-674.866) * (-674.653) (-662.489) [-669.111] (-672.131) -- 0:00:00
2000 -- (-670.888) (-663.255) (-666.998) [-668.190] * [-667.813] (-668.382) (-676.018) (-664.960) -- 0:00:00
3000 -- (-675.865) (-671.533) (-670.451) [-665.029] * (-668.390) [-668.825] (-665.019) (-663.424) -- 0:00:00
4000 -- (-678.286) [-667.247] (-665.873) (-670.259) * (-672.221) (-670.134) (-675.791) [-669.431] -- 0:04:09
5000 -- (-677.424) (-672.543) [-662.862] (-667.347) * (-666.768) [-667.825] (-669.446) (-663.848) -- 0:03:19
Average standard deviation of split frequencies: 0.040739
6000 -- (-666.499) (-669.337) (-672.400) [-662.060] * (-669.967) [-660.614] (-666.669) (-669.464) -- 0:02:45
7000 -- (-667.437) [-667.088] (-667.645) (-665.595) * (-667.854) (-670.651) [-665.030] (-682.763) -- 0:02:21
8000 -- (-661.424) (-679.101) [-669.142] (-668.603) * (-674.523) (-670.934) [-661.958] (-665.879) -- 0:04:08
9000 -- [-671.736] (-664.587) (-663.072) (-669.213) * [-662.595] (-667.570) (-670.864) (-663.016) -- 0:03:40
10000 -- [-666.329] (-666.434) (-665.375) (-681.505) * (-671.968) (-661.750) (-665.676) [-662.642] -- 0:03:18
Average standard deviation of split frequencies: 0.082864
11000 -- [-667.790] (-682.508) (-666.162) (-674.679) * (-667.700) (-681.304) (-671.168) [-663.828] -- 0:04:29
12000 -- (-671.430) [-662.479] (-666.448) (-663.411) * (-669.939) (-660.480) (-669.735) [-665.601] -- 0:04:07
13000 -- (-674.169) (-667.597) [-660.864] (-669.473) * (-669.361) (-671.046) (-673.349) [-675.364] -- 0:03:47
14000 -- (-662.990) [-669.003] (-659.030) (-670.506) * (-671.578) (-664.787) (-666.139) [-663.792] -- 0:03:31
15000 -- (-675.197) (-664.035) [-659.809] (-662.794) * (-668.103) (-673.487) [-664.716] (-666.776) -- 0:04:22
Average standard deviation of split frequencies: 0.065725
16000 -- (-668.363) (-665.105) (-666.359) [-662.568] * (-680.974) [-669.759] (-665.119) (-666.668) -- 0:04:06
17000 -- (-669.679) (-670.604) [-667.068] (-666.164) * (-669.278) (-664.216) (-667.773) [-666.343] -- 0:03:51
18000 -- (-661.830) (-665.344) [-669.393] (-668.282) * (-669.398) (-666.430) [-668.399] (-666.262) -- 0:03:38
19000 -- (-674.471) (-668.184) (-664.693) [-672.599] * (-663.986) [-661.851] (-673.021) (-675.485) -- 0:04:18
20000 -- (-667.785) (-663.709) [-666.002] (-683.884) * (-668.564) (-669.571) [-667.169] (-668.343) -- 0:04:05
Average standard deviation of split frequencies: 0.057025
21000 -- [-669.521] (-658.842) (-673.346) (-670.968) * [-662.238] (-671.756) (-664.008) (-668.389) -- 0:03:53
22000 -- (-668.991) (-672.069) [-662.071] (-668.258) * (-668.282) (-661.388) (-671.687) [-669.755] -- 0:04:26
23000 -- (-661.682) [-665.381] (-664.287) (-664.603) * [-661.484] (-673.579) (-669.652) (-666.604) -- 0:04:14
24000 -- (-675.950) [-663.826] (-672.826) (-662.557) * (-667.250) [-658.840] (-670.369) (-670.803) -- 0:04:04
25000 -- (-666.591) (-668.434) (-658.988) [-667.183] * (-669.667) (-668.795) (-662.251) [-667.299] -- 0:03:54
Average standard deviation of split frequencies: 0.042064
26000 -- (-663.943) [-663.022] (-665.048) (-668.837) * (-673.398) (-671.251) [-661.865] (-666.371) -- 0:04:22
27000 -- (-664.717) (-671.996) (-661.402) [-665.425] * (-664.482) (-685.869) (-671.427) [-671.725] -- 0:04:12
28000 -- (-674.741) (-662.950) [-665.343] (-673.606) * (-665.941) [-669.580] (-666.138) (-663.467) -- 0:04:03
29000 -- (-664.649) (-667.361) [-671.599] (-668.417) * (-663.356) (-674.542) [-667.949] (-665.292) -- 0:03:54
30000 -- [-664.927] (-664.431) (-668.657) (-666.335) * (-671.137) (-678.457) (-667.365) [-669.514] -- 0:04:18
Average standard deviation of split frequencies: 0.035048
31000 -- (-672.568) [-665.046] (-667.529) (-663.433) * (-666.598) (-664.459) [-663.143] (-668.144) -- 0:04:10
32000 -- (-667.860) (-666.833) [-665.440] (-661.896) * (-668.283) (-679.983) (-665.294) [-658.755] -- 0:04:02
33000 -- (-669.201) (-670.206) [-663.798] (-674.398) * [-674.221] (-666.802) (-672.031) (-664.279) -- 0:03:54
34000 -- [-665.986] (-672.395) (-669.249) (-663.445) * (-665.801) (-670.675) [-668.919] (-672.631) -- 0:04:15
35000 -- (-665.976) (-674.642) (-664.356) [-661.719] * (-671.799) [-666.347] (-671.601) (-674.642) -- 0:04:08
Average standard deviation of split frequencies: 0.034373
36000 -- (-675.565) (-677.217) (-664.677) [-663.051] * (-671.692) [-660.888] (-665.790) (-668.914) -- 0:04:01
37000 -- (-670.633) (-678.389) [-664.520] (-674.367) * (-669.524) (-662.562) [-668.150] (-671.710) -- 0:03:54
38000 -- [-666.364] (-675.060) (-671.034) (-667.836) * (-663.769) [-665.380] (-663.701) (-677.393) -- 0:04:13
39000 -- [-664.917] (-669.885) (-668.140) (-674.689) * [-671.464] (-670.807) (-664.063) (-672.798) -- 0:04:06
40000 -- (-677.936) (-669.644) [-667.383] (-664.119) * [-670.753] (-666.870) (-665.471) (-665.158) -- 0:04:00
Average standard deviation of split frequencies: 0.032844
41000 -- [-670.093] (-665.852) (-667.713) (-668.614) * (-665.561) (-678.530) (-676.277) [-666.217] -- 0:04:17
42000 -- (-674.690) [-661.778] (-668.126) (-666.681) * (-673.488) (-669.310) (-672.431) [-662.240] -- 0:04:10
43000 -- (-663.498) (-669.766) (-667.796) [-658.860] * [-670.282] (-669.363) (-671.802) (-659.794) -- 0:04:04
44000 -- (-668.548) (-674.147) (-668.006) [-662.402] * (-668.848) [-669.446] (-665.024) (-664.425) -- 0:03:59
45000 -- [-669.270] (-663.907) (-669.240) (-674.072) * (-671.581) [-665.057] (-666.838) (-666.360) -- 0:04:14
Average standard deviation of split frequencies: 0.029036
46000 -- (-663.217) (-671.568) [-676.619] (-668.556) * (-665.682) (-672.858) (-677.574) [-675.299] -- 0:04:08
47000 -- (-664.052) [-666.204] (-669.333) (-668.903) * (-667.387) [-665.143] (-671.219) (-670.514) -- 0:04:03
48000 -- (-669.452) (-670.578) (-670.789) [-666.861] * (-673.658) [-663.870] (-666.610) (-673.125) -- 0:03:58
49000 -- (-672.922) (-669.857) [-669.498] (-678.325) * (-667.655) [-669.972] (-669.279) (-679.642) -- 0:04:12
50000 -- (-662.365) [-665.328] (-667.907) (-670.517) * (-672.362) (-677.626) [-663.160] (-681.460) -- 0:04:06
Average standard deviation of split frequencies: 0.029935
51000 -- (-669.886) (-667.122) (-671.812) [-665.826] * (-681.500) [-664.628] (-671.238) (-672.345) -- 0:04:01
52000 -- (-666.557) (-663.675) [-673.755] (-674.476) * (-672.771) [-664.729] (-664.544) (-675.458) -- 0:03:57
53000 -- [-671.624] (-672.649) (-672.043) (-670.139) * (-681.995) [-665.841] (-662.037) (-669.977) -- 0:04:10
54000 -- (-671.147) (-665.656) (-669.496) [-672.958] * (-670.042) (-679.331) [-670.039] (-668.795) -- 0:04:05
55000 -- [-662.874] (-674.052) (-669.966) (-665.672) * (-666.888) (-669.511) [-665.102] (-664.153) -- 0:04:00
Average standard deviation of split frequencies: 0.030744
56000 -- (-668.109) (-671.716) [-661.048] (-669.350) * (-663.336) (-665.758) [-670.773] (-675.191) -- 0:03:56
57000 -- [-664.742] (-673.424) (-665.535) (-674.716) * (-665.719) (-665.553) (-677.490) [-666.095] -- 0:04:08
58000 -- (-671.704) (-670.560) [-675.420] (-670.207) * (-667.204) [-669.729] (-674.518) (-663.298) -- 0:04:03
59000 -- (-662.736) (-671.153) (-673.358) [-665.005] * [-660.110] (-667.080) (-668.242) (-672.846) -- 0:03:59
60000 -- (-672.082) [-665.735] (-667.631) (-671.539) * (-664.434) [-665.617] (-664.802) (-663.148) -- 0:04:10
Average standard deviation of split frequencies: 0.027027
61000 -- (-669.372) [-664.398] (-670.079) (-672.204) * [-664.407] (-671.138) (-663.206) (-663.483) -- 0:04:06
62000 -- (-667.147) (-669.082) (-673.725) [-670.177] * (-665.404) (-671.384) [-662.137] (-665.014) -- 0:04:02
63000 -- [-666.914] (-665.366) (-663.107) (-673.807) * (-665.110) (-659.930) (-674.570) [-665.679] -- 0:03:57
64000 -- (-670.389) [-664.547] (-664.053) (-672.014) * (-674.660) (-663.436) [-660.229] (-679.915) -- 0:04:08
65000 -- (-663.281) (-671.075) [-667.993] (-671.456) * [-669.747] (-668.113) (-663.843) (-672.839) -- 0:04:04
Average standard deviation of split frequencies: 0.024284
66000 -- (-666.539) (-666.427) (-663.338) [-663.682] * [-672.583] (-661.454) (-664.843) (-661.397) -- 0:04:00
67000 -- (-669.552) [-664.494] (-662.542) (-666.348) * (-669.080) [-664.469] (-659.777) (-661.980) -- 0:03:56
68000 -- (-665.628) (-660.915) [-664.989] (-665.860) * (-667.941) [-668.971] (-661.311) (-665.344) -- 0:04:06
69000 -- [-662.361] (-664.737) (-672.234) (-677.961) * (-668.936) (-658.446) [-669.677] (-663.516) -- 0:04:02
70000 -- (-661.884) [-667.683] (-663.631) (-664.733) * (-668.135) (-662.545) [-660.569] (-674.994) -- 0:03:59
Average standard deviation of split frequencies: 0.027484
71000 -- (-669.428) (-665.615) [-673.525] (-664.746) * [-661.437] (-670.911) (-666.908) (-664.501) -- 0:03:55
72000 -- (-669.388) (-670.302) (-669.414) [-662.690] * (-674.385) (-677.459) (-663.994) [-669.705] -- 0:04:04
73000 -- [-666.919] (-675.850) (-674.521) (-670.014) * (-675.675) (-678.295) [-663.390] (-674.928) -- 0:04:01
74000 -- (-669.077) (-665.027) [-658.774] (-662.346) * (-675.722) (-665.264) (-670.283) [-671.381] -- 0:03:57
75000 -- (-662.639) (-668.371) [-666.725] (-664.967) * [-667.179] (-664.675) (-669.046) (-659.809) -- 0:04:06
Average standard deviation of split frequencies: 0.024035
76000 -- (-668.326) (-686.135) [-669.117] (-667.786) * (-667.150) (-662.285) (-674.599) [-660.979] -- 0:04:03
77000 -- (-669.804) [-670.275] (-670.431) (-671.110) * [-667.368] (-663.061) (-668.777) (-668.014) -- 0:03:59
78000 -- (-669.410) (-669.937) [-674.158] (-664.996) * (-667.629) [-659.438] (-672.749) (-668.177) -- 0:03:56
79000 -- (-671.174) (-664.758) [-670.052] (-662.743) * (-667.894) (-667.932) [-670.629] (-681.123) -- 0:04:04
80000 -- (-672.131) [-666.983] (-665.014) (-679.627) * (-669.207) (-669.097) (-671.260) [-663.736] -- 0:04:01
Average standard deviation of split frequencies: 0.024593
81000 -- (-675.224) [-668.702] (-669.866) (-668.428) * [-664.988] (-663.773) (-661.989) (-674.590) -- 0:03:58
82000 -- (-676.834) (-672.597) (-673.570) [-659.271] * (-671.287) (-668.139) [-669.748] (-665.316) -- 0:03:55
83000 -- (-672.448) (-672.859) (-672.320) [-670.686] * (-661.850) [-659.675] (-670.859) (-674.934) -- 0:04:03
84000 -- (-674.703) (-672.074) (-662.186) [-667.393] * (-663.920) [-661.511] (-667.095) (-670.749) -- 0:03:59
85000 -- (-666.907) (-679.924) [-667.066] (-666.796) * (-672.861) (-665.292) [-673.352] (-676.617) -- 0:03:56
Average standard deviation of split frequencies: 0.022584
86000 -- [-666.884] (-665.240) (-668.363) (-668.668) * (-670.531) [-665.063] (-665.519) (-678.081) -- 0:03:53
87000 -- [-668.199] (-669.695) (-668.788) (-673.759) * (-679.764) (-672.222) [-665.699] (-672.352) -- 0:04:01
88000 -- (-670.772) [-669.678] (-664.195) (-668.321) * (-669.894) (-667.630) (-664.971) [-669.134] -- 0:03:58
89000 -- (-669.639) (-669.301) (-665.062) [-661.781] * (-666.281) (-664.975) [-669.214] (-670.091) -- 0:03:55
90000 -- (-666.270) [-666.860] (-669.327) (-666.494) * (-681.132) (-666.100) [-662.390] (-665.589) -- 0:04:02
Average standard deviation of split frequencies: 0.023284
91000 -- (-664.973) (-672.904) [-664.277] (-667.124) * (-674.396) (-673.793) [-666.708] (-667.523) -- 0:03:59
92000 -- (-664.656) (-668.790) [-663.338] (-666.947) * (-668.808) (-670.267) (-680.622) [-665.217] -- 0:03:56
93000 -- (-659.254) (-665.361) (-666.908) [-665.477] * (-673.043) (-670.595) (-667.202) [-668.208] -- 0:03:54
94000 -- (-666.431) [-668.988] (-663.170) (-673.000) * [-664.184] (-668.357) (-670.013) (-665.579) -- 0:04:00
95000 -- (-676.028) (-664.907) (-664.614) [-668.409] * (-670.406) (-660.022) [-667.685] (-673.117) -- 0:03:58
Average standard deviation of split frequencies: 0.025985
96000 -- (-676.155) (-667.951) [-666.563] (-676.019) * (-664.062) [-668.143] (-663.952) (-673.969) -- 0:03:55
97000 -- [-666.022] (-677.742) (-675.098) (-668.067) * (-660.732) [-663.024] (-676.859) (-666.531) -- 0:03:52
98000 -- (-668.469) (-667.299) (-682.368) [-662.377] * (-667.043) [-665.917] (-673.883) (-673.520) -- 0:03:59
99000 -- (-673.968) (-662.457) (-659.914) [-666.649] * (-675.198) (-671.370) [-663.720] (-663.886) -- 0:03:56
100000 -- (-664.169) (-668.336) (-671.058) [-659.127] * (-669.196) [-668.832] (-671.555) (-667.832) -- 0:03:53
Average standard deviation of split frequencies: 0.026536
101000 -- (-665.570) [-668.308] (-670.768) (-666.280) * (-667.679) [-663.866] (-675.731) (-667.562) -- 0:03:51
102000 -- (-673.289) (-669.551) (-665.465) [-668.802] * (-671.509) (-664.863) [-663.405] (-669.068) -- 0:03:57
103000 -- (-670.857) (-671.880) [-669.476] (-661.167) * (-666.167) (-664.865) (-671.884) [-658.790] -- 0:03:55
104000 -- [-680.464] (-664.886) (-664.446) (-673.899) * (-667.835) (-665.257) (-663.958) [-668.461] -- 0:03:52
105000 -- (-670.385) (-668.861) [-670.770] (-661.187) * (-661.551) [-661.871] (-671.013) (-669.648) -- 0:03:58
Average standard deviation of split frequencies: 0.024055
106000 -- (-665.485) (-668.370) (-676.305) [-670.714] * [-667.161] (-665.594) (-671.153) (-663.530) -- 0:03:56
107000 -- (-659.705) [-662.942] (-679.043) (-665.572) * (-664.455) [-669.717] (-678.772) (-671.604) -- 0:03:53
108000 -- [-662.160] (-683.389) (-670.921) (-664.419) * (-669.301) (-678.889) [-668.137] (-674.925) -- 0:03:51
109000 -- (-666.335) (-669.865) (-671.477) [-666.088] * (-677.377) [-663.536] (-668.156) (-670.659) -- 0:03:57
110000 -- (-671.261) (-668.045) [-670.620] (-680.507) * (-668.518) [-660.984] (-661.729) (-671.808) -- 0:03:54
Average standard deviation of split frequencies: 0.023073
111000 -- (-668.780) (-661.527) (-675.899) [-668.374] * (-667.653) (-675.579) [-668.934] (-668.367) -- 0:03:52
112000 -- (-661.918) [-666.814] (-670.967) (-673.660) * (-669.872) [-679.641] (-672.398) (-665.493) -- 0:03:49
113000 -- [-670.879] (-665.410) (-668.563) (-667.291) * (-682.472) (-676.356) (-670.745) [-665.479] -- 0:03:55
114000 -- (-679.810) (-659.912) [-665.215] (-664.790) * (-665.459) (-666.086) (-667.262) [-664.899] -- 0:03:53
115000 -- (-669.731) (-669.725) (-673.981) [-667.188] * (-665.345) (-676.165) (-659.517) [-664.285] -- 0:03:50
Average standard deviation of split frequencies: 0.024044
116000 -- (-666.592) (-669.185) (-674.152) [-664.780] * (-667.226) (-667.110) [-660.599] (-661.627) -- 0:03:48
117000 -- (-664.585) (-676.457) [-667.795] (-670.213) * (-671.867) (-669.723) (-671.656) [-666.695] -- 0:03:53
118000 -- (-666.774) (-664.275) (-672.756) [-664.829] * (-664.908) (-670.358) [-660.086] (-663.841) -- 0:03:51
119000 -- [-666.717] (-669.709) (-670.387) (-672.505) * (-662.091) (-674.137) [-661.367] (-671.546) -- 0:03:49
120000 -- (-667.382) (-664.876) [-667.852] (-668.735) * [-659.232] (-665.182) (-668.846) (-661.093) -- 0:03:54
Average standard deviation of split frequencies: 0.022591
121000 -- (-668.761) (-663.284) (-664.934) [-666.227] * (-667.387) (-668.595) [-668.303] (-668.544) -- 0:03:52
122000 -- (-664.171) (-668.025) [-668.491] (-667.765) * (-675.286) [-673.761] (-675.966) (-666.152) -- 0:03:50
123000 -- (-667.740) [-669.282] (-681.516) (-661.763) * (-680.119) (-664.729) (-661.962) [-665.953] -- 0:03:48
124000 -- (-670.347) [-664.874] (-669.523) (-664.781) * [-665.504] (-661.777) (-667.305) (-663.199) -- 0:03:53
125000 -- [-669.026] (-669.785) (-673.399) (-662.705) * (-674.920) (-674.379) [-665.861] (-669.141) -- 0:03:51
Average standard deviation of split frequencies: 0.021357
126000 -- (-673.152) (-669.148) (-678.207) [-669.993] * (-664.510) [-667.904] (-671.351) (-662.683) -- 0:03:48
127000 -- (-668.295) (-663.331) [-668.617] (-671.759) * (-663.661) (-675.282) (-672.376) [-662.196] -- 0:03:46
128000 -- [-663.245] (-665.461) (-675.122) (-670.508) * (-670.096) [-665.279] (-676.268) (-667.705) -- 0:03:51
129000 -- (-663.507) (-674.853) (-665.053) [-664.689] * (-660.641) (-664.034) (-671.216) [-663.768] -- 0:03:49
130000 -- (-664.246) (-664.751) (-662.653) [-662.981] * [-665.303] (-670.133) (-679.577) (-665.398) -- 0:03:47
Average standard deviation of split frequencies: 0.022117
131000 -- (-666.539) (-660.419) [-666.257] (-664.082) * [-668.161] (-667.302) (-666.953) (-661.019) -- 0:03:45
132000 -- (-664.522) [-663.533] (-671.265) (-666.783) * (-662.536) (-671.872) [-665.278] (-663.918) -- 0:03:50
133000 -- (-669.701) (-663.052) [-670.527] (-659.360) * (-661.614) (-674.656) (-669.972) [-666.678] -- 0:03:48
134000 -- (-669.450) (-673.768) (-665.511) [-668.782] * (-667.708) [-659.854] (-662.195) (-666.432) -- 0:03:46
135000 -- (-671.157) (-668.033) (-669.093) [-663.240] * (-674.038) (-666.050) [-660.860] (-673.846) -- 0:03:50
Average standard deviation of split frequencies: 0.020345
136000 -- (-668.647) [-665.339] (-677.689) (-671.870) * [-662.828] (-671.301) (-673.108) (-672.971) -- 0:03:48
137000 -- [-665.090] (-662.231) (-664.517) (-675.114) * [-665.445] (-662.192) (-674.979) (-676.991) -- 0:03:46
138000 -- (-677.931) (-665.816) (-674.739) [-671.783] * (-668.004) (-663.567) (-663.024) [-660.854] -- 0:03:44
139000 -- (-672.983) [-671.924] (-662.555) (-668.337) * (-665.704) (-665.802) [-671.156] (-670.145) -- 0:03:49
140000 -- (-674.629) [-662.071] (-661.839) (-672.476) * [-671.413] (-672.560) (-665.125) (-679.456) -- 0:03:47
Average standard deviation of split frequencies: 0.019803
141000 -- (-675.046) [-668.367] (-659.776) (-672.703) * [-663.259] (-664.921) (-664.233) (-668.272) -- 0:03:45
142000 -- (-669.102) (-666.407) (-665.307) [-666.325] * [-663.383] (-666.005) (-663.788) (-670.782) -- 0:03:43
143000 -- (-669.797) (-668.509) (-664.907) [-666.494] * (-664.482) (-667.403) (-666.812) [-675.997] -- 0:03:47
144000 -- (-664.647) (-667.490) [-668.217] (-678.057) * (-668.234) [-663.215] (-675.870) (-668.938) -- 0:03:45
145000 -- [-672.442] (-676.623) (-666.768) (-666.958) * [-670.718] (-664.510) (-667.234) (-676.325) -- 0:03:44
Average standard deviation of split frequencies: 0.020180
146000 -- (-669.495) (-673.284) [-666.551] (-659.633) * (-671.478) (-672.505) [-668.417] (-670.828) -- 0:03:42
147000 -- [-665.815] (-663.834) (-673.266) (-658.701) * (-672.260) (-663.206) [-669.586] (-670.977) -- 0:03:46
148000 -- (-662.782) [-669.675] (-666.544) (-660.321) * [-664.568] (-665.090) (-682.828) (-664.023) -- 0:03:44
149000 -- (-673.868) (-668.327) (-664.058) [-667.940] * (-671.462) [-662.183] (-673.813) (-667.561) -- 0:03:42
150000 -- (-667.888) [-663.713] (-666.238) (-675.267) * (-665.288) [-660.865] (-668.518) (-670.160) -- 0:03:46
Average standard deviation of split frequencies: 0.019425
151000 -- (-663.983) [-665.418] (-664.672) (-670.102) * (-667.294) (-666.789) [-661.588] (-675.118) -- 0:03:44
152000 -- (-673.543) (-670.060) [-660.836] (-668.500) * (-664.201) [-675.726] (-670.853) (-667.456) -- 0:03:43
153000 -- (-666.855) [-661.740] (-665.969) (-676.862) * [-659.443] (-667.673) (-668.658) (-664.393) -- 0:03:41
154000 -- (-665.781) [-663.119] (-665.394) (-668.419) * [-666.193] (-666.704) (-668.180) (-666.588) -- 0:03:45
155000 -- (-664.808) [-666.536] (-670.292) (-669.109) * (-657.820) (-664.712) (-671.739) [-660.908] -- 0:03:43
Average standard deviation of split frequencies: 0.019581
156000 -- [-671.389] (-665.592) (-665.911) (-671.118) * (-664.795) (-659.957) [-664.637] (-665.204) -- 0:03:41
157000 -- (-666.616) (-668.511) (-668.104) [-668.222] * (-666.866) (-663.907) [-665.865] (-668.360) -- 0:03:40
158000 -- (-664.914) (-665.189) (-667.360) [-667.043] * (-666.066) (-659.644) [-659.668] (-673.088) -- 0:03:43
159000 -- (-674.454) (-664.458) (-673.607) [-664.370] * (-666.390) (-660.505) (-661.364) [-662.366] -- 0:03:42
160000 -- (-671.889) (-672.809) (-664.996) [-668.301] * (-667.432) (-666.305) (-665.826) [-665.047] -- 0:03:40
Average standard deviation of split frequencies: 0.018093
161000 -- [-666.348] (-669.329) (-674.154) (-663.578) * [-662.790] (-660.156) (-662.846) (-660.620) -- 0:03:38
162000 -- (-671.722) (-662.893) (-665.509) [-669.629] * (-664.216) (-669.035) (-668.627) [-663.724] -- 0:03:42
163000 -- (-668.024) (-676.126) (-668.742) [-668.045] * [-660.030] (-673.949) (-663.217) (-670.555) -- 0:03:40
164000 -- (-672.331) (-666.245) (-662.385) [-673.425] * (-658.986) (-667.993) [-666.076] (-665.715) -- 0:03:39
165000 -- (-672.218) [-664.602] (-672.307) (-672.707) * [-663.870] (-671.713) (-664.878) (-672.049) -- 0:03:37
Average standard deviation of split frequencies: 0.018240
166000 -- (-665.763) (-665.323) (-669.828) [-658.500] * (-668.771) (-665.876) (-664.249) [-669.140] -- 0:03:41
167000 -- [-667.159] (-659.712) (-674.134) (-672.656) * [-661.015] (-666.584) (-663.371) (-673.058) -- 0:03:39
168000 -- (-669.757) (-670.283) (-676.041) [-667.715] * (-665.431) (-668.396) [-667.655] (-672.113) -- 0:03:37
169000 -- (-664.543) [-668.563] (-665.057) (-664.219) * (-666.637) (-665.541) (-663.888) [-672.660] -- 0:03:41
170000 -- (-664.971) (-671.419) [-662.846] (-669.862) * (-663.648) (-665.643) [-661.294] (-671.302) -- 0:03:39
Average standard deviation of split frequencies: 0.018069
171000 -- (-665.689) (-667.228) (-667.973) [-661.913] * [-669.511] (-667.869) (-676.805) (-671.645) -- 0:03:38
172000 -- (-667.915) [-662.239] (-670.177) (-665.949) * (-669.614) [-663.102] (-662.107) (-668.154) -- 0:03:36
173000 -- [-663.823] (-669.972) (-668.185) (-666.139) * (-674.643) (-670.410) (-673.274) [-667.354] -- 0:03:39
174000 -- (-669.020) [-664.798] (-671.871) (-665.024) * [-665.442] (-668.438) (-675.682) (-670.126) -- 0:03:38
175000 -- (-666.138) [-661.695] (-662.722) (-684.369) * (-673.106) [-666.421] (-669.154) (-674.363) -- 0:03:36
Average standard deviation of split frequencies: 0.017856
176000 -- [-665.514] (-667.811) (-668.854) (-667.016) * (-668.543) (-670.359) [-664.705] (-665.056) -- 0:03:35
177000 -- (-673.736) (-661.979) (-681.303) [-659.318] * (-677.593) [-664.542] (-665.966) (-665.449) -- 0:03:38
178000 -- [-663.277] (-670.049) (-673.664) (-656.863) * [-668.248] (-665.237) (-661.152) (-668.123) -- 0:03:37
179000 -- (-669.577) (-665.090) [-663.808] (-670.459) * (-667.739) (-660.786) [-662.386] (-669.541) -- 0:03:35
180000 -- [-665.756] (-670.947) (-664.859) (-667.099) * (-667.122) [-665.188] (-663.583) (-669.058) -- 0:03:34
Average standard deviation of split frequencies: 0.015542
181000 -- (-674.504) (-664.763) [-663.915] (-679.057) * (-671.327) [-666.550] (-666.322) (-666.726) -- 0:03:37
182000 -- [-665.642] (-671.445) (-661.573) (-666.027) * (-668.743) [-662.376] (-669.712) (-668.132) -- 0:03:35
183000 -- (-669.077) (-666.449) (-678.615) [-667.029] * (-670.783) [-659.844] (-661.411) (-675.061) -- 0:03:34
184000 -- (-669.692) (-662.907) [-663.724] (-668.718) * (-668.507) (-664.418) [-670.264] (-673.976) -- 0:03:37
185000 -- (-665.532) [-667.760] (-664.287) (-666.273) * [-672.748] (-665.720) (-668.123) (-670.396) -- 0:03:35
Average standard deviation of split frequencies: 0.016423
186000 -- (-665.848) [-669.476] (-667.023) (-671.607) * [-661.165] (-673.873) (-674.036) (-673.012) -- 0:03:34
187000 -- [-665.259] (-664.076) (-668.373) (-666.224) * (-674.799) [-666.048] (-670.007) (-663.981) -- 0:03:33
188000 -- (-667.410) [-663.325] (-663.943) (-663.287) * (-676.040) (-661.443) (-685.103) [-662.657] -- 0:03:35
189000 -- (-671.927) (-670.680) (-671.781) [-661.087] * [-665.604] (-669.801) (-668.535) (-683.479) -- 0:03:34
190000 -- (-668.900) (-668.717) (-673.975) [-666.957] * (-668.215) (-665.090) [-668.890] (-669.009) -- 0:03:33
Average standard deviation of split frequencies: 0.016174
191000 -- (-663.187) [-659.777] (-661.545) (-672.949) * (-668.691) (-671.696) [-665.787] (-668.916) -- 0:03:31
192000 -- [-665.023] (-665.360) (-665.979) (-679.061) * (-663.546) [-675.243] (-665.028) (-664.819) -- 0:03:34
193000 -- (-670.954) (-664.490) (-666.526) [-665.624] * (-661.900) (-664.588) [-665.653] (-675.335) -- 0:03:33
194000 -- [-663.261] (-664.540) (-666.402) (-668.104) * (-664.942) (-667.981) (-661.727) [-663.644] -- 0:03:31
195000 -- (-668.977) [-662.452] (-668.380) (-667.187) * (-680.627) (-663.157) (-665.420) [-665.676] -- 0:03:34
Average standard deviation of split frequencies: 0.016208
196000 -- (-670.200) (-667.240) (-665.126) [-664.665] * [-668.576] (-674.606) (-670.788) (-667.258) -- 0:03:33
197000 -- (-668.664) (-663.521) (-669.457) [-662.085] * (-666.351) (-662.342) [-662.406] (-668.472) -- 0:03:31
198000 -- (-665.674) (-661.557) (-674.207) [-661.567] * [-659.405] (-671.107) (-668.620) (-666.098) -- 0:03:30
199000 -- (-668.634) [-664.285] (-668.746) (-665.046) * [-668.222] (-670.043) (-668.018) (-659.634) -- 0:03:33
200000 -- (-664.518) (-660.433) [-663.828] (-659.987) * [-663.470] (-665.107) (-665.404) (-667.270) -- 0:03:32
Average standard deviation of split frequencies: 0.016138
201000 -- (-664.116) (-665.615) (-664.925) [-665.404] * (-672.415) (-672.055) (-667.355) [-666.673] -- 0:03:30
202000 -- (-666.046) [-666.417] (-665.401) (-668.737) * [-672.727] (-677.623) (-662.686) (-668.438) -- 0:03:29
203000 -- (-668.028) [-663.668] (-668.379) (-662.294) * (-679.083) (-669.756) [-672.570] (-670.449) -- 0:03:32
204000 -- (-661.947) (-665.127) [-663.302] (-677.102) * (-666.342) (-669.840) [-665.736] (-665.371) -- 0:03:30
205000 -- (-671.174) (-664.703) [-667.714] (-677.326) * (-662.667) [-659.783] (-680.059) (-678.703) -- 0:03:29
Average standard deviation of split frequencies: 0.016118
206000 -- (-665.448) [-662.686] (-662.168) (-667.376) * [-659.131] (-665.224) (-665.528) (-671.290) -- 0:03:28
207000 -- (-663.500) [-665.114] (-665.561) (-668.292) * [-665.252] (-663.837) (-676.795) (-663.824) -- 0:03:30
208000 -- (-668.638) (-669.234) [-662.239] (-671.987) * [-669.244] (-664.956) (-674.732) (-667.099) -- 0:03:29
209000 -- (-660.313) (-667.834) [-660.320] (-671.883) * (-668.903) (-663.200) (-672.504) [-666.951] -- 0:03:28
210000 -- [-669.515] (-671.984) (-671.003) (-680.021) * [-673.145] (-666.757) (-665.224) (-673.021) -- 0:03:26
Average standard deviation of split frequencies: 0.014885
211000 -- (-685.570) (-670.580) (-669.260) [-669.902] * (-666.992) (-663.447) [-662.968] (-666.287) -- 0:03:29
212000 -- (-664.366) (-675.528) (-665.270) [-662.984] * (-672.821) [-664.322] (-671.492) (-668.579) -- 0:03:28
213000 -- (-672.010) (-681.370) [-662.428] (-678.676) * (-666.317) [-664.831] (-666.467) (-672.095) -- 0:03:26
214000 -- (-674.907) (-663.088) (-668.169) [-663.833] * [-665.881] (-670.232) (-664.291) (-673.348) -- 0:03:29
215000 -- (-667.725) [-666.783] (-667.744) (-662.866) * (-668.266) (-664.744) [-665.047] (-677.343) -- 0:03:28
Average standard deviation of split frequencies: 0.014897
216000 -- (-670.814) [-662.996] (-665.532) (-661.911) * [-662.130] (-663.512) (-664.393) (-664.304) -- 0:03:26
217000 -- (-665.034) (-657.962) [-665.697] (-667.909) * (-662.679) (-665.498) (-668.964) [-671.795] -- 0:03:25
218000 -- (-676.615) [-661.624] (-667.351) (-672.604) * (-672.153) [-665.031] (-667.477) (-673.275) -- 0:03:28
219000 -- (-672.828) (-679.748) [-663.993] (-669.827) * (-665.183) [-662.617] (-668.240) (-673.446) -- 0:03:26
220000 -- [-666.377] (-675.558) (-663.288) (-670.819) * (-666.383) (-669.845) [-661.275] (-674.371) -- 0:03:25
Average standard deviation of split frequencies: 0.015925
221000 -- (-672.705) (-674.452) [-667.753] (-672.521) * (-678.069) [-680.126] (-663.963) (-672.148) -- 0:03:27
222000 -- (-663.723) (-667.115) [-676.688] (-668.649) * (-676.732) [-672.110] (-665.857) (-669.919) -- 0:03:26
223000 -- (-660.940) (-667.937) [-667.940] (-669.444) * (-671.251) [-668.106] (-663.473) (-666.038) -- 0:03:25
224000 -- (-673.257) (-670.329) (-666.823) [-666.616] * [-667.852] (-669.079) (-677.889) (-671.570) -- 0:03:24
225000 -- (-675.242) (-665.987) [-661.673] (-675.991) * (-671.495) (-661.580) [-670.957] (-666.951) -- 0:03:26
Average standard deviation of split frequencies: 0.013843
226000 -- (-669.513) [-665.645] (-676.616) (-668.745) * (-664.915) (-673.085) [-666.112] (-664.522) -- 0:03:25
227000 -- (-665.667) [-671.789] (-666.692) (-663.471) * (-668.547) (-669.242) [-665.908] (-662.076) -- 0:03:24
228000 -- (-665.637) [-666.476] (-663.724) (-670.100) * (-670.233) [-662.151] (-666.933) (-671.706) -- 0:03:23
229000 -- (-666.587) (-674.097) (-663.944) [-670.930] * [-671.951] (-666.436) (-666.626) (-664.820) -- 0:03:25
230000 -- (-663.870) [-664.560] (-663.657) (-664.663) * (-662.463) [-660.430] (-665.817) (-665.845) -- 0:03:24
Average standard deviation of split frequencies: 0.013934
231000 -- (-664.149) (-675.067) [-659.484] (-671.669) * (-666.075) (-668.096) (-662.689) [-665.267] -- 0:03:23
232000 -- (-660.327) (-665.134) [-670.487] (-673.228) * (-675.632) (-668.202) (-663.133) [-669.859] -- 0:03:25
233000 -- (-670.238) (-666.525) (-663.499) [-666.794] * (-666.666) (-669.807) [-666.510] (-668.597) -- 0:03:24
234000 -- (-663.561) (-675.250) [-662.667] (-663.814) * (-671.376) [-665.258] (-662.662) (-669.720) -- 0:03:22
235000 -- (-675.292) (-678.644) [-661.957] (-663.726) * (-676.132) [-667.419] (-671.187) (-672.692) -- 0:03:21
Average standard deviation of split frequencies: 0.013438
236000 -- [-660.799] (-668.004) (-668.566) (-666.470) * (-669.064) (-670.441) [-657.292] (-672.622) -- 0:03:23
237000 -- (-669.878) (-666.838) (-668.480) [-664.337] * (-665.307) (-661.000) [-664.872] (-661.462) -- 0:03:22
238000 -- [-669.884] (-661.485) (-667.324) (-667.120) * (-682.610) (-663.335) [-662.891] (-663.765) -- 0:03:21
239000 -- [-663.639] (-667.206) (-666.092) (-680.246) * (-679.896) [-668.738] (-662.086) (-670.647) -- 0:03:23
240000 -- [-667.162] (-663.912) (-667.149) (-666.464) * (-667.085) [-662.876] (-663.044) (-670.664) -- 0:03:22
Average standard deviation of split frequencies: 0.014067
241000 -- (-669.011) (-669.623) [-660.293] (-669.520) * (-667.966) [-665.267] (-668.197) (-671.198) -- 0:03:21
242000 -- (-665.763) (-663.675) (-663.903) [-663.883] * (-671.574) [-672.085] (-669.527) (-664.648) -- 0:03:20
243000 -- (-667.356) (-663.008) (-666.838) [-667.011] * [-659.365] (-665.466) (-670.028) (-666.848) -- 0:03:22
244000 -- (-667.466) [-662.383] (-669.309) (-671.449) * [-671.071] (-664.677) (-672.061) (-669.617) -- 0:03:21
245000 -- [-657.695] (-674.043) (-669.366) (-666.733) * [-662.605] (-666.459) (-674.662) (-661.501) -- 0:03:20
Average standard deviation of split frequencies: 0.014111
246000 -- [-671.705] (-676.968) (-674.622) (-671.891) * (-664.350) [-665.501] (-670.701) (-673.103) -- 0:03:19
247000 -- (-665.246) (-666.934) (-674.805) [-663.021] * (-671.892) (-671.006) [-672.895] (-670.528) -- 0:03:21
248000 -- (-665.314) [-663.242] (-664.374) (-667.426) * (-667.819) (-680.287) [-672.389] (-662.537) -- 0:03:20
249000 -- (-665.224) [-663.674] (-668.939) (-667.315) * [-675.579] (-678.578) (-667.581) (-663.775) -- 0:03:19
250000 -- [-665.095] (-669.459) (-674.369) (-663.390) * (-667.804) (-660.160) [-677.232] (-664.173) -- 0:03:18
Average standard deviation of split frequencies: 0.014275
251000 -- (-677.890) (-665.645) [-663.614] (-665.553) * (-669.526) (-663.929) (-667.897) [-667.124] -- 0:03:19
252000 -- (-667.349) (-670.868) [-666.857] (-665.830) * (-679.878) [-665.283] (-668.140) (-666.367) -- 0:03:18
253000 -- [-666.572] (-666.598) (-668.402) (-672.377) * (-669.288) (-667.112) (-668.479) [-665.955] -- 0:03:17
254000 -- (-664.399) [-665.088] (-661.963) (-674.117) * (-666.071) (-664.566) [-665.154] (-672.109) -- 0:03:19
255000 -- (-669.734) (-675.255) (-662.330) [-666.698] * (-675.691) (-667.166) [-664.156] (-664.176) -- 0:03:18
Average standard deviation of split frequencies: 0.014145
256000 -- [-666.279] (-660.412) (-661.084) (-671.671) * (-676.065) [-664.398] (-667.897) (-670.664) -- 0:03:17
257000 -- (-663.978) [-665.420] (-669.065) (-672.254) * [-664.573] (-675.006) (-671.037) (-664.705) -- 0:03:16
258000 -- (-669.223) (-672.606) [-664.293] (-667.855) * (-665.017) [-670.341] (-668.025) (-665.766) -- 0:03:18
259000 -- (-676.744) (-667.172) [-659.021] (-671.169) * (-678.453) (-661.655) (-669.092) [-668.514] -- 0:03:17
260000 -- (-674.037) [-671.555] (-661.499) (-672.106) * (-675.828) (-659.649) [-661.098] (-670.674) -- 0:03:16
Average standard deviation of split frequencies: 0.013646
261000 -- (-666.251) (-670.284) (-670.063) [-668.242] * (-662.242) (-666.490) (-669.479) [-673.086] -- 0:03:15
262000 -- (-670.218) [-667.595] (-666.195) (-665.374) * (-664.723) (-663.709) [-661.421] (-663.787) -- 0:03:17
263000 -- (-670.927) [-662.864] (-665.935) (-675.926) * (-668.112) (-670.450) (-675.807) [-666.808] -- 0:03:16
264000 -- (-669.199) [-670.546] (-663.518) (-663.818) * (-665.713) [-673.019] (-675.070) (-663.787) -- 0:03:15
265000 -- (-665.873) [-673.575] (-664.296) (-675.923) * [-663.312] (-664.511) (-670.910) (-666.452) -- 0:03:16
Average standard deviation of split frequencies: 0.012945
266000 -- (-668.595) [-665.363] (-665.339) (-665.699) * (-666.488) [-665.475] (-668.836) (-665.915) -- 0:03:15
267000 -- (-667.579) [-664.106] (-667.362) (-674.756) * (-669.801) (-673.588) (-673.458) [-662.540] -- 0:03:14
268000 -- [-663.239] (-667.691) (-667.697) (-663.028) * (-668.609) (-674.053) [-659.607] (-668.599) -- 0:03:13
269000 -- (-667.673) (-663.601) (-663.490) [-661.806] * (-666.377) (-665.033) (-664.970) [-668.738] -- 0:03:15
270000 -- (-663.330) [-668.593] (-677.886) (-661.537) * (-663.854) [-663.260] (-665.419) (-673.600) -- 0:03:14
Average standard deviation of split frequencies: 0.013706
271000 -- (-672.606) (-680.660) (-667.919) [-661.696] * (-664.241) (-671.283) (-671.777) [-668.668] -- 0:03:13
272000 -- (-676.511) (-663.414) [-667.028] (-671.138) * (-664.922) (-668.129) (-671.857) [-665.989] -- 0:03:12
273000 -- (-673.781) [-669.260] (-669.798) (-667.683) * (-667.638) [-664.282] (-666.138) (-668.562) -- 0:03:14
274000 -- (-676.058) (-661.574) [-669.900] (-664.482) * (-663.097) [-667.082] (-670.763) (-662.818) -- 0:03:13
275000 -- [-666.958] (-675.372) (-665.038) (-670.272) * (-662.242) [-668.211] (-668.569) (-671.791) -- 0:03:12
Average standard deviation of split frequencies: 0.013339
276000 -- (-671.562) (-667.179) [-664.819] (-673.542) * [-669.704] (-672.471) (-667.403) (-669.540) -- 0:03:11
277000 -- [-666.994] (-666.115) (-673.544) (-664.716) * (-675.932) [-661.643] (-682.715) (-665.717) -- 0:03:13
278000 -- (-668.407) (-672.819) (-671.742) [-665.411] * (-673.454) (-663.013) (-667.874) [-666.418] -- 0:03:12
279000 -- (-659.836) (-665.352) (-665.012) [-662.848] * [-669.655] (-666.447) (-662.154) (-669.106) -- 0:03:11
280000 -- [-661.214] (-668.789) (-669.460) (-675.901) * (-666.255) [-667.595] (-669.263) (-666.170) -- 0:03:12
Average standard deviation of split frequencies: 0.011589
281000 -- (-665.674) (-661.999) [-670.408] (-674.420) * [-665.808] (-670.556) (-670.847) (-660.369) -- 0:03:11
282000 -- [-667.047] (-664.758) (-673.334) (-666.210) * (-670.962) (-667.047) [-668.160] (-667.469) -- 0:03:10
283000 -- (-667.645) (-664.745) [-657.997] (-665.623) * (-668.355) (-673.334) [-662.813] (-668.274) -- 0:03:10
284000 -- (-669.282) [-670.984] (-669.003) (-673.180) * (-663.698) (-665.484) [-671.003] (-670.082) -- 0:03:11
285000 -- (-667.298) (-669.245) (-670.541) [-674.965] * [-665.336] (-668.301) (-680.709) (-664.561) -- 0:03:10
Average standard deviation of split frequencies: 0.012512
286000 -- (-668.656) (-669.803) (-667.415) [-666.980] * [-665.931] (-674.568) (-679.564) (-663.798) -- 0:03:09
287000 -- [-666.715] (-664.850) (-668.658) (-681.059) * (-669.042) (-668.764) [-665.200] (-664.408) -- 0:03:08
288000 -- (-675.049) (-673.390) (-663.127) [-665.732] * (-678.853) (-664.680) [-667.730] (-667.751) -- 0:03:10
289000 -- (-669.590) (-667.221) (-663.984) [-664.769] * [-672.693] (-668.114) (-667.819) (-672.237) -- 0:03:09
290000 -- (-667.097) [-664.845] (-665.863) (-673.417) * [-666.569] (-661.048) (-678.589) (-668.042) -- 0:03:08
Average standard deviation of split frequencies: 0.011275
291000 -- (-673.096) [-668.850] (-670.038) (-662.575) * [-672.505] (-666.621) (-685.334) (-671.297) -- 0:03:10
292000 -- [-663.854] (-671.029) (-670.805) (-659.090) * (-667.551) [-659.577] (-670.501) (-664.201) -- 0:03:09
293000 -- (-664.745) (-680.518) (-671.163) [-670.278] * (-666.790) (-670.105) [-662.054] (-676.007) -- 0:03:08
294000 -- (-671.741) (-665.094) [-664.459] (-659.401) * [-662.991] (-674.010) (-660.714) (-666.915) -- 0:03:07
295000 -- (-673.153) (-667.427) [-663.456] (-669.125) * [-667.532] (-678.621) (-668.500) (-667.361) -- 0:03:08
Average standard deviation of split frequencies: 0.011527
296000 -- (-661.409) (-666.211) [-662.699] (-665.047) * (-667.589) (-669.306) [-673.727] (-661.956) -- 0:03:07
297000 -- (-678.235) [-666.007] (-661.156) (-668.452) * (-670.660) (-663.216) (-666.706) [-678.983] -- 0:03:06
298000 -- (-663.039) [-662.390] (-673.664) (-667.907) * (-663.347) [-664.908] (-667.898) (-671.037) -- 0:03:06
299000 -- (-663.637) (-674.971) (-672.652) [-664.980] * (-667.395) (-675.230) [-668.677] (-666.591) -- 0:03:07
300000 -- (-661.281) (-666.324) [-667.995] (-668.968) * (-679.546) (-669.946) (-662.878) [-667.413] -- 0:03:06
Average standard deviation of split frequencies: 0.011572
301000 -- (-673.652) [-664.475] (-668.115) (-682.075) * (-675.101) (-667.261) [-666.398] (-665.652) -- 0:03:05
302000 -- [-663.669] (-671.451) (-677.106) (-657.539) * (-674.019) (-670.490) (-668.520) [-670.549] -- 0:03:04
303000 -- [-661.496] (-666.011) (-669.552) (-667.056) * [-665.353] (-665.967) (-667.606) (-672.493) -- 0:03:06
304000 -- [-662.004] (-669.291) (-674.655) (-664.423) * (-661.520) (-663.235) [-664.493] (-672.348) -- 0:03:05
305000 -- (-664.415) (-668.992) (-676.317) [-667.511] * (-665.801) (-674.706) [-669.114] (-665.221) -- 0:03:04
Average standard deviation of split frequencies: 0.012324
306000 -- (-667.308) (-672.702) (-665.125) [-665.141] * [-668.544] (-661.804) (-665.355) (-670.644) -- 0:03:05
307000 -- (-667.044) (-665.889) (-666.258) [-672.920] * [-662.205] (-666.791) (-662.579) (-676.003) -- 0:03:05
308000 -- (-670.551) (-664.898) (-667.045) [-670.417] * [-661.054] (-665.016) (-666.408) (-668.619) -- 0:03:04
309000 -- (-669.763) (-673.479) (-674.878) [-666.154] * (-667.159) [-664.035] (-665.474) (-666.934) -- 0:03:03
310000 -- (-666.431) (-665.194) (-675.960) [-665.394] * (-672.365) (-668.333) [-670.863] (-670.850) -- 0:03:04
Average standard deviation of split frequencies: 0.011778
311000 -- (-668.708) [-664.742] (-668.539) (-673.228) * (-664.140) (-670.722) [-665.629] (-672.871) -- 0:03:03
312000 -- [-661.133] (-668.929) (-669.661) (-676.984) * [-664.945] (-668.731) (-668.157) (-676.308) -- 0:03:03
313000 -- (-669.036) (-675.355) [-667.181] (-661.981) * (-677.175) (-667.925) (-672.121) [-672.788] -- 0:03:02
314000 -- (-664.247) [-662.153] (-663.952) (-666.908) * (-667.241) [-664.948] (-674.509) (-676.732) -- 0:03:03
315000 -- (-660.736) (-674.253) [-667.421] (-670.884) * [-674.896] (-667.463) (-672.126) (-672.486) -- 0:03:02
Average standard deviation of split frequencies: 0.012716
316000 -- (-671.926) (-666.952) [-665.420] (-669.293) * [-681.321] (-671.754) (-669.313) (-675.442) -- 0:03:01
317000 -- (-667.606) (-669.415) (-665.424) [-664.493] * [-659.184] (-665.253) (-674.771) (-669.877) -- 0:03:00
318000 -- (-658.362) (-679.793) (-665.817) [-673.150] * (-669.352) (-679.200) (-669.939) [-669.186] -- 0:03:02
319000 -- [-665.004] (-671.866) (-664.919) (-672.022) * (-664.628) (-670.369) (-668.229) [-663.432] -- 0:03:01
320000 -- (-668.570) [-676.341] (-669.939) (-666.229) * [-667.914] (-672.700) (-673.960) (-667.067) -- 0:03:00
Average standard deviation of split frequencies: 0.011971
321000 -- (-671.798) [-668.205] (-672.644) (-666.556) * (-662.150) (-669.119) (-673.426) [-656.622] -- 0:03:01
322000 -- [-667.039] (-676.677) (-672.840) (-679.476) * (-670.764) (-667.929) (-674.964) [-663.877] -- 0:03:01
323000 -- [-664.001] (-670.674) (-667.296) (-662.962) * [-672.297] (-664.536) (-667.374) (-672.273) -- 0:03:00
324000 -- [-664.386] (-667.494) (-663.023) (-678.346) * (-668.330) (-666.175) (-672.236) [-658.743] -- 0:02:59
325000 -- (-667.375) (-674.291) (-663.759) [-659.938] * [-663.420] (-664.643) (-672.031) (-666.997) -- 0:03:00
Average standard deviation of split frequencies: 0.011568
326000 -- (-660.639) [-664.365] (-667.180) (-678.220) * [-669.296] (-673.131) (-666.225) (-677.807) -- 0:02:59
327000 -- (-671.892) [-663.768] (-668.856) (-669.348) * [-668.523] (-663.358) (-676.214) (-672.490) -- 0:02:59
328000 -- (-668.542) (-667.453) [-666.994] (-664.653) * [-667.746] (-675.448) (-672.623) (-668.603) -- 0:02:58
329000 -- [-664.272] (-667.685) (-666.736) (-667.239) * (-677.072) (-672.249) [-669.186] (-669.371) -- 0:02:59
330000 -- [-664.391] (-664.617) (-675.781) (-666.750) * (-688.183) (-672.112) (-660.251) [-670.210] -- 0:02:58
Average standard deviation of split frequencies: 0.011599
331000 -- (-663.746) [-664.096] (-673.053) (-671.793) * [-663.138] (-662.895) (-672.360) (-662.606) -- 0:02:57
332000 -- (-666.279) (-666.286) (-669.880) [-665.588] * (-662.779) [-665.674] (-675.522) (-666.019) -- 0:02:57
333000 -- (-670.519) (-666.125) [-669.480] (-662.343) * (-664.682) (-668.275) (-669.350) [-671.330] -- 0:02:58
334000 -- [-665.010] (-673.873) (-663.991) (-668.403) * (-664.778) (-670.801) (-664.549) [-670.773] -- 0:02:57
335000 -- [-658.863] (-671.567) (-659.124) (-664.323) * (-662.750) [-662.299] (-674.557) (-665.611) -- 0:02:56
Average standard deviation of split frequencies: 0.011825
336000 -- (-668.669) (-669.331) (-664.606) [-666.589] * (-663.691) (-665.613) [-664.865] (-666.747) -- 0:02:57
337000 -- (-665.601) [-672.492] (-664.770) (-668.371) * (-681.797) (-670.994) (-665.765) [-667.393] -- 0:02:57
338000 -- (-669.188) [-664.826] (-671.647) (-671.338) * (-670.885) (-677.829) [-664.518] (-665.284) -- 0:02:56
339000 -- (-673.678) [-663.705] (-668.368) (-675.648) * (-672.467) (-674.790) [-666.490] (-678.720) -- 0:02:55
340000 -- (-676.582) (-662.843) [-676.203] (-672.458) * [-673.611] (-665.499) (-665.109) (-671.183) -- 0:02:56
Average standard deviation of split frequencies: 0.011400
341000 -- (-668.351) (-676.317) [-668.394] (-672.453) * [-671.476] (-667.886) (-669.935) (-667.473) -- 0:02:55
342000 -- [-662.988] (-666.668) (-674.935) (-668.691) * (-666.490) [-664.718] (-674.130) (-664.720) -- 0:02:55
343000 -- (-675.812) (-671.906) [-666.716] (-671.162) * (-666.037) (-670.663) (-660.718) [-659.928] -- 0:02:54
344000 -- (-660.161) [-664.854] (-673.900) (-683.549) * (-663.909) (-667.571) [-665.893] (-673.323) -- 0:02:55
345000 -- [-668.556] (-674.966) (-664.235) (-662.520) * [-667.735] (-663.852) (-665.258) (-667.080) -- 0:02:54
Average standard deviation of split frequencies: 0.010961
346000 -- (-667.455) [-667.671] (-668.903) (-665.234) * (-662.477) (-665.396) [-668.776] (-668.788) -- 0:02:53
347000 -- (-668.865) [-664.848] (-674.470) (-675.144) * (-667.242) (-669.991) [-665.597] (-664.673) -- 0:02:55
348000 -- (-665.378) (-670.822) (-661.183) [-674.208] * (-666.465) (-665.370) (-669.553) [-661.069] -- 0:02:54
349000 -- [-666.644] (-662.629) (-667.623) (-673.467) * (-663.592) (-674.688) [-667.256] (-670.503) -- 0:02:53
350000 -- (-663.802) (-673.245) (-669.187) [-669.096] * (-667.190) [-668.176] (-668.671) (-662.271) -- 0:02:52
Average standard deviation of split frequencies: 0.011203
351000 -- (-669.224) [-663.496] (-669.242) (-672.340) * (-666.316) [-666.807] (-673.351) (-666.718) -- 0:02:53
352000 -- [-664.215] (-664.092) (-672.828) (-674.298) * (-659.765) (-670.504) [-664.202] (-663.410) -- 0:02:53
353000 -- (-669.754) (-660.508) [-669.033] (-661.829) * (-666.051) (-661.637) [-666.460] (-663.220) -- 0:02:52
354000 -- (-673.107) (-664.688) [-667.159] (-666.267) * (-671.629) [-661.661] (-667.411) (-658.814) -- 0:02:51
355000 -- (-666.221) (-663.054) (-668.996) [-666.803] * (-664.214) (-661.760) (-669.269) [-668.528] -- 0:02:52
Average standard deviation of split frequencies: 0.010909
356000 -- (-669.562) [-662.002] (-665.986) (-668.907) * (-662.241) (-670.315) (-677.570) [-670.123] -- 0:02:51
357000 -- (-669.925) (-667.833) (-666.461) [-663.188] * [-666.884] (-670.848) (-673.655) (-669.665) -- 0:02:51
358000 -- [-665.580] (-669.877) (-676.793) (-673.970) * (-674.862) (-674.775) (-661.643) [-666.999] -- 0:02:50
359000 -- (-663.915) (-673.693) (-667.121) [-664.250] * (-672.989) [-666.656] (-667.243) (-665.444) -- 0:02:51
360000 -- (-665.070) [-662.177] (-665.226) (-671.252) * [-670.755] (-670.632) (-669.370) (-668.462) -- 0:02:50
Average standard deviation of split frequencies: 0.010145
361000 -- [-666.403] (-680.249) (-672.846) (-682.073) * [-662.382] (-667.522) (-675.906) (-668.616) -- 0:02:49
362000 -- (-665.247) (-665.538) [-660.945] (-671.497) * (-659.341) [-662.966] (-675.022) (-673.993) -- 0:02:50
363000 -- (-673.125) (-669.678) [-672.061] (-661.970) * [-669.768] (-673.398) (-667.531) (-666.916) -- 0:02:50
364000 -- (-672.033) (-673.285) [-674.246] (-671.989) * (-672.670) [-660.693] (-666.604) (-668.122) -- 0:02:49
365000 -- (-669.551) (-668.877) (-663.035) [-670.872] * [-664.080] (-669.690) (-669.893) (-664.550) -- 0:02:48
Average standard deviation of split frequencies: 0.010480
366000 -- (-667.532) [-664.240] (-681.219) (-668.520) * (-669.934) [-665.904] (-665.819) (-681.959) -- 0:02:49
367000 -- (-667.664) (-675.915) [-671.562] (-663.139) * (-666.115) [-665.671] (-669.423) (-667.223) -- 0:02:49
368000 -- [-662.358] (-667.262) (-683.152) (-672.585) * [-669.344] (-666.543) (-666.789) (-667.088) -- 0:02:48
369000 -- (-666.472) (-663.567) [-673.000] (-674.285) * (-661.848) [-664.820] (-671.680) (-667.550) -- 0:02:47
370000 -- (-668.759) (-667.003) (-673.131) [-669.376] * (-661.917) (-662.861) [-662.207] (-669.632) -- 0:02:48
Average standard deviation of split frequencies: 0.009205
371000 -- [-664.161] (-670.437) (-673.856) (-669.307) * (-666.797) (-670.299) [-665.422] (-670.599) -- 0:02:47
372000 -- (-667.178) (-674.881) [-662.944] (-672.840) * (-663.786) (-661.904) [-665.667] (-662.412) -- 0:02:47
373000 -- (-672.382) (-670.674) [-667.510] (-664.641) * (-668.084) (-665.588) [-666.620] (-666.156) -- 0:02:46
374000 -- (-675.023) (-672.813) (-662.202) [-662.624] * (-674.304) [-664.207] (-668.207) (-666.314) -- 0:02:47
375000 -- (-664.601) [-664.465] (-669.224) (-668.686) * (-667.853) (-672.996) (-670.264) [-671.537] -- 0:02:46
Average standard deviation of split frequencies: 0.008896
376000 -- (-660.144) [-664.664] (-661.770) (-665.737) * (-683.024) [-668.197] (-666.024) (-672.103) -- 0:02:45
377000 -- (-672.974) (-658.451) (-673.536) [-663.628] * [-665.757] (-672.003) (-671.763) (-665.252) -- 0:02:46
378000 -- (-671.105) (-661.924) (-672.087) [-661.479] * (-672.411) (-680.244) [-669.022] (-664.672) -- 0:02:46
379000 -- (-668.656) (-666.840) [-663.185] (-670.428) * (-661.440) (-666.526) [-666.195] (-666.773) -- 0:02:45
380000 -- (-664.778) (-666.637) [-665.415] (-664.938) * (-670.772) [-663.014] (-662.934) (-665.357) -- 0:02:44
Average standard deviation of split frequencies: 0.007926
381000 -- [-669.530] (-668.508) (-666.150) (-663.103) * (-672.890) (-668.870) (-659.516) [-665.032] -- 0:02:45
382000 -- (-675.354) (-670.397) [-665.383] (-661.362) * [-660.545] (-676.044) (-669.880) (-669.305) -- 0:02:45
383000 -- (-665.126) [-667.218] (-669.029) (-661.137) * (-671.253) (-673.519) (-666.721) [-661.012] -- 0:02:44
384000 -- (-677.495) (-662.579) [-667.522] (-672.275) * (-668.569) (-671.769) (-668.309) [-667.524] -- 0:02:43
385000 -- (-669.327) (-670.210) (-665.058) [-663.870] * (-671.162) [-667.627] (-672.757) (-663.372) -- 0:02:44
Average standard deviation of split frequencies: 0.008142
386000 -- (-667.781) [-660.110] (-659.836) (-667.703) * (-666.474) (-673.680) (-674.961) [-673.845] -- 0:02:43
387000 -- (-664.456) [-671.885] (-661.329) (-677.559) * (-660.242) [-662.600] (-666.287) (-670.266) -- 0:02:43
388000 -- (-667.546) [-665.229] (-667.599) (-670.489) * (-669.399) [-671.447] (-663.188) (-673.963) -- 0:02:42
389000 -- (-664.461) (-669.780) [-659.171] (-673.333) * (-661.064) (-663.646) (-671.277) [-666.497] -- 0:02:43
390000 -- (-666.504) (-659.354) (-673.444) [-659.657] * [-668.568] (-668.681) (-673.159) (-662.158) -- 0:02:42
Average standard deviation of split frequencies: 0.008044
391000 -- [-669.915] (-672.993) (-664.157) (-667.235) * (-665.325) (-661.153) (-668.584) [-666.141] -- 0:02:41
392000 -- (-676.379) (-675.552) [-662.165] (-669.206) * (-669.269) (-666.243) [-666.085] (-670.314) -- 0:02:42
393000 -- [-665.390] (-683.689) (-665.464) (-672.173) * (-668.246) (-676.181) [-669.887] (-664.322) -- 0:02:42
394000 -- [-667.193] (-672.793) (-663.869) (-665.705) * [-667.303] (-667.062) (-675.011) (-666.289) -- 0:02:41
395000 -- [-666.783] (-670.648) (-668.997) (-668.615) * (-667.238) (-662.354) (-668.817) [-661.568] -- 0:02:40
Average standard deviation of split frequencies: 0.008035
396000 -- (-668.391) [-668.544] (-661.005) (-668.539) * (-673.778) (-664.918) [-666.574] (-667.404) -- 0:02:41
397000 -- (-668.089) [-676.004] (-670.486) (-670.356) * (-673.332) (-665.973) (-662.565) [-662.046] -- 0:02:41
398000 -- (-668.644) (-666.874) (-676.069) [-661.047] * (-667.391) (-664.845) (-664.696) [-666.822] -- 0:02:40
399000 -- (-672.517) (-669.351) (-665.960) [-671.514] * (-672.967) (-664.318) (-666.107) [-667.369] -- 0:02:39
400000 -- (-664.071) (-671.209) (-668.452) [-663.156] * [-662.351] (-665.358) (-672.148) (-666.234) -- 0:02:40
Average standard deviation of split frequencies: 0.008001
401000 -- (-666.336) (-667.004) (-668.013) [-664.462] * [-669.841] (-672.476) (-673.610) (-671.396) -- 0:02:39
402000 -- (-665.046) [-663.913] (-667.406) (-667.430) * [-677.147] (-667.670) (-670.143) (-674.997) -- 0:02:39
403000 -- [-663.360] (-663.213) (-670.651) (-666.471) * (-663.176) (-663.435) [-668.600] (-676.901) -- 0:02:38
404000 -- (-666.471) (-667.227) (-666.862) [-669.766] * [-667.160] (-679.670) (-663.524) (-670.210) -- 0:02:39
405000 -- (-663.159) (-667.004) [-670.257] (-661.598) * (-669.940) (-662.413) (-672.537) [-666.361] -- 0:02:38
Average standard deviation of split frequencies: 0.008360
406000 -- (-667.898) (-666.563) (-671.454) [-667.573] * (-665.500) (-668.574) [-664.460] (-666.863) -- 0:02:38
407000 -- (-665.989) [-664.466] (-664.291) (-668.922) * [-660.659] (-662.783) (-661.872) (-666.463) -- 0:02:37
408000 -- (-663.168) [-669.834] (-685.465) (-670.463) * [-666.998] (-664.403) (-674.730) (-673.078) -- 0:02:38
409000 -- (-683.901) (-674.582) [-669.142] (-663.487) * [-661.909] (-670.955) (-666.967) (-670.608) -- 0:02:37
410000 -- (-668.209) (-676.647) (-668.373) [-666.676] * (-661.531) (-666.905) (-668.521) [-666.792] -- 0:02:36
Average standard deviation of split frequencies: 0.008691
411000 -- (-679.905) (-666.846) [-668.689] (-667.388) * (-667.991) (-665.818) (-661.535) [-675.376] -- 0:02:37
412000 -- (-676.544) (-671.838) (-666.609) [-664.951] * (-671.405) [-661.893] (-663.315) (-673.534) -- 0:02:36
413000 -- (-666.412) [-668.324] (-664.035) (-674.028) * (-667.847) [-662.653] (-670.817) (-669.767) -- 0:02:36
414000 -- (-664.129) (-667.352) [-670.324] (-669.392) * [-662.373] (-670.042) (-680.539) (-664.773) -- 0:02:35
415000 -- [-663.487] (-666.185) (-663.757) (-664.590) * (-669.275) (-671.191) (-667.535) [-660.140] -- 0:02:36
Average standard deviation of split frequencies: 0.008634
416000 -- (-667.807) (-673.882) (-666.892) [-659.039] * (-678.829) (-662.750) [-665.259] (-668.765) -- 0:02:35
417000 -- (-670.866) (-670.649) [-667.550] (-664.605) * (-676.858) (-663.857) (-671.349) [-663.233] -- 0:02:35
418000 -- (-672.737) (-674.987) (-667.249) [-660.643] * (-661.441) (-672.054) (-667.629) [-670.044] -- 0:02:34
419000 -- [-665.320] (-679.219) (-667.327) (-667.059) * [-664.590] (-667.540) (-670.273) (-666.874) -- 0:02:35
420000 -- [-663.612] (-679.437) (-668.676) (-668.303) * [-666.321] (-669.951) (-661.821) (-675.836) -- 0:02:34
Average standard deviation of split frequencies: 0.008685
421000 -- (-669.676) (-670.121) (-660.658) [-668.552] * (-662.026) [-672.887] (-663.252) (-668.735) -- 0:02:34
422000 -- (-669.558) (-662.968) (-678.635) [-664.191] * (-662.194) (-669.129) [-669.785] (-673.531) -- 0:02:33
423000 -- (-668.482) [-669.169] (-667.197) (-677.831) * [-668.497] (-682.870) (-665.951) (-662.414) -- 0:02:34
424000 -- (-665.326) [-668.793] (-667.020) (-671.800) * [-661.468] (-676.485) (-668.568) (-672.818) -- 0:02:33
425000 -- (-667.627) [-663.691] (-673.979) (-662.006) * (-663.888) (-663.855) (-670.799) [-662.411] -- 0:02:32
Average standard deviation of split frequencies: 0.008133
426000 -- (-680.790) (-672.232) (-672.017) [-663.675] * [-660.721] (-671.812) (-675.544) (-671.701) -- 0:02:33
427000 -- (-674.446) (-673.640) [-668.947] (-669.074) * [-662.381] (-661.587) (-676.359) (-669.986) -- 0:02:32
428000 -- (-680.652) [-670.462] (-670.181) (-666.025) * (-667.406) (-665.261) (-670.096) [-662.081] -- 0:02:32
429000 -- [-662.263] (-674.952) (-666.634) (-665.265) * (-662.503) (-671.156) (-668.090) [-664.523] -- 0:02:31
430000 -- (-669.844) [-670.067] (-660.693) (-670.238) * (-680.054) (-675.632) [-661.560] (-662.302) -- 0:02:32
Average standard deviation of split frequencies: 0.008483
431000 -- (-671.909) (-670.416) (-672.160) [-665.143] * [-669.377] (-677.948) (-673.482) (-660.101) -- 0:02:31
432000 -- (-669.593) [-665.478] (-658.521) (-672.933) * (-666.221) (-666.633) [-663.691] (-671.534) -- 0:02:31
433000 -- (-670.787) [-662.650] (-664.836) (-663.139) * (-666.641) [-667.735] (-672.765) (-670.645) -- 0:02:30
434000 -- (-666.717) (-669.156) (-663.923) [-664.390] * [-669.263] (-666.330) (-667.328) (-670.259) -- 0:02:31
435000 -- (-664.216) [-668.820] (-674.808) (-666.399) * (-667.998) (-668.897) [-667.633] (-675.140) -- 0:02:30
Average standard deviation of split frequencies: 0.008704
436000 -- [-673.298] (-668.122) (-677.128) (-664.855) * (-670.720) (-663.567) (-668.334) [-666.813] -- 0:02:30
437000 -- [-663.698] (-668.046) (-666.266) (-670.170) * (-668.066) (-661.063) [-666.222] (-669.290) -- 0:02:29
438000 -- (-662.511) (-666.676) (-669.924) [-668.809] * (-666.598) (-673.490) [-667.689] (-671.245) -- 0:02:30
439000 -- [-664.016] (-673.329) (-663.470) (-663.871) * (-667.067) (-662.984) [-669.171] (-675.094) -- 0:02:29
440000 -- [-664.524] (-673.531) (-667.123) (-670.490) * (-666.950) (-667.776) [-670.639] (-669.026) -- 0:02:28
Average standard deviation of split frequencies: 0.008665
441000 -- [-664.921] (-672.472) (-669.858) (-669.493) * [-673.560] (-661.567) (-661.411) (-663.721) -- 0:02:29
442000 -- (-665.691) (-669.263) (-674.032) [-663.256] * (-677.984) (-670.841) [-663.865] (-663.224) -- 0:02:28
443000 -- (-665.822) (-663.867) [-667.765] (-667.465) * (-666.774) (-678.425) [-666.669] (-672.130) -- 0:02:28
444000 -- (-665.110) (-665.098) [-665.927] (-668.504) * (-659.432) (-677.457) [-659.080] (-665.568) -- 0:02:27
445000 -- (-668.680) [-667.018] (-660.731) (-671.058) * (-661.502) [-669.078] (-660.760) (-675.577) -- 0:02:28
Average standard deviation of split frequencies: 0.008561
446000 -- [-668.140] (-672.365) (-669.388) (-667.618) * (-666.429) (-670.015) [-667.540] (-665.411) -- 0:02:27
447000 -- [-661.569] (-671.777) (-669.995) (-674.411) * (-663.652) (-672.914) [-667.291] (-672.496) -- 0:02:27
448000 -- (-666.833) (-668.350) (-668.116) [-669.692] * (-664.377) (-665.751) (-675.911) [-661.749] -- 0:02:26
449000 -- [-666.968] (-665.298) (-675.722) (-667.451) * (-663.831) (-664.146) [-660.849] (-673.520) -- 0:02:27
450000 -- (-662.939) [-666.391] (-665.560) (-668.958) * (-672.502) [-667.813] (-676.319) (-667.268) -- 0:02:26
Average standard deviation of split frequencies: 0.008002
451000 -- [-667.495] (-662.617) (-670.283) (-664.351) * (-665.459) [-673.458] (-670.933) (-668.828) -- 0:02:26
452000 -- (-671.657) (-674.904) [-670.394] (-667.776) * (-666.519) [-668.222] (-664.641) (-669.728) -- 0:02:25
453000 -- (-668.907) [-668.482] (-669.260) (-686.011) * (-673.609) (-662.266) [-664.708] (-667.182) -- 0:02:26
454000 -- (-665.721) (-667.780) (-671.762) [-668.200] * [-669.513] (-670.827) (-669.912) (-666.001) -- 0:02:25
455000 -- (-660.829) [-661.283] (-663.720) (-679.106) * (-668.423) (-677.963) [-666.408] (-669.170) -- 0:02:24
Average standard deviation of split frequencies: 0.007340
456000 -- (-669.943) (-672.781) [-666.697] (-661.106) * (-668.776) (-677.317) [-663.983] (-667.678) -- 0:02:25
457000 -- (-661.402) [-665.333] (-667.853) (-670.650) * [-668.197] (-670.436) (-679.068) (-671.749) -- 0:02:24
458000 -- [-668.213] (-665.340) (-666.379) (-663.992) * [-663.345] (-675.187) (-676.901) (-671.164) -- 0:02:24
459000 -- (-676.285) [-664.826] (-669.409) (-666.882) * (-668.538) (-677.355) (-665.308) [-659.234] -- 0:02:23
460000 -- (-664.129) (-668.761) (-683.465) [-663.016] * (-666.425) (-672.268) [-661.150] (-670.847) -- 0:02:24
Average standard deviation of split frequencies: 0.006920
461000 -- (-665.868) (-670.333) [-667.259] (-668.945) * (-671.222) (-665.414) (-669.302) [-665.999] -- 0:02:23
462000 -- [-667.909] (-667.869) (-663.780) (-663.012) * (-666.431) (-665.803) (-665.637) [-672.565] -- 0:02:23
463000 -- (-667.143) (-669.924) [-667.887] (-669.540) * (-665.186) [-667.056] (-668.645) (-671.346) -- 0:02:22
464000 -- (-671.026) (-668.055) [-665.833] (-669.273) * (-662.533) [-670.849] (-662.448) (-674.769) -- 0:02:23
465000 -- [-666.884] (-668.636) (-673.542) (-666.981) * (-670.917) (-669.802) (-671.587) [-663.308] -- 0:02:22
Average standard deviation of split frequencies: 0.007033
466000 -- (-665.684) (-663.254) (-662.930) [-666.956] * [-673.628] (-666.743) (-668.756) (-668.795) -- 0:02:22
467000 -- (-675.363) (-666.754) (-669.122) [-663.609] * (-663.755) [-668.863] (-667.866) (-667.218) -- 0:02:21
468000 -- (-661.927) (-670.516) [-662.808] (-670.725) * (-665.831) [-667.329] (-665.469) (-674.299) -- 0:02:22
469000 -- (-664.799) [-665.133] (-676.090) (-668.047) * (-673.609) [-664.491] (-664.990) (-676.161) -- 0:02:21
470000 -- [-663.694] (-676.720) (-669.424) (-669.731) * (-675.338) (-660.246) [-668.781] (-670.596) -- 0:02:20
Average standard deviation of split frequencies: 0.007412
471000 -- (-671.463) (-679.132) (-667.815) [-668.273] * [-672.886] (-668.169) (-667.741) (-668.255) -- 0:02:21
472000 -- (-671.380) (-665.161) [-662.235] (-667.431) * (-670.690) [-669.269] (-662.492) (-676.051) -- 0:02:20
473000 -- [-666.991] (-666.630) (-663.769) (-674.957) * (-666.118) (-667.362) (-667.593) [-661.968] -- 0:02:20
474000 -- [-662.189] (-671.540) (-665.955) (-666.399) * (-673.611) [-658.746] (-667.181) (-668.198) -- 0:02:19
475000 -- (-670.013) (-671.021) [-665.328] (-666.022) * (-672.517) (-665.814) (-669.384) [-668.525] -- 0:02:20
Average standard deviation of split frequencies: 0.007230
476000 -- (-665.542) [-662.344] (-664.146) (-682.216) * (-664.770) (-677.806) [-670.759] (-664.996) -- 0:02:19
477000 -- [-664.228] (-665.428) (-667.895) (-663.311) * [-658.991] (-665.943) (-668.582) (-664.618) -- 0:02:19
478000 -- (-662.504) (-670.803) [-662.913] (-661.035) * [-664.334] (-668.347) (-670.747) (-679.302) -- 0:02:18
479000 -- [-666.048] (-664.515) (-660.016) (-670.546) * (-677.886) [-667.855] (-672.511) (-667.860) -- 0:02:19
480000 -- (-674.567) (-674.465) [-666.233] (-671.592) * (-674.263) (-670.798) (-667.913) [-666.854] -- 0:02:18
Average standard deviation of split frequencies: 0.008207
481000 -- (-673.164) [-671.180] (-670.557) (-671.026) * (-671.687) (-668.356) [-661.480] (-669.907) -- 0:02:18
482000 -- (-665.927) (-662.370) [-664.258] (-673.261) * (-664.586) [-661.896] (-668.945) (-676.602) -- 0:02:17
483000 -- (-665.698) (-662.761) [-668.388] (-676.806) * [-669.427] (-674.993) (-669.248) (-666.734) -- 0:02:18
484000 -- (-667.922) (-669.897) [-665.288] (-673.136) * [-664.076] (-658.101) (-669.104) (-667.127) -- 0:02:17
485000 -- (-663.455) [-667.791] (-666.148) (-669.534) * (-672.554) [-671.048] (-677.576) (-667.351) -- 0:02:16
Average standard deviation of split frequencies: 0.008321
486000 -- (-667.651) [-663.486] (-678.242) (-659.588) * (-667.239) [-663.743] (-668.306) (-675.515) -- 0:02:17
487000 -- (-678.645) (-667.355) (-671.874) [-664.137] * (-666.058) (-672.737) [-664.119] (-681.491) -- 0:02:16
488000 -- (-670.399) (-670.425) (-668.126) [-665.297] * (-663.680) [-661.988] (-669.906) (-665.125) -- 0:02:16
489000 -- (-680.834) (-671.831) [-666.712] (-673.867) * (-670.061) (-668.659) [-661.879] (-667.126) -- 0:02:15
490000 -- (-672.753) [-658.465] (-665.561) (-668.170) * [-664.565] (-665.841) (-666.740) (-667.102) -- 0:02:16
Average standard deviation of split frequencies: 0.007686
491000 -- (-682.665) (-658.877) [-666.145] (-663.005) * (-665.819) [-660.141] (-672.035) (-668.496) -- 0:02:15
492000 -- (-666.343) (-660.006) [-665.992] (-669.064) * (-668.115) (-665.429) (-670.616) [-667.493] -- 0:02:15
493000 -- (-678.763) (-669.925) (-669.908) [-659.686] * (-666.694) (-663.607) [-662.312] (-662.043) -- 0:02:14
494000 -- (-664.571) (-662.904) [-670.686] (-667.153) * (-675.978) (-664.969) (-662.193) [-662.973] -- 0:02:15
495000 -- (-669.725) (-671.959) [-660.595] (-661.967) * (-672.711) (-667.419) [-665.017] (-665.243) -- 0:02:14
Average standard deviation of split frequencies: 0.007903
496000 -- (-666.108) (-676.297) [-669.091] (-674.250) * [-670.860] (-666.072) (-669.066) (-667.656) -- 0:02:14
497000 -- [-665.485] (-671.762) (-664.015) (-667.609) * (-664.014) (-666.476) (-663.985) [-670.109] -- 0:02:13
498000 -- [-667.583] (-663.977) (-663.257) (-669.382) * (-660.985) [-668.923] (-675.510) (-669.531) -- 0:02:14
499000 -- (-673.182) (-670.039) [-659.572] (-670.868) * (-660.993) (-669.445) (-673.300) [-665.696] -- 0:02:13
500000 -- (-671.575) (-663.888) [-663.647] (-667.774) * [-666.289] (-668.259) (-675.054) (-660.548) -- 0:02:13
Average standard deviation of split frequencies: 0.008127
501000 -- (-664.528) [-659.402] (-664.590) (-668.608) * (-668.233) [-672.498] (-668.277) (-663.403) -- 0:02:13
502000 -- (-661.653) (-665.396) [-661.532] (-671.974) * (-669.386) [-670.732] (-667.441) (-666.974) -- 0:02:12
503000 -- [-666.661] (-669.275) (-665.940) (-680.690) * (-668.724) (-675.222) (-666.611) [-665.977] -- 0:02:12
504000 -- (-666.563) (-672.387) (-665.477) [-665.049] * (-671.187) (-665.999) (-672.680) [-662.672] -- 0:02:11
505000 -- (-665.129) (-671.876) (-669.476) [-666.281] * [-667.826] (-677.685) (-671.495) (-671.764) -- 0:02:12
Average standard deviation of split frequencies: 0.008728
506000 -- (-672.364) (-672.398) (-678.194) [-664.301] * [-665.384] (-669.216) (-669.943) (-663.489) -- 0:02:11
507000 -- (-659.963) [-663.398] (-673.803) (-676.960) * (-660.486) (-661.174) [-665.875] (-670.657) -- 0:02:11
508000 -- (-675.777) [-671.655] (-676.738) (-664.788) * (-667.055) (-663.881) (-673.786) [-666.036] -- 0:02:10
509000 -- (-671.602) (-669.324) [-662.730] (-671.526) * (-662.978) [-661.349] (-664.578) (-673.386) -- 0:02:11
510000 -- (-661.924) [-664.227] (-667.148) (-668.892) * (-664.868) (-666.681) (-666.184) [-662.358] -- 0:02:10
Average standard deviation of split frequencies: 0.009134
511000 -- [-668.625] (-666.716) (-663.405) (-667.553) * (-676.424) (-671.517) (-671.750) [-665.045] -- 0:02:10
512000 -- (-677.406) (-664.380) [-663.169] (-664.530) * (-668.834) [-660.951] (-670.250) (-666.849) -- 0:02:10
513000 -- [-671.242] (-666.004) (-663.607) (-671.814) * (-668.007) (-662.300) (-661.768) [-662.815] -- 0:02:10
514000 -- (-663.233) [-663.787] (-679.598) (-670.922) * [-669.096] (-664.210) (-668.585) (-668.585) -- 0:02:09
515000 -- (-669.623) (-671.408) [-661.465] (-675.586) * [-668.223] (-663.345) (-665.654) (-669.355) -- 0:02:09
Average standard deviation of split frequencies: 0.009280
516000 -- (-666.109) [-662.891] (-665.541) (-666.083) * [-665.855] (-663.031) (-667.689) (-670.506) -- 0:02:09
517000 -- (-668.636) (-667.672) [-669.332] (-666.971) * (-670.199) (-670.654) [-664.130] (-666.435) -- 0:02:08
518000 -- (-670.671) (-671.057) (-668.788) [-660.945] * (-668.021) [-671.675] (-667.569) (-668.865) -- 0:02:08
519000 -- (-674.116) (-663.961) [-667.894] (-679.628) * [-668.521] (-673.479) (-669.876) (-671.239) -- 0:02:07
520000 -- [-658.682] (-663.627) (-665.942) (-662.784) * [-662.387] (-672.227) (-668.096) (-663.813) -- 0:02:08
Average standard deviation of split frequencies: 0.008911
521000 -- (-665.250) [-662.898] (-666.733) (-671.465) * (-665.089) (-669.891) [-664.557] (-669.133) -- 0:02:07
522000 -- [-671.455] (-664.952) (-678.780) (-674.602) * (-671.802) [-661.451] (-667.830) (-661.728) -- 0:02:07
523000 -- [-665.760] (-666.670) (-671.413) (-663.756) * (-668.517) (-678.881) (-668.284) [-665.579] -- 0:02:06
524000 -- [-662.685] (-676.547) (-671.057) (-668.631) * (-669.674) [-659.243] (-669.215) (-673.122) -- 0:02:07
525000 -- [-666.345] (-663.322) (-671.064) (-679.160) * (-669.273) (-672.464) (-676.280) [-664.933] -- 0:02:06
Average standard deviation of split frequencies: 0.009104
526000 -- (-666.315) [-663.752] (-663.947) (-669.392) * (-673.997) (-666.001) [-664.078] (-667.063) -- 0:02:06
527000 -- (-662.954) (-668.600) (-672.445) [-665.200] * [-669.146] (-664.217) (-674.927) (-664.846) -- 0:02:06
528000 -- [-657.284] (-663.881) (-664.675) (-667.807) * (-666.282) [-663.135] (-662.590) (-664.487) -- 0:02:06
529000 -- (-668.937) [-668.619] (-669.544) (-666.037) * [-667.204] (-664.313) (-666.825) (-665.238) -- 0:02:05
530000 -- [-669.558] (-672.780) (-674.212) (-672.662) * [-660.730] (-668.668) (-672.696) (-667.511) -- 0:02:05
Average standard deviation of split frequencies: 0.008930
531000 -- [-661.849] (-660.671) (-670.035) (-673.036) * [-659.875] (-666.631) (-666.145) (-675.481) -- 0:02:05
532000 -- (-664.509) (-665.587) [-668.307] (-671.118) * (-666.322) [-664.415] (-667.410) (-670.733) -- 0:02:04
533000 -- (-665.816) (-674.578) [-659.975] (-659.946) * [-665.922] (-671.466) (-671.661) (-666.211) -- 0:02:04
534000 -- (-665.318) (-660.460) [-660.261] (-667.860) * [-664.392] (-661.163) (-676.337) (-670.393) -- 0:02:03
535000 -- (-667.081) (-667.583) (-661.835) [-670.925] * (-662.600) [-670.639] (-667.569) (-665.934) -- 0:02:04
Average standard deviation of split frequencies: 0.009258
536000 -- [-662.277] (-675.217) (-672.531) (-663.038) * (-671.644) [-663.311] (-667.508) (-666.922) -- 0:02:03
537000 -- [-660.205] (-671.259) (-668.324) (-672.135) * (-673.176) (-664.176) (-673.137) [-667.711] -- 0:02:03
538000 -- (-670.956) (-665.586) (-672.119) [-658.360] * [-664.405] (-665.003) (-667.338) (-662.698) -- 0:02:02
539000 -- [-663.801] (-667.707) (-666.293) (-664.974) * (-667.517) (-670.611) [-665.842] (-669.113) -- 0:02:03
540000 -- [-671.294] (-669.151) (-664.559) (-662.083) * (-664.997) [-664.943] (-669.617) (-679.345) -- 0:02:02
Average standard deviation of split frequencies: 0.009460
541000 -- (-674.737) (-667.643) (-670.028) [-667.057] * (-662.736) (-664.611) [-665.525] (-670.838) -- 0:02:02
542000 -- (-674.441) (-672.953) [-658.922] (-664.315) * (-669.442) (-664.963) (-670.815) [-661.127] -- 0:02:02
543000 -- [-664.195] (-668.004) (-667.622) (-671.867) * (-667.409) (-664.188) (-671.360) [-661.224] -- 0:02:02
544000 -- (-674.641) [-661.813] (-667.769) (-663.057) * (-665.566) (-661.245) [-666.762] (-668.067) -- 0:02:01
545000 -- [-666.644] (-667.764) (-658.956) (-676.375) * (-665.263) (-666.338) (-670.508) [-659.431] -- 0:02:01
Average standard deviation of split frequencies: 0.009368
546000 -- (-664.639) [-666.218] (-672.213) (-667.996) * (-677.212) [-666.278] (-673.797) (-671.924) -- 0:02:01
547000 -- (-666.725) (-673.591) (-675.693) [-666.732] * [-672.027] (-673.445) (-667.591) (-669.838) -- 0:02:00
548000 -- (-677.760) (-664.298) (-673.194) [-669.055] * (-674.668) (-670.516) [-674.833] (-665.398) -- 0:02:00
549000 -- (-674.526) (-668.144) [-666.671] (-667.138) * (-664.091) [-664.366] (-663.332) (-683.653) -- 0:01:59
550000 -- (-661.662) (-667.738) [-668.009] (-667.948) * (-676.162) [-664.249] (-678.036) (-670.967) -- 0:02:00
Average standard deviation of split frequencies: 0.010183
551000 -- (-664.507) (-669.775) (-672.109) [-664.046] * (-661.148) (-670.560) [-661.829] (-669.688) -- 0:01:59
552000 -- (-667.911) (-667.742) (-666.450) [-663.891] * (-667.278) (-683.159) (-665.942) [-671.856] -- 0:01:59
553000 -- (-669.161) [-665.395] (-667.866) (-662.880) * [-661.619] (-668.728) (-666.576) (-673.927) -- 0:01:59
554000 -- (-666.127) (-664.939) (-664.688) [-662.124] * (-673.455) (-665.716) (-668.529) [-662.513] -- 0:01:59
555000 -- (-670.172) (-669.669) [-662.413] (-664.088) * (-665.769) (-666.267) [-659.428] (-674.140) -- 0:01:58
Average standard deviation of split frequencies: 0.009728
556000 -- (-664.960) (-673.193) (-669.686) [-666.799] * [-669.270] (-660.208) (-677.472) (-671.090) -- 0:01:58
557000 -- [-672.019] (-667.679) (-662.586) (-670.817) * (-668.809) (-671.802) [-662.120] (-665.931) -- 0:01:58
558000 -- (-671.309) [-665.164] (-669.705) (-674.524) * [-670.968] (-663.605) (-669.691) (-666.330) -- 0:01:58
559000 -- (-664.388) (-663.613) (-673.175) [-661.521] * (-663.880) [-665.938] (-668.328) (-668.711) -- 0:01:57
560000 -- [-663.499] (-671.689) (-670.128) (-666.113) * (-671.551) (-680.728) [-665.699] (-664.149) -- 0:01:57
Average standard deviation of split frequencies: 0.009426
561000 -- (-672.997) [-671.882] (-677.682) (-665.184) * (-666.879) [-669.867] (-663.172) (-667.580) -- 0:01:57
562000 -- (-668.026) [-664.252] (-679.135) (-666.783) * (-670.454) (-669.956) [-670.850] (-664.682) -- 0:01:56
563000 -- [-665.863] (-676.734) (-671.001) (-664.306) * (-668.992) [-665.188] (-674.479) (-659.110) -- 0:01:56
564000 -- (-664.461) (-674.979) [-657.683] (-669.604) * [-667.607] (-673.907) (-668.972) (-678.090) -- 0:01:55
565000 -- (-671.213) (-668.783) (-667.744) [-665.607] * (-665.690) (-669.194) (-666.145) [-670.394] -- 0:01:56
Average standard deviation of split frequencies: 0.009249
566000 -- (-668.949) (-667.935) [-665.230] (-667.928) * (-675.626) [-663.422] (-670.249) (-672.967) -- 0:01:55
567000 -- (-664.885) [-659.616] (-665.236) (-665.670) * (-668.025) [-666.664] (-667.743) (-671.170) -- 0:01:55
568000 -- (-663.228) [-665.855] (-673.568) (-669.012) * (-671.813) (-670.555) (-662.753) [-666.618] -- 0:01:55
569000 -- (-659.242) (-666.129) [-665.182] (-675.291) * (-671.525) (-661.556) [-661.191] (-663.836) -- 0:01:55
570000 -- [-664.156] (-673.943) (-664.406) (-671.422) * [-658.445] (-676.496) (-670.306) (-671.998) -- 0:01:54
Average standard deviation of split frequencies: 0.009169
571000 -- (-667.853) (-671.417) (-663.897) [-665.886] * [-672.385] (-664.304) (-680.591) (-664.894) -- 0:01:54
572000 -- (-678.804) (-662.417) [-663.309] (-671.933) * (-676.705) [-662.317] (-664.485) (-671.072) -- 0:01:54
573000 -- (-672.888) [-661.478] (-660.269) (-665.869) * (-661.437) [-664.452] (-665.957) (-661.458) -- 0:01:54
574000 -- [-664.581] (-678.557) (-668.762) (-667.992) * (-666.035) (-668.048) [-660.339] (-664.132) -- 0:01:53
575000 -- (-664.807) (-668.913) [-660.557] (-662.517) * (-663.125) (-674.009) [-672.658] (-669.510) -- 0:01:53
Average standard deviation of split frequencies: 0.008880
576000 -- (-668.948) (-667.549) (-667.738) [-662.546] * (-662.473) (-661.176) (-667.311) [-659.029] -- 0:01:53
577000 -- (-664.567) (-670.253) [-668.228] (-666.584) * (-667.166) (-666.760) [-671.475] (-667.700) -- 0:01:52
578000 -- [-666.182] (-669.036) (-665.433) (-676.798) * [-665.640] (-663.935) (-668.877) (-674.849) -- 0:01:52
579000 -- (-663.942) [-661.934] (-664.217) (-673.771) * (-660.930) [-673.175] (-665.542) (-678.362) -- 0:01:51
580000 -- (-661.870) (-667.762) [-668.017] (-673.305) * (-661.805) (-666.798) (-662.406) [-665.197] -- 0:01:52
Average standard deviation of split frequencies: 0.008524
581000 -- (-664.184) (-666.947) [-668.237] (-668.438) * (-665.570) (-672.942) (-665.988) [-662.514] -- 0:01:51
582000 -- (-666.711) [-669.094] (-667.473) (-666.660) * (-673.290) (-670.572) (-670.225) [-665.390] -- 0:01:51
583000 -- (-663.850) (-666.379) (-663.861) [-663.691] * (-672.946) [-666.270] (-668.842) (-672.754) -- 0:01:51
584000 -- (-670.764) [-663.054] (-662.692) (-663.153) * (-667.370) [-675.311] (-672.532) (-665.645) -- 0:01:51
585000 -- (-667.344) (-664.983) [-662.532] (-664.693) * (-669.964) (-679.634) [-664.497] (-666.430) -- 0:01:50
Average standard deviation of split frequencies: 0.008608
586000 -- (-671.641) (-664.653) (-667.037) [-664.275] * (-667.166) (-674.052) (-669.046) [-663.346] -- 0:01:50
587000 -- (-668.057) (-663.647) (-667.051) [-667.584] * (-662.499) [-663.463] (-666.283) (-668.663) -- 0:01:50
588000 -- [-672.431] (-673.265) (-664.174) (-667.998) * (-662.687) (-662.392) [-664.248] (-674.245) -- 0:01:50
589000 -- (-665.182) (-668.851) (-665.821) [-669.272] * [-660.540] (-668.857) (-672.811) (-665.421) -- 0:01:49
590000 -- (-664.544) (-672.308) [-669.667] (-669.516) * [-666.665] (-665.958) (-665.386) (-675.307) -- 0:01:49
Average standard deviation of split frequencies: 0.008061
591000 -- (-661.732) (-661.027) (-671.559) [-671.491] * (-675.561) (-674.407) [-665.745] (-668.733) -- 0:01:49
592000 -- (-664.785) (-666.780) [-666.880] (-670.210) * (-663.795) (-669.969) (-669.364) [-673.338] -- 0:01:48
593000 -- (-676.248) (-675.463) [-667.457] (-664.017) * [-664.901] (-669.885) (-669.701) (-669.173) -- 0:01:48
594000 -- (-670.545) [-664.914] (-664.741) (-664.415) * (-670.341) [-663.596] (-676.291) (-671.677) -- 0:01:48
595000 -- (-665.353) (-667.317) (-672.755) [-662.479] * [-680.149] (-673.340) (-668.370) (-664.196) -- 0:01:48
Average standard deviation of split frequencies: 0.008576
596000 -- (-671.832) [-659.921] (-668.883) (-670.601) * (-664.586) (-664.943) (-668.158) [-670.342] -- 0:01:47
597000 -- (-665.575) [-663.010] (-665.983) (-664.862) * [-662.288] (-661.661) (-678.722) (-667.735) -- 0:01:48
598000 -- (-662.466) (-670.295) [-668.295] (-669.709) * (-674.947) [-662.662] (-673.014) (-677.181) -- 0:01:47
599000 -- [-664.823] (-666.806) (-671.124) (-665.258) * (-670.342) (-670.052) (-671.971) [-670.406] -- 0:01:47
600000 -- (-663.519) (-671.103) [-666.183] (-668.379) * (-675.302) [-662.202] (-661.387) (-678.580) -- 0:01:46
Average standard deviation of split frequencies: 0.008137
601000 -- [-666.303] (-675.088) (-662.251) (-672.146) * [-667.257] (-671.137) (-671.693) (-669.031) -- 0:01:46
602000 -- [-667.138] (-674.365) (-673.901) (-665.624) * (-668.487) (-671.028) [-673.121] (-669.826) -- 0:01:46
603000 -- [-673.268] (-660.875) (-666.793) (-664.430) * (-665.976) [-667.478] (-671.036) (-678.230) -- 0:01:45
604000 -- (-673.330) (-668.258) [-666.977] (-672.010) * (-664.560) (-666.274) [-662.151] (-663.281) -- 0:01:46
605000 -- (-669.235) [-665.866] (-663.382) (-673.851) * (-659.057) (-672.698) [-674.314] (-682.786) -- 0:01:45
Average standard deviation of split frequencies: 0.007973
606000 -- (-688.746) (-667.044) (-669.549) [-669.186] * (-663.907) (-663.998) [-665.704] (-661.709) -- 0:01:45
607000 -- (-668.589) [-662.038] (-670.875) (-671.153) * (-676.843) (-667.138) [-657.617] (-662.456) -- 0:01:44
608000 -- (-665.072) [-658.857] (-674.427) (-666.994) * (-668.252) (-664.302) (-668.094) [-664.496] -- 0:01:45
609000 -- (-666.366) (-664.349) (-667.714) [-666.596] * [-667.153] (-664.914) (-661.349) (-677.018) -- 0:01:44
610000 -- (-668.621) (-663.985) (-664.120) [-672.771] * (-659.038) (-673.666) (-671.215) [-663.746] -- 0:01:44
Average standard deviation of split frequencies: 0.008207
611000 -- (-665.976) (-671.370) (-665.191) [-664.800] * (-661.054) (-671.896) [-666.583] (-673.285) -- 0:01:43
612000 -- (-662.901) (-670.143) (-672.006) [-665.212] * [-664.782] (-665.570) (-673.606) (-675.250) -- 0:01:43
613000 -- (-670.252) (-664.679) (-677.036) [-667.390] * (-667.399) (-668.012) (-661.457) [-669.479] -- 0:01:43
614000 -- (-665.631) (-668.937) [-662.942] (-669.003) * (-661.932) (-676.828) (-665.618) [-668.856] -- 0:01:43
615000 -- (-672.327) (-662.096) (-678.861) [-668.949] * (-665.825) (-672.051) (-667.068) [-667.471] -- 0:01:43
Average standard deviation of split frequencies: 0.008378
616000 -- (-666.331) (-678.235) (-665.702) [-663.861] * (-665.887) (-665.763) [-658.916] (-673.152) -- 0:01:42
617000 -- (-680.053) (-671.683) (-666.407) [-671.427] * [-660.634] (-676.099) (-669.393) (-663.399) -- 0:01:42
618000 -- [-665.435] (-666.154) (-675.330) (-664.308) * (-663.941) (-669.886) [-665.243] (-675.243) -- 0:01:41
619000 -- (-667.356) (-670.996) (-671.006) [-662.356] * [-666.096] (-665.876) (-666.315) (-665.886) -- 0:01:42
620000 -- (-675.274) (-664.471) (-677.962) [-663.423] * [-665.593] (-678.140) (-664.148) (-672.718) -- 0:01:41
Average standard deviation of split frequencies: 0.008874
621000 -- (-675.658) [-668.817] (-666.813) (-675.896) * [-667.630] (-679.045) (-662.859) (-664.824) -- 0:01:41
622000 -- (-671.923) [-666.442] (-667.433) (-666.002) * [-666.120] (-682.997) (-670.111) (-668.390) -- 0:01:40
623000 -- (-661.825) (-660.283) [-670.027] (-667.448) * (-669.226) (-677.673) (-667.172) [-661.141] -- 0:01:41
624000 -- [-666.430] (-666.374) (-659.087) (-666.897) * (-659.897) (-676.360) (-677.664) [-668.215] -- 0:01:40
625000 -- (-667.400) (-666.675) (-676.141) [-660.771] * (-665.042) (-673.434) [-668.173] (-671.904) -- 0:01:40
Average standard deviation of split frequencies: 0.009116
626000 -- [-666.165] (-672.702) (-666.654) (-665.667) * (-676.578) [-665.993] (-661.919) (-673.689) -- 0:01:40
627000 -- [-659.454] (-667.476) (-663.643) (-672.958) * [-666.141] (-680.011) (-666.197) (-667.322) -- 0:01:39
628000 -- (-664.998) (-675.551) [-670.792] (-674.065) * (-662.103) (-667.810) [-668.520] (-661.777) -- 0:01:39
629000 -- (-674.166) (-666.005) [-661.940] (-669.591) * (-668.733) [-662.329] (-670.815) (-659.691) -- 0:01:39
630000 -- (-667.487) (-675.103) [-664.615] (-667.493) * [-666.289] (-673.175) (-678.278) (-661.592) -- 0:01:39
Average standard deviation of split frequencies: 0.009048
631000 -- (-667.958) (-663.493) (-665.697) [-664.215] * (-663.618) [-664.229] (-677.564) (-672.346) -- 0:01:38
632000 -- (-665.460) [-665.509] (-662.693) (-671.863) * [-667.383] (-663.368) (-676.613) (-666.237) -- 0:01:38
633000 -- (-661.681) (-670.427) [-668.872] (-669.087) * (-666.158) (-658.654) (-671.124) [-668.966] -- 0:01:37
634000 -- (-662.057) (-672.356) [-660.095] (-665.145) * [-665.488] (-668.306) (-667.610) (-671.779) -- 0:01:38
635000 -- [-666.379] (-666.256) (-665.927) (-664.333) * (-679.699) (-666.047) [-665.055] (-666.749) -- 0:01:37
Average standard deviation of split frequencies: 0.009050
636000 -- (-666.986) (-671.067) (-680.169) [-664.667] * [-664.092] (-674.518) (-675.074) (-660.438) -- 0:01:37
637000 -- (-658.754) (-671.809) [-669.656] (-663.323) * (-664.676) (-671.358) (-664.254) [-665.872] -- 0:01:37
638000 -- (-672.196) (-669.123) (-668.935) [-664.056] * (-667.870) (-668.002) [-664.274] (-666.335) -- 0:01:37
639000 -- (-666.700) [-668.936] (-666.234) (-660.034) * [-666.708] (-667.953) (-660.588) (-668.783) -- 0:01:36
640000 -- (-666.096) (-677.442) (-669.906) [-665.931] * (-665.615) [-659.168] (-663.258) (-664.043) -- 0:01:36
Average standard deviation of split frequencies: 0.009087
641000 -- [-663.119] (-672.008) (-672.014) (-666.567) * (-667.446) (-665.662) (-669.416) [-660.397] -- 0:01:36
642000 -- (-671.226) (-671.771) [-670.297] (-669.031) * [-668.085] (-671.662) (-668.261) (-664.376) -- 0:01:35
643000 -- (-672.144) [-661.675] (-667.098) (-666.255) * (-670.841) [-664.483] (-664.502) (-664.988) -- 0:01:35
644000 -- (-667.587) (-668.848) (-673.406) [-667.807] * (-671.921) [-663.631] (-677.863) (-665.390) -- 0:01:35
645000 -- (-669.465) (-668.162) [-663.668] (-677.778) * (-663.220) (-670.543) (-665.656) [-663.361] -- 0:01:35
Average standard deviation of split frequencies: 0.008720
646000 -- (-671.186) (-669.462) [-672.611] (-675.984) * (-667.984) (-664.108) [-669.549] (-662.619) -- 0:01:34
647000 -- (-660.759) (-671.632) [-667.324] (-671.317) * (-672.027) (-665.472) (-666.573) [-664.257] -- 0:01:34
648000 -- (-669.911) [-670.783] (-668.891) (-667.239) * [-664.332] (-669.679) (-674.694) (-668.266) -- 0:01:33
649000 -- (-672.380) [-666.359] (-666.114) (-673.444) * (-666.731) (-667.775) [-661.173] (-671.646) -- 0:01:34
650000 -- (-661.422) [-663.022] (-666.847) (-665.251) * (-677.599) (-664.504) (-667.300) [-662.813] -- 0:01:33
Average standard deviation of split frequencies: 0.008763
651000 -- (-665.692) (-671.738) [-661.181] (-669.329) * (-678.410) (-666.632) (-668.765) [-666.139] -- 0:01:33
652000 -- (-662.693) [-665.483] (-668.678) (-670.270) * (-669.417) (-669.766) (-662.661) [-659.730] -- 0:01:32
653000 -- (-672.158) [-668.533] (-667.306) (-660.525) * (-671.885) (-667.558) (-667.901) [-665.092] -- 0:01:32
654000 -- (-669.046) (-666.483) [-665.680] (-667.892) * [-665.269] (-662.862) (-685.157) (-668.845) -- 0:01:32
655000 -- (-667.556) [-670.901] (-664.278) (-672.109) * (-683.048) [-660.016] (-665.598) (-674.302) -- 0:01:32
Average standard deviation of split frequencies: 0.008760
656000 -- (-668.165) (-670.265) (-669.497) [-660.005] * (-670.882) (-670.690) (-668.378) [-660.340] -- 0:01:32
657000 -- (-660.703) (-668.369) (-669.139) [-668.481] * (-663.804) [-661.952] (-663.399) (-662.964) -- 0:01:31
658000 -- (-670.393) [-676.869] (-673.160) (-667.697) * (-672.963) [-661.392] (-670.992) (-667.499) -- 0:01:31
659000 -- (-670.636) [-665.049] (-670.273) (-667.431) * (-675.419) [-668.492] (-670.962) (-667.353) -- 0:01:31
660000 -- [-661.614] (-668.508) (-664.594) (-671.179) * (-667.301) (-666.196) [-664.614] (-662.785) -- 0:01:31
Average standard deviation of split frequencies: 0.008705
661000 -- [-660.337] (-671.857) (-668.898) (-666.892) * (-666.383) (-669.156) [-659.598] (-662.169) -- 0:01:30
662000 -- (-661.647) [-666.857] (-668.565) (-667.571) * (-666.091) (-670.661) (-670.366) [-666.507] -- 0:01:30
663000 -- (-669.966) [-667.382] (-671.250) (-662.817) * (-668.044) (-671.244) (-673.752) [-669.535] -- 0:01:29
664000 -- (-668.925) (-672.045) [-668.892] (-668.880) * (-673.185) (-667.051) (-668.037) [-659.127] -- 0:01:30
665000 -- (-661.816) (-660.485) [-665.831] (-674.033) * [-663.446] (-673.398) (-672.898) (-669.666) -- 0:01:29
Average standard deviation of split frequencies: 0.008777
666000 -- (-659.896) [-663.537] (-661.019) (-671.404) * (-665.528) [-669.342] (-669.910) (-665.177) -- 0:01:29
667000 -- (-668.423) [-668.357] (-669.802) (-667.283) * [-672.821] (-666.870) (-662.901) (-667.627) -- 0:01:29
668000 -- [-668.692] (-671.172) (-671.427) (-670.484) * (-680.364) (-667.644) (-667.164) [-668.359] -- 0:01:28
669000 -- (-670.531) (-671.712) [-669.947] (-668.397) * (-680.582) (-671.460) [-661.858] (-670.584) -- 0:01:28
670000 -- (-672.705) [-662.030] (-674.683) (-671.818) * (-666.060) (-663.560) (-675.695) [-664.270] -- 0:01:28
Average standard deviation of split frequencies: 0.009173
671000 -- (-673.743) [-661.226] (-673.233) (-671.188) * [-665.422] (-672.615) (-670.523) (-667.789) -- 0:01:28
672000 -- (-672.692) [-661.767] (-660.417) (-673.304) * (-665.153) (-669.041) (-668.527) [-667.371] -- 0:01:27
673000 -- (-671.761) (-674.933) (-670.797) [-671.339] * [-661.527] (-675.614) (-670.642) (-669.453) -- 0:01:27
674000 -- (-669.470) [-667.781] (-663.979) (-670.984) * [-666.971] (-669.399) (-668.426) (-664.462) -- 0:01:27
675000 -- (-664.346) [-667.019] (-659.866) (-665.024) * (-667.943) (-671.713) (-664.762) [-664.970] -- 0:01:27
Average standard deviation of split frequencies: 0.008961
676000 -- [-664.645] (-677.307) (-664.010) (-665.563) * (-667.456) (-668.833) [-665.660] (-660.884) -- 0:01:26
677000 -- (-666.088) (-658.491) [-663.908] (-669.716) * [-669.476] (-662.490) (-671.190) (-666.837) -- 0:01:26
678000 -- (-661.271) (-662.577) (-669.309) [-665.334] * (-669.846) (-670.804) [-670.513] (-665.087) -- 0:01:26
679000 -- (-667.991) (-677.663) [-665.014] (-663.317) * (-672.717) [-662.944] (-667.781) (-665.750) -- 0:01:26
680000 -- (-660.378) (-671.691) [-668.616] (-665.970) * [-662.713] (-669.736) (-665.414) (-665.052) -- 0:01:25
Average standard deviation of split frequencies: 0.008934
681000 -- (-662.889) (-666.225) (-672.044) [-664.746] * (-667.762) (-665.567) (-672.917) [-664.930] -- 0:01:25
682000 -- [-667.371] (-665.136) (-661.735) (-664.511) * [-663.356] (-667.899) (-676.261) (-665.129) -- 0:01:25
683000 -- (-666.033) (-676.602) (-665.585) [-663.641] * [-666.745] (-661.458) (-660.631) (-675.421) -- 0:01:24
684000 -- [-661.654] (-672.745) (-667.430) (-662.868) * [-664.056] (-664.740) (-674.776) (-666.410) -- 0:01:24
685000 -- (-662.477) (-673.271) [-664.891] (-668.669) * (-661.157) (-664.834) [-668.987] (-674.164) -- 0:01:24
Average standard deviation of split frequencies: 0.008968
686000 -- (-665.737) [-665.180] (-669.181) (-673.497) * [-663.843] (-665.666) (-662.053) (-669.070) -- 0:01:24
687000 -- [-663.561] (-671.367) (-666.323) (-663.156) * (-670.765) (-670.256) [-670.760] (-669.705) -- 0:01:23
688000 -- (-667.021) [-665.170] (-671.256) (-673.842) * (-668.672) (-670.962) (-664.537) [-664.109] -- 0:01:23
689000 -- [-669.401] (-666.569) (-661.206) (-665.317) * [-668.601] (-667.868) (-665.500) (-670.434) -- 0:01:23
690000 -- (-666.975) [-670.727] (-672.120) (-668.578) * (-673.633) (-677.756) [-657.531] (-666.518) -- 0:01:23
Average standard deviation of split frequencies: 0.009009
691000 -- (-664.305) [-670.096] (-671.357) (-667.545) * [-662.676] (-672.024) (-665.765) (-671.138) -- 0:01:22
692000 -- (-668.069) (-666.925) (-665.445) [-674.098] * [-664.200] (-668.195) (-669.209) (-674.373) -- 0:01:22
693000 -- [-671.981] (-665.001) (-673.256) (-666.552) * [-667.659] (-664.817) (-667.260) (-682.457) -- 0:01:22
694000 -- (-666.428) (-669.116) (-665.151) [-667.611] * (-665.269) [-662.635] (-664.968) (-672.179) -- 0:01:22
695000 -- (-666.329) (-669.629) (-663.187) [-663.233] * (-667.046) [-673.031] (-665.910) (-676.253) -- 0:01:21
Average standard deviation of split frequencies: 0.009177
696000 -- (-668.024) (-662.130) (-672.168) [-662.285] * [-674.480] (-677.603) (-669.934) (-669.737) -- 0:01:21
697000 -- (-661.807) (-680.783) (-664.483) [-672.875] * (-667.005) [-662.081] (-668.969) (-663.778) -- 0:01:21
698000 -- [-666.407] (-669.132) (-663.881) (-673.113) * (-663.373) (-663.381) (-674.823) [-661.607] -- 0:01:20
699000 -- (-671.136) (-680.023) [-668.121] (-673.229) * (-671.465) (-662.666) (-666.085) [-660.853] -- 0:01:20
700000 -- [-664.218] (-669.989) (-670.684) (-665.318) * (-664.269) (-676.666) (-667.292) [-668.090] -- 0:01:20
Average standard deviation of split frequencies: 0.008982
701000 -- (-667.509) [-664.482] (-670.229) (-666.249) * [-659.340] (-671.557) (-673.297) (-664.525) -- 0:01:20
702000 -- [-664.794] (-672.974) (-667.586) (-681.613) * (-666.531) (-670.435) [-665.801] (-662.223) -- 0:01:19
703000 -- (-663.203) [-667.566] (-665.474) (-672.382) * (-669.072) (-676.521) [-666.935] (-666.637) -- 0:01:19
704000 -- (-668.015) (-667.212) [-664.462] (-671.333) * (-664.216) [-664.972] (-672.245) (-674.205) -- 0:01:19
705000 -- (-673.479) (-663.450) (-665.645) [-672.342] * (-671.105) (-667.835) [-662.896] (-664.520) -- 0:01:19
Average standard deviation of split frequencies: 0.008914
706000 -- (-665.276) (-680.760) (-667.539) [-672.278] * (-668.816) (-669.599) [-666.990] (-670.523) -- 0:01:18
707000 -- [-664.805] (-681.022) (-661.947) (-663.503) * (-672.596) [-666.163] (-669.745) (-670.525) -- 0:01:18
708000 -- (-665.506) (-666.512) (-666.823) [-667.163] * (-662.085) (-660.571) [-668.573] (-668.739) -- 0:01:18
709000 -- [-667.170] (-671.870) (-670.288) (-663.229) * [-668.587] (-670.065) (-669.183) (-670.121) -- 0:01:17
710000 -- (-665.885) (-673.878) (-673.050) [-670.511] * (-664.124) (-666.465) [-671.412] (-671.270) -- 0:01:17
Average standard deviation of split frequencies: 0.009088
711000 -- [-668.846] (-667.656) (-669.441) (-665.059) * (-664.245) [-666.043] (-668.287) (-667.428) -- 0:01:17
712000 -- (-660.902) (-674.346) (-672.112) [-667.867] * (-666.839) [-666.576] (-665.661) (-667.619) -- 0:01:17
713000 -- (-665.529) [-661.387] (-669.062) (-675.584) * (-661.869) (-670.371) [-662.531] (-675.181) -- 0:01:16
714000 -- (-663.752) (-663.056) [-665.413] (-675.224) * [-678.570] (-673.756) (-672.242) (-668.144) -- 0:01:16
715000 -- (-669.053) [-664.633] (-663.539) (-666.467) * (-662.805) (-678.067) [-663.581] (-669.876) -- 0:01:16
Average standard deviation of split frequencies: 0.008524
716000 -- (-671.690) [-670.099] (-673.422) (-668.169) * (-665.040) (-668.776) [-665.218] (-676.029) -- 0:01:16
717000 -- (-665.426) (-677.368) (-666.942) [-671.455] * (-662.666) (-665.772) (-670.831) [-671.961] -- 0:01:15
718000 -- (-678.334) (-667.422) (-670.515) [-665.059] * (-663.812) (-676.164) (-671.060) [-664.956] -- 0:01:15
719000 -- (-676.297) [-663.119] (-669.450) (-670.214) * [-672.759] (-667.513) (-669.891) (-662.173) -- 0:01:15
720000 -- (-660.490) (-672.643) [-662.454] (-669.300) * [-659.462] (-665.060) (-674.576) (-673.158) -- 0:01:15
Average standard deviation of split frequencies: 0.008469
721000 -- [-664.822] (-676.829) (-669.082) (-660.651) * (-686.610) [-660.340] (-672.058) (-678.216) -- 0:01:14
722000 -- [-664.174] (-666.461) (-667.832) (-664.450) * [-661.739] (-663.296) (-676.644) (-668.395) -- 0:01:14
723000 -- (-664.134) (-671.340) [-667.728] (-665.763) * [-668.684] (-666.153) (-673.745) (-662.698) -- 0:01:14
724000 -- (-670.340) (-663.639) (-658.732) [-666.165] * (-671.560) [-662.945] (-665.768) (-665.783) -- 0:01:13
725000 -- [-663.729] (-664.280) (-662.684) (-676.364) * (-667.580) (-669.580) (-672.001) [-667.874] -- 0:01:13
Average standard deviation of split frequencies: 0.008920
726000 -- (-667.609) (-662.770) [-667.850] (-666.577) * (-677.210) (-677.976) (-662.618) [-665.491] -- 0:01:13
727000 -- (-671.517) (-666.079) [-663.654] (-672.081) * (-666.649) (-663.424) (-667.005) [-662.031] -- 0:01:13
728000 -- (-669.791) (-664.272) [-667.968] (-666.506) * (-662.773) [-662.433] (-666.074) (-669.634) -- 0:01:12
729000 -- (-664.147) (-675.003) [-669.432] (-662.568) * [-663.267] (-674.385) (-662.870) (-677.156) -- 0:01:12
730000 -- (-673.165) [-665.216] (-660.785) (-675.185) * (-667.454) [-673.904] (-668.278) (-677.970) -- 0:01:12
Average standard deviation of split frequencies: 0.008761
731000 -- (-667.833) [-662.141] (-673.547) (-664.812) * (-668.351) (-674.423) [-665.357] (-674.304) -- 0:01:12
732000 -- (-664.964) (-667.801) [-668.688] (-668.736) * (-665.383) (-672.509) [-665.716] (-660.024) -- 0:01:11
733000 -- (-660.728) (-672.300) (-670.133) [-660.677] * (-664.807) [-666.635] (-669.509) (-671.292) -- 0:01:11
734000 -- (-667.905) (-663.672) (-665.331) [-666.024] * (-673.002) (-664.744) (-664.290) [-660.172] -- 0:01:11
735000 -- [-660.727] (-677.606) (-666.768) (-667.965) * [-667.940] (-668.694) (-676.905) (-676.876) -- 0:01:11
Average standard deviation of split frequencies: 0.008428
736000 -- [-664.118] (-668.050) (-663.300) (-667.705) * (-674.065) [-667.902] (-674.395) (-679.032) -- 0:01:10
737000 -- (-673.211) (-672.519) [-661.735] (-663.101) * (-661.755) (-665.979) (-689.290) [-664.250] -- 0:01:10
738000 -- (-667.019) (-657.605) [-661.034] (-671.430) * [-664.563] (-664.846) (-676.092) (-672.716) -- 0:01:10
739000 -- (-664.074) [-665.325] (-661.418) (-677.054) * (-662.487) [-669.011] (-669.475) (-665.464) -- 0:01:09
740000 -- (-671.932) [-671.456] (-669.788) (-661.643) * (-659.328) (-675.379) [-667.911] (-668.508) -- 0:01:09
Average standard deviation of split frequencies: 0.008073
741000 -- (-672.935) (-666.985) (-660.933) [-667.980] * (-666.085) (-666.508) (-668.294) [-664.358] -- 0:01:09
742000 -- (-670.109) [-671.264] (-674.264) (-667.104) * (-663.211) (-668.952) (-671.034) [-661.917] -- 0:01:09
743000 -- (-682.243) (-663.253) (-670.489) [-666.121] * (-669.199) [-673.101] (-678.368) (-665.420) -- 0:01:08
744000 -- (-666.398) (-665.706) [-679.297] (-665.001) * (-665.010) (-662.796) (-675.423) [-661.516] -- 0:01:08
745000 -- (-668.017) (-672.995) [-667.998] (-669.512) * (-662.889) (-662.117) [-665.299] (-665.092) -- 0:01:08
Average standard deviation of split frequencies: 0.008315
746000 -- (-674.906) (-659.172) (-680.710) [-670.815] * (-668.125) [-663.802] (-672.433) (-666.011) -- 0:01:08
747000 -- (-665.289) (-671.159) (-672.035) [-676.916] * (-678.116) [-664.118] (-664.602) (-675.764) -- 0:01:07
748000 -- (-669.833) (-673.759) (-660.624) [-663.629] * (-668.916) (-664.723) (-671.427) [-663.671] -- 0:01:07
749000 -- [-662.127] (-674.310) (-671.671) (-665.458) * (-678.147) (-668.270) [-675.875] (-667.040) -- 0:01:07
750000 -- (-667.569) (-664.084) [-670.728] (-669.592) * [-671.999] (-664.566) (-671.302) (-669.079) -- 0:01:07
Average standard deviation of split frequencies: 0.008296
751000 -- (-671.878) (-680.683) (-665.166) [-671.554] * (-665.981) [-665.698] (-665.229) (-664.146) -- 0:01:06
752000 -- (-678.220) (-667.167) (-667.594) [-663.143] * (-667.290) [-669.768] (-664.707) (-666.350) -- 0:01:06
753000 -- (-665.433) [-671.763] (-672.371) (-673.347) * [-667.452] (-670.576) (-663.444) (-668.102) -- 0:01:06
754000 -- (-669.423) [-666.706] (-666.118) (-676.973) * (-672.240) (-665.406) (-668.737) [-668.011] -- 0:01:05
755000 -- [-658.636] (-679.240) (-669.265) (-664.710) * (-672.072) (-660.337) (-668.432) [-665.623] -- 0:01:05
Average standard deviation of split frequencies: 0.008205
756000 -- (-666.425) (-672.946) (-672.652) [-663.757] * [-668.411] (-661.318) (-666.163) (-668.040) -- 0:01:05
757000 -- (-667.782) (-666.136) [-662.194] (-664.319) * (-667.275) [-662.026] (-661.556) (-667.716) -- 0:01:05
758000 -- (-669.155) [-664.851] (-673.617) (-665.646) * (-666.208) (-663.821) [-659.645] (-670.506) -- 0:01:04
759000 -- (-672.047) (-672.560) (-670.371) [-665.721] * (-674.383) (-662.331) [-667.251] (-669.191) -- 0:01:04
760000 -- (-668.576) (-669.127) (-670.484) [-665.643] * [-662.506] (-668.446) (-668.737) (-665.710) -- 0:01:04
Average standard deviation of split frequencies: 0.008122
761000 -- (-675.553) [-668.541] (-676.308) (-673.703) * (-667.733) [-673.354] (-669.927) (-665.465) -- 0:01:04
762000 -- (-664.509) (-676.194) [-662.347] (-661.521) * (-668.954) (-669.465) [-664.920] (-676.359) -- 0:01:03
763000 -- [-666.355] (-671.999) (-663.043) (-667.748) * [-664.577] (-665.557) (-674.326) (-667.636) -- 0:01:03
764000 -- (-662.938) [-666.942] (-666.566) (-671.303) * (-666.316) (-670.925) [-664.802] (-672.771) -- 0:01:03
765000 -- (-674.276) (-664.562) [-666.911] (-664.242) * (-665.073) [-671.372] (-665.802) (-677.950) -- 0:01:02
Average standard deviation of split frequencies: 0.007676
766000 -- (-665.776) [-661.543] (-674.522) (-667.054) * (-665.537) [-665.679] (-664.894) (-675.710) -- 0:01:02
767000 -- (-661.766) (-670.110) (-665.256) [-661.060] * (-663.465) [-666.339] (-663.939) (-673.638) -- 0:01:02
768000 -- (-671.482) (-667.968) (-665.856) [-666.745] * (-662.934) (-676.552) [-667.479] (-671.857) -- 0:01:02
769000 -- (-670.333) (-670.654) [-672.391] (-666.187) * [-659.456] (-668.324) (-663.073) (-672.145) -- 0:01:01
770000 -- [-667.945] (-665.672) (-672.962) (-662.352) * (-662.852) (-664.708) (-660.239) [-667.124] -- 0:01:01
Average standard deviation of split frequencies: 0.007630
771000 -- [-668.073] (-671.186) (-664.607) (-669.276) * (-677.323) (-666.011) [-666.814] (-663.606) -- 0:01:01
772000 -- (-670.095) (-671.056) (-662.160) [-678.618] * (-660.850) [-664.227] (-664.842) (-668.332) -- 0:01:01
773000 -- (-663.579) (-671.946) [-665.402] (-667.048) * (-663.818) [-666.056] (-669.312) (-676.643) -- 0:01:01
774000 -- (-665.928) (-661.329) (-671.329) [-663.014] * (-670.101) (-673.899) [-669.064] (-669.859) -- 0:01:00
775000 -- [-665.151] (-668.831) (-671.651) (-669.614) * (-667.528) [-669.426] (-661.381) (-668.687) -- 0:01:00
Average standard deviation of split frequencies: 0.007418
776000 -- (-675.522) (-672.362) [-664.950] (-666.808) * (-679.152) [-665.085] (-679.326) (-673.637) -- 0:01:00
777000 -- (-675.144) (-664.962) (-665.851) [-666.939] * (-670.735) (-663.119) (-670.684) [-666.148] -- 0:00:59
778000 -- (-678.911) [-664.483] (-667.653) (-665.054) * (-665.092) (-667.819) [-663.905] (-671.689) -- 0:00:59
779000 -- (-672.615) (-669.994) (-667.918) [-665.796] * [-668.249] (-663.269) (-662.817) (-659.843) -- 0:00:59
780000 -- (-666.691) (-664.266) [-662.970] (-671.899) * (-679.237) (-662.518) (-670.671) [-661.285] -- 0:00:58
Average standard deviation of split frequencies: 0.007278
781000 -- (-685.079) (-664.887) [-671.037] (-664.562) * (-667.130) (-669.183) [-676.821] (-663.534) -- 0:00:58
782000 -- (-671.883) (-675.127) (-665.821) [-666.074] * [-666.145] (-670.757) (-670.385) (-664.591) -- 0:00:58
783000 -- (-672.344) (-669.015) (-681.059) [-661.786] * (-668.838) (-664.748) (-670.436) [-662.041] -- 0:00:58
784000 -- (-666.657) [-664.477] (-664.803) (-662.524) * (-666.193) [-670.977] (-667.140) (-663.800) -- 0:00:58
785000 -- (-662.458) (-666.701) (-676.309) [-665.362] * (-671.310) [-664.164] (-670.717) (-675.419) -- 0:00:57
Average standard deviation of split frequencies: 0.007260
786000 -- (-663.439) (-670.291) [-666.318] (-660.333) * (-680.943) [-660.591] (-671.829) (-673.251) -- 0:00:57
787000 -- (-659.202) (-681.819) [-670.944] (-669.001) * (-674.785) (-663.029) (-667.893) [-675.414] -- 0:00:57
788000 -- (-663.061) (-674.177) [-661.988] (-665.682) * (-663.071) (-667.922) [-673.346] (-663.315) -- 0:00:57
789000 -- [-662.312] (-672.766) (-662.744) (-668.394) * (-672.213) (-668.062) [-663.876] (-662.823) -- 0:00:56
790000 -- (-661.852) (-668.453) [-663.471] (-671.703) * (-661.446) [-662.441] (-662.677) (-664.943) -- 0:00:56
Average standard deviation of split frequencies: 0.007274
791000 -- (-665.242) [-663.550] (-668.906) (-658.096) * [-665.563] (-667.121) (-660.227) (-671.042) -- 0:00:56
792000 -- (-669.036) (-672.995) [-671.638] (-661.914) * (-674.169) (-658.448) [-660.600] (-668.794) -- 0:00:55
793000 -- (-676.494) (-658.823) (-666.273) [-667.170] * (-665.886) [-662.187] (-658.948) (-661.718) -- 0:00:55
794000 -- (-666.705) [-670.872] (-678.789) (-663.185) * [-668.058] (-661.904) (-663.152) (-668.899) -- 0:00:55
795000 -- (-662.846) [-664.617] (-667.643) (-668.673) * [-663.511] (-660.349) (-669.204) (-661.995) -- 0:00:55
Average standard deviation of split frequencies: 0.007231
796000 -- [-661.134] (-673.886) (-663.820) (-667.840) * (-666.274) (-660.948) [-666.805] (-670.653) -- 0:00:54
797000 -- (-665.835) (-672.256) [-662.725] (-675.627) * (-667.505) (-677.825) [-660.570] (-667.756) -- 0:00:54
798000 -- (-666.327) (-674.763) [-664.492] (-663.494) * [-661.730] (-679.599) (-662.591) (-667.927) -- 0:00:54
799000 -- [-666.395] (-668.595) (-662.611) (-667.574) * (-661.622) (-665.412) (-671.156) [-667.510] -- 0:00:54
800000 -- (-668.654) (-664.500) [-662.387] (-669.517) * [-664.831] (-664.036) (-664.611) (-669.043) -- 0:00:53
Average standard deviation of split frequencies: 0.007183
801000 -- [-660.455] (-659.747) (-676.194) (-675.598) * (-669.280) (-668.239) [-663.929] (-660.267) -- 0:00:53
802000 -- (-673.298) [-665.450] (-662.755) (-665.738) * (-671.924) [-666.920] (-670.372) (-674.798) -- 0:00:53
803000 -- (-663.251) (-665.128) [-665.291] (-674.599) * [-674.708] (-672.519) (-660.632) (-663.764) -- 0:00:52
804000 -- (-665.988) (-665.960) [-667.887] (-667.411) * (-673.404) (-671.769) (-660.370) [-658.001] -- 0:00:52
805000 -- (-668.694) (-674.145) (-679.427) [-667.996] * (-672.596) (-664.863) [-660.325] (-665.246) -- 0:00:52
Average standard deviation of split frequencies: 0.006865
806000 -- (-676.120) (-672.043) [-661.404] (-674.350) * [-668.932] (-662.186) (-665.072) (-667.714) -- 0:00:51
807000 -- (-671.011) (-668.409) [-664.426] (-665.588) * (-678.269) (-662.705) [-669.038] (-671.044) -- 0:00:51
808000 -- (-667.266) [-666.501] (-671.897) (-666.350) * [-663.122] (-666.522) (-674.980) (-664.148) -- 0:00:51
809000 -- [-662.559] (-664.389) (-673.044) (-674.254) * [-667.187] (-664.486) (-671.053) (-663.728) -- 0:00:51
810000 -- [-668.641] (-667.125) (-672.673) (-663.551) * (-663.692) (-675.366) (-666.991) [-665.772] -- 0:00:51
Average standard deviation of split frequencies: 0.007131
811000 -- [-670.658] (-669.709) (-667.153) (-670.105) * (-666.279) (-676.881) (-666.640) [-666.468] -- 0:00:50
812000 -- (-672.114) (-666.947) [-664.865] (-666.712) * [-662.747] (-666.796) (-667.042) (-670.728) -- 0:00:50
813000 -- (-665.725) [-660.816] (-665.619) (-658.930) * [-660.466] (-667.464) (-665.325) (-664.964) -- 0:00:50
814000 -- [-668.185] (-663.314) (-666.090) (-663.336) * (-672.838) (-661.674) (-681.494) [-666.304] -- 0:00:50
815000 -- (-668.064) [-663.317] (-671.429) (-665.749) * (-663.987) (-669.147) [-669.803] (-668.671) -- 0:00:49
Average standard deviation of split frequencies: 0.006841
816000 -- (-668.689) (-669.680) [-666.023] (-676.039) * (-667.933) [-662.214] (-667.959) (-663.393) -- 0:00:49
817000 -- (-670.143) [-665.759] (-667.022) (-662.410) * (-669.168) [-661.191] (-675.260) (-666.880) -- 0:00:49
818000 -- (-666.885) (-660.600) (-670.631) [-669.262] * [-665.371] (-666.371) (-672.382) (-661.277) -- 0:00:48
819000 -- [-668.397] (-664.150) (-665.459) (-671.408) * (-668.326) [-667.990] (-666.618) (-667.067) -- 0:00:48
820000 -- (-660.098) [-669.817] (-665.693) (-665.569) * [-665.161] (-676.050) (-671.561) (-666.013) -- 0:00:48
Average standard deviation of split frequencies: 0.006923
821000 -- (-663.122) (-666.523) [-664.996] (-677.540) * (-666.069) (-669.015) (-661.179) [-663.322] -- 0:00:48
822000 -- [-666.266] (-665.431) (-674.379) (-677.160) * [-665.835] (-664.964) (-669.868) (-669.371) -- 0:00:47
823000 -- (-667.861) (-665.117) (-666.460) [-667.500] * (-674.167) (-664.074) (-666.303) [-666.209] -- 0:00:47
824000 -- (-673.975) (-669.639) (-666.219) [-672.943] * (-668.061) (-669.009) [-666.347] (-667.300) -- 0:00:47
825000 -- (-669.328) (-674.163) (-665.627) [-664.638] * (-667.186) [-663.071] (-670.409) (-663.397) -- 0:00:47
Average standard deviation of split frequencies: 0.006939
826000 -- (-660.748) (-664.649) (-674.152) [-671.075] * (-671.177) (-662.183) [-660.057] (-673.257) -- 0:00:46
827000 -- (-675.311) [-661.290] (-659.364) (-672.097) * [-667.301] (-663.044) (-668.257) (-670.971) -- 0:00:46
828000 -- (-661.450) (-667.297) (-668.181) [-657.833] * (-665.714) (-669.052) (-663.521) [-662.796] -- 0:00:46
829000 -- [-663.977] (-665.609) (-676.334) (-667.504) * (-666.938) (-667.207) (-668.290) [-668.573] -- 0:00:45
830000 -- (-666.883) (-671.394) [-668.223] (-673.825) * (-663.645) [-665.691] (-661.040) (-673.157) -- 0:00:45
Average standard deviation of split frequencies: 0.007019
831000 -- (-662.901) (-672.283) (-664.212) [-666.838] * (-665.633) (-667.904) [-666.780] (-670.129) -- 0:00:45
832000 -- (-661.955) (-670.891) [-663.918] (-672.866) * (-663.793) (-664.024) [-666.199] (-670.950) -- 0:00:45
833000 -- (-664.954) [-659.774] (-665.582) (-665.527) * (-667.367) (-669.658) (-673.809) [-672.822] -- 0:00:44
834000 -- (-674.763) (-665.827) (-662.146) [-666.639] * (-664.847) (-659.875) (-673.986) [-671.297] -- 0:00:44
835000 -- (-667.370) (-668.522) (-679.030) [-670.251] * (-663.589) (-671.499) (-665.807) [-668.127] -- 0:00:44
Average standard deviation of split frequencies: 0.006618
836000 -- (-671.355) (-667.847) [-662.422] (-669.124) * [-663.761] (-661.220) (-677.345) (-668.988) -- 0:00:44
837000 -- (-671.929) (-670.154) (-661.738) [-668.308] * [-663.610] (-660.338) (-672.397) (-664.596) -- 0:00:43
838000 -- (-665.464) (-665.171) (-667.578) [-661.757] * [-670.038] (-667.602) (-666.443) (-665.842) -- 0:00:43
839000 -- (-661.580) [-666.735] (-666.127) (-665.791) * (-661.094) (-666.619) [-666.602] (-662.574) -- 0:00:43
840000 -- [-666.008] (-671.791) (-669.012) (-676.326) * (-663.076) [-663.221] (-664.526) (-667.947) -- 0:00:43
Average standard deviation of split frequencies: 0.006818
841000 -- (-663.887) (-681.887) [-668.200] (-672.083) * (-664.879) (-664.670) [-661.969] (-667.101) -- 0:00:42
842000 -- [-665.979] (-676.602) (-670.457) (-667.258) * (-667.354) (-673.771) (-663.318) [-661.535] -- 0:00:42
843000 -- (-670.260) (-683.538) (-661.719) [-663.025] * (-670.933) (-680.738) [-665.270] (-665.408) -- 0:00:42
844000 -- (-667.591) (-661.777) (-672.550) [-671.795] * (-670.201) (-668.440) [-663.877] (-673.169) -- 0:00:41
845000 -- (-661.878) (-666.926) [-659.177] (-665.617) * (-668.831) (-671.073) [-666.449] (-665.576) -- 0:00:41
Average standard deviation of split frequencies: 0.006659
846000 -- [-663.752] (-665.940) (-666.556) (-668.067) * (-669.469) [-670.409] (-672.690) (-674.100) -- 0:00:41
847000 -- (-673.033) (-667.195) (-662.543) [-661.068] * (-665.520) [-668.474] (-669.232) (-668.000) -- 0:00:41
848000 -- (-676.920) [-664.438] (-670.475) (-665.194) * (-663.985) (-677.549) [-666.918] (-673.236) -- 0:00:40
849000 -- [-661.286] (-664.920) (-670.565) (-669.271) * (-666.784) [-674.027] (-667.488) (-671.451) -- 0:00:40
850000 -- (-669.531) (-668.821) [-667.199] (-668.433) * (-666.963) [-667.989] (-669.279) (-671.064) -- 0:00:40
Average standard deviation of split frequencies: 0.006883
851000 -- (-674.890) [-672.233] (-673.607) (-669.376) * [-664.493] (-662.977) (-665.169) (-668.032) -- 0:00:40
852000 -- (-669.410) (-674.186) (-669.671) [-667.026] * (-671.077) (-669.845) [-663.177] (-666.274) -- 0:00:39
853000 -- (-668.433) (-667.532) (-663.424) [-665.845] * [-668.761] (-674.076) (-665.430) (-667.254) -- 0:00:39
854000 -- (-668.537) (-670.907) (-667.633) [-669.642] * (-676.237) [-668.764] (-663.208) (-665.255) -- 0:00:39
855000 -- (-673.746) (-668.399) [-663.266] (-666.792) * (-670.097) (-666.490) [-661.069] (-670.337) -- 0:00:39
Average standard deviation of split frequencies: 0.006911
856000 -- [-668.794] (-670.171) (-662.883) (-669.890) * (-670.921) [-666.275] (-662.731) (-667.581) -- 0:00:38
857000 -- [-662.361] (-690.552) (-670.772) (-662.534) * (-664.849) [-665.931] (-665.071) (-670.538) -- 0:00:38
858000 -- (-670.410) [-662.778] (-671.405) (-667.104) * (-663.112) (-667.363) (-662.829) [-669.446] -- 0:00:38
859000 -- (-670.290) (-674.275) (-670.203) [-670.360] * (-663.500) (-666.061) (-661.106) [-668.160] -- 0:00:37
860000 -- (-669.757) (-667.354) (-662.897) [-664.093] * (-674.285) [-670.855] (-674.059) (-673.127) -- 0:00:37
Average standard deviation of split frequencies: 0.006919
861000 -- (-667.373) (-674.836) (-672.673) [-662.744] * [-660.902] (-665.351) (-664.832) (-667.321) -- 0:00:37
862000 -- (-670.964) (-676.713) (-677.426) [-666.887] * [-662.383] (-675.643) (-669.396) (-677.782) -- 0:00:37
863000 -- (-676.212) [-668.569] (-664.113) (-663.548) * (-673.307) (-668.014) [-670.742] (-671.674) -- 0:00:36
864000 -- (-665.620) (-663.395) (-662.468) [-666.403] * (-678.043) (-664.829) (-666.465) [-666.022] -- 0:00:36
865000 -- (-678.514) (-661.393) [-666.191] (-671.550) * (-670.997) [-664.905] (-670.656) (-667.758) -- 0:00:36
Average standard deviation of split frequencies: 0.006804
866000 -- (-671.816) (-661.932) [-664.661] (-668.354) * (-665.946) [-665.043] (-660.305) (-666.121) -- 0:00:36
867000 -- (-672.535) [-664.865] (-664.638) (-670.328) * [-663.769] (-664.812) (-679.358) (-678.964) -- 0:00:35
868000 -- (-679.897) (-676.688) (-669.959) [-670.649] * (-670.316) (-663.721) [-661.811] (-674.386) -- 0:00:35
869000 -- [-670.728] (-664.032) (-672.135) (-673.933) * (-666.576) (-669.627) (-660.049) [-669.070] -- 0:00:35
870000 -- (-665.953) (-671.394) [-663.479] (-663.258) * (-661.810) (-672.970) [-666.143] (-676.320) -- 0:00:34
Average standard deviation of split frequencies: 0.006383
871000 -- (-664.014) [-665.061] (-663.409) (-668.982) * (-668.986) (-666.921) [-667.902] (-659.642) -- 0:00:34
872000 -- (-674.178) (-665.883) [-673.510] (-665.558) * [-663.857] (-667.209) (-664.387) (-669.299) -- 0:00:34
873000 -- (-672.835) (-667.767) (-663.020) [-664.790] * (-661.132) (-669.103) (-675.795) [-665.751] -- 0:00:34
874000 -- (-666.647) (-668.398) (-669.141) [-668.784] * [-665.512] (-664.418) (-665.229) (-665.269) -- 0:00:33
875000 -- (-670.430) (-664.257) (-670.334) [-663.324] * [-663.639] (-667.589) (-667.444) (-662.711) -- 0:00:33
Average standard deviation of split frequencies: 0.006288
876000 -- (-670.084) (-676.892) (-668.137) [-668.100] * (-659.394) [-677.942] (-668.463) (-671.890) -- 0:00:33
877000 -- (-665.484) (-671.723) [-667.206] (-671.279) * [-663.337] (-664.492) (-670.098) (-672.266) -- 0:00:33
878000 -- (-663.732) (-672.771) (-672.372) [-664.539] * (-667.216) (-668.571) (-671.794) [-665.483] -- 0:00:32
879000 -- [-659.775] (-667.593) (-665.586) (-689.352) * (-672.397) (-669.040) (-660.922) [-666.628] -- 0:00:32
880000 -- [-668.697] (-668.625) (-672.862) (-668.004) * (-668.843) [-668.931] (-679.210) (-663.445) -- 0:00:32
Average standard deviation of split frequencies: 0.006198
881000 -- [-666.587] (-665.260) (-668.684) (-668.230) * (-668.384) (-666.744) (-675.406) [-659.751] -- 0:00:32
882000 -- [-669.745] (-666.893) (-672.951) (-667.299) * (-662.648) (-661.992) [-663.083] (-666.532) -- 0:00:31
883000 -- [-667.682] (-672.492) (-659.040) (-671.237) * [-661.663] (-681.908) (-668.494) (-666.835) -- 0:00:31
884000 -- [-658.544] (-664.970) (-670.339) (-668.134) * [-663.287] (-663.308) (-668.702) (-674.813) -- 0:00:31
885000 -- (-662.975) (-670.926) [-660.278] (-664.817) * [-663.424] (-668.543) (-666.638) (-662.987) -- 0:00:30
Average standard deviation of split frequencies: 0.006065
886000 -- (-665.991) (-677.444) (-674.177) [-664.311] * (-663.362) (-664.771) [-668.696] (-670.288) -- 0:00:30
887000 -- (-666.289) (-670.904) (-665.889) [-669.526] * (-663.911) [-668.020] (-669.318) (-665.822) -- 0:00:30
888000 -- (-668.051) (-670.997) [-657.859] (-665.089) * (-665.396) [-664.928] (-665.648) (-662.135) -- 0:00:30
889000 -- [-661.411] (-669.089) (-672.093) (-666.831) * (-665.831) (-671.704) (-668.568) [-664.024] -- 0:00:29
890000 -- (-666.140) [-665.444] (-666.888) (-672.758) * (-667.185) [-660.230] (-664.989) (-668.280) -- 0:00:29
Average standard deviation of split frequencies: 0.005954
891000 -- [-666.109] (-674.233) (-665.786) (-659.400) * (-665.984) [-670.356] (-676.010) (-682.104) -- 0:00:29
892000 -- [-672.381] (-669.516) (-679.004) (-668.623) * (-664.129) (-667.065) (-678.462) [-666.076] -- 0:00:29
893000 -- (-665.349) [-667.292] (-679.356) (-666.257) * (-669.597) [-663.662] (-669.310) (-667.233) -- 0:00:28
894000 -- [-661.591] (-665.908) (-668.010) (-668.741) * (-667.259) [-667.093] (-670.050) (-661.131) -- 0:00:28
895000 -- (-668.706) [-666.248] (-668.345) (-666.900) * (-666.442) (-660.612) [-664.095] (-675.581) -- 0:00:28
Average standard deviation of split frequencies: 0.005870
896000 -- (-667.765) [-666.948] (-670.646) (-670.240) * (-672.413) [-664.240] (-660.498) (-668.927) -- 0:00:27
897000 -- [-660.999] (-666.036) (-679.085) (-669.174) * (-667.676) (-659.670) [-666.542] (-669.374) -- 0:00:27
898000 -- (-668.331) (-665.497) [-663.625] (-674.977) * (-670.987) (-674.966) [-660.690] (-666.119) -- 0:00:27
899000 -- (-668.215) (-666.288) [-664.224] (-666.868) * (-674.161) (-683.109) (-662.434) [-664.621] -- 0:00:27
900000 -- [-671.877] (-680.440) (-663.615) (-675.092) * (-671.773) (-678.683) [-663.759] (-669.906) -- 0:00:26
Average standard deviation of split frequencies: 0.005812
901000 -- [-671.915] (-667.875) (-660.641) (-670.008) * (-663.380) (-678.279) [-665.186] (-680.353) -- 0:00:26
902000 -- (-664.910) (-669.376) [-667.364] (-666.173) * (-675.319) [-664.053] (-669.183) (-666.714) -- 0:00:26
903000 -- (-668.957) (-663.415) [-662.303] (-665.628) * [-667.231] (-666.261) (-667.339) (-667.979) -- 0:00:26
904000 -- (-672.227) (-671.169) [-662.905] (-666.677) * (-662.786) [-663.478] (-670.030) (-673.483) -- 0:00:25
905000 -- (-668.971) (-677.024) (-666.778) [-671.707] * (-665.319) (-667.651) [-668.860] (-674.693) -- 0:00:25
Average standard deviation of split frequencies: 0.005593
906000 -- (-666.934) (-662.261) (-664.611) [-662.353] * (-670.714) (-674.305) [-668.969] (-662.554) -- 0:00:25
907000 -- (-667.652) (-674.002) (-673.433) [-672.271] * (-666.355) [-664.160] (-659.810) (-673.059) -- 0:00:25
908000 -- (-673.924) (-669.133) [-670.145] (-663.026) * (-668.313) (-662.069) [-678.223] (-665.242) -- 0:00:24
909000 -- (-661.201) (-667.857) [-660.920] (-664.540) * (-670.883) (-674.937) [-658.786] (-666.312) -- 0:00:24
910000 -- (-670.450) (-664.553) (-674.917) [-666.337] * [-664.578] (-672.304) (-665.651) (-662.153) -- 0:00:24
Average standard deviation of split frequencies: 0.005720
911000 -- (-673.928) (-670.952) (-665.986) [-663.290] * (-663.685) (-673.911) (-662.701) [-667.414] -- 0:00:23
912000 -- (-666.220) (-668.796) (-665.201) [-662.846] * [-675.017] (-665.751) (-670.516) (-663.974) -- 0:00:23
913000 -- (-663.495) (-665.118) [-664.875] (-659.432) * (-664.219) (-670.645) [-670.600] (-667.189) -- 0:00:23
914000 -- (-659.477) [-661.531] (-659.312) (-678.028) * [-663.504] (-667.638) (-661.492) (-674.725) -- 0:00:23
915000 -- (-669.770) (-665.209) (-662.510) [-665.869] * (-660.981) [-671.411] (-667.055) (-679.509) -- 0:00:22
Average standard deviation of split frequencies: 0.005635
916000 -- (-661.590) (-669.652) [-658.143] (-664.881) * (-665.333) [-669.385] (-669.997) (-670.503) -- 0:00:22
917000 -- (-662.945) (-667.271) [-668.648] (-668.271) * (-676.001) (-665.866) (-664.362) [-667.124] -- 0:00:22
918000 -- [-663.475] (-665.417) (-685.799) (-664.730) * (-669.389) (-667.740) (-674.128) [-663.801] -- 0:00:22
919000 -- (-672.044) (-672.591) (-667.681) [-668.730] * (-664.998) [-657.612] (-670.812) (-666.407) -- 0:00:21
920000 -- (-669.536) [-667.305] (-667.133) (-661.195) * (-670.545) [-665.129] (-672.338) (-665.949) -- 0:00:21
Average standard deviation of split frequencies: 0.005453
921000 -- (-673.530) (-672.157) [-664.146] (-664.196) * (-669.027) [-669.421] (-662.323) (-662.785) -- 0:00:21
922000 -- (-672.563) (-667.695) [-671.005] (-673.803) * (-668.318) [-657.815] (-669.710) (-664.505) -- 0:00:20
923000 -- (-662.929) [-662.061] (-672.368) (-675.235) * (-668.498) (-671.887) [-664.728] (-668.903) -- 0:00:20
924000 -- (-669.499) [-670.201] (-668.887) (-661.959) * (-672.086) (-670.980) [-671.173] (-664.276) -- 0:00:20
925000 -- (-666.711) (-663.668) (-671.987) [-665.209] * (-667.123) [-665.647] (-670.367) (-670.511) -- 0:00:20
Average standard deviation of split frequencies: 0.005320
926000 -- [-662.562] (-667.168) (-671.932) (-665.377) * (-661.223) (-672.455) (-662.074) [-667.122] -- 0:00:19
927000 -- (-666.338) [-672.343] (-666.954) (-679.403) * (-665.394) (-670.292) [-669.102] (-667.524) -- 0:00:19
928000 -- (-665.362) (-667.854) [-665.696] (-672.236) * [-664.591] (-673.365) (-670.404) (-671.594) -- 0:00:19
929000 -- [-666.756] (-669.600) (-663.875) (-663.706) * (-666.959) [-668.853] (-666.238) (-664.496) -- 0:00:19
930000 -- (-673.364) (-668.167) [-667.473] (-669.717) * (-661.778) [-663.766] (-671.294) (-671.677) -- 0:00:18
Average standard deviation of split frequencies: 0.005015
931000 -- (-666.821) (-662.251) [-662.263] (-666.554) * (-668.824) [-669.878] (-667.401) (-673.533) -- 0:00:18
932000 -- [-673.581] (-663.185) (-664.519) (-667.317) * (-668.954) (-674.695) [-664.344] (-676.465) -- 0:00:18
933000 -- (-674.856) [-666.745] (-673.885) (-675.055) * (-676.158) [-663.243] (-672.409) (-672.630) -- 0:00:18
934000 -- (-669.930) [-658.147] (-674.235) (-667.159) * (-671.060) (-660.047) (-661.681) [-665.979] -- 0:00:17
935000 -- (-673.042) (-665.621) (-660.307) [-666.075] * [-664.401] (-666.720) (-670.490) (-674.830) -- 0:00:17
Average standard deviation of split frequencies: 0.004798
936000 -- (-669.032) (-665.646) (-666.146) [-668.024] * (-662.826) (-664.037) [-659.471] (-672.843) -- 0:00:17
937000 -- (-670.007) (-667.282) [-670.589] (-667.452) * (-662.729) (-669.162) (-670.559) [-671.573] -- 0:00:16
938000 -- (-666.840) [-668.706] (-672.413) (-660.602) * (-663.164) [-660.869] (-665.362) (-672.451) -- 0:00:16
939000 -- (-667.656) [-668.210] (-674.642) (-666.876) * (-676.427) (-667.603) (-668.533) [-659.931] -- 0:00:16
940000 -- [-661.489] (-664.743) (-672.447) (-671.354) * [-674.772] (-671.258) (-670.928) (-667.100) -- 0:00:16
Average standard deviation of split frequencies: 0.004774
941000 -- (-661.903) (-667.067) [-667.591] (-669.417) * (-664.979) (-671.874) (-661.124) [-664.634] -- 0:00:15
942000 -- (-678.366) (-665.817) (-674.254) [-662.758] * (-670.024) (-664.678) (-670.667) [-671.329] -- 0:00:15
943000 -- [-668.208] (-665.226) (-667.924) (-664.808) * (-677.842) (-667.070) [-668.589] (-665.814) -- 0:00:15
944000 -- (-667.938) (-666.951) [-664.975] (-672.729) * [-669.051] (-662.843) (-665.910) (-668.791) -- 0:00:15
945000 -- (-662.381) (-676.173) (-679.873) [-661.425] * (-666.774) [-661.158] (-663.430) (-668.758) -- 0:00:14
Average standard deviation of split frequencies: 0.004695
946000 -- (-668.928) (-675.658) [-674.371] (-665.505) * (-668.159) (-667.064) [-664.228] (-666.352) -- 0:00:14
947000 -- [-663.409] (-684.117) (-666.990) (-670.804) * (-673.921) [-672.913] (-667.259) (-669.434) -- 0:00:14
948000 -- (-665.124) [-659.507] (-666.332) (-671.720) * (-669.746) (-664.971) (-663.897) [-667.631] -- 0:00:13
949000 -- [-669.779] (-671.505) (-670.059) (-661.338) * [-667.838] (-670.035) (-668.734) (-665.186) -- 0:00:13
950000 -- (-673.403) (-667.802) (-664.078) [-666.531] * (-675.437) [-670.224] (-665.475) (-660.545) -- 0:00:13
Average standard deviation of split frequencies: 0.004959
951000 -- (-666.458) (-667.365) [-664.087] (-669.534) * (-668.594) [-664.395] (-667.841) (-665.212) -- 0:00:13
952000 -- (-667.784) (-661.663) (-670.174) [-666.006] * (-678.820) (-663.555) (-665.552) [-668.793] -- 0:00:12
953000 -- [-666.451] (-677.386) (-676.159) (-681.558) * [-662.921] (-666.065) (-671.523) (-672.408) -- 0:00:12
954000 -- (-667.574) (-669.377) [-662.025] (-676.043) * [-672.842] (-666.504) (-663.598) (-675.904) -- 0:00:12
955000 -- (-669.809) (-665.664) [-670.762] (-668.421) * [-667.294] (-668.659) (-669.594) (-672.628) -- 0:00:12
Average standard deviation of split frequencies: 0.004905
956000 -- (-662.571) (-662.504) [-667.135] (-664.613) * (-673.213) (-674.276) (-669.381) [-671.032] -- 0:00:11
957000 -- [-662.975] (-670.568) (-675.667) (-666.536) * [-662.853] (-668.502) (-668.229) (-669.177) -- 0:00:11
958000 -- (-662.008) [-665.310] (-670.163) (-660.702) * [-660.082] (-672.982) (-673.829) (-668.261) -- 0:00:11
959000 -- (-675.932) (-670.026) (-675.186) [-664.190] * (-679.630) (-665.524) [-664.558] (-668.947) -- 0:00:11
960000 -- (-672.415) [-666.338] (-669.789) (-662.810) * (-671.727) (-661.272) (-673.847) [-668.137] -- 0:00:10
Average standard deviation of split frequencies: 0.005165
961000 -- (-672.809) (-672.586) (-665.887) [-661.483] * [-673.334] (-665.213) (-666.124) (-669.906) -- 0:00:10
962000 -- (-676.610) (-666.924) (-669.259) [-661.765] * (-667.669) (-672.754) [-660.268] (-666.304) -- 0:00:10
963000 -- [-671.287] (-669.416) (-673.426) (-660.330) * (-665.680) [-678.974] (-669.908) (-674.352) -- 0:00:09
964000 -- (-671.913) (-662.450) (-671.911) [-663.405] * [-664.910] (-671.031) (-669.041) (-664.819) -- 0:00:09
965000 -- (-683.291) [-662.477] (-666.777) (-675.945) * (-682.475) [-664.697] (-677.999) (-672.364) -- 0:00:09
Average standard deviation of split frequencies: 0.005111
966000 -- (-660.019) (-665.888) [-659.786] (-676.011) * (-667.169) [-663.915] (-679.226) (-661.342) -- 0:00:09
967000 -- (-669.204) (-668.183) (-669.623) [-669.058] * (-671.629) [-662.650] (-676.365) (-668.989) -- 0:00:08
968000 -- (-668.608) [-673.302] (-664.656) (-663.215) * (-660.871) [-668.500] (-672.450) (-668.243) -- 0:00:08
969000 -- [-664.311] (-667.756) (-669.309) (-668.124) * (-661.221) (-665.565) [-673.245] (-660.830) -- 0:00:08
970000 -- (-668.619) [-669.530] (-668.827) (-662.391) * (-669.228) (-673.137) (-671.699) [-665.159] -- 0:00:08
Average standard deviation of split frequencies: 0.004959
971000 -- (-676.304) (-669.344) (-667.552) [-664.553] * (-665.992) (-672.799) [-669.890] (-665.831) -- 0:00:07
972000 -- (-670.953) [-668.703] (-667.226) (-669.892) * [-667.855] (-668.483) (-665.804) (-658.098) -- 0:00:07
973000 -- (-663.613) (-670.101) [-668.110] (-670.634) * (-665.049) [-670.898] (-674.537) (-666.440) -- 0:00:07
974000 -- (-671.731) (-671.297) [-663.000] (-681.051) * (-667.279) (-668.301) (-667.720) [-662.600] -- 0:00:06
975000 -- [-664.623] (-668.789) (-665.875) (-680.629) * (-665.741) [-670.191] (-670.382) (-669.302) -- 0:00:06
Average standard deviation of split frequencies: 0.005059
976000 -- (-670.789) (-663.379) (-662.678) [-670.673] * (-671.043) (-663.635) (-671.134) [-662.674] -- 0:00:06
977000 -- (-666.724) (-672.956) (-672.726) [-662.141] * (-661.828) [-662.963] (-668.983) (-675.207) -- 0:00:06
978000 -- [-666.020] (-667.389) (-675.682) (-674.115) * (-671.090) (-661.348) (-666.262) [-669.235] -- 0:00:05
979000 -- (-663.038) [-672.864] (-673.159) (-669.490) * (-670.058) (-658.155) (-662.211) [-667.795] -- 0:00:05
980000 -- (-671.471) (-667.806) [-666.169] (-660.132) * (-664.354) (-662.582) [-670.976] (-662.001) -- 0:00:05
Average standard deviation of split frequencies: 0.004908
981000 -- (-672.264) [-663.434] (-664.085) (-660.543) * (-665.591) (-663.951) [-663.382] (-666.347) -- 0:00:05
982000 -- [-668.582] (-662.679) (-674.999) (-667.047) * (-676.040) (-675.240) [-662.326] (-665.743) -- 0:00:04
983000 -- [-667.102] (-674.727) (-666.242) (-668.783) * (-681.147) [-670.345] (-663.814) (-668.189) -- 0:00:04
984000 -- (-676.281) (-669.365) (-666.301) [-664.554] * [-672.500] (-677.173) (-667.598) (-672.963) -- 0:00:04
985000 -- (-667.415) (-673.238) [-666.937] (-666.690) * [-668.065] (-663.621) (-660.457) (-664.905) -- 0:00:04
Average standard deviation of split frequencies: 0.004982
986000 -- (-661.841) (-674.556) (-659.516) [-671.273] * [-666.754] (-667.316) (-676.639) (-670.172) -- 0:00:03
987000 -- (-662.464) [-670.997] (-659.997) (-670.767) * [-672.181] (-676.673) (-669.102) (-671.421) -- 0:00:03
988000 -- [-660.301] (-670.420) (-675.475) (-666.633) * (-667.915) (-678.713) (-670.227) [-670.631] -- 0:00:03
989000 -- (-675.081) (-663.952) (-670.503) [-672.260] * (-663.970) (-670.984) (-671.197) [-665.614] -- 0:00:02
990000 -- (-672.435) (-672.676) [-663.665] (-677.223) * (-665.092) (-676.353) [-675.184] (-673.348) -- 0:00:02
Average standard deviation of split frequencies: 0.005209
991000 -- (-671.746) (-662.590) [-664.221] (-673.136) * (-670.684) [-665.755] (-670.624) (-663.640) -- 0:00:02
992000 -- [-665.996] (-666.624) (-669.736) (-669.612) * (-670.034) [-665.953] (-668.499) (-670.578) -- 0:00:02
993000 -- (-673.572) (-665.164) (-674.313) [-663.374] * (-667.662) (-668.920) (-672.900) [-668.583] -- 0:00:01
994000 -- (-665.380) (-667.985) [-663.306] (-667.671) * (-672.555) [-666.486] (-675.105) (-662.229) -- 0:00:01
995000 -- (-673.296) [-661.658] (-664.314) (-673.703) * (-665.495) (-671.906) (-662.929) [-671.333] -- 0:00:01
Average standard deviation of split frequencies: 0.005156
996000 -- [-667.376] (-675.466) (-672.137) (-668.227) * (-668.826) (-674.637) (-667.713) [-666.930] -- 0:00:01
997000 -- (-662.552) [-668.005] (-663.455) (-671.009) * (-668.071) [-665.921] (-673.932) (-667.298) -- 0:00:00
998000 -- (-664.914) (-664.780) [-665.003] (-666.944) * (-664.138) [-662.927] (-667.830) (-680.955) -- 0:00:00
999000 -- [-671.985] (-663.890) (-668.751) (-673.279) * (-668.814) [-658.726] (-674.036) (-670.421) -- 0:00:00
1000000 -- [-667.948] (-663.694) (-664.118) (-665.105) * (-669.234) (-669.298) [-666.262] (-665.341) -- 0:00:00
Average standard deviation of split frequencies: 0.005356
Analysis completed in 4 mins 29 seconds
Analysis used 269.03 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -653.97
Likelihood of best state for "cold" chain of run 2 was -654.18
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
67.9 % ( 59 %) Dirichlet(Revmat{all})
81.2 % ( 75 %) Slider(Revmat{all})
39.6 % ( 31 %) Dirichlet(Pi{all})
39.1 % ( 22 %) Slider(Pi{all})
73.8 % ( 60 %) Multiplier(Alpha{1,2})
66.2 % ( 43 %) Multiplier(Alpha{3})
87.1 % ( 75 %) Slider(Pinvar{all})
40.7 % ( 36 %) ExtSPR(Tau{all},V{all})
31.0 % ( 30 %) ExtTBR(Tau{all},V{all})
42.7 % ( 43 %) NNI(Tau{all},V{all})
44.3 % ( 43 %) ParsSPR(Tau{all},V{all})
27.2 % ( 21 %) Multiplier(V{all})
57.7 % ( 51 %) Nodeslider(V{all})
26.3 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
68.6 % ( 66 %) Dirichlet(Revmat{all})
80.7 % ( 69 %) Slider(Revmat{all})
40.2 % ( 30 %) Dirichlet(Pi{all})
38.7 % ( 24 %) Slider(Pi{all})
73.5 % ( 47 %) Multiplier(Alpha{1,2})
66.6 % ( 41 %) Multiplier(Alpha{3})
86.5 % ( 67 %) Slider(Pinvar{all})
40.5 % ( 45 %) ExtSPR(Tau{all},V{all})
30.8 % ( 35 %) ExtTBR(Tau{all},V{all})
42.8 % ( 47 %) NNI(Tau{all},V{all})
44.3 % ( 44 %) ParsSPR(Tau{all},V{all})
27.2 % ( 23 %) Multiplier(V{all})
57.9 % ( 70 %) Nodeslider(V{all})
26.3 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.75 0.53 0.37
2 | 166434 0.76 0.57
3 | 166846 166956 0.78
4 | 166953 166597 166214
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.75 0.53 0.37
2 | 166499 0.77 0.57
3 | 166757 166666 0.78
4 | 166674 166801 166603
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -664.25
| 2 1 1 2 1 |
| 1 2 2 1 |
| 1 1 2 1 * |
| 2 2 2 2 12 22 |
| 2 1 2 1 1 1 * 1 1|
| 1 2 1 22 1 1 2 21 2 * 2|
|2*11 1 2 2 1 2 22 * 2 2 1 |
|1 1 2 1 1 2 2 2 1* 1 22 2 |
| 2 * 1 2 112 1 1 1 1 1 1 1 1 1 1 |
| 22 1 11 2 122 1 1 |
| 2 2 2 22 |
| 2 2 1 1 2 |
| |
| |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -668.13
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -661.42 -674.27
2 -661.39 -674.79
--------------------------------------
TOTAL -661.41 -674.56
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.243776 0.001885 0.157868 0.326228 0.239299 1101.06 1246.22 1.000
r(A<->C){all} 0.125960 0.002750 0.031124 0.230342 0.121468 510.00 557.36 1.001
r(A<->G){all} 0.155073 0.003314 0.052039 0.265862 0.149024 503.52 583.70 1.000
r(A<->T){all} 0.109110 0.001481 0.039763 0.184046 0.105104 591.45 708.85 1.000
r(C<->G){all} 0.192989 0.004551 0.068097 0.322612 0.188350 500.86 507.06 1.000
r(C<->T){all} 0.303893 0.004489 0.170312 0.427833 0.299457 585.66 666.18 1.000
r(G<->T){all} 0.112975 0.001934 0.030100 0.194180 0.108138 587.04 764.06 1.000
pi(A){all} 0.255018 0.000593 0.209766 0.302909 0.254409 1023.33 1097.78 1.000
pi(C){all} 0.197026 0.000478 0.156667 0.239690 0.196978 1032.38 1187.69 1.000
pi(G){all} 0.177421 0.000461 0.135303 0.218348 0.176994 1301.74 1337.95 1.000
pi(T){all} 0.370535 0.000718 0.321220 0.423978 0.370215 1163.42 1178.75 1.000
alpha{1,2} 0.682364 0.518946 0.000092 2.031786 0.447306 898.44 1085.52 1.000
alpha{3} 1.950309 1.446788 0.318461 4.416256 1.656120 1429.24 1449.96 1.001
pinvar{all} 0.189105 0.017979 0.000035 0.437507 0.168981 1173.77 1222.88 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C10
3 -- C2
4 -- C3
5 -- C4
6 -- C5
7 -- C6
8 -- C7
9 -- C8
10 -- C9
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
----------------
1 -- .*********
2 -- .*........
3 -- ..*.......
4 -- ...*......
5 -- ....*.....
6 -- .....*....
7 -- ......*...
8 -- .......*..
9 -- ........*.
10 -- .........*
11 -- .....**...
12 -- .*......*.
13 -- ....***...
14 -- .*..***.*.
15 -- .*.*******
16 -- .*.****.*.
17 -- .******.**
18 -- .*..***.**
19 -- ..*....*..
20 -- .......*.*
21 -- .*..*****.
22 -- ..*......*
23 -- ...*...*..
24 -- .**.***.*.
25 -- .**.******
26 -- ...*.....*
27 -- ..**...*.*
28 -- .********.
29 -- ..**......
----------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 3002 1.000000 0.000000 1.000000 1.000000 2
13 3002 1.000000 0.000000 1.000000 1.000000 2
14 3002 1.000000 0.000000 1.000000 1.000000 2
15 473 0.157562 0.011777 0.149234 0.165889 2
16 455 0.151566 0.001413 0.150566 0.152565 2
17 450 0.149900 0.002827 0.147901 0.151899 2
18 449 0.149567 0.008009 0.143904 0.155230 2
19 443 0.147568 0.008951 0.141239 0.153897 2
20 433 0.144237 0.001413 0.143238 0.145237 2
21 431 0.143571 0.002355 0.141905 0.145237 2
22 430 0.143238 0.000942 0.142572 0.143904 2
23 429 0.142905 0.014604 0.132578 0.153231 2
24 428 0.142572 0.003769 0.139907 0.145237 2
25 425 0.141572 0.008009 0.135909 0.147235 2
26 422 0.140573 0.001884 0.139241 0.141905 2
27 414 0.137908 0.010364 0.130580 0.145237 2
28 409 0.136243 0.014604 0.125916 0.146569 2
29 393 0.130913 0.010835 0.123251 0.138574 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.003069 0.000009 0.000000 0.008913 0.002186 1.000 2
length{all}[2] 0.013603 0.000055 0.001843 0.027856 0.012274 1.000 2
length{all}[3] 0.003194 0.000011 0.000001 0.009734 0.002225 1.000 2
length{all}[4] 0.003159 0.000010 0.000000 0.009455 0.002206 1.000 2
length{all}[5] 0.004447 0.000018 0.000001 0.012584 0.003212 1.000 2
length{all}[6] 0.022455 0.000085 0.007595 0.041212 0.020970 1.000 2
length{all}[7] 0.003266 0.000010 0.000000 0.009666 0.002241 1.000 2
length{all}[8] 0.003019 0.000010 0.000000 0.009118 0.002084 1.000 2
length{all}[9] 0.005698 0.000027 0.000003 0.015491 0.004332 1.001 2
length{all}[10] 0.003082 0.000009 0.000001 0.009390 0.002133 1.000 2
length{all}[11] 0.033139 0.000137 0.012908 0.056294 0.031517 1.000 2
length{all}[12] 0.034790 0.000188 0.011482 0.062509 0.032885 1.000 2
length{all}[13] 0.061158 0.000358 0.027746 0.098241 0.058905 1.000 2
length{all}[14] 0.040388 0.000208 0.016026 0.070780 0.038265 1.000 2
length{all}[15] 0.002909 0.000010 0.000004 0.008961 0.001998 0.998 2
length{all}[16] 0.003123 0.000010 0.000004 0.010369 0.002125 0.998 2
length{all}[17] 0.003028 0.000011 0.000004 0.009252 0.002031 0.998 2
length{all}[18] 0.003150 0.000011 0.000003 0.009585 0.002078 1.000 2
length{all}[19] 0.003290 0.000011 0.000013 0.010239 0.002273 0.998 2
length{all}[20] 0.003296 0.000010 0.000002 0.009265 0.002317 0.998 2
length{all}[21] 0.003114 0.000008 0.000025 0.008940 0.002362 1.001 2
length{all}[22] 0.002989 0.000009 0.000001 0.009557 0.001844 1.004 2
length{all}[23] 0.003214 0.000013 0.000002 0.010061 0.002117 0.998 2
length{all}[24] 0.003415 0.000012 0.000010 0.009913 0.002435 1.004 2
length{all}[25] 0.002874 0.000009 0.000009 0.009164 0.001947 1.005 2
length{all}[26] 0.003332 0.000012 0.000029 0.009958 0.002270 0.999 2
length{all}[27] 0.002846 0.000010 0.000003 0.009165 0.001887 1.001 2
length{all}[28] 0.003121 0.000010 0.000029 0.009366 0.002215 1.000 2
length{all}[29] 0.003179 0.000009 0.000005 0.009676 0.002222 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005356
Maximum standard deviation of split frequencies = 0.014604
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (3)
|
|----------------------------------------------------------------------- C3 (4)
|
|----------------------------------------------------------------------- C7 (8)
+
|----------------------------------------------------------------------- C9 (10)
|
| /------------------ C10 (2)
| /----------------100---------------+
| | \------------------ C8 (9)
| |
\-------100-------+ /----------------------------------- C4 (5)
| |
\-------100-------+ /------------------ C5 (6)
\-------100------+
\------------------ C6 (7)
Phylogram (based on average branch lengths):
/- C1 (1)
|
|- C2 (3)
|
|- C3 (4)
|
|- C7 (8)
+
|- C9 (10)
|
| /------ C10 (2)
| /---------------+
| | \-- C8 (9)
| |
\-----------------+ /- C4 (5)
| |
\----------------------------+ /---------- C5 (6)
\--------------+
\- C6 (7)
|--------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
Running FUBAR...
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\
***************** TYPES OF STANDARD ANALYSES *****************
(1) Selection Analyses
(2) Evolutionary Hypothesis Testing
(3) Relative evolutionary rate inference
(4) Coevolutionary analysis
(5) Basic Analyses
(6) Codon Selection Analyses
(7) Compartmentalization
(8) Data File Tools
(9) Miscellaneous
(10) Model Comparison
(11) Kernel Analysis Tools
(12) Molecular Clock
(13) Phylogeny Reconstruction
(14) Positive Selection
(15) Recombination
(16) Selection/Recombination
(17) Relative Rate
(18) Relative Ratio
(19) Substitution Rates
Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' *****************
(1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution).
(2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood).
(3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting).
(4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection).
(5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification).
(6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood).
(7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation).
Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types):
Analysis Description
--------------------
Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a
coding sequence alignment to determine whether some sites have been
subject to pervasive purifying or diversifying selection. v2.1
introduces two more methods for estimating the posterior distribution of
grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation
Bayes approximation (fastest). Please note that a FUBAR analysis
generates a cache and a results JSON file in the same directory as
directory as the original alignment. HyPhy needs to have write
privileges to this directory. For example if the original file is in
/home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there
will also exist FUBAR-generated files
/home/sergei/FUBAR/data/pol.nex.FUBAR.json,
/home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide
checkpointing so that a partially completed analysis can be restarted.
- __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree
(one per partition)
- __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring
selection (2013), Mol Biol Evol. 30(5):1196-205
- __Written by__: Sergei L Kosakovsky Pond
- __Contact Information__: spond@temple.edu
- __Analysis Version__: 2.1
####Choose Genetic Code
1. [**Universal**] Universal code. (Genebank transl_table=1).
2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2).
3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3).
4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4).
5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5).
6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6).
7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9).
8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10).
9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12).
10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13).
11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14).
12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15).
13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16).
14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21).
15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22).
16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23).
17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24).
18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25).
19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26).
>Please choose an option (or press q to cancel selection):
>Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`)
>A tree was found in the data file: `(C1,C2,C3,C7,C9,((C10,C8),(C4,(C5,C6))))`
>Would you like to use it (y/n)?
>Loaded a multiple sequence alignment with **10** sequences, **91** codons, and **1** partitions from `/data//pss_subsets/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/fubar/results/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1.fna`
> FUBAR will write cache and result files to _/data//pss_subsets/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/fubar/results/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/fubar/results/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1.fna.FUBAR.json_, respectively
> Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer):
####Posterior estimation method
1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation)
2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed)
3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default)
>Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5):
### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model
* Log(L) = -652.05, AIC-c = 1348.47 (22 estimated parameters)
* Tree length (expected substitutions/site) for partition 1 : 0.213
### Computing the phylogenetic likelihood function on the grid
* Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid
* Best scaling achieved for
* synonymous rate = 2.815
* non-synonymous rate = 0.643
* Computing conditional site likelihoods on a 20 x 20 rate grid
### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights
* Using the following settings
* Dirichlet alpha : 0.5
### Tabulating site-level results
| Codon | Partition | alpha | beta |Posterior prob for positive selection|
|:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:|
| 12 | 1 | 1.252 | 9.247 | Pos. posterior = 0.9262 |
----
## FUBAR inferred 1 sites subject to diversifying positive selection at posterior probability >= 0.9
Of these, 0.07 are expected to be false positives (95% confidence interval of 0-1 )
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=10, Len=91
B04f_NS3a_ABN10840_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
B07f_NS3a_ABN10858_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
BtTp_GX2012_NA_AIA62353_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNVTAILLVLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
CZ01_orf3_AWH65878_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ---MNVTAILLQNVANAFSNPLYVPEHCVGMPGTLFQACIRQTMVDTTGM
CZ07_orf3_AWH65889_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ---MNVTAILLQNVANAFSNPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
HKU4_1_B04f_NS3a_YP_001039954_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
LMH1f_NS3a_ABN10867_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
SM3A_NA_QQD78084_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
B04f_NS3a_ABN10840_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU40 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSATLFQACIRQTMVDTTGM
:*.***:* :*****:******** **..*****************
B04f_NS3a_ABN10840_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
B07f_NS3a_ABN10858_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
BtTp_GX2012_NA_AIA62353_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 YTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV
CZ01_orf3_AWH65878_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 YTNSAMSYDGTTIPFDIHGIVHEDHYTDTKPTPLSDVGFSV
CZ07_orf3_AWH65889_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 YTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV
HKU4_1_B04f_NS3a_YP_001039954_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
LMH1f_NS3a_ABN10867_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 YTNSAMSHDGITIPFDRDGIVHEEHYTETNPTPLSDVGFSV
SM3A_NA_QQD78084_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
B04f_NS3a_ABN10840_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU40 YTNSDMSHDGITIPFDRDGIVHEEHYTETNPTPLFDAGFSV
**** **:** ***** .*****:***:*:**** *.****
>B04f_NS3a_ABN10840_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGTTTCTTTTAATGCTACTGCTATTCTTCTTTTATTACTTGCTAATGCTTTTTCTAAACCTTTATATGTCCCTGAGCATTGTGGTGGCATGTCTGGCACTCTCTTTCAGGCTTGTATTAGACAAACTATGGTTGATACAACCGGTATGTACACCAATTCAGCTATGTCACATGATGGTGTTACAATACCATTTGATAGAGATGGCATTGTACATGAAGATCATTACACTGAAACAAACCCTACACCACTTTTTGATGCTGGGTTTTCCGTA >B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGTTTCTTTTAATGCTACTGCTATTCTTCTTTTATTACTTGCTAATGCTTTTTCTAAACCTTTATATGTCCCTGAGCATTGTGGTGGCATGTCTGGCACTCTCTTTCAGGCTTGTATTAGACAAACTATGGTTGATACAACCGGTATGTACACCAATTCAGCTATGTCACATGATGGTGTTACAATACCATTTGATAGAGATGGCATTGTACATGAAGATCATTACACTGAAACAAACCCTACACCACTTTTTGATGCTGGGTTTTCCGTA >B07f_NS3a_ABN10858_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGTTTCTTTTAATGCTACTGCTATTCTTCTTTTATTACTTGCTAATGCTTTTTCTAAACCTTTATATGTCCCTGAGCATTGTGGTGGCATGTCTGGCACTCTCTTTCAGGCTTGTATTAGACAAACTATGGTTGATACAACCGGTATGTACACCAATTCAGCTATGTCACATGATGGTGTTACAATACCATTTGATAGAGATGGCATTGTACATGAAGATCATTACACTGAAACAAACCCTACACCACTTTTTGATGCTGGGTTTTCCGTA >BtTp_GX2012_NA_AIA62353_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGTTTCTTTTAACGTTACTGCTATTCTTCTCGTATTAGTTGCTAATGCTTTTTCTAAACCCTTATATGTTCCTGAACATTGTGTTGGCATGTCTGGCACTTTGTTTCAAGCTTGTATTAGACAAACTATGGTTGATACAACAGGTATGTACACCAATTCAGCTATGTCATATGATGGTACTACAATACCATTCGATAGAGATGGCATTGTACATGAGGATCATTACACTGATACAAAACCTACACCCTTGTCTGATGTTGGTTTTTCCGTA >CZ01_orf3_AWH65878_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ---------ATGAACGTTACTGCTATTCTTCTCCAAAACGTTGCTAATGCTTTTTCTAATCCCTTATATGTTCCTGAACATTGTGTTGGCATGCCCGGGACTTTGTTTCAAGCTTGTATTAGACAAACTATGGTTGATACAACAGGTATGTACACCAATTCAGCTATGTCATATGATGGTACTACAATACCATTCGATATTCATGGCATTGTACATGAGGATCATTACACTGATACTAAACCTACACCCTTGTCTGATGTTGGTTTTTCCGTA >CZ07_orf3_AWH65889_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ---------ATGAACGTTACTGCTATTCTTCTCCAAAACGTTGCTAATGCTTTTTCTAATCCCTTATATGTTCCTGAACATTGTGTTGGCATGTCTGGCACTTTGTTTCAAGCTTGTATTAGACAAACTATGGTTGATACAACAGGTATGTACACCAATTCAGCTATGTCATATGATGGTACTACAATACCATTCGATAGAGATGGCATTGTACATGAGGATCATTACACTGATACTAAACCTACACCCTTGTCTGATGTTGGTTTTTCCGTA >HKU4_1_B04f_NS3a_YP_001039954_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGTTTCTTTTAATGCTACTGCTATTCTTCTTTTATTACTTGCTAATGCTTTTTCTAAACCTTTATATGTCCCTGAGCATTGTGGTGGCATGTCTGGCACTCTCTTTCAGGCTTGTATTAGACAAACTATGGTTGATACAACCGGTATGTACACCAATTCAGCTATGTCACATGATGGTGTTACAATACCATTTGATAGAGATGGCATTGTACATGAAGATCATTACACTGAAACAAACCCTACACCACTTTTTGATGCTGGGTTTTCCGTA >LMH1f_NS3a_ABN10867_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGTTTCTTTTAATGCTACTGCTATTTTTCTTTTATTAGTTGCTAATGCTTTTTCTAAACCATTGTATGTACCTGAACATTGTGTTGGCATGTCTGGCACTTTGTTTCAAGCTTGTATTAGACAAACTATGGTTGATACAACTGGTATGTATACCAACTCAGCTATGTCACATGATGGTATTACAATACCATTCGATAGGGATGGCATTGTACATGAAGAGCATTATACTGAAACAAACCCTACACCACTTTCTGATGTTGGGTTTTCCGTA >SM3A_NA_QQD78084_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGTTTCTTTTAATGCTACTGCTATTCTTCTTTTATTACTTGCTAATGCTTTTTCTAAACCTTTATATGTCCCTGAGCATTGTGGTGGCATGTCTGGCACTCTCTTTCAGGCTTGTATTAGACAAACTATGGTTGATACAACCGGTATGTACACCAATTCAGCTATGTCACATGATGGTGTTACAATACCATTTGATAGAGATGGCATTGTACATGAAGATCATTACACTGAAACAAACCCTACACCACTTTTTGATGCTGGGTTTTCCGTA >SZ140324_orf3_AWH65900_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ATGGTTTCTTTTAATGCTACTGCTATTTTTCTTTTATTAGTTGCTAATGCTTTTTCTAAACCATTGTATGTACCTGAACATTGTGTTGGCATGTCTGCCACTTTGTTTCAAGCTTGTATTAGACAAACTATGGTTGATACAACTGGTATGTATACCAACTCAGATATGTCACATGATGGTATTACAATACCATTCGATAGGGATGGCATTGTACATGAAGAGCATTATACTGAAACAAACCCTACACCACTTTTTGATGCTGGGTTTTCCGTA
>B04f_NS3a_ABN10840_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV >B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV >B07f_NS3a_ABN10858_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV >BtTp_GX2012_NA_AIA62353_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNVTAILLVLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGM YTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV >CZ01_orf3_AWH65878_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ---MNVTAILLQNVANAFSNPLYVPEHCVGMPGTLFQACIRQTMVDTTGM YTNSAMSYDGTTIPFDIHGIVHEDHYTDTKPTPLSDVGFSV >CZ07_orf3_AWH65889_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ---MNVTAILLQNVANAFSNPLYVPEHCVGMSGTLFQACIRQTMVDTTGM YTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV >HKU4_1_B04f_NS3a_YP_001039954_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV >LMH1f_NS3a_ABN10867_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGM YTNSAMSHDGITIPFDRDGIVHEEHYTETNPTPLSDVGFSV >SM3A_NA_QQD78084_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV >SZ140324_orf3_AWH65900_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSATLFQACIRQTMVDTTGM YTNSDMSHDGITIPFDRDGIVHEEHYTETNPTPLFDAGFSV
Reading sequence file /data//pss_subsets/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/fubar/fasta/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1
Found 10 sequences of length 273
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 7.7%
Found 41 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 12
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 32 polymorphic sites
**p-Value(s)**
----------
NSS: 2.00e-02 (1000 permutations)
Max Chi^2: 1.10e-02 (1000 permutations)
PHI (Permutation): 3.49e-01 (1000 permutations)
PHI (Normal): 2.94e-01
#NEXUS
[ID: 1938929574]
begin taxa;
dimensions ntax=10;
taxlabels
B04f_NS3a_ABN10840_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
SZ140324_orf3_AWH65900_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4
B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
B07f_NS3a_ABN10858_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
BtTp_GX2012_NA_AIA62353_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4
CZ01_orf3_AWH65878_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4
CZ07_orf3_AWH65889_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4
HKU4_1_B04f_NS3a_YP_001039954_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
LMH1f_NS3a_ABN10867_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
SM3A_NA_QQD78084_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4
;
end;
begin trees;
translate
1 B04f_NS3a_ABN10840_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
2 SZ140324_orf3_AWH65900_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4,
3 B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
4 B07f_NS3a_ABN10858_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
5 BtTp_GX2012_NA_AIA62353_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
6 CZ01_orf3_AWH65878_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4,
7 CZ07_orf3_AWH65889_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4,
8 HKU4_1_B04f_NS3a_YP_001039954_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
9 LMH1f_NS3a_ABN10867_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
10 SM3A_NA_QQD78084_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:2.186038e-03,3:2.224785e-03,4:2.206385e-03,8:2.083606e-03,10:2.133000e-03,((2:1.227391e-02,9:4.332192e-03)1.000:3.288507e-02,(5:3.212290e-03,(6:2.097049e-02,7:2.240621e-03)1.000:3.151663e-02)1.000:5.890539e-02)1.000:3.826451e-02);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:2.186038e-03,3:2.224785e-03,4:2.206385e-03,8:2.083606e-03,10:2.133000e-03,((2:1.227391e-02,9:4.332192e-03):3.288507e-02,(5:3.212290e-03,(6:2.097049e-02,7:2.240621e-03):3.151663e-02):5.890539e-02):3.826451e-02);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -661.20 -675.31
2 -661.42 -674.82
--------------------------------------
TOTAL -661.31 -675.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.244417 0.001925 0.166413 0.333500 0.241348 1347.97 1379.67 1.000
r(A<->C){all} 0.130756 0.002910 0.034473 0.232751 0.124507 547.35 611.46 1.001
r(A<->G){all} 0.151664 0.003032 0.051761 0.257343 0.147630 536.08 614.59 1.001
r(A<->T){all} 0.107938 0.001444 0.037894 0.183019 0.103776 501.22 658.85 1.000
r(C<->G){all} 0.194736 0.004460 0.070312 0.322834 0.190441 595.91 620.68 1.000
r(C<->T){all} 0.305273 0.004349 0.185833 0.437422 0.303200 678.59 692.81 1.000
r(G<->T){all} 0.109632 0.001903 0.035757 0.201501 0.104854 426.53 570.62 1.000
pi(A){all} 0.256399 0.000603 0.211168 0.305750 0.255863 1142.95 1208.62 1.000
pi(C){all} 0.196613 0.000483 0.153181 0.240209 0.196081 862.43 1000.99 1.000
pi(G){all} 0.176108 0.000482 0.133979 0.217289 0.175082 1074.12 1168.91 1.000
pi(T){all} 0.370880 0.000760 0.321745 0.426653 0.369967 1141.06 1180.20 1.000
alpha{1,2} 0.660894 0.486095 0.001693 2.010291 0.442134 1107.58 1143.40 1.001
alpha{3} 1.954139 1.360016 0.304380 4.298999 1.691177 1110.77 1305.88 1.000
pinvar{all} 0.187144 0.017825 0.000136 0.440395 0.162519 955.53 1021.50 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C2,C3,C7,C9,((C10,C8),(C4,(C5,C6))))` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **10** sequences, **91** codons, and **1** partitions from `/data//pss_subsets/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/fubar/results/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/fubar/results/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/fubar/results/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -652.05, AIC-c = 1348.47 (22 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.213 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 2.815 * non-synonymous rate = 0.643 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results | Codon | Partition | alpha | beta |Posterior prob for positive selection| |:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:| | 12 | 1 | 1.252 | 9.247 | Pos. posterior = 0.9262 | ---- ## FUBAR inferred 1 sites subject to diversifying positive selection at posterior probability >= 0.9 Of these, 0.07 are expected to be false positives (95% confidence interval of 0-1 )
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
