--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2746.33 -2757.25
2 -2746.30 -2755.89
--------------------------------------
TOTAL -2746.32 -2756.79
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.758356 0.117618 1.209732 2.422642 1.702358 603.78 676.79 1.000
r(A<->C){all} 0.017884 0.000203 0.000003 0.046152 0.014845 734.76 796.80 1.000
r(A<->G){all} 0.382895 0.004558 0.251118 0.512757 0.382036 344.33 447.59 1.000
r(A<->T){all} 0.076631 0.000325 0.041542 0.112264 0.075618 463.55 658.83 1.000
r(C<->G){all} 0.010057 0.000080 0.000001 0.027860 0.007508 768.64 825.75 1.000
r(C<->T){all} 0.506121 0.005617 0.376491 0.669285 0.504561 153.86 242.89 1.000
r(G<->T){all} 0.006412 0.000030 0.000003 0.017079 0.005022 1063.50 1076.73 1.000
pi(A){all} 0.266054 0.000144 0.242359 0.290059 0.265924 1053.91 1202.96 1.000
pi(C){all} 0.166623 0.000097 0.147877 0.185854 0.166476 593.48 934.14 1.000
pi(G){all} 0.237042 0.000143 0.215824 0.262194 0.236852 1179.38 1235.16 1.000
pi(T){all} 0.330280 0.000170 0.304961 0.354783 0.330450 1101.74 1147.73 1.001
alpha{1,2} 0.070701 0.000443 0.014109 0.102596 0.075258 809.04 822.77 1.000
alpha{3} 4.062788 2.273282 1.552859 7.073329 3.833098 1412.76 1426.68 1.000
pinvar{all} 0.261553 0.002079 0.173867 0.351149 0.263047 915.10 1208.05 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
-- Starting log on Wed Oct 26 00:49:25 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=337
C1 SLENVAYNVLKSGHFTAIAGELPVAILNDRLYIKEEGVDKLLFTNNTCLP
C2 SLENVAYNVLKSGHFMAVAGELPVAILNDRLYIKEDGVDKLLFTNNTCLP
C3 SLENVAYNVLKSGHFTPVAGELPVAIFNDRLYIREDGVDKLLFTNNTCLP
C4 SLENVAYNVLKSGHFTAVAGELPVAILNDRLYIKEDGADKLLFTNNTCLP
*************** .:********:******:*:*.************
C1 TNVAFELWAKRSVNVVPEVKLLHNLGVTCTYNLVIWDYECNAPLVPNTVG
C2 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYENNAPLVPNTVG
C3 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYEHNAPLVPNTVG
C4 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYESNAPLVPNTVG
**********************:**************** **********
C1 VCTYTDLTKLDDQIVLVDGRQLDSYSKFCQLKNAVYFSPSKPKCICTKGP
C2 ICNYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPSKPKCVCTKGP
C3 VCTYTDLINLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPTKPKCISARGP
C4 ICTYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAIYFSPSKPKCVCTRGP
:*.**** :****:*********:**********:****:****:.::**
C1 PHASINGVIVEAADRGTAFWYAMRKDGAFVQLTDGYFTQSRTLNDFQPRT
C2 THASINGVVVEAPDKGTAFWYAVRKDGAFVQPTDGYFTQSRTLDDFQPRT
C3 MHASINGVVVEAPDKGTAFWYAVRKDGAFVQPADGYFTQSRTLDNFQPRT
C4 THASINGVVVEAPDRGTAFWYAMRKDGAFVQPTDGYFTQSRTVDDFQPRT
*******:***.*:*******:******** :*********:::*****
C1 QLEIDFLDLEQSCFLDKYDLHDLGLEHIAYGQFDGTIGGLHLLIGAVRRK
C2 QLELDFLDLEQSCFLDKYDLHDLGLEHIAYGQFEGTIGGLHLLIGAVRRK
C3 QLELDFLDLDESCFLDRYDLHDLGLEHIAYGQFEGTIGGLHLLLGAVRRR
C4 QLEIDFLDLEQSCFLDKYDLHDLGLEHIVYGQFDGTIGGLHLLIGAVRRK
***:*****::*****:***********.****:*********:*****:
C1 RTANLVMETVLGTDTVTAYAVIDQPTASSKQVCSVFDMVLDDFIELIRAQ
C2 RTANLVMETVLGTDTVTSYAVIDQPTASSKQVCSVFDMILDDFIELIKAQ
C3 RTANLVMETVLGTDTVTSYAVIDQPTAANKQVCSVFDMVLDDFVALIKSQ
C4 RTAHLVMETVLGTDTVTSYAVIDQPTASSKQVCSVVDIILDDFIALIKAQ
***:*************:*********:.******.*::****: **::*
C1 DRSVVSKVVQCCLDFKMFRFMLWCKDGKVATFYPQLQ
C2 DRSVVSKVVQCCLDFKVFRFMLWCKDGKVATFYPQLQ
C3 DRTVVSKVVQCCLDFKMFRFMLWCKDGKIATFYPQLQ
C4 DRSVVSKVVQCCLDFKVFRFMLWCKGGKISTFYPQLQ
**:*************:********.**::*******
-- Starting log on Wed Oct 26 00:50:15 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=4, Len=337
C1 SLENVAYNVLKSGHFTAIAGELPVAILNDRLYIKEEGVDKLLFTNNTCLP
C2 SLENVAYNVLKSGHFMAVAGELPVAILNDRLYIKEDGVDKLLFTNNTCLP
C3 SLENVAYNVLKSGHFTPVAGELPVAIFNDRLYIREDGVDKLLFTNNTCLP
C4 SLENVAYNVLKSGHFTAVAGELPVAILNDRLYIKEDGADKLLFTNNTCLP
*************** .:********:******:*:*.************
C1 TNVAFELWAKRSVNVVPEVKLLHNLGVTCTYNLVIWDYECNAPLVPNTVG
C2 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYENNAPLVPNTVG
C3 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYEHNAPLVPNTVG
C4 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYESNAPLVPNTVG
**********************:**************** **********
C1 VCTYTDLTKLDDQIVLVDGRQLDSYSKFCQLKNAVYFSPSKPKCICTKGP
C2 ICNYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPSKPKCVCTKGP
C3 VCTYTDLINLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPTKPKCISARGP
C4 ICTYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAIYFSPSKPKCVCTRGP
:*.**** :****:*********:**********:****:****:.::**
C1 PHASINGVIVEAADRGTAFWYAMRKDGAFVQLTDGYFTQSRTLNDFQPRT
C2 THASINGVVVEAPDKGTAFWYAVRKDGAFVQPTDGYFTQSRTLDDFQPRT
C3 MHASINGVVVEAPDKGTAFWYAVRKDGAFVQPADGYFTQSRTLDNFQPRT
C4 THASINGVVVEAPDRGTAFWYAMRKDGAFVQPTDGYFTQSRTVDDFQPRT
*******:***.*:*******:******** :*********:::*****
C1 QLEIDFLDLEQSCFLDKYDLHDLGLEHIAYGQFDGTIGGLHLLIGAVRRK
C2 QLELDFLDLEQSCFLDKYDLHDLGLEHIAYGQFEGTIGGLHLLIGAVRRK
C3 QLELDFLDLDESCFLDRYDLHDLGLEHIAYGQFEGTIGGLHLLLGAVRRR
C4 QLEIDFLDLEQSCFLDKYDLHDLGLEHIVYGQFDGTIGGLHLLIGAVRRK
***:*****::*****:***********.****:*********:*****:
C1 RTANLVMETVLGTDTVTAYAVIDQPTASSKQVCSVFDMVLDDFIELIRAQ
C2 RTANLVMETVLGTDTVTSYAVIDQPTASSKQVCSVFDMILDDFIELIKAQ
C3 RTANLVMETVLGTDTVTSYAVIDQPTAANKQVCSVFDMVLDDFVALIKSQ
C4 RTAHLVMETVLGTDTVTSYAVIDQPTASSKQVCSVVDIILDDFIALIKAQ
***:*************:*********:.******.*::****: **::*
C1 DRSVVSKVVQCCLDFKMFRFMLWCKDGKVATFYPQLQ
C2 DRSVVSKVVQCCLDFKVFRFMLWCKDGKVATFYPQLQ
C3 DRTVVSKVVQCCLDFKMFRFMLWCKDGKIATFYPQLQ
C4 DRSVVSKVVQCCLDFKVFRFMLWCKGGKISTFYPQLQ
**:*************:********.**::*******
-- Starting log on Wed Oct 26 00:49:25 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=337
C1 SLENVAYNVLKSGHFTAIAGELPVAILNDRLYIKEEGVDKLLFTNNTCLP
C2 SLENVAYNVLKSGHFMAVAGELPVAILNDRLYIKEDGVDKLLFTNNTCLP
C3 SLENVAYNVLKSGHFTPVAGELPVAIFNDRLYIREDGVDKLLFTNNTCLP
C4 SLENVAYNVLKSGHFTAVAGELPVAILNDRLYIKEDGADKLLFTNNTCLP
*************** .:********:******:*:*.************
C1 TNVAFELWAKRSVNVVPEVKLLHNLGVTCTYNLVIWDYECNAPLVPNTVG
C2 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYENNAPLVPNTVG
C3 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYEHNAPLVPNTVG
C4 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYESNAPLVPNTVG
**********************:**************** **********
C1 VCTYTDLTKLDDQIVLVDGRQLDSYSKFCQLKNAVYFSPSKPKCICTKGP
C2 ICNYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPSKPKCVCTKGP
C3 VCTYTDLINLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPTKPKCISARGP
C4 ICTYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAIYFSPSKPKCVCTRGP
:*.**** :****:*********:**********:****:****:.::**
C1 PHASINGVIVEAADRGTAFWYAMRKDGAFVQLTDGYFTQSRTLNDFQPRT
C2 THASINGVVVEAPDKGTAFWYAVRKDGAFVQPTDGYFTQSRTLDDFQPRT
C3 MHASINGVVVEAPDKGTAFWYAVRKDGAFVQPADGYFTQSRTLDNFQPRT
C4 THASINGVVVEAPDRGTAFWYAMRKDGAFVQPTDGYFTQSRTVDDFQPRT
*******:***.*:*******:******** :*********:::*****
C1 QLEIDFLDLEQSCFLDKYDLHDLGLEHIAYGQFDGTIGGLHLLIGAVRRK
C2 QLELDFLDLEQSCFLDKYDLHDLGLEHIAYGQFEGTIGGLHLLIGAVRRK
C3 QLELDFLDLDESCFLDRYDLHDLGLEHIAYGQFEGTIGGLHLLLGAVRRR
C4 QLEIDFLDLEQSCFLDKYDLHDLGLEHIVYGQFDGTIGGLHLLIGAVRRK
***:*****::*****:***********.****:*********:*****:
C1 RTANLVMETVLGTDTVTAYAVIDQPTASSKQVCSVFDMVLDDFIELIRAQ
C2 RTANLVMETVLGTDTVTSYAVIDQPTASSKQVCSVFDMILDDFIELIKAQ
C3 RTANLVMETVLGTDTVTSYAVIDQPTAANKQVCSVFDMVLDDFVALIKSQ
C4 RTAHLVMETVLGTDTVTSYAVIDQPTASSKQVCSVVDIILDDFIALIKAQ
***:*************:*********:.******.*::****: **::*
C1 DRSVVSKVVQCCLDFKMFRFMLWCKDGKVATFYPQLQ
C2 DRSVVSKVVQCCLDFKVFRFMLWCKDGKVATFYPQLQ
C3 DRTVVSKVVQCCLDFKMFRFMLWCKDGKIATFYPQLQ
C4 DRSVVSKVVQCCLDFKVFRFMLWCKGGKISTFYPQLQ
**:*************:********.**::*******
-- Starting log on Wed Oct 26 01:22:25 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/gapped_alignment/fubar,BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 1011 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666747347
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1744136311
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5415592825
Seed = 1147518302
Swapseed = 1666747347
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.00 % Dirichlet(Revmat{all})
1.00 % Slider(Revmat{all})
1.00 % Dirichlet(Pi{all})
1.00 % Slider(Pi{all})
2.00 % Multiplier(Alpha{1,2})
2.00 % Multiplier(Alpha{3})
2.00 % Slider(Pinvar{all})
10.00 % ExtSPR(Tau{all},V{all})
10.00 % NNI(Tau{all},V{all})
10.00 % ParsSPR(Tau{all},V{all})
40.00 % Multiplier(V{all})
14.00 % Nodeslider(V{all})
6.00 % TLMultiplier(V{all})
Division 1 has 36 unique site patterns
Division 2 has 19 unique site patterns
Division 3 has 83 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -3280.731520 -- 13.556448
Chain 2 -- -3245.803475 -- 13.556448
Chain 3 -- -3280.731520 -- 13.556448
Chain 4 -- -3242.382090 -- 13.556448
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -3242.382090 -- 13.556448
Chain 2 -- -3245.803475 -- 13.556448
Chain 3 -- -3245.803475 -- 13.556448
Chain 4 -- -3242.382090 -- 13.556448
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-3280.732] (-3245.803) (-3280.732) (-3242.382) * [-3242.382] (-3245.803) (-3245.803) (-3242.382)
1000 -- (-2899.893) [-2853.334] (-2877.813) (-2896.004) * (-2859.318) (-2858.971) [-2848.255] (-2912.312) -- 0:00:00
2000 -- (-2826.791) [-2821.905] (-2824.676) (-2835.483) * (-2813.372) (-2803.504) [-2784.791] (-2818.800) -- 0:08:19
3000 -- (-2779.241) (-2795.514) (-2804.241) [-2778.480] * (-2789.241) (-2780.572) [-2752.255] (-2778.971) -- 0:05:32
4000 -- [-2761.105] (-2788.166) (-2779.834) (-2770.535) * (-2775.983) (-2758.364) [-2756.627] (-2757.757) -- 0:04:09
5000 -- [-2761.398] (-2764.161) (-2763.445) (-2750.450) * (-2754.341) [-2750.665] (-2748.499) (-2749.436) -- 0:03:19
Average standard deviation of split frequencies: 0.235702
6000 -- (-2763.208) (-2757.650) [-2759.825] (-2749.053) * (-2762.897) (-2754.424) (-2750.077) [-2755.170] -- 0:02:45
7000 -- (-2757.401) (-2751.406) (-2762.703) [-2749.896] * (-2752.740) [-2751.813] (-2747.203) (-2751.113) -- 0:04:43
8000 -- (-2753.036) (-2753.003) (-2757.661) [-2754.598] * (-2749.522) [-2746.391] (-2752.213) (-2756.228) -- 0:04:08
9000 -- (-2753.687) (-2746.031) (-2753.871) [-2749.232] * [-2747.003] (-2762.406) (-2750.719) (-2748.325) -- 0:03:40
10000 -- (-2748.054) (-2748.468) (-2762.610) [-2746.655] * [-2747.643] (-2754.572) (-2760.552) (-2745.904) -- 0:03:18
Average standard deviation of split frequencies: 0.066291
11000 -- (-2756.141) [-2753.375] (-2750.758) (-2751.622) * [-2753.538] (-2751.298) (-2764.311) (-2745.942) -- 0:02:59
12000 -- (-2751.434) [-2752.472] (-2750.409) (-2758.365) * (-2746.298) (-2750.458) (-2750.723) [-2745.705] -- 0:04:07
13000 -- (-2757.448) [-2754.584] (-2751.661) (-2745.402) * [-2749.313] (-2749.081) (-2750.379) (-2746.364) -- 0:03:47
14000 -- [-2750.615] (-2749.570) (-2752.126) (-2753.498) * [-2748.940] (-2749.128) (-2751.475) (-2747.959) -- 0:03:31
15000 -- (-2758.393) (-2744.112) [-2748.533] (-2760.651) * (-2749.307) [-2748.055] (-2748.307) (-2757.545) -- 0:03:17
Average standard deviation of split frequencies: 0.073657
16000 -- (-2750.545) (-2750.768) [-2748.021] (-2752.318) * [-2752.355] (-2748.091) (-2749.747) (-2751.170) -- 0:04:06
17000 -- [-2751.774] (-2756.107) (-2746.891) (-2751.935) * [-2752.215] (-2756.197) (-2748.054) (-2751.026) -- 0:03:51
18000 -- [-2748.987] (-2751.521) (-2747.094) (-2749.151) * [-2746.940] (-2755.879) (-2754.753) (-2751.021) -- 0:03:38
19000 -- [-2744.515] (-2754.842) (-2751.978) (-2755.185) * (-2746.674) (-2747.860) (-2752.620) [-2748.037] -- 0:03:26
20000 -- (-2749.042) (-2754.288) (-2749.335) [-2748.438] * (-2745.500) [-2745.243] (-2747.075) (-2754.344) -- 0:03:16
Average standard deviation of split frequencies: 0.022810
21000 -- (-2745.311) (-2759.914) [-2748.144] (-2748.430) * (-2745.329) (-2753.518) (-2750.079) [-2753.178] -- 0:03:53
22000 -- (-2745.249) (-2746.789) (-2745.545) [-2744.819] * [-2746.928] (-2752.869) (-2748.318) (-2757.544) -- 0:03:42
23000 -- (-2754.195) (-2750.402) (-2746.747) [-2750.598] * [-2748.402] (-2764.981) (-2744.727) (-2750.075) -- 0:03:32
24000 -- [-2746.509] (-2742.625) (-2747.843) (-2754.652) * (-2751.008) [-2751.452] (-2748.066) (-2747.835) -- 0:03:23
25000 -- (-2757.250) (-2750.570) [-2753.472] (-2751.172) * (-2751.832) (-2754.039) (-2749.018) [-2749.848] -- 0:03:54
Average standard deviation of split frequencies: 0.009065
26000 -- [-2752.934] (-2748.113) (-2753.873) (-2754.556) * [-2748.667] (-2751.310) (-2748.868) (-2752.514) -- 0:03:44
27000 -- (-2758.231) (-2755.564) (-2749.056) [-2750.687] * (-2750.148) (-2747.674) (-2750.347) [-2753.070] -- 0:03:36
28000 -- (-2750.473) [-2745.744] (-2749.448) (-2746.622) * (-2746.788) (-2749.272) [-2756.941] (-2751.030) -- 0:03:28
29000 -- (-2753.108) (-2751.067) (-2751.923) [-2749.926] * [-2748.267] (-2752.299) (-2752.167) (-2750.296) -- 0:03:20
30000 -- (-2753.827) (-2750.818) (-2754.637) [-2747.936] * (-2751.305) [-2749.781] (-2753.314) (-2749.459) -- 0:03:46
Average standard deviation of split frequencies: 0.015372
31000 -- (-2753.845) (-2752.738) (-2757.822) [-2743.299] * (-2749.043) (-2755.199) (-2752.743) [-2746.798] -- 0:03:38
32000 -- [-2752.122] (-2763.630) (-2746.690) (-2748.566) * (-2761.484) (-2751.323) [-2758.377] (-2753.063) -- 0:03:31
33000 -- [-2747.954] (-2752.186) (-2743.517) (-2753.164) * (-2753.101) (-2751.359) (-2756.409) [-2750.017] -- 0:03:25
34000 -- (-2749.621) (-2757.968) [-2749.673] (-2748.455) * [-2749.691] (-2752.520) (-2748.817) (-2751.483) -- 0:03:47
35000 -- (-2752.447) (-2746.128) (-2747.027) [-2752.839] * [-2746.566] (-2758.955) (-2748.506) (-2749.058) -- 0:03:40
Average standard deviation of split frequencies: 0.032736
36000 -- (-2751.651) (-2752.853) (-2747.071) [-2750.298] * (-2747.833) (-2752.641) (-2749.483) [-2752.360] -- 0:03:34
37000 -- (-2746.871) (-2747.554) (-2749.357) [-2746.904] * [-2747.961] (-2750.382) (-2758.932) (-2749.474) -- 0:03:28
38000 -- [-2749.200] (-2755.673) (-2752.051) (-2748.663) * (-2750.056) (-2745.894) (-2760.053) [-2750.310] -- 0:03:22
39000 -- [-2747.531] (-2752.540) (-2747.116) (-2755.259) * (-2747.936) (-2747.204) [-2749.990] (-2746.462) -- 0:03:41
40000 -- (-2745.556) (-2759.693) (-2745.666) [-2751.190] * (-2750.434) (-2749.657) [-2745.707] (-2752.110) -- 0:03:36
Average standard deviation of split frequencies: 0.028980
41000 -- [-2751.086] (-2752.554) (-2747.218) (-2750.594) * (-2754.734) (-2747.747) [-2744.451] (-2748.745) -- 0:03:30
42000 -- (-2752.551) [-2747.738] (-2747.612) (-2759.517) * (-2744.921) (-2747.356) [-2750.054] (-2746.134) -- 0:03:25
43000 -- (-2749.125) (-2752.879) (-2755.656) [-2749.312] * (-2748.614) (-2748.259) [-2752.225] (-2753.883) -- 0:03:42
44000 -- [-2754.813] (-2751.764) (-2749.537) (-2749.642) * (-2749.698) (-2746.119) [-2744.788] (-2755.983) -- 0:03:37
45000 -- (-2750.117) (-2746.859) [-2746.918] (-2749.615) * (-2749.110) [-2745.785] (-2749.193) (-2750.946) -- 0:03:32
Average standard deviation of split frequencies: 0.030744
46000 -- (-2750.363) [-2748.709] (-2753.195) (-2748.653) * (-2754.244) [-2748.012] (-2751.111) (-2756.166) -- 0:03:27
47000 -- (-2751.094) (-2753.499) (-2750.361) [-2744.591] * (-2748.464) (-2747.111) (-2752.235) [-2752.979] -- 0:03:22
48000 -- (-2745.422) (-2753.096) [-2747.164] (-2747.186) * (-2749.816) [-2745.822] (-2746.953) (-2752.883) -- 0:03:38
49000 -- (-2747.426) (-2751.541) (-2753.227) [-2752.356] * (-2751.019) [-2746.883] (-2746.996) (-2747.965) -- 0:03:33
50000 -- (-2744.901) [-2750.538] (-2748.389) (-2748.976) * [-2746.909] (-2753.047) (-2753.239) (-2747.806) -- 0:03:29
Average standard deviation of split frequencies: 0.018608
51000 -- (-2744.631) (-2750.745) [-2750.041] (-2752.109) * [-2749.282] (-2755.546) (-2748.289) (-2748.361) -- 0:03:24
52000 -- (-2750.347) [-2749.836] (-2748.364) (-2760.302) * (-2750.712) (-2757.614) [-2745.997] (-2751.472) -- 0:03:38
53000 -- (-2749.120) [-2746.224] (-2754.331) (-2751.449) * (-2747.974) (-2753.770) [-2752.648] (-2750.589) -- 0:03:34
54000 -- (-2748.518) (-2749.430) [-2746.302] (-2754.249) * (-2750.910) (-2748.035) [-2748.662] (-2747.555) -- 0:03:30
55000 -- (-2758.041) [-2754.121] (-2746.767) (-2747.787) * (-2748.672) (-2753.570) [-2754.376] (-2745.462) -- 0:03:26
Average standard deviation of split frequencies: 0.016836
56000 -- (-2753.406) [-2751.554] (-2754.552) (-2745.539) * [-2745.765] (-2750.029) (-2750.652) (-2751.254) -- 0:03:22
57000 -- (-2757.150) [-2751.444] (-2753.007) (-2747.978) * (-2747.637) (-2746.610) (-2747.836) [-2753.263] -- 0:03:35
58000 -- (-2751.865) [-2750.383] (-2750.164) (-2747.741) * (-2748.664) (-2749.013) (-2750.877) [-2746.210] -- 0:03:31
59000 -- (-2755.356) (-2746.509) (-2752.225) [-2747.055] * (-2754.102) [-2747.372] (-2754.552) (-2749.536) -- 0:03:27
60000 -- (-2754.334) [-2745.382] (-2751.710) (-2756.079) * (-2748.593) [-2745.372] (-2747.619) (-2748.966) -- 0:03:23
Average standard deviation of split frequencies: 0.038852
61000 -- [-2754.075] (-2749.877) (-2748.775) (-2747.354) * (-2750.618) [-2747.555] (-2752.775) (-2747.624) -- 0:03:20
62000 -- (-2758.578) (-2751.210) [-2753.546] (-2746.219) * (-2758.233) (-2747.423) [-2749.985] (-2750.752) -- 0:03:31
63000 -- (-2753.070) (-2749.829) (-2748.820) [-2749.154] * [-2751.529] (-2752.018) (-2747.461) (-2743.795) -- 0:03:28
64000 -- (-2756.425) [-2749.990] (-2750.041) (-2752.679) * (-2753.121) (-2746.137) (-2744.160) [-2747.821] -- 0:03:24
65000 -- (-2758.007) (-2749.113) [-2745.727] (-2747.826) * (-2751.027) (-2749.245) [-2751.335] (-2756.752) -- 0:03:21
Average standard deviation of split frequencies: 0.032141
66000 -- (-2751.558) [-2746.006] (-2744.663) (-2749.004) * (-2752.577) [-2746.601] (-2752.086) (-2750.329) -- 0:03:32
67000 -- (-2755.341) [-2744.093] (-2746.826) (-2758.325) * (-2750.073) [-2753.777] (-2751.981) (-2751.404) -- 0:03:28
68000 -- (-2756.559) (-2746.640) [-2748.508] (-2753.641) * (-2747.027) [-2747.814] (-2755.881) (-2749.384) -- 0:03:25
69000 -- (-2748.312) [-2745.345] (-2748.564) (-2751.878) * (-2748.196) [-2750.079] (-2746.040) (-2750.187) -- 0:03:22
70000 -- (-2748.957) [-2750.983] (-2752.536) (-2757.179) * (-2749.434) (-2748.655) [-2746.243] (-2746.425) -- 0:03:19
Average standard deviation of split frequencies: 0.026683
71000 -- (-2745.647) (-2748.908) [-2748.753] (-2750.390) * (-2747.416) [-2750.517] (-2744.788) (-2745.542) -- 0:03:29
72000 -- (-2750.003) (-2751.936) [-2753.182] (-2752.363) * (-2745.711) (-2754.306) (-2754.298) [-2748.588] -- 0:03:26
73000 -- [-2747.066] (-2753.223) (-2749.138) (-2752.877) * [-2746.977] (-2747.080) (-2746.758) (-2744.060) -- 0:03:23
74000 -- [-2753.960] (-2756.003) (-2751.845) (-2754.705) * (-2751.474) (-2750.943) [-2750.415] (-2747.068) -- 0:03:20
75000 -- (-2753.607) (-2747.296) (-2749.253) [-2755.958] * [-2748.371] (-2750.776) (-2751.975) (-2751.051) -- 0:03:29
Average standard deviation of split frequencies: 0.003101
76000 -- [-2753.662] (-2750.823) (-2748.695) (-2751.681) * (-2756.044) (-2756.539) [-2750.131] (-2753.904) -- 0:03:26
77000 -- [-2747.325] (-2750.534) (-2749.964) (-2751.336) * (-2746.294) [-2749.463] (-2754.848) (-2759.248) -- 0:03:23
78000 -- [-2747.735] (-2755.164) (-2752.246) (-2754.088) * (-2745.247) (-2750.079) (-2747.924) [-2746.088] -- 0:03:20
79000 -- (-2748.529) (-2754.185) [-2745.566] (-2750.379) * (-2749.260) (-2747.462) [-2755.198] (-2747.486) -- 0:03:18
80000 -- (-2749.316) (-2752.821) (-2748.690) [-2746.227] * (-2749.960) (-2751.895) [-2747.393] (-2753.394) -- 0:03:27
Average standard deviation of split frequencies: 0.020454
81000 -- (-2754.650) (-2755.060) [-2751.825] (-2756.513) * (-2752.823) (-2749.642) (-2753.676) [-2750.581] -- 0:03:24
82000 -- [-2746.006] (-2753.050) (-2757.259) (-2750.030) * (-2749.990) (-2750.603) [-2745.735] (-2746.354) -- 0:03:21
83000 -- (-2749.361) (-2756.201) [-2754.460] (-2751.363) * (-2749.272) [-2749.601] (-2750.506) (-2752.360) -- 0:03:18
84000 -- (-2750.333) [-2748.946] (-2752.574) (-2752.245) * (-2746.862) (-2757.343) (-2744.943) [-2744.721] -- 0:03:27
85000 -- (-2747.344) (-2750.418) [-2746.057] (-2751.626) * (-2748.440) (-2751.076) [-2746.912] (-2748.687) -- 0:03:24
Average standard deviation of split frequencies: 0.010963
86000 -- (-2749.472) (-2752.236) [-2750.780] (-2751.140) * (-2746.490) (-2748.679) (-2753.859) [-2746.399] -- 0:03:21
87000 -- (-2753.539) (-2747.878) (-2747.485) [-2753.455] * (-2750.064) (-2754.124) [-2753.572] (-2751.356) -- 0:03:19
88000 -- [-2747.958] (-2752.718) (-2753.607) (-2754.136) * [-2751.977] (-2747.017) (-2750.106) (-2748.746) -- 0:03:16
89000 -- [-2751.979] (-2749.497) (-2749.986) (-2755.216) * (-2753.886) [-2750.314] (-2754.981) (-2746.845) -- 0:03:24
90000 -- [-2750.131] (-2748.772) (-2748.016) (-2746.297) * [-2751.073] (-2752.105) (-2749.973) (-2750.767) -- 0:03:22
Average standard deviation of split frequencies: 0.005199
91000 -- [-2749.482] (-2755.206) (-2753.671) (-2745.523) * (-2747.847) (-2750.230) [-2745.980] (-2749.869) -- 0:03:19
92000 -- (-2753.031) (-2756.379) [-2747.846] (-2750.711) * (-2750.740) (-2749.429) (-2749.183) [-2749.679] -- 0:03:17
93000 -- [-2747.167] (-2762.223) (-2748.819) (-2752.746) * (-2751.008) (-2752.738) [-2750.525] (-2755.870) -- 0:03:24
94000 -- [-2747.546] (-2751.744) (-2755.957) (-2755.305) * [-2749.902] (-2750.016) (-2747.363) (-2750.754) -- 0:03:22
95000 -- (-2750.421) (-2753.811) [-2749.289] (-2751.291) * [-2748.177] (-2752.127) (-2747.600) (-2748.670) -- 0:03:20
Average standard deviation of split frequencies: 0.007366
96000 -- (-2752.863) (-2751.262) (-2746.959) [-2748.084] * (-2749.355) (-2749.296) (-2750.335) [-2747.506] -- 0:03:17
97000 -- (-2749.775) [-2745.786] (-2747.448) (-2745.250) * [-2747.270] (-2749.044) (-2753.557) (-2751.183) -- 0:03:15
98000 -- (-2753.887) (-2748.053) [-2749.627] (-2752.928) * (-2749.226) [-2747.430] (-2753.318) (-2750.057) -- 0:03:22
99000 -- (-2748.099) (-2749.952) [-2748.979] (-2755.894) * [-2749.889] (-2744.843) (-2752.397) (-2748.851) -- 0:03:20
100000 -- [-2745.437] (-2747.672) (-2748.199) (-2756.257) * (-2751.812) (-2749.869) [-2747.554] (-2752.026) -- 0:03:18
Average standard deviation of split frequencies: 0.014048
101000 -- (-2749.880) (-2750.319) (-2747.484) [-2749.774] * (-2751.786) (-2749.066) (-2748.746) [-2748.669] -- 0:03:15
102000 -- (-2758.963) [-2750.550] (-2747.761) (-2748.924) * (-2751.807) [-2746.978] (-2749.422) (-2749.934) -- 0:03:22
103000 -- (-2750.859) [-2752.088] (-2755.275) (-2747.021) * (-2752.617) (-2748.498) [-2749.472] (-2749.379) -- 0:03:20
104000 -- [-2750.741] (-2747.023) (-2749.500) (-2748.725) * (-2752.408) (-2749.787) (-2750.846) [-2746.303] -- 0:03:18
105000 -- [-2750.090] (-2749.128) (-2754.337) (-2750.669) * (-2746.677) (-2752.240) [-2753.845] (-2745.186) -- 0:03:16
Average standard deviation of split frequencies: 0.008894
106000 -- (-2751.883) (-2750.473) (-2753.136) [-2748.944] * (-2750.046) (-2751.132) [-2757.626] (-2747.330) -- 0:03:13
107000 -- [-2746.675] (-2750.027) (-2752.024) (-2751.299) * (-2747.792) (-2748.984) [-2747.907] (-2758.152) -- 0:03:20
108000 -- [-2749.574] (-2750.041) (-2753.213) (-2753.067) * [-2747.678] (-2746.974) (-2753.638) (-2753.435) -- 0:03:18
109000 -- (-2753.265) (-2750.308) (-2753.353) [-2755.790] * (-2750.055) (-2749.000) [-2753.921] (-2755.263) -- 0:03:16
110000 -- (-2755.360) (-2751.959) (-2754.752) [-2745.756] * [-2751.353] (-2748.391) (-2752.966) (-2758.398) -- 0:03:14
Average standard deviation of split frequencies: 0.012779
111000 -- (-2755.478) (-2756.533) (-2752.934) [-2749.617] * (-2747.958) (-2749.113) [-2749.719] (-2752.732) -- 0:03:20
112000 -- [-2750.988] (-2753.097) (-2750.649) (-2750.256) * [-2744.866] (-2749.928) (-2751.188) (-2753.450) -- 0:03:18
113000 -- (-2746.474) [-2752.762] (-2746.225) (-2754.457) * [-2748.974] (-2750.995) (-2750.801) (-2751.615) -- 0:03:16
114000 -- [-2748.302] (-2747.745) (-2744.300) (-2747.426) * [-2747.070] (-2750.419) (-2748.673) (-2751.429) -- 0:03:14
115000 -- (-2749.654) (-2748.644) (-2761.534) [-2752.343] * (-2749.888) (-2756.195) (-2747.371) [-2755.912] -- 0:03:12
Average standard deviation of split frequencies: 0.018287
116000 -- (-2745.366) [-2750.493] (-2756.231) (-2751.605) * (-2753.947) (-2750.997) [-2747.848] (-2745.504) -- 0:03:18
117000 -- [-2747.537] (-2744.987) (-2749.558) (-2750.441) * (-2752.732) (-2756.331) (-2747.042) [-2744.566] -- 0:03:16
118000 -- (-2747.090) (-2747.449) (-2753.987) [-2753.925] * (-2751.493) [-2754.657] (-2748.132) (-2752.654) -- 0:03:14
119000 -- (-2747.904) [-2745.912] (-2745.711) (-2756.502) * [-2748.265] (-2748.721) (-2746.480) (-2748.542) -- 0:03:12
120000 -- [-2749.034] (-2748.970) (-2747.202) (-2749.282) * [-2749.349] (-2757.756) (-2746.884) (-2744.304) -- 0:03:18
Average standard deviation of split frequencies: 0.039067
121000 -- (-2748.408) (-2757.686) [-2749.530] (-2750.839) * (-2749.617) (-2755.135) [-2744.494] (-2750.559) -- 0:03:16
122000 -- (-2748.569) [-2748.515] (-2755.743) (-2754.329) * (-2747.641) (-2759.122) [-2749.804] (-2744.792) -- 0:03:14
123000 -- (-2742.824) (-2749.435) (-2746.288) [-2745.540] * (-2746.627) (-2752.533) (-2746.511) [-2752.514] -- 0:03:12
124000 -- (-2749.802) (-2746.642) (-2751.782) [-2751.444] * (-2755.086) (-2748.891) (-2744.710) [-2751.357] -- 0:03:10
125000 -- (-2747.986) [-2746.578] (-2752.775) (-2751.060) * (-2750.712) (-2758.190) [-2745.848] (-2750.391) -- 0:03:16
Average standard deviation of split frequencies: 0.037413
126000 -- [-2760.227] (-2744.538) (-2749.186) (-2750.221) * (-2753.150) [-2754.933] (-2743.574) (-2749.838) -- 0:03:14
127000 -- (-2752.915) [-2745.081] (-2756.911) (-2750.154) * (-2747.774) (-2747.042) [-2749.467] (-2751.989) -- 0:03:12
128000 -- (-2747.505) (-2750.163) (-2745.970) [-2751.052] * (-2749.533) [-2748.713] (-2744.833) (-2746.843) -- 0:03:10
129000 -- (-2753.470) (-2743.685) [-2752.038] (-2745.626) * (-2745.502) (-2747.674) [-2743.945] (-2752.681) -- 0:03:15
130000 -- (-2750.177) [-2750.048] (-2747.579) (-2748.296) * [-2749.592] (-2748.815) (-2742.001) (-2751.215) -- 0:03:14
Average standard deviation of split frequencies: 0.048704
131000 -- (-2756.071) (-2747.235) [-2750.477] (-2750.850) * [-2750.761] (-2746.145) (-2755.357) (-2749.651) -- 0:03:12
132000 -- [-2743.745] (-2748.176) (-2746.210) (-2748.515) * (-2748.098) (-2749.746) (-2751.824) [-2752.814] -- 0:03:10
133000 -- [-2749.548] (-2746.451) (-2751.160) (-2750.555) * (-2752.920) (-2753.709) (-2748.444) [-2749.089] -- 0:03:09
134000 -- (-2752.587) [-2741.165] (-2758.207) (-2752.527) * [-2750.551] (-2748.702) (-2744.942) (-2756.196) -- 0:03:13
135000 -- (-2752.906) (-2748.274) (-2747.504) [-2746.111] * (-2748.403) [-2744.869] (-2748.935) (-2760.258) -- 0:03:12
Average standard deviation of split frequencies: 0.045061
136000 -- (-2746.518) (-2753.409) [-2745.501] (-2753.871) * (-2749.919) [-2746.180] (-2747.914) (-2761.488) -- 0:03:10
137000 -- (-2746.481) (-2749.344) [-2743.783] (-2747.798) * [-2746.350] (-2747.346) (-2754.157) (-2758.696) -- 0:03:08
138000 -- (-2749.014) (-2747.347) [-2750.202] (-2750.435) * (-2747.163) [-2748.559] (-2744.568) (-2759.142) -- 0:03:07
139000 -- (-2761.809) [-2754.056] (-2746.963) (-2756.139) * [-2751.453] (-2746.601) (-2760.031) (-2759.546) -- 0:03:12
140000 -- (-2757.119) (-2751.480) (-2747.479) [-2751.303] * [-2749.724] (-2750.612) (-2752.757) (-2748.833) -- 0:03:10
Average standard deviation of split frequencies: 0.045241
141000 -- (-2752.681) (-2748.905) [-2748.673] (-2756.370) * [-2748.585] (-2747.141) (-2753.826) (-2749.663) -- 0:03:08
142000 -- (-2749.159) (-2748.764) [-2748.089] (-2754.225) * (-2752.983) (-2752.838) (-2749.716) [-2748.789] -- 0:03:07
143000 -- [-2748.953] (-2752.883) (-2746.095) (-2753.257) * (-2756.589) (-2746.305) (-2750.125) [-2744.746] -- 0:03:11
144000 -- (-2746.948) (-2747.204) [-2744.918] (-2755.765) * [-2749.307] (-2745.354) (-2746.899) (-2755.044) -- 0:03:10
145000 -- (-2750.326) (-2752.256) [-2750.053] (-2746.344) * [-2748.602] (-2745.342) (-2746.172) (-2749.207) -- 0:03:08
Average standard deviation of split frequencies: 0.033902
146000 -- (-2747.175) (-2747.920) [-2750.235] (-2748.017) * (-2752.929) [-2746.281] (-2755.497) (-2752.392) -- 0:03:07
147000 -- (-2756.251) (-2755.096) (-2752.668) [-2751.170] * (-2746.643) (-2752.714) [-2748.539] (-2749.937) -- 0:03:05
148000 -- (-2746.985) [-2748.116] (-2750.765) (-2747.023) * (-2748.197) (-2749.451) [-2751.300] (-2754.668) -- 0:03:09
149000 -- (-2749.450) [-2748.391] (-2753.623) (-2751.269) * (-2753.873) [-2744.771] (-2749.057) (-2751.558) -- 0:03:08
150000 -- (-2748.824) (-2754.109) (-2746.642) [-2749.202] * [-2748.101] (-2746.935) (-2752.208) (-2750.849) -- 0:03:07
Average standard deviation of split frequencies: 0.029724
151000 -- (-2750.098) [-2747.202] (-2745.838) (-2745.017) * [-2742.626] (-2749.495) (-2756.472) (-2746.564) -- 0:03:05
152000 -- [-2748.657] (-2744.467) (-2753.339) (-2749.876) * (-2754.021) (-2752.767) (-2755.310) [-2751.515] -- 0:03:09
153000 -- [-2749.804] (-2752.571) (-2755.341) (-2752.732) * (-2747.591) [-2749.325] (-2750.512) (-2755.915) -- 0:03:08
154000 -- (-2749.932) [-2749.664] (-2749.835) (-2747.828) * (-2749.554) (-2747.546) (-2754.895) [-2750.181] -- 0:03:06
155000 -- (-2747.709) [-2749.732] (-2758.245) (-2753.947) * (-2750.065) [-2748.611] (-2751.734) (-2751.596) -- 0:03:05
Average standard deviation of split frequencies: 0.025686
156000 -- (-2746.829) [-2748.929] (-2751.839) (-2746.049) * (-2743.460) (-2747.553) [-2745.316] (-2752.149) -- 0:03:03
157000 -- (-2747.442) [-2752.094] (-2748.925) (-2749.459) * (-2750.654) (-2743.928) (-2746.207) [-2749.304] -- 0:03:07
158000 -- [-2752.590] (-2748.608) (-2750.819) (-2759.393) * [-2750.377] (-2749.132) (-2745.609) (-2747.270) -- 0:03:06
159000 -- [-2751.447] (-2756.572) (-2746.824) (-2751.820) * (-2761.178) [-2747.862] (-2746.390) (-2749.949) -- 0:03:05
160000 -- [-2746.139] (-2753.888) (-2752.395) (-2753.690) * [-2749.441] (-2752.797) (-2745.138) (-2751.253) -- 0:03:03
Average standard deviation of split frequencies: 0.019071
161000 -- [-2747.886] (-2749.800) (-2750.272) (-2753.634) * (-2750.669) (-2752.827) (-2749.708) [-2750.216] -- 0:03:07
162000 -- (-2753.678) [-2749.347] (-2746.131) (-2747.005) * [-2748.560] (-2749.695) (-2747.250) (-2749.621) -- 0:03:06
163000 -- [-2751.240] (-2754.371) (-2747.492) (-2750.387) * (-2744.856) (-2745.110) (-2753.135) [-2745.041] -- 0:03:04
164000 -- (-2747.612) [-2746.752] (-2751.714) (-2750.746) * [-2748.305] (-2746.190) (-2744.818) (-2752.082) -- 0:03:03
165000 -- (-2748.641) (-2754.398) [-2749.651] (-2744.565) * [-2751.200] (-2754.700) (-2744.238) (-2758.499) -- 0:03:02
Average standard deviation of split frequencies: 0.011359
166000 -- (-2753.950) (-2751.847) (-2748.596) [-2750.335] * [-2753.486] (-2749.857) (-2748.431) (-2748.620) -- 0:03:05
167000 -- (-2753.422) [-2753.067] (-2747.058) (-2749.225) * (-2749.017) [-2752.845] (-2749.484) (-2751.944) -- 0:03:04
168000 -- (-2753.089) [-2747.265] (-2748.588) (-2750.451) * (-2745.634) [-2750.213] (-2749.960) (-2751.814) -- 0:03:03
169000 -- (-2752.444) (-2747.571) [-2746.318] (-2752.579) * (-2748.989) (-2752.931) [-2747.858] (-2751.253) -- 0:03:01
170000 -- (-2750.590) (-2749.914) [-2745.401] (-2754.313) * (-2752.142) (-2754.546) (-2753.589) [-2749.243] -- 0:03:05
Average standard deviation of split frequencies: 0.012430
171000 -- (-2746.836) [-2745.151] (-2743.826) (-2753.978) * (-2756.588) [-2749.678] (-2747.606) (-2753.675) -- 0:03:04
172000 -- (-2747.076) [-2754.206] (-2749.646) (-2754.237) * [-2752.886] (-2748.607) (-2754.006) (-2745.737) -- 0:03:02
173000 -- [-2748.338] (-2747.861) (-2750.341) (-2746.757) * (-2753.741) (-2747.065) [-2749.119] (-2750.038) -- 0:03:01
174000 -- (-2751.323) (-2747.867) (-2752.695) [-2748.549] * (-2759.086) (-2751.784) [-2752.024] (-2751.651) -- 0:03:00
175000 -- (-2750.522) (-2748.340) [-2743.125] (-2753.880) * (-2758.020) [-2749.339] (-2750.171) (-2748.570) -- 0:03:03
Average standard deviation of split frequencies: 0.010714
176000 -- (-2746.212) [-2743.047] (-2754.264) (-2752.008) * (-2753.314) (-2756.572) [-2752.151] (-2745.419) -- 0:03:02
177000 -- (-2748.647) (-2750.354) [-2747.185] (-2749.596) * (-2756.551) [-2749.834] (-2748.184) (-2752.721) -- 0:03:01
178000 -- (-2749.474) [-2744.656] (-2748.319) (-2749.772) * (-2748.958) (-2747.202) (-2750.499) [-2749.983] -- 0:03:00
179000 -- [-2743.976] (-2747.301) (-2749.444) (-2745.906) * (-2750.857) [-2749.704] (-2750.014) (-2750.812) -- 0:03:03
180000 -- [-2747.682] (-2747.724) (-2750.609) (-2747.300) * (-2749.497) (-2753.356) (-2755.131) [-2751.273] -- 0:03:02
Average standard deviation of split frequencies: 0.014351
181000 -- [-2753.980] (-2750.957) (-2747.641) (-2749.502) * [-2749.453] (-2754.713) (-2750.377) (-2749.989) -- 0:03:00
182000 -- (-2750.002) (-2747.542) (-2746.678) [-2751.217] * (-2748.067) [-2747.612] (-2749.053) (-2746.632) -- 0:02:59
183000 -- (-2748.446) [-2750.289] (-2750.177) (-2747.685) * [-2745.665] (-2751.685) (-2752.365) (-2753.112) -- 0:02:58
184000 -- (-2753.278) (-2749.914) [-2750.250] (-2752.690) * (-2752.169) (-2750.450) (-2759.413) [-2749.396] -- 0:03:01
185000 -- (-2753.186) (-2746.311) (-2748.951) [-2750.361] * (-2745.653) [-2748.770] (-2744.643) (-2749.077) -- 0:03:00
Average standard deviation of split frequencies: 0.015207
186000 -- (-2751.477) (-2749.538) [-2748.271] (-2748.865) * (-2746.179) [-2751.204] (-2746.102) (-2747.371) -- 0:02:59
187000 -- [-2751.261] (-2749.770) (-2752.109) (-2762.724) * (-2753.281) (-2750.998) (-2747.457) [-2747.490] -- 0:02:58
188000 -- (-2750.097) (-2751.209) (-2748.049) [-2746.966] * (-2758.977) [-2749.794] (-2744.636) (-2751.642) -- 0:02:57
189000 -- (-2753.881) (-2748.966) (-2754.369) [-2745.478] * (-2749.478) (-2745.595) (-2745.244) [-2751.228] -- 0:03:00
190000 -- [-2752.503] (-2747.517) (-2745.160) (-2751.644) * (-2753.773) (-2745.575) (-2749.245) [-2754.058] -- 0:02:59
Average standard deviation of split frequencies: 0.016071
191000 -- [-2751.094] (-2748.169) (-2750.755) (-2750.849) * (-2751.207) [-2751.931] (-2765.500) (-2749.234) -- 0:02:57
192000 -- [-2748.181] (-2748.539) (-2755.878) (-2754.743) * (-2751.203) [-2746.610] (-2754.711) (-2751.665) -- 0:02:56
193000 -- (-2752.664) [-2750.616] (-2752.100) (-2752.457) * [-2754.187] (-2755.256) (-2748.932) (-2753.653) -- 0:02:59
194000 -- (-2748.245) [-2749.441] (-2747.708) (-2753.354) * (-2749.188) (-2747.819) (-2746.488) [-2746.952] -- 0:02:58
195000 -- (-2742.849) (-2745.436) (-2748.589) [-2752.000] * (-2745.795) [-2751.916] (-2748.881) (-2747.466) -- 0:02:57
Average standard deviation of split frequencies: 0.010823
196000 -- (-2752.169) [-2745.811] (-2753.198) (-2747.906) * (-2749.026) [-2746.207] (-2747.572) (-2752.446) -- 0:02:56
197000 -- (-2748.076) (-2746.880) (-2751.176) [-2750.072] * (-2750.217) (-2746.433) [-2747.205] (-2747.064) -- 0:02:55
198000 -- (-2748.288) [-2754.311] (-2748.399) (-2754.452) * (-2752.381) (-2750.130) (-2748.785) [-2751.635] -- 0:02:58
199000 -- (-2749.194) (-2747.739) [-2744.793] (-2752.000) * (-2757.400) (-2750.017) (-2755.613) [-2752.165] -- 0:02:57
200000 -- (-2750.395) [-2746.615] (-2752.284) (-2749.494) * (-2750.752) (-2745.223) [-2745.431] (-2754.418) -- 0:02:56
Average standard deviation of split frequencies: 0.003524
201000 -- [-2747.010] (-2745.482) (-2750.443) (-2747.890) * (-2746.050) (-2755.238) [-2748.087] (-2751.824) -- 0:02:54
202000 -- (-2751.081) (-2755.043) (-2753.269) [-2749.692] * (-2755.574) [-2750.397] (-2743.602) (-2751.610) -- 0:02:57
203000 -- [-2750.671] (-2773.649) (-2747.592) (-2744.988) * (-2757.135) (-2750.065) [-2749.164] (-2756.162) -- 0:02:56
204000 -- [-2751.695] (-2751.053) (-2744.294) (-2752.544) * (-2758.684) (-2745.169) [-2748.301] (-2755.382) -- 0:02:55
205000 -- (-2749.962) [-2750.542] (-2748.401) (-2753.466) * (-2751.103) (-2751.833) [-2748.148] (-2759.231) -- 0:02:54
Average standard deviation of split frequencies: 0.004577
206000 -- (-2749.419) (-2745.650) [-2748.028] (-2746.138) * (-2749.340) [-2750.543] (-2747.591) (-2751.545) -- 0:02:53
207000 -- (-2748.661) [-2749.809] (-2750.995) (-2758.879) * [-2747.198] (-2749.528) (-2752.378) (-2755.165) -- 0:02:56
208000 -- [-2746.218] (-2751.228) (-2754.746) (-2750.382) * [-2750.553] (-2754.408) (-2750.164) (-2754.174) -- 0:02:55
209000 -- (-2742.996) (-2750.706) [-2748.587] (-2753.973) * (-2749.210) (-2743.233) [-2753.187] (-2746.618) -- 0:02:54
210000 -- (-2747.018) [-2757.861] (-2748.698) (-2751.112) * (-2747.667) (-2746.615) [-2748.408] (-2750.849) -- 0:02:53
Average standard deviation of split frequencies: 0.002238
211000 -- (-2748.501) (-2752.867) (-2755.485) [-2749.553] * (-2747.320) [-2747.794] (-2755.524) (-2745.790) -- 0:02:55
212000 -- (-2746.711) [-2749.903] (-2755.938) (-2751.939) * (-2744.819) [-2748.443] (-2748.706) (-2749.148) -- 0:02:54
213000 -- (-2749.163) (-2745.303) [-2746.879] (-2753.541) * [-2761.872] (-2749.437) (-2750.176) (-2749.201) -- 0:02:53
214000 -- (-2746.035) (-2754.126) [-2750.032] (-2749.505) * (-2747.742) [-2749.355] (-2753.311) (-2749.760) -- 0:02:52
215000 -- (-2753.621) (-2743.755) (-2746.372) [-2746.627] * (-2747.101) [-2752.636] (-2746.046) (-2750.511) -- 0:02:51
Average standard deviation of split frequencies: 0.006547
216000 -- (-2752.804) [-2750.532] (-2752.855) (-2748.421) * (-2749.273) (-2755.309) [-2752.975] (-2755.260) -- 0:02:54
217000 -- (-2763.240) (-2752.409) (-2747.494) [-2747.613] * (-2744.883) (-2749.193) (-2754.948) [-2745.847] -- 0:02:53
218000 -- (-2749.366) [-2745.488] (-2750.232) (-2751.190) * [-2749.899] (-2744.380) (-2752.048) (-2755.230) -- 0:02:52
219000 -- (-2746.599) [-2745.266] (-2750.863) (-2750.102) * (-2752.992) [-2748.744] (-2749.931) (-2755.595) -- 0:02:51
220000 -- (-2752.497) (-2750.781) (-2749.831) [-2748.725] * (-2750.523) (-2751.431) (-2747.942) [-2748.290] -- 0:02:53
Average standard deviation of split frequencies: 0.010681
221000 -- [-2746.603] (-2745.762) (-2749.122) (-2746.955) * (-2748.200) (-2760.441) [-2746.662] (-2748.191) -- 0:02:52
222000 -- [-2744.310] (-2750.000) (-2745.443) (-2757.324) * [-2747.765] (-2752.598) (-2746.818) (-2749.074) -- 0:02:51
223000 -- [-2747.813] (-2752.094) (-2747.895) (-2745.368) * (-2746.865) (-2748.911) [-2749.474] (-2756.688) -- 0:02:50
224000 -- [-2748.994] (-2746.347) (-2749.072) (-2750.634) * [-2756.548] (-2751.183) (-2750.310) (-2761.938) -- 0:02:49
225000 -- (-2751.187) (-2749.143) (-2751.333) [-2751.637] * [-2754.385] (-2747.085) (-2754.733) (-2763.244) -- 0:02:52
Average standard deviation of split frequencies: 0.008343
226000 -- (-2747.347) [-2754.250] (-2754.135) (-2748.231) * (-2751.503) [-2751.441] (-2750.890) (-2761.220) -- 0:02:51
227000 -- (-2746.748) [-2748.734] (-2750.388) (-2751.332) * (-2755.354) [-2747.215] (-2748.038) (-2758.748) -- 0:02:50
228000 -- (-2745.399) (-2751.346) (-2752.810) [-2746.757] * (-2748.224) (-2753.057) (-2754.148) [-2752.922] -- 0:02:49
229000 -- (-2747.487) [-2745.172] (-2753.574) (-2745.924) * (-2754.862) (-2750.938) (-2752.959) [-2750.923] -- 0:02:48
230000 -- [-2749.563] (-2746.667) (-2744.378) (-2751.335) * (-2752.018) (-2743.847) [-2748.084] (-2749.445) -- 0:02:50
Average standard deviation of split frequencies: 0.011240
231000 -- (-2749.902) (-2747.793) (-2755.963) [-2750.065] * (-2755.015) (-2750.204) (-2749.220) [-2758.778] -- 0:02:49
232000 -- [-2750.255] (-2746.310) (-2751.564) (-2749.988) * [-2752.007] (-2748.696) (-2748.078) (-2749.818) -- 0:02:48
233000 -- (-2748.767) [-2747.750] (-2751.101) (-2748.963) * (-2748.482) (-2751.072) [-2746.818] (-2758.410) -- 0:02:47
234000 -- [-2745.624] (-2751.077) (-2749.874) (-2751.526) * (-2749.283) (-2746.219) (-2749.134) [-2753.144] -- 0:02:50
235000 -- [-2750.877] (-2750.369) (-2748.330) (-2745.994) * (-2744.089) [-2753.357] (-2751.817) (-2757.035) -- 0:02:49
Average standard deviation of split frequencies: 0.015980
236000 -- (-2749.554) (-2745.156) (-2748.424) [-2748.318] * (-2745.450) (-2751.102) [-2752.118] (-2745.157) -- 0:02:48
237000 -- (-2750.836) (-2757.289) [-2746.455] (-2745.978) * (-2751.763) (-2751.187) (-2751.130) [-2750.450] -- 0:02:47
238000 -- (-2746.768) (-2750.119) (-2748.295) [-2752.530] * (-2749.075) (-2747.350) (-2755.958) [-2743.060] -- 0:02:46
239000 -- [-2751.467] (-2757.617) (-2746.895) (-2754.246) * (-2750.558) [-2750.044] (-2748.070) (-2750.872) -- 0:02:48
240000 -- (-2746.054) (-2749.185) [-2748.084] (-2751.619) * [-2749.048] (-2747.388) (-2753.604) (-2749.024) -- 0:02:47
Average standard deviation of split frequencies: 0.005876
241000 -- (-2747.238) (-2746.789) [-2750.748] (-2756.770) * (-2750.974) (-2755.062) [-2760.830] (-2749.076) -- 0:02:46
242000 -- (-2746.079) (-2744.619) [-2749.731] (-2746.384) * (-2748.357) (-2755.720) (-2757.848) [-2749.455] -- 0:02:46
243000 -- (-2753.977) (-2751.925) (-2751.644) [-2749.887] * [-2751.207] (-2751.661) (-2752.731) (-2751.395) -- 0:02:48
244000 -- (-2752.523) [-2749.002] (-2749.909) (-2752.901) * [-2750.731] (-2752.690) (-2747.703) (-2753.534) -- 0:02:47
245000 -- (-2752.827) [-2747.999] (-2746.735) (-2747.278) * [-2746.319] (-2750.337) (-2748.977) (-2744.858) -- 0:02:46
Average standard deviation of split frequencies: 0.001916
246000 -- (-2756.360) (-2749.420) [-2749.665] (-2753.205) * [-2749.752] (-2754.339) (-2754.349) (-2753.368) -- 0:02:45
247000 -- (-2750.262) (-2748.250) [-2748.330] (-2750.393) * [-2748.482] (-2750.793) (-2747.985) (-2755.124) -- 0:02:44
248000 -- (-2752.484) (-2752.909) [-2748.845] (-2749.908) * (-2753.426) (-2749.883) (-2753.375) [-2748.822] -- 0:02:46
249000 -- (-2747.049) [-2757.443] (-2749.988) (-2744.049) * [-2755.709] (-2748.151) (-2750.033) (-2752.734) -- 0:02:45
250000 -- [-2746.311] (-2757.347) (-2750.273) (-2751.557) * (-2744.133) (-2751.568) (-2750.644) [-2747.862] -- 0:02:45
Average standard deviation of split frequencies: 0.007522
251000 -- (-2745.189) (-2755.506) [-2749.773] (-2748.044) * (-2749.836) (-2751.326) [-2756.806] (-2749.252) -- 0:02:44
252000 -- (-2755.149) (-2746.609) [-2750.130] (-2745.643) * (-2750.623) (-2749.392) [-2748.596] (-2746.562) -- 0:02:43
253000 -- (-2756.148) [-2748.680] (-2754.281) (-2746.671) * (-2749.865) [-2744.389] (-2750.706) (-2752.900) -- 0:02:45
254000 -- (-2755.529) [-2747.366] (-2755.532) (-2746.534) * (-2753.798) (-2750.917) (-2747.894) [-2749.024] -- 0:02:44
255000 -- (-2755.253) (-2747.997) (-2756.410) [-2749.414] * (-2748.986) (-2756.945) (-2760.659) [-2744.545] -- 0:02:43
Average standard deviation of split frequencies: 0.003683
256000 -- (-2759.069) (-2747.294) (-2755.240) [-2745.583] * [-2754.625] (-2748.644) (-2747.717) (-2744.522) -- 0:02:42
257000 -- [-2753.869] (-2747.862) (-2760.441) (-2743.177) * (-2755.438) (-2749.664) [-2753.068] (-2746.649) -- 0:02:44
258000 -- (-2747.578) [-2747.850] (-2755.933) (-2748.909) * (-2751.291) [-2755.559] (-2752.984) (-2750.802) -- 0:02:43
259000 -- (-2754.797) (-2749.855) (-2754.558) [-2749.722] * (-2750.789) (-2748.678) (-2750.923) [-2752.929] -- 0:02:43
260000 -- [-2749.945] (-2750.973) (-2753.896) (-2750.454) * (-2751.881) [-2745.748] (-2757.784) (-2746.266) -- 0:02:42
Average standard deviation of split frequencies: 0.002713
261000 -- (-2743.132) [-2749.168] (-2754.483) (-2751.961) * (-2754.645) (-2751.341) (-2749.447) [-2750.150] -- 0:02:41
262000 -- [-2746.742] (-2749.645) (-2752.890) (-2748.033) * (-2759.032) (-2746.882) [-2746.359] (-2750.736) -- 0:02:43
263000 -- [-2743.533] (-2752.825) (-2758.768) (-2749.510) * (-2753.897) [-2744.541] (-2754.625) (-2747.746) -- 0:02:42
264000 -- (-2744.312) [-2753.285] (-2748.790) (-2750.311) * (-2754.057) (-2749.801) (-2749.931) [-2751.592] -- 0:02:41
265000 -- (-2753.128) (-2751.717) [-2747.079] (-2747.175) * (-2751.081) [-2754.476] (-2749.059) (-2752.419) -- 0:02:40
Average standard deviation of split frequencies: 0.002658
266000 -- [-2750.341] (-2759.417) (-2750.702) (-2756.908) * (-2751.711) [-2751.604] (-2745.290) (-2746.614) -- 0:02:42
267000 -- [-2748.345] (-2753.477) (-2749.399) (-2744.067) * [-2745.088] (-2747.092) (-2751.246) (-2744.103) -- 0:02:41
268000 -- [-2749.004] (-2750.226) (-2745.555) (-2747.099) * (-2747.081) (-2749.232) (-2749.753) [-2748.291] -- 0:02:41
269000 -- (-2757.456) [-2749.042] (-2749.955) (-2752.034) * [-2743.031] (-2754.933) (-2748.879) (-2754.452) -- 0:02:40
270000 -- (-2755.646) [-2747.810] (-2753.934) (-2748.400) * (-2748.457) [-2750.849] (-2751.590) (-2755.536) -- 0:02:39
Average standard deviation of split frequencies: 0.006096
271000 -- (-2750.267) (-2746.587) (-2747.646) [-2747.133] * (-2756.839) (-2749.679) (-2750.338) [-2749.924] -- 0:02:41
272000 -- [-2752.640] (-2750.078) (-2750.764) (-2749.689) * [-2750.114] (-2748.809) (-2750.680) (-2747.705) -- 0:02:40
273000 -- [-2748.108] (-2754.524) (-2761.064) (-2749.713) * (-2749.845) (-2745.983) (-2752.352) [-2755.541] -- 0:02:39
274000 -- [-2744.812] (-2751.842) (-2751.993) (-2753.065) * (-2749.876) (-2756.686) (-2750.700) [-2746.319] -- 0:02:38
275000 -- (-2748.416) [-2751.557] (-2745.935) (-2757.476) * (-2749.447) (-2764.105) (-2747.905) [-2750.055] -- 0:02:40
Average standard deviation of split frequencies: 0.005978
276000 -- (-2747.600) (-2755.353) [-2747.499] (-2747.981) * [-2748.234] (-2750.912) (-2751.485) (-2746.054) -- 0:02:40
277000 -- (-2746.897) (-2753.452) [-2747.635] (-2745.797) * (-2744.766) [-2752.558] (-2746.860) (-2755.273) -- 0:02:39
278000 -- (-2749.635) (-2751.160) [-2743.547] (-2753.477) * (-2747.388) [-2746.524] (-2747.778) (-2751.161) -- 0:02:38
279000 -- (-2757.783) [-2745.520] (-2752.711) (-2752.089) * (-2750.170) [-2745.660] (-2755.633) (-2745.285) -- 0:02:37
280000 -- (-2750.848) (-2750.383) (-2753.484) [-2751.592] * (-2749.820) (-2749.921) [-2749.802] (-2745.908) -- 0:02:39
Average standard deviation of split frequencies: 0.007558
281000 -- [-2752.054] (-2748.260) (-2754.092) (-2749.192) * [-2751.347] (-2750.836) (-2748.482) (-2750.531) -- 0:02:38
282000 -- (-2749.738) (-2748.930) [-2752.268] (-2749.291) * (-2750.008) (-2744.511) (-2758.631) [-2746.577] -- 0:02:37
283000 -- (-2757.219) (-2752.671) [-2749.617] (-2745.751) * (-2748.989) [-2750.072] (-2745.677) (-2751.242) -- 0:02:37
284000 -- (-2754.418) (-2746.374) [-2746.737] (-2755.038) * (-2755.150) [-2751.800] (-2755.208) (-2752.209) -- 0:02:38
285000 -- (-2748.805) [-2748.553] (-2746.860) (-2753.128) * (-2753.255) [-2747.417] (-2758.448) (-2760.375) -- 0:02:38
Average standard deviation of split frequencies: 0.014010
286000 -- (-2752.423) [-2747.451] (-2746.040) (-2750.192) * (-2756.338) (-2754.012) (-2753.886) [-2754.547] -- 0:02:37
287000 -- (-2753.853) [-2747.587] (-2750.828) (-2747.829) * (-2751.614) (-2747.414) (-2753.691) [-2754.283] -- 0:02:36
288000 -- (-2752.776) (-2750.756) [-2747.074] (-2753.038) * (-2752.665) (-2745.403) (-2752.688) [-2747.535] -- 0:02:35
289000 -- (-2747.407) (-2749.011) (-2751.386) [-2747.738] * (-2752.486) [-2750.562] (-2753.556) (-2748.668) -- 0:02:37
290000 -- (-2744.414) (-2751.189) (-2753.153) [-2747.556] * (-2750.626) (-2746.573) (-2754.445) [-2744.411] -- 0:02:36
Average standard deviation of split frequencies: 0.017029
291000 -- (-2749.597) (-2757.631) [-2748.274] (-2746.813) * (-2754.919) [-2748.617] (-2749.280) (-2751.688) -- 0:02:35
292000 -- (-2750.782) (-2747.476) [-2750.639] (-2746.322) * (-2750.593) (-2754.925) [-2746.036] (-2748.155) -- 0:02:35
293000 -- [-2753.018] (-2748.840) (-2760.927) (-2749.737) * (-2748.582) (-2757.488) [-2746.141] (-2749.601) -- 0:02:36
294000 -- [-2746.895] (-2746.955) (-2754.100) (-2756.185) * (-2745.968) (-2755.422) (-2748.385) [-2750.380] -- 0:02:36
295000 -- [-2748.064] (-2748.241) (-2751.627) (-2751.473) * (-2747.329) (-2751.560) (-2754.177) [-2744.996] -- 0:02:35
Average standard deviation of split frequencies: 0.019111
296000 -- (-2752.278) (-2752.231) (-2748.150) [-2752.383] * [-2746.829] (-2748.255) (-2749.503) (-2749.535) -- 0:02:34
297000 -- [-2751.137] (-2752.081) (-2750.910) (-2752.904) * (-2748.819) [-2749.510] (-2752.544) (-2748.751) -- 0:02:33
298000 -- (-2752.124) (-2747.314) [-2749.148] (-2750.991) * (-2750.585) [-2750.209] (-2749.209) (-2750.167) -- 0:02:35
299000 -- [-2749.530] (-2750.268) (-2748.974) (-2743.704) * (-2746.549) (-2756.740) (-2749.156) [-2746.129] -- 0:02:34
300000 -- [-2752.392] (-2747.952) (-2752.458) (-2751.340) * (-2747.383) (-2752.233) (-2758.813) [-2746.849] -- 0:02:34
Average standard deviation of split frequencies: 0.016463
301000 -- (-2750.795) (-2745.504) (-2753.052) [-2748.922] * (-2749.727) (-2750.386) [-2751.170] (-2749.517) -- 0:02:33
302000 -- (-2751.106) [-2747.460] (-2752.011) (-2750.979) * (-2744.970) [-2750.884] (-2752.534) (-2752.077) -- 0:02:32
303000 -- [-2756.194] (-2752.881) (-2746.663) (-2751.527) * (-2750.134) (-2748.709) (-2750.718) [-2750.697] -- 0:02:34
304000 -- (-2757.811) [-2748.690] (-2750.528) (-2747.744) * (-2754.150) [-2749.109] (-2753.254) (-2751.900) -- 0:02:33
305000 -- (-2751.998) [-2746.781] (-2754.194) (-2751.488) * (-2751.289) (-2757.025) (-2750.448) [-2745.381] -- 0:02:32
Average standard deviation of split frequencies: 0.020027
306000 -- (-2752.090) (-2745.812) (-2748.414) [-2745.891] * (-2752.938) (-2748.682) (-2759.736) [-2746.619] -- 0:02:31
307000 -- (-2758.685) [-2746.152] (-2747.991) (-2746.655) * [-2747.440] (-2749.106) (-2754.404) (-2748.354) -- 0:02:33
308000 -- (-2744.544) [-2747.288] (-2749.269) (-2748.446) * (-2746.533) [-2746.664] (-2748.015) (-2745.614) -- 0:02:32
309000 -- (-2750.115) (-2746.593) [-2748.406] (-2752.729) * (-2750.303) (-2746.899) [-2746.412] (-2745.080) -- 0:02:32
310000 -- [-2745.908] (-2748.159) (-2752.275) (-2746.200) * (-2746.337) (-2750.078) (-2747.292) [-2745.393] -- 0:02:31
Average standard deviation of split frequencies: 0.020485
311000 -- (-2748.306) [-2750.566] (-2747.515) (-2750.244) * (-2748.890) (-2751.855) (-2747.473) [-2750.531] -- 0:02:30
312000 -- (-2747.930) (-2749.827) (-2749.640) [-2749.457] * (-2755.046) [-2759.283] (-2747.013) (-2746.445) -- 0:02:32
313000 -- [-2744.989] (-2748.159) (-2746.699) (-2746.800) * (-2752.315) [-2750.023] (-2751.439) (-2747.407) -- 0:02:31
314000 -- (-2746.491) (-2756.087) [-2749.565] (-2745.400) * (-2754.665) [-2756.631] (-2748.822) (-2745.356) -- 0:02:30
315000 -- (-2748.283) (-2757.814) (-2744.604) [-2745.814] * (-2748.572) (-2750.020) (-2745.748) [-2747.568] -- 0:02:30
Average standard deviation of split frequencies: 0.029090
316000 -- (-2745.184) [-2750.818] (-2751.619) (-2744.341) * (-2747.273) (-2750.106) (-2749.055) [-2749.604] -- 0:02:31
317000 -- [-2744.786] (-2749.260) (-2751.531) (-2746.782) * (-2757.778) (-2748.476) (-2752.905) [-2749.597] -- 0:02:30
318000 -- [-2751.930] (-2752.295) (-2747.226) (-2751.930) * (-2753.946) [-2747.325] (-2745.211) (-2750.950) -- 0:02:30
319000 -- [-2751.246] (-2749.842) (-2753.699) (-2745.828) * (-2748.619) (-2750.474) [-2748.940] (-2754.153) -- 0:02:29
320000 -- (-2750.150) (-2749.178) (-2743.819) [-2755.369] * [-2747.518] (-2749.844) (-2750.078) (-2759.255) -- 0:02:28
Average standard deviation of split frequencies: 0.027931
321000 -- (-2748.178) (-2754.769) (-2750.211) [-2754.080] * [-2750.130] (-2748.224) (-2759.409) (-2750.190) -- 0:02:30
322000 -- [-2750.157] (-2749.797) (-2753.160) (-2748.609) * [-2748.050] (-2753.894) (-2748.552) (-2751.650) -- 0:02:29
323000 -- (-2749.043) (-2751.355) [-2749.345] (-2748.426) * (-2756.876) (-2753.632) (-2755.764) [-2749.961] -- 0:02:28
324000 -- (-2747.929) (-2750.136) (-2747.855) [-2747.080] * (-2751.262) [-2748.614] (-2753.154) (-2755.804) -- 0:02:28
325000 -- (-2749.403) (-2751.325) [-2747.707] (-2750.924) * (-2747.922) (-2752.694) [-2748.795] (-2750.806) -- 0:02:29
Average standard deviation of split frequencies: 0.031090
326000 -- [-2745.759] (-2749.790) (-2750.805) (-2755.323) * [-2744.904] (-2750.749) (-2748.802) (-2754.371) -- 0:02:28
327000 -- (-2745.008) [-2745.669] (-2746.454) (-2746.109) * (-2748.963) [-2753.705] (-2750.827) (-2747.074) -- 0:02:28
328000 -- (-2748.827) (-2746.505) (-2754.528) [-2746.934] * (-2752.124) (-2765.380) [-2747.672] (-2752.157) -- 0:02:27
329000 -- (-2762.507) (-2752.385) (-2749.223) [-2747.413] * (-2749.849) (-2755.785) [-2748.833] (-2751.328) -- 0:02:26
330000 -- (-2751.113) (-2747.857) (-2748.353) [-2753.201] * (-2753.110) [-2749.055] (-2745.065) (-2751.825) -- 0:02:28
Average standard deviation of split frequencies: 0.027087
331000 -- (-2753.403) (-2752.515) (-2754.844) [-2750.179] * (-2749.390) [-2751.941] (-2748.351) (-2752.436) -- 0:02:27
332000 -- (-2756.023) [-2748.018] (-2746.001) (-2758.534) * [-2747.724] (-2746.674) (-2749.129) (-2754.048) -- 0:02:26
333000 -- (-2750.753) (-2745.148) (-2748.839) [-2750.960] * (-2750.498) [-2748.279] (-2749.567) (-2751.346) -- 0:02:26
334000 -- (-2745.350) (-2745.954) [-2749.010] (-2758.177) * [-2751.585] (-2750.746) (-2748.879) (-2750.200) -- 0:02:25
335000 -- (-2743.685) (-2746.637) [-2750.212] (-2749.799) * (-2747.772) (-2753.232) [-2746.224] (-2760.593) -- 0:02:26
Average standard deviation of split frequencies: 0.025254
336000 -- [-2748.904] (-2751.820) (-2751.326) (-2750.603) * (-2749.368) (-2750.528) [-2752.153] (-2752.516) -- 0:02:26
337000 -- (-2750.994) (-2743.145) [-2749.592] (-2753.463) * [-2746.374] (-2750.357) (-2752.386) (-2752.276) -- 0:02:25
338000 -- [-2752.690] (-2746.674) (-2748.148) (-2747.971) * (-2752.029) (-2755.683) (-2753.435) [-2754.023] -- 0:02:24
339000 -- (-2752.623) (-2748.047) [-2750.351] (-2754.385) * (-2747.390) (-2747.950) [-2749.837] (-2750.702) -- 0:02:26
340000 -- (-2750.401) [-2747.670] (-2751.315) (-2750.883) * (-2748.370) (-2753.704) [-2751.747] (-2748.028) -- 0:02:25
Average standard deviation of split frequencies: 0.025600
341000 -- (-2751.393) [-2747.835] (-2751.482) (-2753.387) * [-2748.018] (-2753.758) (-2757.317) (-2749.544) -- 0:02:24
342000 -- (-2754.144) (-2753.975) [-2747.755] (-2757.171) * [-2746.975] (-2757.750) (-2759.117) (-2759.941) -- 0:02:24
343000 -- (-2754.700) (-2748.043) [-2748.251] (-2745.544) * (-2747.592) (-2754.871) [-2752.809] (-2748.051) -- 0:02:23
344000 -- (-2757.595) (-2750.128) [-2746.360] (-2747.078) * (-2746.502) (-2752.463) [-2747.829] (-2753.999) -- 0:02:24
345000 -- (-2755.439) (-2748.113) [-2748.270] (-2748.823) * (-2749.353) (-2758.440) (-2750.734) [-2750.872] -- 0:02:24
Average standard deviation of split frequencies: 0.025886
346000 -- (-2751.642) [-2749.587] (-2752.333) (-2753.219) * (-2750.834) [-2754.538] (-2747.410) (-2757.984) -- 0:02:23
347000 -- (-2749.577) (-2749.464) (-2753.407) [-2746.468] * (-2750.141) (-2748.189) [-2753.319] (-2745.154) -- 0:02:23
348000 -- (-2751.330) [-2748.487] (-2752.073) (-2744.168) * (-2752.390) (-2751.717) (-2746.200) [-2751.144] -- 0:02:24
349000 -- (-2754.338) (-2751.085) [-2749.026] (-2748.381) * (-2747.895) (-2755.745) (-2751.153) [-2754.739] -- 0:02:23
350000 -- (-2749.557) (-2752.711) (-2748.378) [-2743.740] * (-2745.978) (-2749.833) [-2752.798] (-2749.282) -- 0:02:23
Average standard deviation of split frequencies: 0.022853
351000 -- (-2751.933) [-2745.336] (-2748.112) (-2750.430) * (-2748.826) (-2750.400) [-2750.081] (-2743.295) -- 0:02:22
352000 -- (-2753.436) [-2748.179] (-2753.047) (-2749.187) * [-2754.344] (-2749.982) (-2747.169) (-2749.121) -- 0:02:21
353000 -- (-2757.136) [-2748.567] (-2750.588) (-2747.450) * [-2745.555] (-2753.769) (-2745.711) (-2756.560) -- 0:02:22
354000 -- (-2744.654) (-2751.254) (-2748.805) [-2746.573] * (-2750.283) (-2748.180) [-2749.775] (-2752.261) -- 0:02:22
355000 -- [-2750.564] (-2749.030) (-2750.890) (-2749.957) * (-2751.513) (-2750.932) (-2749.441) [-2745.552] -- 0:02:21
Average standard deviation of split frequencies: 0.023173
356000 -- [-2751.421] (-2748.772) (-2753.127) (-2749.417) * [-2749.518] (-2753.285) (-2750.624) (-2750.998) -- 0:02:21
357000 -- [-2747.556] (-2758.559) (-2751.762) (-2752.860) * (-2750.055) [-2751.726] (-2747.004) (-2749.879) -- 0:02:22
358000 -- (-2750.962) (-2744.866) (-2754.102) [-2749.398] * [-2754.141] (-2758.057) (-2753.432) (-2750.234) -- 0:02:21
359000 -- (-2749.954) [-2756.217] (-2750.358) (-2751.414) * [-2747.139] (-2746.336) (-2753.511) (-2743.377) -- 0:02:21
360000 -- (-2749.018) [-2748.386] (-2752.984) (-2750.827) * (-2750.903) (-2751.956) (-2747.846) [-2749.930] -- 0:02:20
Average standard deviation of split frequencies: 0.021566
361000 -- [-2750.124] (-2751.450) (-2748.922) (-2749.665) * (-2749.973) (-2752.111) [-2750.317] (-2759.569) -- 0:02:19
362000 -- [-2748.348] (-2752.265) (-2750.304) (-2745.422) * (-2748.869) [-2749.536] (-2747.289) (-2749.040) -- 0:02:20
363000 -- (-2751.197) (-2751.545) (-2751.187) [-2744.644] * (-2746.305) (-2753.945) (-2749.721) [-2748.377] -- 0:02:20
364000 -- (-2753.739) [-2750.257] (-2748.712) (-2750.212) * (-2747.858) (-2755.794) [-2746.586] (-2752.333) -- 0:02:19
365000 -- [-2751.023] (-2747.564) (-2752.578) (-2758.102) * [-2751.021] (-2750.495) (-2752.495) (-2751.529) -- 0:02:19
Average standard deviation of split frequencies: 0.024472
366000 -- (-2748.777) (-2749.895) [-2746.397] (-2762.129) * (-2753.121) (-2748.813) [-2751.264] (-2745.204) -- 0:02:20
367000 -- (-2752.120) (-2754.475) (-2745.314) [-2748.469] * (-2751.191) (-2749.810) [-2755.207] (-2750.765) -- 0:02:19
368000 -- (-2747.025) (-2748.854) (-2744.409) [-2750.819] * (-2750.324) (-2747.875) [-2750.351] (-2750.308) -- 0:02:19
369000 -- [-2752.064] (-2751.406) (-2746.202) (-2747.616) * (-2748.519) [-2749.644] (-2752.693) (-2750.704) -- 0:02:18
370000 -- (-2748.421) (-2756.217) [-2747.958] (-2749.716) * (-2751.345) (-2746.909) (-2750.124) [-2747.041] -- 0:02:17
Average standard deviation of split frequencies: 0.022892
371000 -- [-2744.799] (-2748.823) (-2749.930) (-2746.176) * (-2747.375) [-2748.200] (-2751.577) (-2746.794) -- 0:02:19
372000 -- (-2759.218) (-2750.977) [-2745.840] (-2746.799) * (-2745.550) [-2751.231] (-2750.544) (-2745.395) -- 0:02:18
373000 -- (-2748.989) (-2757.679) (-2749.463) [-2750.268] * (-2751.609) [-2749.892] (-2749.919) (-2745.303) -- 0:02:17
374000 -- [-2750.631] (-2753.735) (-2745.773) (-2752.324) * (-2747.077) (-2755.366) (-2755.200) [-2746.921] -- 0:02:17
375000 -- [-2749.042] (-2751.317) (-2747.736) (-2753.594) * (-2749.693) [-2750.510] (-2760.240) (-2747.719) -- 0:02:18
Average standard deviation of split frequencies: 0.024448
376000 -- (-2749.378) [-2744.497] (-2752.772) (-2750.458) * (-2749.831) (-2746.278) [-2752.254] (-2744.124) -- 0:02:17
377000 -- (-2754.515) (-2746.307) (-2750.653) [-2748.569] * (-2751.715) (-2746.323) (-2746.604) [-2747.209] -- 0:02:17
378000 -- (-2750.162) (-2747.862) (-2751.050) [-2752.261] * (-2748.617) [-2747.732] (-2747.332) (-2747.384) -- 0:02:16
379000 -- (-2749.473) [-2753.744] (-2748.321) (-2755.928) * (-2744.258) (-2748.511) (-2753.385) [-2750.882] -- 0:02:15
380000 -- (-2752.595) (-2749.933) [-2745.781] (-2751.761) * (-2748.126) (-2745.816) [-2749.296] (-2751.168) -- 0:02:17
Average standard deviation of split frequencies: 0.028482
381000 -- [-2753.641] (-2754.680) (-2753.130) (-2748.531) * (-2746.176) [-2751.778] (-2746.206) (-2747.630) -- 0:02:16
382000 -- (-2748.167) (-2750.267) [-2751.349] (-2752.482) * (-2749.664) (-2749.075) (-2749.971) [-2754.405] -- 0:02:15
383000 -- (-2748.244) (-2754.124) [-2746.035] (-2750.051) * (-2747.683) [-2746.576] (-2751.934) (-2758.859) -- 0:02:15
384000 -- (-2746.347) [-2746.672] (-2752.470) (-2747.511) * [-2748.276] (-2747.703) (-2750.201) (-2752.107) -- 0:02:16
385000 -- (-2757.684) [-2744.106] (-2751.463) (-2750.006) * (-2750.002) (-2749.614) [-2747.938] (-2751.520) -- 0:02:15
Average standard deviation of split frequencies: 0.027478
386000 -- [-2750.522] (-2753.960) (-2745.252) (-2751.191) * (-2745.456) (-2758.781) [-2749.548] (-2748.855) -- 0:02:15
387000 -- (-2746.310) (-2748.965) [-2744.454] (-2754.250) * (-2753.489) (-2754.065) [-2749.237] (-2747.560) -- 0:02:14
388000 -- (-2744.876) (-2746.727) (-2749.823) [-2751.944] * (-2746.042) (-2745.750) [-2747.457] (-2748.600) -- 0:02:14
389000 -- (-2751.794) (-2753.343) [-2748.724] (-2766.044) * (-2750.899) (-2748.423) [-2747.412] (-2752.080) -- 0:02:15
390000 -- (-2745.456) (-2757.465) (-2749.586) [-2752.064] * (-2752.473) (-2748.987) (-2750.480) [-2749.142] -- 0:02:14
Average standard deviation of split frequencies: 0.029563
391000 -- [-2747.322] (-2750.997) (-2750.173) (-2754.819) * [-2749.404] (-2745.960) (-2746.921) (-2755.337) -- 0:02:13
392000 -- (-2752.340) (-2752.820) [-2751.222] (-2760.620) * (-2749.015) [-2749.403] (-2750.502) (-2749.970) -- 0:02:13
393000 -- (-2758.912) (-2752.144) (-2753.994) [-2750.778] * [-2749.908] (-2753.204) (-2762.587) (-2748.403) -- 0:02:12
394000 -- (-2747.086) [-2746.251] (-2754.259) (-2751.075) * [-2748.405] (-2749.221) (-2750.660) (-2745.329) -- 0:02:13
395000 -- [-2752.347] (-2750.063) (-2747.336) (-2747.952) * (-2757.350) [-2757.566] (-2747.976) (-2749.518) -- 0:02:13
Average standard deviation of split frequencies: 0.028570
396000 -- (-2750.313) (-2749.513) [-2747.840] (-2750.663) * (-2750.016) (-2750.945) (-2750.511) [-2748.760] -- 0:02:12
397000 -- (-2753.739) (-2751.586) [-2753.838] (-2743.914) * (-2748.127) (-2746.287) [-2749.620] (-2743.810) -- 0:02:12
398000 -- (-2751.720) [-2744.876] (-2754.329) (-2751.236) * [-2753.300] (-2747.672) (-2752.821) (-2748.467) -- 0:02:13
399000 -- (-2748.567) (-2748.741) [-2750.322] (-2749.165) * (-2746.196) [-2747.597] (-2751.630) (-2750.158) -- 0:02:12
400000 -- [-2751.321] (-2748.022) (-2746.958) (-2753.229) * (-2747.923) [-2757.006] (-2748.992) (-2747.306) -- 0:02:12
Average standard deviation of split frequencies: 0.024119
401000 -- (-2748.481) (-2748.700) (-2750.979) [-2750.677] * (-2757.571) (-2752.189) [-2744.950] (-2750.504) -- 0:02:11
402000 -- (-2744.553) (-2747.337) (-2752.432) [-2750.481] * (-2750.848) [-2746.934] (-2742.652) (-2754.993) -- 0:02:10
403000 -- (-2746.713) (-2749.559) (-2756.296) [-2745.212] * (-2750.900) [-2747.687] (-2759.733) (-2754.792) -- 0:02:11
404000 -- (-2754.133) (-2749.099) [-2749.425] (-2760.016) * (-2750.994) (-2748.006) [-2748.187] (-2754.680) -- 0:02:11
405000 -- (-2747.562) (-2747.495) [-2750.004] (-2752.190) * (-2745.880) (-2754.940) (-2750.429) [-2751.401] -- 0:02:10
Average standard deviation of split frequencies: 0.026125
406000 -- [-2746.116] (-2747.165) (-2745.009) (-2748.212) * (-2747.519) [-2750.937] (-2752.981) (-2753.768) -- 0:02:10
407000 -- (-2745.902) (-2751.354) (-2742.921) [-2749.414] * [-2749.741] (-2746.927) (-2756.392) (-2756.447) -- 0:02:11
408000 -- (-2745.844) (-2747.824) [-2747.999] (-2745.980) * (-2749.876) (-2750.441) (-2751.213) [-2750.070] -- 0:02:10
409000 -- (-2747.661) [-2752.293] (-2753.202) (-2750.615) * (-2751.323) (-2749.342) [-2746.051] (-2749.037) -- 0:02:10
410000 -- [-2749.124] (-2763.256) (-2752.933) (-2749.236) * (-2748.261) [-2751.389] (-2763.127) (-2745.815) -- 0:02:09
Average standard deviation of split frequencies: 0.025828
411000 -- (-2750.007) (-2752.439) [-2749.934] (-2747.346) * (-2743.174) (-2752.294) (-2746.145) [-2746.146] -- 0:02:08
412000 -- (-2749.350) (-2747.224) (-2748.730) [-2751.035] * (-2748.187) (-2744.850) (-2758.147) [-2745.748] -- 0:02:09
413000 -- (-2745.264) (-2750.478) [-2752.747] (-2751.928) * [-2755.385] (-2744.255) (-2756.589) (-2751.663) -- 0:02:09
414000 -- [-2745.302] (-2748.932) (-2748.412) (-2755.513) * (-2747.897) (-2749.571) (-2748.331) [-2746.829] -- 0:02:08
415000 -- [-2751.621] (-2755.782) (-2749.498) (-2752.775) * (-2750.076) [-2748.991] (-2752.386) (-2755.307) -- 0:02:08
Average standard deviation of split frequencies: 0.032296
416000 -- (-2756.516) [-2754.037] (-2750.314) (-2749.430) * (-2752.103) (-2757.193) (-2750.778) [-2748.098] -- 0:02:09
417000 -- (-2753.670) [-2746.372] (-2753.374) (-2760.385) * (-2757.082) (-2748.949) (-2746.915) [-2749.215] -- 0:02:08
418000 -- (-2747.851) (-2750.984) (-2754.399) [-2749.238] * (-2754.770) (-2750.500) (-2745.831) [-2749.249] -- 0:02:08
419000 -- (-2744.977) (-2746.334) (-2752.200) [-2746.795] * (-2748.316) (-2754.487) (-2745.922) [-2748.276] -- 0:02:07
420000 -- (-2748.416) (-2748.856) (-2755.829) [-2752.740] * (-2757.114) (-2749.048) [-2747.954] (-2745.239) -- 0:02:07
Average standard deviation of split frequencies: 0.034179
421000 -- [-2749.735] (-2747.929) (-2749.244) (-2747.541) * [-2755.547] (-2745.774) (-2750.815) (-2753.241) -- 0:02:07
422000 -- [-2756.161] (-2749.425) (-2747.610) (-2746.656) * (-2753.935) (-2750.686) (-2749.519) [-2755.724] -- 0:02:07
423000 -- [-2749.144] (-2751.461) (-2755.171) (-2751.817) * [-2744.814] (-2745.975) (-2752.393) (-2755.003) -- 0:02:06
424000 -- (-2750.833) [-2750.753] (-2746.822) (-2757.972) * (-2750.594) (-2747.596) (-2751.654) [-2754.597] -- 0:02:06
425000 -- [-2750.639] (-2748.907) (-2750.609) (-2751.721) * [-2758.826] (-2744.881) (-2745.759) (-2747.397) -- 0:02:07
Average standard deviation of split frequencies: 0.038730
426000 -- (-2752.322) (-2746.925) [-2755.246] (-2750.843) * (-2744.949) [-2750.327] (-2753.873) (-2748.756) -- 0:02:06
427000 -- (-2749.729) (-2750.103) [-2747.559] (-2754.192) * [-2752.729] (-2750.583) (-2746.665) (-2747.699) -- 0:02:06
428000 -- (-2745.992) (-2754.818) (-2752.103) [-2749.335] * (-2751.094) (-2751.255) (-2747.513) [-2746.493] -- 0:02:05
429000 -- (-2748.338) (-2755.102) [-2746.096] (-2747.748) * (-2750.301) (-2752.357) [-2748.780] (-2751.284) -- 0:02:05
430000 -- (-2745.873) (-2744.767) (-2750.266) [-2748.550] * (-2745.829) (-2749.040) [-2746.637] (-2751.603) -- 0:02:05
Average standard deviation of split frequencies: 0.039953
431000 -- (-2748.900) (-2746.613) [-2749.452] (-2749.121) * (-2751.779) [-2755.119] (-2751.529) (-2748.522) -- 0:02:05
432000 -- (-2748.188) [-2749.265] (-2749.603) (-2753.107) * (-2756.100) (-2753.253) (-2750.598) [-2744.434] -- 0:02:04
433000 -- (-2747.533) (-2752.116) (-2750.186) [-2746.561] * (-2751.224) (-2752.813) (-2746.781) [-2747.794] -- 0:02:04
434000 -- (-2751.153) [-2744.744] (-2753.569) (-2747.926) * (-2752.132) [-2751.372] (-2749.566) (-2752.377) -- 0:02:03
435000 -- (-2747.530) [-2748.661] (-2748.115) (-2752.582) * (-2748.647) [-2747.352] (-2746.862) (-2747.254) -- 0:02:04
Average standard deviation of split frequencies: 0.038383
436000 -- [-2747.073] (-2751.920) (-2753.374) (-2747.594) * (-2748.699) (-2747.311) [-2748.666] (-2747.916) -- 0:02:04
437000 -- [-2746.763] (-2754.842) (-2749.402) (-2750.634) * [-2747.969] (-2745.663) (-2746.380) (-2748.588) -- 0:02:03
438000 -- (-2745.160) (-2752.040) [-2750.989] (-2753.432) * (-2751.122) [-2747.846] (-2756.631) (-2753.148) -- 0:02:03
439000 -- (-2745.419) (-2748.037) [-2756.487] (-2749.117) * (-2756.505) [-2744.801] (-2762.239) (-2751.480) -- 0:02:03
440000 -- [-2747.971] (-2753.294) (-2746.687) (-2752.632) * (-2755.123) (-2744.520) (-2749.594) [-2750.781] -- 0:02:03
Average standard deviation of split frequencies: 0.033697
441000 -- (-2745.846) [-2748.319] (-2747.579) (-2749.811) * (-2752.256) (-2752.026) [-2746.195] (-2744.372) -- 0:02:02
442000 -- [-2750.746] (-2746.738) (-2753.134) (-2750.552) * (-2748.181) [-2749.149] (-2749.786) (-2765.088) -- 0:02:02
443000 -- [-2750.440] (-2751.211) (-2752.234) (-2751.875) * (-2752.589) (-2747.886) (-2748.041) [-2746.971] -- 0:02:01
444000 -- [-2750.262] (-2749.746) (-2752.453) (-2753.310) * (-2752.264) [-2748.544] (-2749.218) (-2747.640) -- 0:02:02
445000 -- [-2755.507] (-2743.611) (-2752.703) (-2754.550) * [-2748.660] (-2746.700) (-2745.222) (-2750.961) -- 0:02:02
Average standard deviation of split frequencies: 0.034351
446000 -- (-2752.485) [-2743.772] (-2746.591) (-2748.985) * (-2746.064) (-2752.391) (-2758.524) [-2749.102] -- 0:02:01
447000 -- (-2755.377) (-2750.737) (-2752.318) [-2749.026] * [-2747.354] (-2747.850) (-2748.244) (-2750.447) -- 0:02:01
448000 -- (-2755.043) (-2746.998) (-2746.443) [-2746.441] * (-2748.339) (-2750.012) [-2746.096] (-2749.080) -- 0:02:01
449000 -- [-2748.025] (-2747.635) (-2753.249) (-2748.362) * (-2749.167) (-2750.828) (-2744.279) [-2748.605] -- 0:02:01
450000 -- (-2749.927) (-2751.008) [-2751.037] (-2750.935) * (-2749.999) (-2746.419) (-2756.571) [-2748.199] -- 0:02:01
Average standard deviation of split frequencies: 0.038180
451000 -- (-2751.007) [-2750.443] (-2751.105) (-2756.370) * (-2754.167) [-2749.007] (-2757.544) (-2746.659) -- 0:02:00
452000 -- (-2750.152) (-2747.276) (-2754.013) [-2749.626] * (-2748.507) (-2751.212) (-2748.362) [-2747.241] -- 0:02:00
453000 -- [-2749.695] (-2750.994) (-2751.078) (-2748.011) * (-2749.861) (-2746.095) [-2749.401] (-2750.024) -- 0:02:00
454000 -- [-2747.925] (-2750.987) (-2747.763) (-2747.727) * (-2754.575) (-2746.694) [-2748.600] (-2747.870) -- 0:02:00
455000 -- (-2753.009) (-2755.777) (-2745.499) [-2746.684] * (-2757.108) (-2748.990) (-2752.183) [-2748.827] -- 0:01:59
Average standard deviation of split frequencies: 0.035149
456000 -- [-2747.453] (-2750.509) (-2750.270) (-2747.063) * (-2754.803) [-2746.793] (-2748.773) (-2749.977) -- 0:01:59
457000 -- (-2752.962) (-2748.564) [-2751.414] (-2749.943) * (-2747.941) (-2745.098) [-2746.271] (-2756.012) -- 0:02:00
458000 -- (-2750.689) [-2747.934] (-2750.422) (-2755.620) * (-2748.373) (-2748.191) [-2746.098] (-2756.206) -- 0:01:59
459000 -- (-2749.222) [-2745.628] (-2748.092) (-2749.322) * (-2748.907) (-2753.997) (-2748.826) [-2749.915] -- 0:01:59
460000 -- (-2748.167) (-2749.495) [-2753.579] (-2751.278) * (-2750.129) (-2748.901) (-2748.724) [-2746.356] -- 0:01:58
Average standard deviation of split frequencies: 0.035816
461000 -- [-2749.000] (-2751.766) (-2753.943) (-2746.090) * (-2754.865) (-2748.597) [-2752.276] (-2748.084) -- 0:01:58
462000 -- (-2747.952) (-2752.609) (-2755.173) [-2750.758] * (-2750.768) (-2754.681) (-2750.552) [-2746.709] -- 0:01:58
463000 -- (-2748.474) (-2750.825) [-2746.173] (-2749.275) * (-2750.282) (-2753.910) [-2754.423] (-2755.488) -- 0:01:58
464000 -- (-2744.325) (-2747.653) (-2756.642) [-2746.981] * (-2752.882) (-2749.699) (-2749.727) [-2745.987] -- 0:01:57
465000 -- [-2745.599] (-2746.718) (-2751.533) (-2746.961) * (-2752.371) [-2747.535] (-2752.512) (-2751.014) -- 0:01:57
Average standard deviation of split frequencies: 0.035406
466000 -- (-2749.582) (-2751.499) [-2751.488] (-2750.066) * (-2750.934) (-2748.669) [-2745.445] (-2749.475) -- 0:01:58
467000 -- [-2748.783] (-2751.696) (-2751.787) (-2746.571) * [-2751.847] (-2755.044) (-2752.448) (-2752.080) -- 0:01:57
468000 -- (-2754.980) (-2749.986) (-2753.276) [-2749.864] * (-2748.862) (-2754.566) [-2755.522] (-2750.910) -- 0:01:57
469000 -- (-2757.473) (-2750.105) (-2751.003) [-2745.525] * [-2745.253] (-2751.910) (-2751.002) (-2747.982) -- 0:01:56
470000 -- (-2758.879) (-2748.977) (-2753.529) [-2744.224] * (-2754.090) [-2752.900] (-2755.249) (-2748.266) -- 0:01:56
Average standard deviation of split frequencies: 0.033553
471000 -- (-2751.246) (-2748.715) (-2752.279) [-2744.624] * [-2752.774] (-2754.121) (-2746.999) (-2750.327) -- 0:01:56
472000 -- (-2752.349) [-2745.141] (-2754.960) (-2743.643) * (-2753.237) (-2752.804) [-2746.621] (-2750.338) -- 0:01:56
473000 -- (-2746.130) (-2745.671) (-2752.570) [-2749.102] * (-2749.261) [-2753.723] (-2748.814) (-2748.202) -- 0:01:55
474000 -- (-2749.221) (-2750.304) (-2751.886) [-2749.858] * [-2753.241] (-2753.174) (-2746.855) (-2756.807) -- 0:01:55
475000 -- [-2747.094] (-2752.716) (-2756.538) (-2745.075) * (-2758.074) (-2746.876) (-2744.927) [-2753.625] -- 0:01:56
Average standard deviation of split frequencies: 0.032186
476000 -- (-2750.263) (-2757.621) [-2748.940] (-2746.248) * (-2749.816) (-2749.238) [-2747.056] (-2750.548) -- 0:01:55
477000 -- (-2752.833) [-2745.962] (-2750.410) (-2748.088) * (-2749.444) [-2751.559] (-2753.347) (-2748.956) -- 0:01:55
478000 -- (-2748.897) (-2749.512) [-2746.741] (-2754.381) * (-2746.511) (-2746.374) (-2756.491) [-2754.011] -- 0:01:54
479000 -- [-2752.860] (-2749.470) (-2751.221) (-2747.036) * (-2752.579) (-2746.383) [-2748.363] (-2752.909) -- 0:01:54
480000 -- (-2752.396) (-2749.928) [-2750.167] (-2748.055) * [-2748.988] (-2748.247) (-2752.984) (-2749.229) -- 0:01:54
Average standard deviation of split frequencies: 0.031383
481000 -- (-2751.346) (-2752.993) [-2748.305] (-2748.290) * (-2752.778) [-2747.391] (-2747.469) (-2746.624) -- 0:01:54
482000 -- (-2749.093) (-2752.483) (-2749.973) [-2751.005] * (-2751.361) (-2748.940) [-2747.857] (-2747.544) -- 0:01:53
483000 -- [-2744.828] (-2748.981) (-2745.189) (-2751.749) * (-2750.838) (-2750.678) [-2748.267] (-2753.354) -- 0:01:53
484000 -- (-2754.770) (-2754.274) [-2750.525] (-2746.710) * (-2752.843) (-2750.372) (-2747.159) [-2750.085] -- 0:01:54
485000 -- (-2748.944) (-2747.446) [-2749.450] (-2747.343) * (-2756.666) [-2749.842] (-2749.036) (-2756.850) -- 0:01:53
Average standard deviation of split frequencies: 0.034434
486000 -- [-2743.392] (-2753.195) (-2754.701) (-2748.310) * (-2756.627) (-2748.265) [-2747.397] (-2749.674) -- 0:01:53
487000 -- (-2747.264) [-2749.417] (-2749.691) (-2758.852) * (-2756.051) (-2752.801) [-2751.179] (-2751.442) -- 0:01:52
488000 -- (-2744.224) (-2747.579) (-2748.349) [-2746.913] * (-2756.414) (-2754.572) [-2756.485] (-2757.804) -- 0:01:52
489000 -- (-2746.799) [-2749.764] (-2744.544) (-2749.490) * (-2752.898) (-2751.732) [-2749.301] (-2759.032) -- 0:01:52
490000 -- [-2751.807] (-2754.986) (-2750.816) (-2748.781) * [-2746.890] (-2754.225) (-2752.444) (-2749.823) -- 0:01:52
Average standard deviation of split frequencies: 0.035067
491000 -- (-2747.052) (-2749.726) (-2751.059) [-2753.812] * (-2756.625) [-2751.726] (-2749.983) (-2747.222) -- 0:01:51
492000 -- (-2748.676) (-2762.090) [-2745.770] (-2756.540) * [-2757.516] (-2751.309) (-2750.441) (-2749.398) -- 0:01:51
493000 -- (-2745.375) [-2749.902] (-2747.196) (-2750.549) * (-2750.303) (-2748.511) (-2747.375) [-2750.354] -- 0:01:51
494000 -- (-2743.881) [-2749.705] (-2748.002) (-2744.791) * (-2744.167) (-2747.259) [-2747.545] (-2749.075) -- 0:01:51
495000 -- (-2748.962) (-2756.664) (-2750.304) [-2745.673] * (-2751.023) (-2747.263) (-2747.200) [-2747.880] -- 0:01:51
Average standard deviation of split frequencies: 0.031364
496000 -- (-2753.179) (-2748.129) [-2752.975] (-2743.734) * (-2750.119) (-2747.296) [-2748.553] (-2748.884) -- 0:01:50
497000 -- [-2749.519] (-2749.407) (-2753.871) (-2750.034) * (-2754.609) (-2749.437) [-2748.907] (-2751.031) -- 0:01:50
498000 -- (-2747.295) (-2750.847) [-2753.301] (-2749.224) * (-2750.620) (-2750.442) (-2752.283) [-2750.175] -- 0:01:50
499000 -- (-2745.752) (-2748.173) [-2754.921] (-2760.430) * (-2745.817) (-2748.710) (-2747.937) [-2750.353] -- 0:01:50
500000 -- (-2746.649) (-2748.153) (-2756.207) [-2751.950] * (-2746.631) [-2747.803] (-2748.653) (-2748.079) -- 0:01:50
Average standard deviation of split frequencies: 0.031542
501000 -- [-2751.891] (-2752.547) (-2754.721) (-2751.471) * (-2752.411) (-2747.457) (-2756.529) [-2748.058] -- 0:01:49
502000 -- [-2745.590] (-2756.078) (-2746.679) (-2750.568) * (-2754.793) (-2752.477) [-2747.226] (-2750.917) -- 0:01:49
503000 -- (-2757.614) [-2744.761] (-2746.503) (-2745.663) * (-2750.935) [-2749.634] (-2745.695) (-2751.011) -- 0:01:49
504000 -- [-2746.888] (-2745.489) (-2745.619) (-2746.272) * (-2754.530) (-2747.632) [-2749.887] (-2754.013) -- 0:01:49
505000 -- (-2745.359) [-2748.294] (-2747.505) (-2752.900) * (-2757.485) (-2751.105) [-2745.958] (-2751.602) -- 0:01:48
Average standard deviation of split frequencies: 0.035868
506000 -- [-2748.209] (-2745.398) (-2747.657) (-2756.925) * (-2755.770) (-2747.962) (-2747.753) [-2746.294] -- 0:01:48
507000 -- [-2752.730] (-2745.132) (-2746.290) (-2752.993) * [-2747.775] (-2755.767) (-2758.465) (-2755.432) -- 0:01:48
508000 -- (-2752.275) (-2749.997) (-2743.969) [-2748.383] * [-2744.855] (-2751.392) (-2751.927) (-2757.639) -- 0:01:48
509000 -- [-2748.076] (-2748.766) (-2747.080) (-2747.542) * (-2745.940) (-2748.272) (-2758.777) [-2752.382] -- 0:01:48
510000 -- (-2747.507) (-2756.172) (-2744.333) [-2747.299] * (-2753.292) (-2755.748) (-2750.798) [-2757.930] -- 0:01:47
Average standard deviation of split frequencies: 0.036002
511000 -- (-2749.983) (-2748.357) (-2752.322) [-2751.642] * (-2751.435) (-2764.069) (-2749.260) [-2749.786] -- 0:01:47
512000 -- (-2743.582) (-2744.745) (-2754.243) [-2747.888] * (-2747.702) (-2758.228) [-2757.047] (-2755.578) -- 0:01:47
513000 -- [-2750.730] (-2747.583) (-2745.853) (-2750.478) * (-2756.603) [-2750.875] (-2755.388) (-2748.489) -- 0:01:47
514000 -- (-2750.187) (-2747.810) [-2748.774] (-2753.360) * (-2754.572) [-2747.725] (-2755.243) (-2761.932) -- 0:01:46
515000 -- (-2749.980) [-2749.711] (-2753.044) (-2756.000) * (-2758.370) [-2752.702] (-2753.432) (-2755.525) -- 0:01:46
Average standard deviation of split frequencies: 0.034716
516000 -- (-2748.657) [-2748.081] (-2749.459) (-2746.656) * (-2747.097) (-2748.201) [-2753.066] (-2744.222) -- 0:01:46
517000 -- (-2744.547) (-2747.863) (-2752.465) [-2746.484] * (-2753.142) [-2752.418] (-2753.330) (-2753.366) -- 0:01:46
518000 -- (-2749.629) (-2750.825) (-2757.257) [-2744.900] * (-2750.408) [-2746.609] (-2754.152) (-2752.377) -- 0:01:46
519000 -- (-2748.924) (-2749.915) (-2748.673) [-2750.523] * (-2751.837) (-2746.084) (-2751.771) [-2749.736] -- 0:01:45
520000 -- [-2750.608] (-2748.003) (-2751.828) (-2754.547) * (-2750.869) [-2747.454] (-2751.696) (-2749.177) -- 0:01:45
Average standard deviation of split frequencies: 0.030783
521000 -- (-2751.129) (-2754.164) (-2746.301) [-2745.953] * (-2749.637) (-2749.154) [-2748.605] (-2749.312) -- 0:01:45
522000 -- [-2743.624] (-2754.196) (-2755.772) (-2748.763) * (-2750.747) [-2749.822] (-2746.205) (-2752.694) -- 0:01:45
523000 -- [-2745.850] (-2752.459) (-2752.990) (-2755.424) * (-2747.669) (-2756.685) (-2757.561) [-2750.774] -- 0:01:44
524000 -- (-2748.071) (-2752.058) [-2750.786] (-2747.643) * [-2752.762] (-2747.453) (-2747.260) (-2754.854) -- 0:01:44
525000 -- (-2753.982) (-2750.044) [-2746.088] (-2752.375) * (-2756.195) [-2746.451] (-2748.178) (-2747.203) -- 0:01:44
Average standard deviation of split frequencies: 0.031367
526000 -- (-2749.386) [-2749.056] (-2744.329) (-2751.784) * (-2746.327) (-2746.306) [-2752.767] (-2748.635) -- 0:01:44
527000 -- [-2747.977] (-2747.163) (-2748.082) (-2752.838) * (-2751.417) (-2753.971) (-2754.277) [-2748.798] -- 0:01:44
528000 -- (-2751.797) (-2750.901) [-2749.872] (-2761.167) * (-2753.113) (-2749.799) [-2750.623] (-2750.170) -- 0:01:43
529000 -- [-2754.757] (-2747.492) (-2752.256) (-2759.943) * (-2750.012) (-2746.601) [-2749.441] (-2748.432) -- 0:01:43
530000 -- (-2750.850) [-2744.398] (-2757.957) (-2749.967) * [-2747.661] (-2753.756) (-2751.349) (-2752.153) -- 0:01:43
Average standard deviation of split frequencies: 0.030203
531000 -- (-2762.130) [-2751.761] (-2749.344) (-2749.271) * [-2746.610] (-2750.405) (-2751.954) (-2748.628) -- 0:01:43
532000 -- (-2747.879) (-2744.540) [-2747.041] (-2750.124) * [-2752.625] (-2754.441) (-2750.325) (-2747.350) -- 0:01:42
533000 -- [-2747.574] (-2755.245) (-2759.491) (-2749.799) * (-2754.251) [-2748.614] (-2747.807) (-2745.744) -- 0:01:42
534000 -- (-2746.788) [-2752.840] (-2752.992) (-2746.821) * (-2750.584) (-2748.022) [-2748.024] (-2751.519) -- 0:01:42
535000 -- (-2749.742) [-2748.935] (-2759.772) (-2757.410) * (-2750.745) (-2753.179) [-2745.991] (-2751.669) -- 0:01:42
Average standard deviation of split frequencies: 0.031661
536000 -- [-2747.379] (-2751.242) (-2748.730) (-2754.565) * (-2752.363) (-2753.234) (-2749.442) [-2747.640] -- 0:01:42
537000 -- (-2752.627) (-2744.448) (-2749.660) [-2753.170] * (-2752.687) (-2749.782) (-2749.677) [-2747.673] -- 0:01:41
538000 -- (-2755.899) (-2748.949) (-2749.625) [-2751.598] * [-2744.279] (-2753.205) (-2751.413) (-2755.090) -- 0:01:41
539000 -- (-2744.471) (-2746.446) [-2750.300] (-2754.771) * [-2744.871] (-2747.011) (-2753.587) (-2753.665) -- 0:01:41
540000 -- (-2743.252) (-2751.997) [-2746.576] (-2759.711) * (-2754.823) (-2754.133) [-2746.316] (-2750.974) -- 0:01:41
Average standard deviation of split frequencies: 0.030080
541000 -- (-2750.052) (-2756.281) [-2753.557] (-2748.985) * (-2747.799) (-2749.431) (-2749.242) [-2747.648] -- 0:01:40
542000 -- (-2748.619) [-2749.528] (-2756.680) (-2749.609) * [-2751.348] (-2744.157) (-2749.871) (-2755.594) -- 0:01:40
543000 -- (-2752.388) (-2747.081) [-2753.091] (-2750.804) * (-2747.205) [-2744.536] (-2758.141) (-2753.565) -- 0:01:40
544000 -- (-2746.627) (-2745.486) (-2749.211) [-2751.595] * (-2750.307) [-2743.248] (-2750.602) (-2745.954) -- 0:01:40
545000 -- [-2748.404] (-2751.864) (-2749.626) (-2756.633) * (-2752.639) (-2750.853) [-2749.901] (-2749.034) -- 0:01:40
Average standard deviation of split frequencies: 0.030650
546000 -- [-2744.692] (-2749.559) (-2752.244) (-2754.993) * (-2751.479) (-2747.787) [-2750.887] (-2749.605) -- 0:01:39
547000 -- [-2748.541] (-2756.899) (-2751.218) (-2746.599) * [-2746.189] (-2754.065) (-2748.558) (-2750.306) -- 0:01:39
548000 -- (-2746.472) (-2750.094) (-2753.751) [-2745.549] * (-2747.679) (-2748.481) (-2752.819) [-2749.212] -- 0:01:39
549000 -- [-2752.420] (-2749.618) (-2750.780) (-2748.132) * [-2750.166] (-2760.297) (-2747.644) (-2756.898) -- 0:01:39
550000 -- (-2757.532) [-2746.651] (-2751.853) (-2752.558) * (-2748.035) (-2755.648) (-2749.904) [-2751.630] -- 0:01:39
Average standard deviation of split frequencies: 0.026966
551000 -- (-2750.287) [-2741.357] (-2754.600) (-2752.909) * [-2749.058] (-2756.304) (-2751.655) (-2747.029) -- 0:01:38
552000 -- (-2750.796) (-2745.830) (-2745.919) [-2749.950] * (-2751.250) [-2751.692] (-2750.836) (-2746.351) -- 0:01:38
553000 -- (-2747.585) (-2747.815) [-2751.032] (-2746.947) * [-2750.552] (-2757.810) (-2753.520) (-2752.173) -- 0:01:38
554000 -- (-2748.171) (-2747.797) (-2747.777) [-2748.791] * (-2751.790) (-2750.046) [-2745.276] (-2749.986) -- 0:01:38
555000 -- [-2749.816] (-2746.937) (-2748.128) (-2752.691) * (-2748.440) (-2750.706) (-2745.093) [-2750.285] -- 0:01:37
Average standard deviation of split frequencies: 0.030523
556000 -- (-2746.713) (-2745.888) (-2745.581) [-2745.926] * [-2746.924] (-2755.171) (-2748.589) (-2755.490) -- 0:01:37
557000 -- [-2747.153] (-2749.523) (-2748.966) (-2745.131) * (-2751.415) [-2747.208] (-2749.491) (-2746.787) -- 0:01:37
558000 -- (-2749.212) (-2747.149) [-2752.554] (-2749.003) * [-2750.132] (-2750.083) (-2748.888) (-2751.704) -- 0:01:37
559000 -- (-2751.178) (-2749.455) [-2751.400] (-2750.671) * [-2753.962] (-2750.312) (-2752.771) (-2749.151) -- 0:01:37
560000 -- [-2749.352] (-2758.857) (-2749.848) (-2747.399) * (-2752.534) (-2749.678) (-2752.361) [-2748.340] -- 0:01:36
Average standard deviation of split frequencies: 0.031109
561000 -- (-2753.007) (-2755.502) (-2763.979) [-2750.974] * (-2752.440) (-2751.551) (-2754.591) [-2745.898] -- 0:01:36
562000 -- (-2760.130) (-2747.628) (-2760.986) [-2754.729] * (-2751.345) [-2751.168] (-2761.114) (-2749.818) -- 0:01:36
563000 -- (-2748.901) [-2754.356] (-2753.315) (-2751.226) * (-2747.252) (-2748.810) (-2750.776) [-2749.603] -- 0:01:36
564000 -- (-2748.611) (-2752.592) (-2759.333) [-2748.057] * [-2750.714] (-2754.266) (-2748.162) (-2745.397) -- 0:01:35
565000 -- [-2745.262] (-2754.875) (-2754.079) (-2754.028) * (-2751.611) (-2747.841) [-2743.365] (-2752.174) -- 0:01:35
Average standard deviation of split frequencies: 0.032898
566000 -- (-2745.451) [-2754.076] (-2757.802) (-2746.345) * (-2748.147) (-2748.988) [-2748.557] (-2749.113) -- 0:01:35
567000 -- (-2751.554) (-2750.027) (-2755.796) [-2750.424] * (-2751.621) (-2757.121) (-2752.187) [-2752.224] -- 0:01:35
568000 -- (-2753.565) (-2747.823) (-2758.859) [-2745.261] * (-2748.462) (-2746.495) (-2762.390) [-2746.523] -- 0:01:35
569000 -- (-2747.043) (-2744.166) (-2748.784) [-2749.471] * [-2746.411] (-2750.869) (-2753.567) (-2760.577) -- 0:01:34
570000 -- (-2748.898) [-2751.718] (-2749.996) (-2747.398) * [-2753.129] (-2749.239) (-2747.610) (-2757.244) -- 0:01:34
Average standard deviation of split frequencies: 0.029738
571000 -- (-2749.137) (-2747.394) (-2746.057) [-2746.936] * [-2747.111] (-2753.141) (-2747.363) (-2754.701) -- 0:01:34
572000 -- (-2748.766) [-2752.145] (-2755.043) (-2747.841) * [-2747.726] (-2753.428) (-2747.462) (-2748.558) -- 0:01:34
573000 -- (-2750.297) (-2752.287) [-2747.657] (-2745.267) * (-2749.627) (-2752.518) [-2744.726] (-2747.423) -- 0:01:33
574000 -- (-2747.662) (-2748.815) (-2756.474) [-2745.530] * [-2748.581] (-2748.407) (-2745.033) (-2750.331) -- 0:01:33
575000 -- (-2750.484) (-2752.145) (-2747.295) [-2750.367] * (-2747.818) (-2748.908) (-2749.769) [-2752.774] -- 0:01:33
Average standard deviation of split frequencies: 0.031918
576000 -- (-2755.693) [-2743.599] (-2752.933) (-2752.907) * [-2746.209] (-2755.205) (-2747.891) (-2754.160) -- 0:01:33
577000 -- [-2753.762] (-2749.107) (-2746.699) (-2750.105) * [-2755.129] (-2758.249) (-2747.879) (-2747.741) -- 0:01:33
578000 -- (-2753.275) (-2755.940) [-2752.606] (-2751.376) * [-2755.176] (-2753.406) (-2750.156) (-2750.127) -- 0:01:32
579000 -- (-2752.469) [-2751.573] (-2747.972) (-2747.324) * (-2748.872) (-2752.755) (-2753.771) [-2747.424] -- 0:01:32
580000 -- (-2746.416) (-2760.784) [-2750.606] (-2751.798) * (-2745.651) [-2758.431] (-2748.198) (-2752.686) -- 0:01:32
Average standard deviation of split frequencies: 0.033285
581000 -- [-2744.300] (-2749.468) (-2746.580) (-2747.549) * (-2747.763) (-2755.608) (-2745.927) [-2750.003] -- 0:01:32
582000 -- (-2748.127) (-2749.720) (-2745.401) [-2746.443] * (-2749.602) (-2758.360) (-2748.844) [-2746.253] -- 0:01:31
583000 -- [-2746.143] (-2759.207) (-2746.992) (-2756.458) * (-2749.420) (-2749.524) [-2748.685] (-2743.797) -- 0:01:31
584000 -- (-2749.391) (-2758.455) [-2747.457] (-2746.320) * (-2746.708) (-2756.677) [-2752.223] (-2746.157) -- 0:01:31
585000 -- (-2745.762) (-2747.092) (-2753.892) [-2745.198] * (-2752.330) (-2746.990) (-2748.637) [-2749.717] -- 0:01:31
Average standard deviation of split frequencies: 0.030569
586000 -- [-2746.017] (-2750.015) (-2757.271) (-2754.271) * [-2743.888] (-2755.903) (-2748.514) (-2750.983) -- 0:01:31
587000 -- (-2749.192) (-2746.206) [-2754.374] (-2749.734) * [-2748.104] (-2747.770) (-2751.074) (-2757.337) -- 0:01:30
588000 -- [-2745.429] (-2755.806) (-2752.451) (-2755.801) * (-2746.391) (-2747.755) [-2747.561] (-2754.064) -- 0:01:30
589000 -- (-2748.627) (-2757.799) [-2751.525] (-2745.215) * (-2748.045) [-2745.466] (-2751.972) (-2750.688) -- 0:01:30
590000 -- (-2755.113) (-2751.931) (-2749.761) [-2743.869] * (-2748.908) (-2745.055) [-2746.666] (-2746.788) -- 0:01:30
Average standard deviation of split frequencies: 0.032722
591000 -- (-2752.684) (-2747.932) [-2747.124] (-2746.745) * (-2752.039) (-2748.801) (-2750.402) [-2756.864] -- 0:01:29
592000 -- (-2749.160) (-2752.062) (-2755.292) [-2749.678] * (-2753.023) [-2748.790] (-2752.385) (-2744.684) -- 0:01:29
593000 -- [-2746.845] (-2751.574) (-2746.982) (-2750.647) * [-2751.206] (-2753.160) (-2754.640) (-2747.391) -- 0:01:29
594000 -- (-2748.834) [-2746.926] (-2750.282) (-2750.091) * [-2753.816] (-2754.887) (-2754.664) (-2748.150) -- 0:01:29
595000 -- (-2747.331) [-2752.120] (-2747.697) (-2752.225) * (-2752.519) (-2750.423) [-2747.966] (-2749.470) -- 0:01:29
Average standard deviation of split frequencies: 0.031638
596000 -- (-2747.998) (-2749.630) (-2759.138) [-2752.734] * [-2749.925] (-2750.388) (-2746.114) (-2756.732) -- 0:01:28
597000 -- [-2745.238] (-2753.268) (-2760.435) (-2752.854) * [-2749.528] (-2748.570) (-2750.642) (-2755.147) -- 0:01:28
598000 -- (-2747.135) [-2747.813] (-2745.311) (-2749.481) * (-2749.493) (-2748.682) (-2751.409) [-2749.956] -- 0:01:28
599000 -- (-2747.400) (-2750.133) [-2745.395] (-2755.145) * (-2748.024) (-2748.624) (-2753.064) [-2747.589] -- 0:01:28
600000 -- (-2744.624) (-2759.849) (-2753.511) [-2745.263] * [-2751.709] (-2752.063) (-2754.828) (-2752.672) -- 0:01:28
Average standard deviation of split frequencies: 0.032177
601000 -- (-2750.026) (-2757.268) [-2747.196] (-2752.419) * (-2750.867) [-2748.030] (-2753.506) (-2747.764) -- 0:01:27
602000 -- (-2749.602) [-2756.562] (-2753.999) (-2751.843) * [-2754.164] (-2747.884) (-2752.509) (-2758.925) -- 0:01:27
603000 -- (-2746.814) (-2751.115) [-2749.527] (-2756.197) * [-2746.692] (-2752.518) (-2747.622) (-2749.141) -- 0:01:27
604000 -- (-2750.704) (-2750.634) (-2754.509) [-2751.420] * [-2747.945] (-2747.832) (-2746.618) (-2750.455) -- 0:01:27
605000 -- (-2752.484) (-2754.076) [-2747.997] (-2750.759) * (-2750.261) (-2746.339) [-2747.183] (-2748.152) -- 0:01:26
Average standard deviation of split frequencies: 0.028004
606000 -- (-2749.331) (-2749.462) [-2748.598] (-2750.840) * (-2749.130) (-2747.564) (-2748.694) [-2749.681] -- 0:01:26
607000 -- (-2751.737) (-2746.885) (-2745.041) [-2745.776] * (-2750.026) [-2749.964] (-2753.261) (-2751.800) -- 0:01:26
608000 -- [-2747.756] (-2748.901) (-2748.431) (-2747.378) * [-2752.385] (-2752.158) (-2748.934) (-2746.737) -- 0:01:26
609000 -- (-2747.800) (-2749.160) (-2752.280) [-2751.480] * [-2755.267] (-2751.015) (-2746.414) (-2756.872) -- 0:01:26
610000 -- (-2746.534) (-2751.294) [-2757.338] (-2747.386) * (-2751.288) [-2749.540] (-2751.435) (-2753.489) -- 0:01:25
Average standard deviation of split frequencies: 0.026246
611000 -- (-2749.115) (-2752.199) (-2756.626) [-2748.287] * (-2755.200) (-2752.673) (-2754.076) [-2749.272] -- 0:01:25
612000 -- (-2750.079) (-2748.687) (-2755.798) [-2749.670] * (-2746.452) (-2753.865) (-2749.077) [-2750.479] -- 0:01:25
613000 -- (-2750.159) (-2753.882) [-2747.380] (-2747.292) * (-2747.735) (-2752.407) (-2746.305) [-2752.320] -- 0:01:25
614000 -- (-2758.147) (-2747.110) (-2746.824) [-2747.082] * (-2750.005) (-2751.227) (-2749.503) [-2752.097] -- 0:01:24
615000 -- (-2759.628) (-2751.191) [-2748.682] (-2753.734) * (-2754.331) (-2752.716) (-2748.222) [-2753.281] -- 0:01:24
Average standard deviation of split frequencies: 0.025636
616000 -- (-2749.995) (-2751.134) [-2755.297] (-2747.791) * [-2753.284] (-2754.308) (-2750.157) (-2751.243) -- 0:01:24
617000 -- (-2748.652) (-2755.484) (-2751.184) [-2754.065] * (-2751.058) [-2747.758] (-2751.235) (-2749.865) -- 0:01:24
618000 -- (-2750.950) (-2749.983) (-2751.463) [-2748.840] * (-2756.820) [-2747.807] (-2754.095) (-2753.752) -- 0:01:24
619000 -- [-2746.172] (-2750.125) (-2757.799) (-2746.615) * (-2757.576) [-2747.572] (-2755.887) (-2751.531) -- 0:01:23
620000 -- [-2747.316] (-2746.014) (-2748.120) (-2749.163) * [-2747.351] (-2752.691) (-2747.721) (-2749.936) -- 0:01:23
Average standard deviation of split frequencies: 0.022785
621000 -- (-2748.485) [-2746.498] (-2746.904) (-2745.478) * (-2745.774) [-2748.032] (-2747.323) (-2751.877) -- 0:01:23
622000 -- (-2751.142) (-2750.308) [-2752.030] (-2745.034) * (-2747.900) (-2750.096) [-2745.118] (-2751.908) -- 0:01:23
623000 -- (-2755.371) (-2755.643) [-2751.258] (-2752.925) * (-2747.743) [-2749.718] (-2751.392) (-2746.589) -- 0:01:22
624000 -- (-2749.610) (-2749.388) [-2752.208] (-2748.613) * (-2750.066) (-2752.489) [-2746.835] (-2753.839) -- 0:01:22
625000 -- [-2746.628] (-2748.759) (-2750.618) (-2755.744) * [-2752.596] (-2752.689) (-2750.184) (-2749.888) -- 0:01:22
Average standard deviation of split frequencies: 0.024097
626000 -- (-2751.607) [-2744.454] (-2749.182) (-2752.714) * [-2743.153] (-2756.058) (-2750.866) (-2748.661) -- 0:01:22
627000 -- (-2753.082) (-2743.765) (-2753.458) [-2750.548] * (-2753.141) (-2751.158) [-2747.312] (-2750.332) -- 0:01:22
628000 -- (-2750.934) [-2752.528] (-2753.945) (-2745.937) * (-2753.650) (-2749.372) (-2744.872) [-2756.572] -- 0:01:21
629000 -- (-2752.488) (-2746.312) [-2752.277] (-2753.117) * (-2747.009) (-2751.239) (-2748.056) [-2749.290] -- 0:01:21
630000 -- (-2749.714) (-2749.045) [-2746.205] (-2748.358) * (-2747.529) (-2755.698) (-2745.682) [-2748.088] -- 0:01:21
Average standard deviation of split frequencies: 0.026161
631000 -- (-2752.354) (-2752.101) [-2743.728] (-2755.588) * (-2749.607) (-2751.634) [-2750.019] (-2749.345) -- 0:01:21
632000 -- (-2748.045) (-2754.167) [-2749.956] (-2748.611) * (-2747.954) (-2747.563) (-2749.232) [-2746.474] -- 0:01:20
633000 -- [-2751.251] (-2753.271) (-2747.783) (-2751.153) * [-2750.178] (-2756.435) (-2751.580) (-2747.999) -- 0:01:20
634000 -- (-2749.418) (-2749.783) (-2750.380) [-2745.729] * (-2748.791) (-2754.459) [-2750.518] (-2746.853) -- 0:01:20
635000 -- (-2753.003) (-2745.059) [-2747.613] (-2755.854) * (-2749.835) [-2745.469] (-2752.508) (-2744.833) -- 0:01:20
Average standard deviation of split frequencies: 0.025201
636000 -- [-2751.152] (-2754.965) (-2752.072) (-2754.146) * (-2756.994) (-2744.393) [-2748.293] (-2755.723) -- 0:01:20
637000 -- (-2760.025) (-2746.941) [-2748.983] (-2750.014) * (-2753.599) (-2750.413) (-2748.080) [-2744.959] -- 0:01:19
638000 -- (-2748.497) (-2750.397) [-2746.375] (-2749.860) * (-2748.311) (-2748.260) (-2752.185) [-2749.300] -- 0:01:19
639000 -- (-2751.525) [-2752.056] (-2748.762) (-2755.807) * (-2748.684) (-2749.213) [-2743.732] (-2747.624) -- 0:01:19
640000 -- (-2756.892) (-2748.870) [-2744.756] (-2750.889) * [-2744.254] (-2748.698) (-2747.587) (-2751.346) -- 0:01:19
Average standard deviation of split frequencies: 0.026489
641000 -- (-2749.778) (-2747.490) [-2748.148] (-2750.368) * (-2751.349) (-2750.900) (-2748.503) [-2746.527] -- 0:01:18
642000 -- [-2748.001] (-2753.411) (-2751.904) (-2750.525) * [-2752.411] (-2748.922) (-2764.108) (-2752.933) -- 0:01:18
643000 -- [-2746.672] (-2750.254) (-2752.542) (-2749.801) * (-2753.924) (-2753.570) (-2756.443) [-2746.686] -- 0:01:18
644000 -- (-2744.553) (-2750.100) [-2749.811] (-2747.266) * (-2754.503) (-2746.853) [-2750.204] (-2751.080) -- 0:01:18
645000 -- (-2748.898) (-2751.014) [-2751.685] (-2750.357) * (-2748.926) [-2745.498] (-2747.400) (-2746.805) -- 0:01:18
Average standard deviation of split frequencies: 0.024811
646000 -- (-2751.867) (-2746.643) (-2756.411) [-2745.946] * (-2751.933) [-2754.384] (-2748.390) (-2752.262) -- 0:01:17
647000 -- [-2748.628] (-2749.731) (-2752.970) (-2748.527) * (-2753.710) [-2746.118] (-2750.979) (-2744.968) -- 0:01:17
648000 -- [-2749.610] (-2747.966) (-2750.098) (-2752.122) * (-2756.029) (-2747.804) [-2746.358] (-2748.088) -- 0:01:17
649000 -- (-2752.415) [-2746.421] (-2749.337) (-2754.584) * (-2744.485) [-2750.665] (-2747.878) (-2751.018) -- 0:01:17
650000 -- (-2761.763) [-2747.483] (-2746.358) (-2749.736) * (-2750.382) (-2752.229) (-2763.062) [-2746.311] -- 0:01:17
Average standard deviation of split frequencies: 0.028255
651000 -- (-2759.197) (-2747.010) [-2752.705] (-2751.019) * [-2748.558] (-2757.638) (-2754.099) (-2749.444) -- 0:01:16
652000 -- (-2749.083) [-2749.835] (-2752.055) (-2744.182) * (-2750.930) (-2747.455) (-2747.806) [-2749.050] -- 0:01:16
653000 -- (-2749.970) [-2748.350] (-2747.938) (-2746.605) * (-2749.345) (-2756.633) (-2752.806) [-2752.033] -- 0:01:16
654000 -- (-2751.591) [-2747.540] (-2745.007) (-2747.809) * [-2748.589] (-2758.181) (-2750.924) (-2748.542) -- 0:01:16
655000 -- (-2751.866) (-2747.068) (-2755.877) [-2748.511] * (-2757.114) (-2753.358) (-2748.506) [-2749.315] -- 0:01:15
Average standard deviation of split frequencies: 0.028385
656000 -- (-2752.878) (-2749.563) (-2751.796) [-2745.233] * [-2754.895] (-2751.853) (-2750.231) (-2750.691) -- 0:01:15
657000 -- (-2755.769) [-2749.620] (-2751.542) (-2748.077) * [-2755.284] (-2752.834) (-2750.105) (-2753.591) -- 0:01:15
658000 -- (-2754.125) [-2751.350] (-2748.073) (-2747.866) * (-2748.050) [-2751.717] (-2749.621) (-2748.689) -- 0:01:15
659000 -- (-2749.546) (-2751.006) [-2746.974] (-2744.033) * (-2754.724) (-2750.133) (-2747.441) [-2750.386] -- 0:01:15
660000 -- (-2751.251) (-2750.021) [-2748.262] (-2751.634) * (-2754.056) [-2751.800] (-2752.384) (-2749.925) -- 0:01:14
Average standard deviation of split frequencies: 0.026757
661000 -- (-2748.194) (-2752.798) (-2754.104) [-2747.099] * (-2749.376) [-2750.228] (-2749.186) (-2748.352) -- 0:01:14
662000 -- (-2743.939) [-2747.441] (-2750.939) (-2749.750) * (-2753.298) (-2750.845) (-2749.622) [-2748.151] -- 0:01:14
663000 -- [-2747.799] (-2749.800) (-2747.231) (-2754.757) * (-2751.968) [-2744.880] (-2755.349) (-2748.441) -- 0:01:14
664000 -- (-2746.069) (-2746.566) [-2750.239] (-2751.498) * [-2755.726] (-2748.869) (-2751.531) (-2743.311) -- 0:01:13
665000 -- (-2756.098) [-2742.182] (-2754.007) (-2751.883) * (-2746.517) (-2750.538) (-2750.371) [-2747.438] -- 0:01:13
Average standard deviation of split frequencies: 0.025481
666000 -- [-2754.899] (-2748.893) (-2747.610) (-2749.331) * (-2755.906) (-2747.480) (-2745.703) [-2745.149] -- 0:01:13
667000 -- (-2756.244) (-2751.278) [-2747.983] (-2750.485) * (-2747.620) (-2748.319) (-2748.683) [-2747.265] -- 0:01:13
668000 -- (-2751.380) (-2743.836) [-2748.583] (-2755.028) * [-2752.844] (-2750.457) (-2749.733) (-2749.946) -- 0:01:13
669000 -- (-2750.258) (-2747.936) [-2749.491] (-2746.046) * (-2751.435) (-2748.506) [-2746.263] (-2748.626) -- 0:01:12
670000 -- (-2755.878) (-2747.407) (-2749.852) [-2750.643] * (-2753.262) [-2742.860] (-2746.447) (-2748.325) -- 0:01:12
Average standard deviation of split frequencies: 0.023547
671000 -- (-2751.910) [-2745.156] (-2747.323) (-2747.906) * (-2747.850) (-2751.392) [-2746.295] (-2751.439) -- 0:01:12
672000 -- (-2757.121) [-2753.770] (-2744.689) (-2749.251) * (-2745.991) (-2745.162) [-2744.981] (-2748.396) -- 0:01:12
673000 -- [-2747.080] (-2747.617) (-2752.293) (-2751.523) * (-2748.373) (-2760.336) (-2745.018) [-2758.483] -- 0:01:11
674000 -- (-2745.646) (-2749.004) [-2747.261] (-2754.894) * (-2755.212) [-2746.950] (-2751.834) (-2748.176) -- 0:01:11
675000 -- (-2749.260) (-2744.094) [-2746.559] (-2758.170) * (-2749.512) [-2749.398] (-2747.681) (-2745.815) -- 0:01:11
Average standard deviation of split frequencies: 0.027545
676000 -- (-2748.646) (-2751.491) [-2745.050] (-2755.053) * (-2749.481) (-2748.677) [-2749.638] (-2750.921) -- 0:01:11
677000 -- [-2746.057] (-2748.754) (-2752.784) (-2763.517) * [-2752.434] (-2755.721) (-2757.533) (-2747.334) -- 0:01:11
678000 -- (-2749.610) (-2748.444) [-2748.146] (-2748.688) * (-2751.508) [-2749.344] (-2757.693) (-2746.249) -- 0:01:10
679000 -- (-2754.867) [-2747.890] (-2752.722) (-2750.881) * (-2746.821) (-2749.646) (-2754.958) [-2744.715] -- 0:01:10
680000 -- (-2751.390) (-2751.781) (-2747.228) [-2744.852] * (-2748.949) [-2746.033] (-2750.137) (-2756.879) -- 0:01:10
Average standard deviation of split frequencies: 0.024932
681000 -- (-2747.938) (-2751.774) [-2747.372] (-2747.343) * (-2750.470) (-2746.241) [-2754.352] (-2749.926) -- 0:01:10
682000 -- (-2747.552) (-2752.942) [-2750.722] (-2749.030) * (-2750.207) (-2747.952) [-2749.813] (-2750.614) -- 0:01:09
683000 -- [-2747.045] (-2751.467) (-2748.167) (-2751.426) * (-2752.374) [-2752.987] (-2753.542) (-2752.946) -- 0:01:09
684000 -- (-2744.308) (-2759.141) (-2745.654) [-2751.595] * (-2748.379) [-2743.994] (-2749.253) (-2750.928) -- 0:01:09
685000 -- (-2755.616) [-2747.145] (-2752.908) (-2750.624) * (-2756.030) [-2751.412] (-2751.001) (-2745.913) -- 0:01:09
Average standard deviation of split frequencies: 0.023364
686000 -- [-2752.649] (-2747.269) (-2753.251) (-2748.447) * (-2749.807) (-2751.695) [-2750.735] (-2746.774) -- 0:01:09
687000 -- [-2744.656] (-2753.208) (-2750.010) (-2752.553) * (-2759.212) [-2747.528] (-2753.303) (-2744.757) -- 0:01:08
688000 -- (-2754.973) (-2752.115) [-2742.984] (-2756.958) * [-2747.426] (-2744.179) (-2755.064) (-2747.103) -- 0:01:08
689000 -- [-2747.488] (-2746.432) (-2749.472) (-2746.650) * (-2750.338) [-2748.467] (-2748.787) (-2749.796) -- 0:01:08
690000 -- [-2746.912] (-2749.041) (-2756.270) (-2744.511) * (-2748.573) (-2745.757) (-2750.550) [-2746.022] -- 0:01:08
Average standard deviation of split frequencies: 0.022524
691000 -- [-2746.866] (-2754.315) (-2746.601) (-2747.481) * (-2755.863) (-2745.786) [-2750.748] (-2751.258) -- 0:01:07
692000 -- [-2750.137] (-2750.792) (-2751.880) (-2747.211) * (-2747.877) (-2748.922) (-2748.058) [-2744.590] -- 0:01:07
693000 -- (-2749.603) (-2750.388) [-2747.159] (-2745.855) * (-2745.786) (-2754.099) [-2750.578] (-2758.380) -- 0:01:07
694000 -- (-2748.705) [-2747.648] (-2748.423) (-2747.455) * (-2747.300) (-2750.536) (-2750.138) [-2747.250] -- 0:01:07
695000 -- (-2748.524) [-2753.467] (-2751.684) (-2750.914) * [-2753.114] (-2749.902) (-2751.136) (-2750.140) -- 0:01:07
Average standard deviation of split frequencies: 0.024044
696000 -- [-2746.612] (-2751.086) (-2748.126) (-2752.269) * (-2748.286) (-2748.126) (-2749.766) [-2755.318] -- 0:01:06
697000 -- (-2744.361) [-2751.349] (-2747.523) (-2747.410) * [-2747.906] (-2750.762) (-2751.652) (-2748.324) -- 0:01:06
698000 -- (-2755.560) (-2747.173) (-2743.816) [-2744.830] * (-2750.000) (-2753.770) (-2750.960) [-2752.476] -- 0:01:06
699000 -- (-2747.776) (-2745.321) [-2747.917] (-2753.056) * [-2749.234] (-2749.878) (-2743.292) (-2748.302) -- 0:01:06
700000 -- (-2751.875) (-2752.812) [-2747.358] (-2753.285) * (-2751.964) (-2753.681) [-2748.375] (-2752.543) -- 0:01:06
Average standard deviation of split frequencies: 0.024557
701000 -- (-2746.550) (-2754.907) (-2748.063) [-2742.648] * (-2748.659) [-2745.522] (-2753.305) (-2751.844) -- 0:01:05
702000 -- [-2749.470] (-2751.053) (-2752.668) (-2749.013) * (-2747.514) [-2751.970] (-2754.318) (-2750.517) -- 0:01:05
703000 -- [-2747.902] (-2751.597) (-2751.941) (-2744.905) * (-2748.100) [-2743.467] (-2753.527) (-2753.660) -- 0:01:05
704000 -- [-2748.649] (-2756.970) (-2750.228) (-2746.203) * (-2746.230) (-2749.041) (-2752.216) [-2746.446] -- 0:01:05
705000 -- [-2746.552] (-2747.968) (-2745.146) (-2750.308) * (-2744.396) [-2755.999] (-2750.893) (-2754.418) -- 0:01:04
Average standard deviation of split frequencies: 0.024371
706000 -- (-2746.566) (-2750.864) [-2751.569] (-2748.971) * [-2749.759] (-2747.133) (-2755.578) (-2755.401) -- 0:01:04
707000 -- (-2748.344) (-2758.297) (-2744.793) [-2755.340] * (-2758.529) (-2746.756) [-2754.015] (-2746.293) -- 0:01:04
708000 -- (-2747.532) (-2748.065) [-2749.727] (-2745.749) * (-2754.317) (-2754.302) [-2754.024] (-2750.715) -- 0:01:04
709000 -- (-2751.822) [-2754.802] (-2752.735) (-2752.814) * (-2747.799) (-2747.431) [-2752.638] (-2748.676) -- 0:01:04
710000 -- (-2745.385) (-2754.656) [-2751.474] (-2746.166) * (-2751.415) (-2747.480) [-2749.454] (-2757.868) -- 0:01:03
Average standard deviation of split frequencies: 0.022221
711000 -- [-2747.010] (-2750.040) (-2751.731) (-2744.534) * [-2753.777] (-2756.448) (-2753.937) (-2751.080) -- 0:01:03
712000 -- [-2746.674] (-2748.899) (-2754.426) (-2751.440) * (-2754.838) [-2746.920] (-2756.866) (-2749.926) -- 0:01:03
713000 -- (-2747.809) (-2753.263) (-2751.322) [-2749.930] * (-2752.194) (-2746.004) (-2755.869) [-2749.735] -- 0:01:03
714000 -- (-2757.671) (-2746.459) (-2745.766) [-2750.211] * [-2751.078] (-2754.201) (-2751.392) (-2749.360) -- 0:01:02
715000 -- (-2755.064) (-2747.897) (-2743.897) [-2751.823] * (-2749.840) (-2743.718) [-2749.770] (-2749.913) -- 0:01:02
Average standard deviation of split frequencies: 0.021727
716000 -- (-2758.065) (-2747.066) [-2746.854] (-2750.504) * (-2762.753) [-2747.545] (-2753.858) (-2752.257) -- 0:01:02
717000 -- (-2753.082) (-2751.505) (-2752.248) [-2743.381] * (-2756.955) (-2749.646) (-2746.037) [-2749.600] -- 0:01:02
718000 -- (-2745.694) [-2747.177] (-2751.213) (-2752.105) * (-2745.309) [-2748.803] (-2751.534) (-2751.969) -- 0:01:02
719000 -- (-2748.215) (-2747.216) [-2744.858] (-2764.969) * (-2747.403) (-2751.895) [-2752.542] (-2750.745) -- 0:01:01
720000 -- (-2753.232) (-2753.041) [-2745.689] (-2756.403) * (-2746.876) [-2746.267] (-2753.069) (-2746.226) -- 0:01:01
Average standard deviation of split frequencies: 0.018643
721000 -- (-2751.799) (-2744.583) [-2746.536] (-2755.926) * [-2749.046] (-2756.606) (-2748.294) (-2754.045) -- 0:01:01
722000 -- (-2757.749) (-2750.099) (-2745.451) [-2753.088] * (-2747.019) (-2746.872) [-2753.212] (-2743.428) -- 0:01:01
723000 -- (-2748.375) [-2749.558] (-2751.012) (-2752.982) * [-2750.881] (-2751.057) (-2750.241) (-2747.217) -- 0:01:00
724000 -- (-2750.650) [-2745.059] (-2760.957) (-2751.646) * (-2753.290) [-2749.314] (-2750.252) (-2743.471) -- 0:01:00
725000 -- [-2753.768] (-2749.246) (-2752.993) (-2755.401) * (-2750.767) [-2748.106] (-2748.541) (-2753.278) -- 0:01:00
Average standard deviation of split frequencies: 0.016233
726000 -- (-2747.262) [-2747.319] (-2750.075) (-2753.775) * (-2750.410) (-2752.001) (-2748.011) [-2749.971] -- 0:01:00
727000 -- [-2749.337] (-2750.394) (-2751.160) (-2753.666) * [-2745.538] (-2750.787) (-2749.777) (-2751.137) -- 0:01:00
728000 -- (-2747.729) (-2747.303) [-2745.056] (-2745.440) * [-2746.678] (-2750.851) (-2753.051) (-2744.522) -- 0:00:59
729000 -- (-2753.651) (-2745.643) (-2747.394) [-2753.815] * (-2753.014) (-2750.159) [-2750.367] (-2749.208) -- 0:00:59
730000 -- (-2752.518) (-2747.476) (-2750.044) [-2753.139] * (-2750.902) (-2750.757) (-2755.204) [-2748.798] -- 0:00:59
Average standard deviation of split frequencies: 0.017742
731000 -- (-2756.143) [-2746.390] (-2745.930) (-2747.584) * (-2750.698) [-2751.566] (-2748.954) (-2751.464) -- 0:00:59
732000 -- (-2747.042) (-2748.831) (-2749.622) [-2744.629] * (-2748.902) (-2749.249) (-2745.977) [-2746.274] -- 0:00:58
733000 -- [-2748.232] (-2745.786) (-2748.080) (-2748.318) * (-2746.777) (-2750.789) (-2751.079) [-2752.458] -- 0:00:58
734000 -- (-2749.315) [-2749.004] (-2749.261) (-2749.796) * [-2754.077] (-2749.477) (-2746.806) (-2752.327) -- 0:00:58
735000 -- (-2746.797) (-2749.178) (-2748.377) [-2746.384] * (-2749.277) [-2746.064] (-2747.963) (-2748.990) -- 0:00:58
Average standard deviation of split frequencies: 0.018254
736000 -- [-2752.424] (-2755.859) (-2748.271) (-2745.888) * [-2747.940] (-2751.801) (-2744.650) (-2752.331) -- 0:00:58
737000 -- (-2748.377) [-2746.955] (-2750.731) (-2757.810) * (-2752.723) (-2744.096) [-2755.077] (-2753.343) -- 0:00:57
738000 -- (-2749.622) (-2748.630) [-2755.218] (-2747.715) * [-2749.868] (-2747.568) (-2752.031) (-2750.796) -- 0:00:57
739000 -- (-2753.812) (-2756.717) (-2748.196) [-2749.954] * (-2750.245) (-2744.175) (-2743.803) [-2746.850] -- 0:00:57
740000 -- [-2748.598] (-2751.284) (-2754.545) (-2749.688) * (-2756.424) (-2746.876) (-2745.656) [-2750.734] -- 0:00:57
Average standard deviation of split frequencies: 0.015275
741000 -- (-2745.364) [-2748.726] (-2757.930) (-2750.795) * (-2750.289) [-2748.708] (-2749.944) (-2746.062) -- 0:00:56
742000 -- (-2748.150) (-2745.934) [-2751.684] (-2747.766) * [-2747.505] (-2756.471) (-2750.497) (-2750.374) -- 0:00:56
743000 -- (-2747.290) (-2751.398) (-2752.065) [-2747.402] * (-2753.080) (-2756.265) [-2745.555] (-2751.637) -- 0:00:56
744000 -- (-2745.153) [-2749.594] (-2749.180) (-2748.089) * [-2747.163] (-2754.344) (-2745.969) (-2758.394) -- 0:00:56
745000 -- (-2748.760) [-2750.537] (-2749.101) (-2745.170) * [-2749.075] (-2750.236) (-2744.172) (-2756.503) -- 0:00:56
Average standard deviation of split frequencies: 0.015798
746000 -- (-2746.817) [-2756.420] (-2756.767) (-2749.552) * (-2755.339) [-2747.800] (-2747.133) (-2754.926) -- 0:00:55
747000 -- (-2748.439) [-2746.602] (-2752.451) (-2747.269) * (-2749.686) [-2752.640] (-2750.697) (-2747.098) -- 0:00:55
748000 -- (-2749.832) (-2745.694) (-2746.019) [-2748.751] * (-2751.448) [-2748.361] (-2746.410) (-2752.552) -- 0:00:55
749000 -- (-2747.187) [-2746.210] (-2749.159) (-2750.736) * (-2746.830) (-2754.017) [-2749.539] (-2751.725) -- 0:00:55
750000 -- (-2750.655) (-2748.462) [-2746.688] (-2757.621) * (-2749.189) [-2748.885] (-2752.439) (-2751.492) -- 0:00:55
Average standard deviation of split frequencies: 0.016328
751000 -- (-2754.706) (-2750.470) [-2748.512] (-2754.056) * (-2751.239) (-2747.892) [-2757.691] (-2755.651) -- 0:00:54
752000 -- (-2745.699) [-2749.961] (-2749.229) (-2754.883) * [-2752.220] (-2748.162) (-2749.966) (-2757.592) -- 0:00:54
753000 -- (-2751.820) (-2750.697) (-2751.946) [-2756.394] * (-2748.293) (-2748.138) [-2754.736] (-2756.083) -- 0:00:54
754000 -- (-2752.634) (-2749.616) [-2749.931] (-2757.430) * (-2750.455) (-2753.445) (-2755.431) [-2748.469] -- 0:00:54
755000 -- (-2751.994) [-2743.867] (-2746.928) (-2753.256) * [-2751.768] (-2751.447) (-2753.887) (-2752.250) -- 0:00:53
Average standard deviation of split frequencies: 0.013718
756000 -- (-2755.491) (-2748.226) [-2746.862] (-2748.375) * (-2754.819) [-2745.005] (-2753.511) (-2749.593) -- 0:00:53
757000 -- [-2751.633] (-2749.696) (-2746.040) (-2744.702) * [-2752.971] (-2744.744) (-2758.336) (-2755.302) -- 0:00:53
758000 -- (-2753.146) (-2747.498) [-2748.741] (-2758.888) * [-2753.681] (-2750.001) (-2748.811) (-2752.096) -- 0:00:53
759000 -- (-2751.944) [-2747.095] (-2751.154) (-2758.021) * [-2750.455] (-2749.071) (-2749.384) (-2748.911) -- 0:00:53
760000 -- (-2750.290) [-2746.873] (-2750.527) (-2751.399) * [-2749.336] (-2750.691) (-2756.859) (-2755.172) -- 0:00:52
Average standard deviation of split frequencies: 0.015493
761000 -- (-2745.395) (-2747.940) (-2757.846) [-2751.327] * (-2759.278) [-2747.633] (-2755.752) (-2753.116) -- 0:00:52
762000 -- (-2748.471) (-2745.868) [-2751.386] (-2762.456) * (-2760.115) (-2750.035) (-2748.612) [-2747.171] -- 0:00:52
763000 -- (-2750.126) (-2752.999) (-2755.775) [-2745.230] * (-2751.768) (-2753.020) [-2750.971] (-2743.894) -- 0:00:52
764000 -- (-2747.710) (-2748.883) (-2746.324) [-2746.183] * (-2759.022) [-2745.929] (-2747.764) (-2749.374) -- 0:00:51
765000 -- (-2752.236) [-2745.332] (-2748.794) (-2753.915) * (-2752.409) (-2748.660) [-2749.374] (-2754.139) -- 0:00:51
Average standard deviation of split frequencies: 0.014462
766000 -- (-2748.224) [-2752.062] (-2753.189) (-2747.101) * (-2752.426) (-2749.287) (-2752.071) [-2747.607] -- 0:00:51
767000 -- (-2750.778) (-2748.875) (-2747.338) [-2746.050] * [-2744.467] (-2748.094) (-2754.571) (-2747.755) -- 0:00:51
768000 -- [-2749.119] (-2745.515) (-2745.413) (-2752.098) * [-2746.427] (-2751.291) (-2747.041) (-2749.050) -- 0:00:51
769000 -- (-2747.723) [-2753.571] (-2747.603) (-2748.591) * [-2745.178] (-2748.708) (-2752.078) (-2748.692) -- 0:00:50
770000 -- (-2750.719) (-2754.661) (-2747.636) [-2749.857] * (-2749.506) (-2749.848) [-2752.885] (-2752.109) -- 0:00:50
Average standard deviation of split frequencies: 0.014375
771000 -- (-2746.883) (-2746.008) (-2747.171) [-2743.091] * (-2749.439) (-2748.145) (-2752.209) [-2750.611] -- 0:00:50
772000 -- (-2752.266) [-2752.798] (-2752.735) (-2748.400) * (-2752.389) [-2749.541] (-2747.044) (-2753.143) -- 0:00:50
773000 -- (-2751.249) [-2743.715] (-2750.049) (-2747.544) * (-2751.160) (-2745.145) (-2749.252) [-2745.763] -- 0:00:49
774000 -- (-2752.600) [-2749.925] (-2751.550) (-2751.176) * (-2750.519) (-2750.431) (-2744.392) [-2754.065] -- 0:00:49
775000 -- (-2752.859) (-2749.996) (-2753.112) [-2745.507] * (-2748.318) [-2749.777] (-2749.857) (-2749.921) -- 0:00:49
Average standard deviation of split frequencies: 0.013972
776000 -- [-2745.043] (-2759.711) (-2753.387) (-2748.833) * [-2749.308] (-2753.028) (-2758.251) (-2749.003) -- 0:00:49
777000 -- [-2743.593] (-2750.883) (-2749.733) (-2751.744) * (-2743.881) (-2757.331) (-2752.905) [-2748.277] -- 0:00:49
778000 -- (-2753.943) (-2754.169) [-2749.446] (-2752.577) * [-2748.833] (-2749.533) (-2753.694) (-2761.038) -- 0:00:48
779000 -- (-2752.429) (-2747.598) [-2751.004] (-2757.106) * (-2750.719) (-2751.246) [-2749.434] (-2751.565) -- 0:00:48
780000 -- [-2749.911] (-2750.377) (-2750.303) (-2747.524) * [-2746.540] (-2750.425) (-2746.645) (-2750.578) -- 0:00:48
Average standard deviation of split frequencies: 0.012681
781000 -- (-2753.521) (-2746.508) (-2750.644) [-2752.189] * (-2750.367) (-2748.899) [-2749.142] (-2750.586) -- 0:00:48
782000 -- [-2744.965] (-2753.264) (-2751.897) (-2751.629) * (-2747.484) (-2746.648) (-2746.086) [-2746.778] -- 0:00:47
783000 -- [-2746.713] (-2755.307) (-2751.855) (-2747.037) * (-2745.450) [-2746.909] (-2754.421) (-2745.898) -- 0:00:47
784000 -- (-2752.983) (-2753.091) [-2748.967] (-2749.588) * (-2748.124) (-2753.446) [-2745.026] (-2748.878) -- 0:00:47
785000 -- (-2747.023) (-2756.875) (-2754.944) [-2748.096] * (-2750.889) (-2748.933) [-2747.353] (-2747.607) -- 0:00:47
Average standard deviation of split frequencies: 0.010496
786000 -- (-2748.571) (-2758.162) [-2749.882] (-2747.733) * (-2760.783) [-2746.281] (-2758.685) (-2749.737) -- 0:00:47
787000 -- [-2751.987] (-2754.512) (-2765.577) (-2754.771) * (-2748.700) [-2748.717] (-2752.497) (-2746.327) -- 0:00:46
788000 -- [-2749.546] (-2753.223) (-2755.714) (-2747.015) * [-2746.250] (-2751.479) (-2753.296) (-2753.960) -- 0:00:46
789000 -- [-2750.520] (-2758.153) (-2768.085) (-2746.358) * [-2750.955] (-2753.964) (-2754.651) (-2750.565) -- 0:00:46
790000 -- (-2749.499) (-2751.742) [-2757.577] (-2750.099) * (-2748.148) (-2744.667) (-2754.785) [-2752.832] -- 0:00:46
Average standard deviation of split frequencies: 0.013117
791000 -- (-2745.395) (-2751.981) (-2752.382) [-2748.330] * [-2745.167] (-2745.496) (-2755.595) (-2746.485) -- 0:00:45
792000 -- [-2745.624] (-2748.931) (-2753.045) (-2747.037) * [-2749.860] (-2753.286) (-2754.800) (-2749.922) -- 0:00:45
793000 -- [-2753.119] (-2750.269) (-2750.066) (-2753.776) * (-2752.298) (-2750.220) (-2754.786) [-2745.344] -- 0:00:45
794000 -- (-2755.879) [-2754.179] (-2750.292) (-2749.445) * [-2744.627] (-2746.583) (-2761.056) (-2746.005) -- 0:00:45
795000 -- (-2759.630) (-2745.715) [-2750.268] (-2751.103) * [-2747.496] (-2748.453) (-2753.222) (-2744.572) -- 0:00:45
Average standard deviation of split frequencies: 0.013621
796000 -- (-2747.187) (-2747.999) (-2744.756) [-2745.754] * (-2745.588) [-2746.676] (-2747.515) (-2746.510) -- 0:00:44
797000 -- [-2751.055] (-2745.073) (-2745.218) (-2753.212) * (-2753.376) (-2752.463) [-2750.500] (-2750.489) -- 0:00:44
798000 -- (-2751.652) (-2751.281) (-2754.726) [-2746.076] * (-2754.299) (-2757.027) (-2745.177) [-2751.105] -- 0:00:44
799000 -- (-2752.434) (-2752.742) (-2753.460) [-2745.977] * [-2749.202] (-2744.074) (-2745.640) (-2750.820) -- 0:00:44
800000 -- (-2754.663) (-2757.069) [-2749.959] (-2746.046) * (-2748.779) [-2751.053] (-2755.069) (-2749.864) -- 0:00:44
Average standard deviation of split frequencies: 0.015897
801000 -- (-2749.663) (-2750.126) (-2743.979) [-2750.746] * (-2755.287) [-2749.922] (-2747.092) (-2752.039) -- 0:00:43
802000 -- [-2750.464] (-2747.765) (-2750.841) (-2750.773) * (-2752.875) (-2754.211) [-2749.150] (-2751.689) -- 0:00:43
803000 -- (-2753.053) [-2747.769] (-2748.523) (-2754.070) * [-2748.533] (-2747.397) (-2751.386) (-2747.936) -- 0:00:43
804000 -- (-2749.126) (-2742.399) [-2754.009] (-2753.899) * (-2750.521) [-2744.186] (-2754.158) (-2752.615) -- 0:00:43
805000 -- [-2748.517] (-2750.726) (-2756.134) (-2760.663) * (-2751.672) [-2752.355] (-2750.806) (-2749.132) -- 0:00:42
Average standard deviation of split frequencies: 0.014622
806000 -- (-2749.636) (-2751.067) [-2747.281] (-2754.305) * [-2750.241] (-2752.059) (-2756.606) (-2757.642) -- 0:00:42
807000 -- (-2749.791) (-2750.471) (-2747.363) [-2749.368] * (-2752.062) [-2749.110] (-2755.652) (-2752.532) -- 0:00:42
808000 -- (-2751.055) (-2749.291) (-2749.175) [-2751.436] * (-2751.941) [-2751.554] (-2749.213) (-2758.002) -- 0:00:42
809000 -- (-2747.533) (-2752.942) (-2750.819) [-2748.466] * (-2751.389) (-2748.159) [-2746.786] (-2750.370) -- 0:00:42
810000 -- (-2749.959) [-2746.833] (-2757.863) (-2754.391) * (-2755.544) [-2744.252] (-2755.090) (-2748.626) -- 0:00:41
Average standard deviation of split frequencies: 0.016282
811000 -- [-2749.721] (-2746.536) (-2751.299) (-2756.540) * [-2747.805] (-2758.740) (-2750.639) (-2751.995) -- 0:00:41
812000 -- (-2747.405) (-2747.867) [-2748.874] (-2760.521) * (-2748.097) [-2745.461] (-2747.219) (-2750.791) -- 0:00:41
813000 -- (-2745.100) (-2747.192) (-2748.606) [-2746.947] * (-2750.704) (-2755.656) [-2745.344] (-2756.721) -- 0:00:41
814000 -- (-2754.111) (-2749.918) [-2745.419] (-2747.038) * [-2743.400] (-2755.108) (-2748.371) (-2756.128) -- 0:00:40
815000 -- [-2748.080] (-2746.320) (-2752.270) (-2753.503) * [-2748.817] (-2750.839) (-2750.759) (-2745.897) -- 0:00:40
Average standard deviation of split frequencies: 0.013576
816000 -- (-2749.724) (-2746.508) (-2746.578) [-2744.614] * (-2749.749) [-2744.257] (-2751.911) (-2751.458) -- 0:00:40
817000 -- (-2747.556) (-2746.868) (-2750.604) [-2748.391] * (-2755.219) (-2750.848) [-2755.109] (-2745.340) -- 0:00:40
818000 -- (-2746.684) [-2747.862] (-2750.911) (-2749.445) * (-2750.193) (-2751.566) (-2747.342) [-2748.239] -- 0:00:40
819000 -- (-2746.040) (-2747.393) (-2750.607) [-2752.777] * (-2750.088) [-2752.110] (-2749.596) (-2749.559) -- 0:00:39
820000 -- (-2749.553) (-2750.512) [-2746.260] (-2752.847) * [-2748.640] (-2745.128) (-2749.515) (-2747.980) -- 0:00:39
Average standard deviation of split frequencies: 0.011488
821000 -- (-2749.067) (-2756.480) [-2755.322] (-2750.707) * [-2750.840] (-2748.969) (-2755.542) (-2755.467) -- 0:00:39
822000 -- (-2748.166) (-2749.416) (-2748.856) [-2752.252] * [-2750.061] (-2748.929) (-2751.244) (-2745.591) -- 0:00:39
823000 -- (-2745.827) (-2752.376) [-2749.240] (-2746.995) * (-2744.487) (-2751.638) (-2752.415) [-2746.066] -- 0:00:38
824000 -- (-2751.824) [-2748.321] (-2753.710) (-2747.634) * (-2755.221) (-2754.131) (-2749.510) [-2746.871] -- 0:00:38
825000 -- (-2749.164) (-2753.012) (-2747.153) [-2747.965] * (-2752.997) [-2746.265] (-2746.763) (-2755.884) -- 0:00:38
Average standard deviation of split frequencies: 0.009987
826000 -- (-2748.750) (-2746.934) [-2749.363] (-2753.178) * (-2754.608) (-2745.603) [-2746.902] (-2754.528) -- 0:00:38
827000 -- (-2749.723) [-2747.762] (-2751.967) (-2748.602) * (-2751.706) [-2749.618] (-2745.357) (-2748.254) -- 0:00:38
828000 -- [-2748.801] (-2748.675) (-2755.664) (-2757.843) * (-2751.033) (-2746.335) [-2745.153] (-2747.709) -- 0:00:37
829000 -- (-2752.133) [-2750.614] (-2755.818) (-2745.711) * [-2749.892] (-2745.207) (-2745.116) (-2749.885) -- 0:00:37
830000 -- [-2747.135] (-2751.199) (-2760.140) (-2749.690) * [-2750.503] (-2748.032) (-2753.618) (-2745.632) -- 0:00:37
Average standard deviation of split frequencies: 0.013620
831000 -- (-2747.798) (-2745.176) (-2746.139) [-2748.146] * [-2749.630] (-2754.284) (-2755.682) (-2747.657) -- 0:00:37
832000 -- (-2754.678) (-2747.830) (-2749.410) [-2747.380] * (-2748.246) (-2749.093) (-2751.613) [-2752.347] -- 0:00:36
833000 -- (-2756.738) [-2750.272] (-2749.471) (-2751.513) * (-2754.649) (-2760.703) (-2751.623) [-2750.936] -- 0:00:36
834000 -- (-2751.002) (-2747.260) (-2747.358) [-2749.337] * [-2745.754] (-2757.147) (-2757.790) (-2750.397) -- 0:00:36
835000 -- (-2757.044) (-2749.783) (-2756.428) [-2752.551] * (-2748.112) (-2746.075) (-2755.856) [-2751.559] -- 0:00:36
Average standard deviation of split frequencies: 0.012687
836000 -- (-2745.523) [-2753.106] (-2749.468) (-2758.458) * (-2748.893) [-2753.813] (-2751.070) (-2749.127) -- 0:00:36
837000 -- [-2749.063] (-2750.630) (-2751.856) (-2748.874) * [-2743.458] (-2746.320) (-2752.059) (-2744.676) -- 0:00:35
838000 -- (-2753.980) (-2750.928) [-2747.251] (-2748.613) * (-2749.815) (-2747.612) [-2752.982] (-2750.161) -- 0:00:35
839000 -- [-2744.826] (-2747.004) (-2747.400) (-2749.402) * (-2750.459) [-2753.992] (-2751.653) (-2745.341) -- 0:00:35
840000 -- (-2749.249) (-2745.088) (-2746.265) [-2752.953] * (-2748.753) [-2747.980] (-2751.928) (-2750.203) -- 0:00:35
Average standard deviation of split frequencies: 0.010935
841000 -- (-2756.695) [-2748.286] (-2745.848) (-2746.057) * (-2752.372) [-2754.409] (-2751.992) (-2745.339) -- 0:00:34
842000 -- (-2754.240) (-2745.572) [-2746.433] (-2749.675) * [-2749.224] (-2753.210) (-2754.315) (-2747.403) -- 0:00:34
843000 -- (-2750.429) (-2750.923) (-2747.307) [-2752.946] * (-2757.104) (-2750.324) (-2749.985) [-2748.249] -- 0:00:34
844000 -- (-2748.146) (-2749.955) [-2748.001] (-2753.622) * (-2748.984) (-2752.807) (-2746.638) [-2750.800] -- 0:00:34
845000 -- (-2747.612) [-2749.129] (-2754.022) (-2752.696) * (-2744.329) (-2757.402) (-2749.332) [-2755.676] -- 0:00:34
Average standard deviation of split frequencies: 0.009751
846000 -- (-2746.406) (-2747.319) (-2753.681) [-2746.040] * (-2749.234) (-2750.475) [-2752.915] (-2755.612) -- 0:00:33
847000 -- (-2750.607) (-2754.281) (-2759.254) [-2745.862] * (-2747.847) [-2745.512] (-2743.856) (-2746.799) -- 0:00:33
848000 -- (-2750.249) (-2748.199) [-2748.649] (-2758.551) * [-2746.577] (-2747.472) (-2752.063) (-2747.276) -- 0:00:33
849000 -- (-2752.627) (-2750.948) [-2746.641] (-2760.625) * (-2746.763) (-2751.816) (-2749.454) [-2746.602] -- 0:00:33
850000 -- (-2749.158) (-2746.851) (-2751.487) [-2747.731] * (-2748.231) (-2755.926) (-2745.049) [-2748.943] -- 0:00:33
Average standard deviation of split frequencies: 0.009698
851000 -- (-2750.355) [-2744.576] (-2751.036) (-2749.232) * (-2745.255) (-2750.157) (-2751.251) [-2743.264] -- 0:00:32
852000 -- (-2751.929) (-2745.571) [-2748.538] (-2756.980) * (-2750.305) [-2747.476] (-2752.699) (-2745.487) -- 0:00:32
853000 -- (-2753.170) (-2745.638) (-2747.478) [-2751.213] * (-2752.070) (-2753.470) [-2749.537] (-2748.540) -- 0:00:32
854000 -- (-2757.478) [-2745.703] (-2747.185) (-2752.227) * (-2755.580) (-2750.794) (-2747.473) [-2746.359] -- 0:00:32
855000 -- (-2757.963) (-2747.742) [-2751.093] (-2747.744) * [-2744.287] (-2752.374) (-2748.119) (-2746.027) -- 0:00:31
Average standard deviation of split frequencies: 0.009913
856000 -- (-2752.214) [-2745.772] (-2743.812) (-2748.365) * (-2746.932) [-2750.756] (-2747.746) (-2756.054) -- 0:00:31
857000 -- (-2751.851) [-2753.497] (-2745.222) (-2749.810) * [-2750.924] (-2758.377) (-2744.014) (-2750.149) -- 0:00:31
858000 -- (-2753.799) (-2746.815) [-2745.613] (-2751.076) * (-2745.481) (-2743.886) (-2748.979) [-2753.317] -- 0:00:31
859000 -- (-2753.389) (-2745.146) (-2757.153) [-2748.396] * [-2746.490] (-2750.414) (-2752.994) (-2750.225) -- 0:00:31
860000 -- (-2757.545) (-2748.488) (-2752.279) [-2744.877] * (-2751.173) [-2750.752] (-2754.709) (-2750.716) -- 0:00:30
Average standard deviation of split frequencies: 0.010407
861000 -- (-2751.810) (-2744.802) (-2757.303) [-2747.641] * (-2747.320) [-2749.602] (-2752.196) (-2756.093) -- 0:00:30
862000 -- (-2748.138) [-2749.570] (-2754.533) (-2745.006) * (-2754.112) (-2746.326) [-2747.901] (-2750.355) -- 0:00:30
863000 -- (-2747.972) [-2747.984] (-2756.210) (-2749.859) * (-2749.034) (-2757.534) [-2752.650] (-2752.917) -- 0:00:30
864000 -- (-2748.504) [-2744.143] (-2748.553) (-2750.930) * [-2748.948] (-2750.400) (-2750.627) (-2753.324) -- 0:00:29
865000 -- (-2748.931) (-2747.911) [-2744.086] (-2746.484) * [-2753.270] (-2752.932) (-2747.330) (-2756.635) -- 0:00:29
Average standard deviation of split frequencies: 0.010070
866000 -- [-2745.918] (-2746.287) (-2745.801) (-2751.943) * (-2752.060) (-2745.409) (-2747.723) [-2748.832] -- 0:00:29
867000 -- (-2749.844) [-2748.557] (-2755.689) (-2750.627) * (-2754.193) (-2748.060) [-2752.848] (-2752.794) -- 0:00:29
868000 -- (-2747.718) (-2749.686) [-2756.561] (-2760.051) * (-2755.548) [-2748.173] (-2750.497) (-2754.577) -- 0:00:29
869000 -- (-2747.337) (-2752.930) [-2747.448] (-2749.811) * (-2749.368) [-2749.450] (-2751.548) (-2753.354) -- 0:00:28
870000 -- (-2743.620) (-2748.413) [-2745.174] (-2745.651) * (-2747.361) (-2749.070) (-2748.258) [-2747.763] -- 0:00:28
Average standard deviation of split frequencies: 0.010287
871000 -- (-2753.852) (-2751.566) [-2751.245] (-2748.081) * (-2750.846) (-2756.220) (-2747.998) [-2749.806] -- 0:00:28
872000 -- (-2755.152) (-2749.592) [-2747.674] (-2750.050) * (-2746.541) [-2752.820] (-2753.742) (-2751.380) -- 0:00:28
873000 -- [-2746.320] (-2752.627) (-2751.939) (-2757.202) * [-2750.302] (-2753.347) (-2748.770) (-2760.968) -- 0:00:27
874000 -- (-2751.081) (-2742.887) (-2747.208) [-2751.204] * [-2750.817] (-2751.910) (-2749.098) (-2751.450) -- 0:00:27
875000 -- (-2748.001) [-2749.201] (-2752.414) (-2747.344) * (-2743.938) (-2746.058) (-2750.171) [-2747.061] -- 0:00:27
Average standard deviation of split frequencies: 0.012377
876000 -- [-2754.603] (-2746.661) (-2747.236) (-2750.890) * (-2748.386) (-2750.925) (-2751.037) [-2753.631] -- 0:00:27
877000 -- (-2750.169) [-2754.298] (-2749.690) (-2749.031) * [-2751.020] (-2753.118) (-2745.640) (-2753.750) -- 0:00:27
878000 -- (-2748.405) (-2747.208) (-2748.939) [-2748.504] * (-2753.583) (-2745.859) [-2753.547] (-2746.631) -- 0:00:26
879000 -- (-2750.528) (-2756.838) (-2750.053) [-2755.947] * (-2750.692) (-2744.304) (-2752.609) [-2750.171] -- 0:00:26
880000 -- (-2751.764) (-2754.890) (-2751.417) [-2744.864] * (-2750.959) (-2744.295) [-2748.056] (-2744.676) -- 0:00:26
Average standard deviation of split frequencies: 0.013650
881000 -- (-2752.772) [-2750.433] (-2749.515) (-2755.293) * (-2750.122) [-2745.853] (-2752.667) (-2748.650) -- 0:00:26
882000 -- (-2747.059) (-2750.668) [-2747.186] (-2757.909) * (-2750.180) (-2753.895) [-2745.485] (-2756.442) -- 0:00:25
883000 -- [-2745.443] (-2748.647) (-2749.478) (-2755.879) * (-2744.906) (-2746.941) (-2748.749) [-2745.380] -- 0:00:25
884000 -- (-2750.940) (-2749.252) [-2754.275] (-2747.100) * (-2747.655) [-2747.192] (-2745.587) (-2754.670) -- 0:00:25
885000 -- (-2756.102) [-2747.802] (-2749.748) (-2745.840) * [-2748.009] (-2747.894) (-2745.004) (-2747.598) -- 0:00:25
Average standard deviation of split frequencies: 0.013035
886000 -- [-2755.886] (-2749.501) (-2763.265) (-2750.267) * (-2756.657) [-2746.020] (-2752.531) (-2753.227) -- 0:00:25
887000 -- (-2747.461) (-2744.926) [-2756.809] (-2750.219) * (-2754.866) (-2752.245) (-2749.032) [-2755.971] -- 0:00:24
888000 -- (-2751.506) [-2748.049] (-2764.907) (-2755.242) * [-2749.740] (-2752.287) (-2747.353) (-2745.834) -- 0:00:24
889000 -- (-2752.294) (-2744.243) (-2751.829) [-2753.124] * (-2751.677) [-2749.105] (-2750.738) (-2751.299) -- 0:00:24
890000 -- [-2755.381] (-2750.532) (-2754.284) (-2747.226) * [-2748.086] (-2759.341) (-2750.883) (-2748.260) -- 0:00:24
Average standard deviation of split frequencies: 0.012173
891000 -- [-2752.564] (-2747.651) (-2750.981) (-2753.110) * (-2747.941) (-2743.737) (-2749.956) [-2746.257] -- 0:00:23
892000 -- (-2753.353) (-2751.288) (-2756.983) [-2751.707] * [-2751.171] (-2747.253) (-2750.439) (-2749.222) -- 0:00:23
893000 -- (-2748.707) (-2747.946) (-2748.111) [-2746.653] * (-2754.546) (-2749.210) (-2744.444) [-2746.796] -- 0:00:23
894000 -- (-2743.892) (-2751.096) (-2745.951) [-2753.330] * (-2749.767) (-2756.184) [-2747.380] (-2749.383) -- 0:00:23
895000 -- (-2757.215) [-2752.254] (-2753.978) (-2749.557) * (-2748.050) (-2749.597) (-2751.560) [-2757.464] -- 0:00:23
Average standard deviation of split frequencies: 0.010785
896000 -- [-2750.887] (-2748.094) (-2747.381) (-2751.206) * (-2748.455) [-2746.983] (-2746.978) (-2757.857) -- 0:00:22
897000 -- (-2756.875) (-2750.300) [-2750.441] (-2745.372) * [-2748.634] (-2747.451) (-2747.089) (-2758.161) -- 0:00:22
898000 -- [-2750.446] (-2751.690) (-2752.644) (-2751.290) * (-2752.061) [-2744.601] (-2751.228) (-2749.565) -- 0:00:22
899000 -- (-2749.476) (-2749.313) (-2745.325) [-2746.534] * (-2749.198) (-2758.311) [-2753.283] (-2747.589) -- 0:00:22
900000 -- [-2747.592] (-2750.936) (-2748.287) (-2753.260) * (-2751.305) (-2745.639) (-2758.568) [-2749.549] -- 0:00:22
Average standard deviation of split frequencies: 0.010206
901000 -- [-2757.643] (-2748.088) (-2752.508) (-2748.160) * [-2744.689] (-2749.715) (-2746.617) (-2752.956) -- 0:00:21
902000 -- (-2746.707) (-2742.908) [-2754.683] (-2749.672) * (-2747.327) (-2748.832) (-2749.969) [-2755.575] -- 0:00:21
903000 -- [-2751.696] (-2752.736) (-2747.793) (-2749.616) * [-2751.218] (-2751.951) (-2748.291) (-2755.148) -- 0:00:21
904000 -- (-2750.584) (-2748.140) (-2747.240) [-2750.145] * [-2748.727] (-2748.119) (-2752.491) (-2755.638) -- 0:00:21
905000 -- (-2749.106) (-2749.190) [-2748.966] (-2757.272) * (-2745.597) [-2746.987] (-2749.334) (-2748.403) -- 0:00:20
Average standard deviation of split frequencies: 0.011447
906000 -- (-2754.056) [-2753.341] (-2745.999) (-2752.626) * [-2756.846] (-2757.166) (-2751.377) (-2756.330) -- 0:00:20
907000 -- (-2752.542) [-2754.119] (-2756.759) (-2757.255) * (-2744.674) [-2751.895] (-2755.438) (-2749.693) -- 0:00:20
908000 -- (-2750.399) [-2748.690] (-2756.966) (-2752.044) * (-2746.133) [-2756.242] (-2746.941) (-2750.754) -- 0:00:20
909000 -- (-2750.000) [-2747.944] (-2752.398) (-2747.552) * [-2747.564] (-2744.974) (-2752.818) (-2751.229) -- 0:00:20
910000 -- (-2750.029) [-2742.872] (-2758.246) (-2744.429) * (-2750.965) (-2748.572) [-2746.327] (-2746.956) -- 0:00:19
Average standard deviation of split frequencies: 0.011906
911000 -- (-2754.170) (-2748.463) [-2749.054] (-2755.145) * (-2748.593) (-2751.753) (-2753.190) [-2748.590] -- 0:00:19
912000 -- (-2749.552) (-2752.681) [-2753.354] (-2750.221) * [-2749.921] (-2747.505) (-2759.876) (-2748.395) -- 0:00:19
913000 -- (-2749.191) [-2748.279] (-2750.171) (-2747.681) * (-2752.512) (-2747.181) [-2751.894] (-2750.671) -- 0:00:19
914000 -- (-2750.557) (-2760.017) (-2749.017) [-2751.516] * (-2752.540) (-2747.377) (-2754.925) [-2751.981] -- 0:00:18
915000 -- (-2755.517) (-2751.439) (-2752.837) [-2751.285] * [-2746.843] (-2749.643) (-2748.804) (-2754.106) -- 0:00:18
Average standard deviation of split frequencies: 0.012094
916000 -- (-2756.893) (-2749.964) [-2745.631] (-2748.192) * [-2746.820] (-2747.623) (-2744.902) (-2751.955) -- 0:00:18
917000 -- (-2748.074) (-2751.478) (-2750.168) [-2748.369] * (-2753.783) [-2746.935] (-2747.662) (-2756.214) -- 0:00:18
918000 -- (-2747.472) (-2746.731) [-2754.951] (-2750.443) * [-2745.060] (-2749.386) (-2752.565) (-2747.008) -- 0:00:18
919000 -- (-2749.240) (-2750.744) [-2752.186] (-2747.016) * (-2750.198) [-2745.118] (-2751.775) (-2749.246) -- 0:00:17
920000 -- [-2757.602] (-2750.944) (-2755.047) (-2749.580) * (-2753.199) (-2744.962) (-2752.674) [-2754.621] -- 0:00:17
Average standard deviation of split frequencies: 0.012801
921000 -- (-2749.379) (-2748.391) (-2747.287) [-2750.406] * [-2748.482] (-2748.973) (-2754.729) (-2746.381) -- 0:00:17
922000 -- [-2748.236] (-2753.934) (-2744.658) (-2744.463) * (-2749.520) (-2746.086) [-2748.444] (-2753.162) -- 0:00:17
923000 -- (-2752.023) [-2750.270] (-2748.325) (-2755.327) * (-2753.700) (-2752.028) (-2752.607) [-2758.308] -- 0:00:16
924000 -- (-2751.629) (-2750.836) (-2751.151) [-2756.820] * (-2744.882) (-2759.370) (-2750.139) [-2747.761] -- 0:00:16
925000 -- (-2752.836) (-2748.693) (-2746.058) [-2747.611] * (-2770.318) (-2752.330) [-2747.896] (-2748.274) -- 0:00:16
Average standard deviation of split frequencies: 0.012218
926000 -- (-2745.622) (-2753.620) [-2744.181] (-2748.831) * (-2748.016) (-2748.818) [-2746.890] (-2750.956) -- 0:00:16
927000 -- (-2747.131) (-2751.497) [-2748.268] (-2754.018) * (-2750.461) (-2749.543) [-2750.025] (-2752.082) -- 0:00:16
928000 -- (-2750.262) (-2747.452) [-2752.241] (-2750.810) * (-2746.588) [-2747.240] (-2749.389) (-2751.697) -- 0:00:15
929000 -- [-2747.804] (-2751.983) (-2748.812) (-2749.974) * (-2756.827) (-2746.707) (-2754.453) [-2745.998] -- 0:00:15
930000 -- (-2746.883) (-2753.787) [-2747.413] (-2750.501) * (-2745.669) [-2743.415] (-2751.217) (-2750.129) -- 0:00:15
Average standard deviation of split frequencies: 0.012410
931000 -- (-2748.336) (-2747.124) [-2750.217] (-2752.999) * [-2745.472] (-2751.814) (-2750.787) (-2749.214) -- 0:00:15
932000 -- (-2748.240) (-2750.965) (-2751.894) [-2750.057] * [-2743.185] (-2757.501) (-2750.460) (-2750.716) -- 0:00:14
933000 -- (-2749.590) (-2751.473) [-2745.290] (-2748.934) * [-2750.373] (-2753.696) (-2757.222) (-2754.812) -- 0:00:14
934000 -- (-2757.232) (-2758.007) [-2752.776] (-2749.391) * (-2749.859) [-2747.493] (-2754.042) (-2755.932) -- 0:00:14
935000 -- (-2756.722) (-2755.243) [-2747.526] (-2746.307) * [-2744.267] (-2743.497) (-2756.461) (-2753.488) -- 0:00:14
Average standard deviation of split frequencies: 0.010073
936000 -- (-2750.637) (-2751.759) (-2754.865) [-2749.999] * [-2749.971] (-2746.683) (-2747.638) (-2746.813) -- 0:00:14
937000 -- (-2753.063) (-2749.389) [-2746.967] (-2750.022) * [-2746.869] (-2748.749) (-2752.517) (-2756.431) -- 0:00:13
938000 -- [-2753.129] (-2747.849) (-2751.409) (-2752.006) * (-2753.338) (-2747.978) [-2750.329] (-2748.363) -- 0:00:13
939000 -- (-2754.329) (-2751.360) [-2749.214] (-2756.862) * (-2751.556) (-2747.165) [-2747.477] (-2747.873) -- 0:00:13
940000 -- (-2749.468) [-2749.524] (-2751.617) (-2751.425) * [-2750.100] (-2749.032) (-2748.076) (-2750.162) -- 0:00:13
Average standard deviation of split frequencies: 0.010273
941000 -- (-2752.242) (-2745.524) [-2746.928] (-2756.395) * (-2758.537) (-2750.090) (-2753.148) [-2748.121] -- 0:00:12
942000 -- [-2749.365] (-2746.872) (-2753.321) (-2752.647) * (-2747.571) (-2747.581) (-2746.730) [-2746.582] -- 0:00:12
943000 -- (-2748.050) (-2749.742) (-2752.419) [-2747.100] * (-2757.422) (-2749.397) (-2751.275) [-2749.374] -- 0:00:12
944000 -- (-2750.440) (-2749.866) [-2750.094] (-2748.420) * (-2747.222) (-2753.012) [-2751.810] (-2750.502) -- 0:00:12
945000 -- (-2750.460) [-2748.549] (-2760.982) (-2754.585) * [-2746.975] (-2743.034) (-2751.396) (-2749.800) -- 0:00:12
Average standard deviation of split frequencies: 0.010215
946000 -- (-2747.792) [-2751.318] (-2753.720) (-2753.827) * (-2756.487) [-2748.691] (-2751.852) (-2750.071) -- 0:00:11
947000 -- [-2748.966] (-2752.883) (-2746.205) (-2750.103) * (-2747.331) [-2745.355] (-2753.531) (-2751.392) -- 0:00:11
948000 -- (-2751.895) [-2750.752] (-2743.825) (-2746.166) * (-2746.872) [-2749.378] (-2752.122) (-2751.898) -- 0:00:11
949000 -- (-2751.811) (-2748.513) (-2747.157) [-2750.232] * [-2748.351] (-2751.577) (-2758.484) (-2752.877) -- 0:00:11
950000 -- [-2749.230] (-2748.412) (-2746.736) (-2752.196) * (-2746.174) (-2752.493) [-2751.078] (-2756.235) -- 0:00:11
Average standard deviation of split frequencies: 0.009669
951000 -- [-2756.059] (-2755.405) (-2750.225) (-2748.190) * (-2746.862) (-2751.755) [-2749.107] (-2750.186) -- 0:00:10
952000 -- [-2749.152] (-2753.247) (-2746.838) (-2748.511) * (-2747.649) (-2756.903) (-2747.652) [-2751.520] -- 0:00:10
953000 -- (-2757.502) (-2752.285) [-2753.925] (-2756.107) * (-2743.240) (-2756.990) [-2752.963] (-2745.652) -- 0:00:10
954000 -- [-2751.926] (-2745.191) (-2752.517) (-2746.705) * (-2749.477) (-2754.881) (-2749.689) [-2745.192] -- 0:00:10
955000 -- (-2752.197) [-2751.426] (-2752.157) (-2744.540) * (-2751.997) [-2749.046] (-2747.308) (-2745.186) -- 0:00:09
Average standard deviation of split frequencies: 0.009615
956000 -- (-2745.569) [-2749.587] (-2754.695) (-2742.889) * (-2745.128) (-2757.246) (-2753.800) [-2748.428] -- 0:00:09
957000 -- (-2748.713) [-2751.769] (-2752.355) (-2747.247) * (-2746.992) (-2748.985) (-2745.180) [-2748.155] -- 0:00:09
958000 -- [-2750.282] (-2749.447) (-2747.285) (-2754.932) * (-2749.894) [-2745.138] (-2746.580) (-2752.952) -- 0:00:09
959000 -- [-2754.776] (-2747.031) (-2755.112) (-2750.441) * [-2750.049] (-2747.992) (-2750.470) (-2758.728) -- 0:00:09
960000 -- [-2752.516] (-2753.502) (-2758.442) (-2752.805) * (-2753.801) (-2751.054) (-2758.903) [-2744.868] -- 0:00:08
Average standard deviation of split frequencies: 0.011041
961000 -- (-2747.610) (-2747.855) (-2744.866) [-2748.872] * (-2754.003) [-2750.755] (-2753.991) (-2755.759) -- 0:00:08
962000 -- (-2748.116) [-2744.664] (-2748.719) (-2751.967) * (-2745.751) (-2745.986) [-2747.028] (-2753.664) -- 0:00:08
963000 -- (-2751.527) (-2749.437) [-2754.291] (-2748.748) * [-2749.350] (-2748.943) (-2749.882) (-2748.555) -- 0:00:08
964000 -- [-2747.656] (-2751.523) (-2750.096) (-2748.319) * [-2746.543] (-2751.371) (-2746.743) (-2745.793) -- 0:00:07
965000 -- (-2750.033) (-2746.874) [-2749.506] (-2745.345) * (-2748.700) [-2749.258] (-2746.407) (-2758.400) -- 0:00:07
Average standard deviation of split frequencies: 0.011224
966000 -- (-2751.068) (-2752.419) (-2747.317) [-2745.270] * (-2747.886) (-2755.387) [-2751.351] (-2757.632) -- 0:00:07
967000 -- (-2751.495) [-2746.586] (-2747.026) (-2747.976) * [-2748.679] (-2749.460) (-2747.091) (-2761.429) -- 0:00:07
968000 -- (-2748.540) (-2745.989) [-2744.954] (-2752.239) * [-2745.636] (-2751.287) (-2747.281) (-2759.490) -- 0:00:07
969000 -- [-2749.034] (-2755.889) (-2745.079) (-2749.007) * (-2746.250) (-2750.811) [-2750.845] (-2753.610) -- 0:00:06
970000 -- (-2748.585) (-2747.831) [-2751.198] (-2745.788) * [-2744.130] (-2752.007) (-2751.244) (-2744.136) -- 0:00:06
Average standard deviation of split frequencies: 0.013355
971000 -- (-2746.046) (-2755.425) [-2743.891] (-2755.980) * (-2755.605) (-2752.624) [-2749.815] (-2751.989) -- 0:00:06
972000 -- (-2753.922) [-2749.194] (-2745.290) (-2758.626) * (-2749.167) (-2752.821) [-2746.635] (-2754.802) -- 0:00:06
973000 -- (-2751.581) (-2748.342) [-2752.119] (-2746.927) * [-2748.434] (-2756.406) (-2750.468) (-2751.547) -- 0:00:05
974000 -- (-2753.711) [-2752.747] (-2751.347) (-2746.560) * (-2746.797) [-2758.319] (-2743.855) (-2764.386) -- 0:00:05
975000 -- (-2753.977) (-2745.954) [-2748.154] (-2744.842) * (-2752.538) [-2745.167] (-2756.418) (-2752.223) -- 0:00:05
Average standard deviation of split frequencies: 0.013524
976000 -- (-2745.952) (-2744.834) [-2750.178] (-2753.583) * (-2749.886) (-2746.197) [-2745.296] (-2747.827) -- 0:00:05
977000 -- (-2749.851) (-2747.149) (-2747.130) [-2750.218] * [-2746.020] (-2753.788) (-2754.806) (-2747.418) -- 0:00:05
978000 -- (-2754.926) [-2746.863] (-2753.141) (-2751.965) * (-2744.996) (-2749.115) (-2749.113) [-2747.473] -- 0:00:04
979000 -- [-2747.228] (-2746.318) (-2751.569) (-2754.874) * (-2751.850) (-2752.264) (-2749.212) [-2749.682] -- 0:00:04
980000 -- (-2747.817) [-2750.057] (-2746.844) (-2748.901) * (-2746.664) (-2746.151) (-2750.223) [-2748.381] -- 0:00:04
Average standard deviation of split frequencies: 0.013700
981000 -- (-2749.400) (-2757.161) (-2750.783) [-2748.711] * [-2747.882] (-2753.283) (-2753.270) (-2746.973) -- 0:00:04
982000 -- (-2751.628) (-2748.337) (-2747.080) [-2746.122] * (-2745.316) [-2747.701] (-2748.547) (-2749.777) -- 0:00:03
983000 -- (-2746.519) (-2746.869) (-2750.321) [-2747.155] * [-2744.714] (-2752.691) (-2749.046) (-2749.512) -- 0:00:03
984000 -- (-2748.828) (-2745.169) (-2748.306) [-2742.741] * (-2751.847) (-2749.710) [-2749.862] (-2751.981) -- 0:00:03
985000 -- (-2752.106) (-2747.982) (-2749.723) [-2756.289] * (-2748.437) [-2750.382] (-2747.739) (-2751.501) -- 0:00:03
Average standard deviation of split frequencies: 0.015299
986000 -- (-2752.618) [-2750.384] (-2751.486) (-2749.098) * (-2753.144) [-2748.400] (-2750.864) (-2750.230) -- 0:00:03
987000 -- (-2748.829) [-2749.996] (-2749.840) (-2748.211) * [-2753.830] (-2750.271) (-2755.817) (-2748.443) -- 0:00:02
988000 -- (-2746.757) (-2748.235) (-2747.472) [-2750.648] * [-2746.840] (-2752.633) (-2747.402) (-2752.005) -- 0:00:02
989000 -- (-2752.407) [-2751.756] (-2748.236) (-2752.568) * (-2748.111) (-2748.317) [-2757.700] (-2751.515) -- 0:00:02
990000 -- (-2755.000) (-2750.068) [-2758.565] (-2748.587) * (-2750.612) [-2746.761] (-2753.104) (-2752.071) -- 0:00:02
Average standard deviation of split frequencies: 0.015941
991000 -- (-2752.288) [-2745.665] (-2748.949) (-2757.073) * (-2754.376) (-2748.806) (-2750.495) [-2754.681] -- 0:00:01
992000 -- [-2746.517] (-2748.280) (-2752.904) (-2747.651) * [-2749.205] (-2750.834) (-2744.353) (-2756.695) -- 0:00:01
993000 -- [-2750.417] (-2750.545) (-2744.808) (-2746.008) * (-2747.024) [-2749.442] (-2745.552) (-2752.695) -- 0:00:01
994000 -- (-2758.386) (-2751.644) (-2748.866) [-2747.826] * [-2752.203] (-2753.835) (-2748.793) (-2746.066) -- 0:00:01
995000 -- (-2750.691) (-2747.164) [-2749.470] (-2749.095) * (-2746.401) [-2751.211] (-2750.093) (-2749.040) -- 0:00:01
Average standard deviation of split frequencies: 0.016092
996000 -- [-2746.617] (-2753.689) (-2746.615) (-2747.462) * [-2753.685] (-2752.811) (-2750.447) (-2748.285) -- 0:00:00
997000 -- (-2752.147) (-2750.348) [-2749.214] (-2754.653) * (-2746.950) (-2745.979) (-2747.377) [-2744.861] -- 0:00:00
998000 -- (-2753.068) [-2749.331] (-2746.348) (-2748.634) * [-2743.887] (-2749.587) (-2752.411) (-2755.393) -- 0:00:00
999000 -- (-2748.837) [-2748.371] (-2761.257) (-2745.723) * (-2747.768) [-2747.928] (-2753.567) (-2754.669) -- 0:00:00
1000000 -- (-2746.606) (-2753.361) [-2747.410] (-2750.978) * [-2752.323] (-2750.827) (-2749.686) (-2747.873) -- 0:00:00
Average standard deviation of split frequencies: 0.015546
Analysis completed in 3 mins 40 seconds
Analysis used 219.67 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2740.94
Likelihood of best state for "cold" chain of run 2 was -2740.92
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
32.7 % ( 23 %) Dirichlet(Revmat{all})
57.6 % ( 44 %) Slider(Revmat{all})
23.6 % ( 15 %) Dirichlet(Pi{all})
26.0 % ( 27 %) Slider(Pi{all})
34.6 % ( 34 %) Multiplier(Alpha{1,2})
47.4 % ( 21 %) Multiplier(Alpha{3})
45.6 % ( 26 %) Slider(Pinvar{all})
34.0 % ( 30 %) ExtSPR(Tau{all},V{all})
34.2 % ( 30 %) NNI(Tau{all},V{all})
38.0 % ( 41 %) ParsSPR(Tau{all},V{all})
26.0 % ( 24 %) Multiplier(V{all})
25.3 % ( 26 %) Nodeslider(V{all})
25.5 % ( 21 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
32.0 % ( 22 %) Dirichlet(Revmat{all})
57.3 % ( 47 %) Slider(Revmat{all})
23.6 % ( 23 %) Dirichlet(Pi{all})
26.7 % ( 28 %) Slider(Pi{all})
33.9 % ( 21 %) Multiplier(Alpha{1,2})
47.9 % ( 19 %) Multiplier(Alpha{3})
46.0 % ( 26 %) Slider(Pinvar{all})
33.9 % ( 27 %) ExtSPR(Tau{all},V{all})
34.1 % ( 38 %) NNI(Tau{all},V{all})
38.1 % ( 37 %) ParsSPR(Tau{all},V{all})
25.8 % ( 27 %) Multiplier(V{all})
25.5 % ( 24 %) Nodeslider(V{all})
25.3 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.71 0.59
2 | 166603 0.85 0.73
3 | 167205 166786 0.87
4 | 166400 165977 167029
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.71 0.59
2 | 166691 0.86 0.73
3 | 166758 166549 0.87
4 | 166520 166902 166580
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2747.70
| 1 |
| 2 2 2 |
| 1 11 2 2 11 1 2 1 1|
| 2 1 1 11 1 1 1 1 1 |
| *11 2 12 1 2 2 22 1 |
|1 21 1 2 2 1 2 2 1 * 1 |
| 1 2 2 2 2 2 1 2 2 |
| 2 11 2 2 21 1 2 * 1 1 2 2 |
| 1 1 1 22 11 2 11 1 |
| 2 21 2 22 1 * |
| 2 11 2 2 2 |
|2 2 1 1 1 * |
| 2 1 2 2 1 2|
| 2 2 2 2 |
| 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2750.58
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2746.04 -2754.02
2 -2746.32 -2755.50
--------------------------------------
TOTAL -2746.17 -2755.01
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.742291 0.104745 1.182075 2.372784 1.695294 463.83 644.49 1.000
r(A<->C){all} 0.017384 0.000195 0.000001 0.044430 0.014115 793.22 869.70 1.002
r(A<->G){all} 0.386260 0.004219 0.268634 0.516934 0.385702 334.72 451.66 1.000
r(A<->T){all} 0.077571 0.000321 0.044045 0.114248 0.077359 370.89 541.93 1.001
r(C<->G){all} 0.009833 0.000071 0.000002 0.026404 0.007679 885.87 918.40 1.001
r(C<->T){all} 0.502431 0.005128 0.364970 0.636917 0.500970 288.22 411.38 1.000
r(G<->T){all} 0.006522 0.000032 0.000005 0.017192 0.004920 869.70 959.25 1.000
pi(A){all} 0.266280 0.000143 0.243223 0.289261 0.266152 678.93 818.49 1.001
pi(C){all} 0.166711 0.000101 0.147821 0.186964 0.166395 1108.42 1167.33 1.000
pi(G){all} 0.237110 0.000144 0.214159 0.260285 0.237420 1057.46 1087.61 1.000
pi(T){all} 0.329898 0.000178 0.305281 0.356825 0.330026 1039.71 1106.11 1.001
alpha{1,2} 0.071182 0.000407 0.020600 0.104349 0.074785 896.93 1026.04 1.000
alpha{3} 4.122444 2.395084 1.714507 7.296948 3.868654 1226.23 1308.18 1.000
pinvar{all} 0.262455 0.002144 0.171737 0.350075 0.264699 1272.11 1301.58 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .*.*
6 -- ..**
----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 1703 0.567288 0.013662 0.557628 0.576949 2
6 1169 0.389407 0.017430 0.377082 0.401732 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.504696 0.016553 0.275950 0.753975 0.488276 1.000 2
length{all}[2] 0.176730 0.003272 0.076075 0.290992 0.171201 1.000 2
length{all}[3] 0.593568 0.022151 0.338689 0.895176 0.571331 1.000 2
length{all}[4] 0.371266 0.009866 0.203150 0.565704 0.357473 1.000 2
length{all}[5] 0.105660 0.003660 0.000547 0.211547 0.096200 1.001 2
length{all}[6] 0.088270 0.003101 0.000346 0.188198 0.079094 0.999 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.015546
Maximum standard deviation of split frequencies = 0.017430
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C3 (3)
+
| /------------------------------------ C2 (2)
\-----------------57----------------+
\------------------------------------ C4 (4)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C3 (3)
+
| /---------------------- C2 (2)
\-----------+
\--------------------------------------------- C4 (4)
|-----------| 0.100 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
90 % credible set contains 2 trees
95 % credible set contains 2 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
Running FUBAR...
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\
***************** TYPES OF STANDARD ANALYSES *****************
(1) Selection Analyses
(2) Evolutionary Hypothesis Testing
(3) Relative evolutionary rate inference
(4) Coevolutionary analysis
(5) Basic Analyses
(6) Codon Selection Analyses
(7) Compartmentalization
(8) Data File Tools
(9) Miscellaneous
(10) Model Comparison
(11) Kernel Analysis Tools
(12) Molecular Clock
(13) Phylogeny Reconstruction
(14) Positive Selection
(15) Recombination
(16) Selection/Recombination
(17) Relative Rate
(18) Relative Ratio
(19) Substitution Rates
Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' *****************
(1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution).
(2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood).
(3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting).
(4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection).
(5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification).
(6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood).
(7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation).
Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types):
Analysis Description
--------------------
Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a
coding sequence alignment to determine whether some sites have been
subject to pervasive purifying or diversifying selection. v2.1
introduces two more methods for estimating the posterior distribution of
grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation
Bayes approximation (fastest). Please note that a FUBAR analysis
generates a cache and a results JSON file in the same directory as
directory as the original alignment. HyPhy needs to have write
privileges to this directory. For example if the original file is in
/home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there
will also exist FUBAR-generated files
/home/sergei/FUBAR/data/pol.nex.FUBAR.json,
/home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide
checkpointing so that a partially completed analysis can be restarted.
- __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree
(one per partition)
- __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring
selection (2013), Mol Biol Evol. 30(5):1196-205
- __Written by__: Sergei L Kosakovsky Pond
- __Contact Information__: spond@temple.edu
- __Analysis Version__: 2.1
####Choose Genetic Code
1. [**Universal**] Universal code. (Genebank transl_table=1).
2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2).
3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3).
4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4).
5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5).
6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6).
7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9).
8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10).
9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12).
10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13).
11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14).
12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15).
13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16).
14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21).
15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22).
16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23).
17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24).
18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25).
19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26).
>Please choose an option (or press q to cancel selection):
>Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`)
>A tree was found in the data file: `(C1,C3,(C2,C4))`
>Would you like to use it (y/n)?
>Loaded a multiple sequence alignment with **4** sequences, **337** codons, and **1** partitions from `/data//pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/fubar/results/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1.fna`
> FUBAR will write cache and result files to _/data//pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/fubar/results/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/fubar/results/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1.fna.FUBAR.json_, respectively
> Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer):
####Posterior estimation method
1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation)
2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed)
3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default)
>Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5):
### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model
* Log(L) = -2896.96, AIC-c = 5820.01 (13 estimated parameters)
* Tree length (expected substitutions/site) for partition 1 : 0.406
### Computing the phylogenetic likelihood function on the grid
* Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid
* Best scaling achieved for
* synonymous rate = 2.815
* non-synonymous rate = 0.214
* Computing conditional site likelihoods on a 20 x 20 rate grid
### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights
* Using the following settings
* Dirichlet alpha : 0.5
### Tabulating site-level results
----
## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=337
BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 SLENVAYNVLKSGHFTAIAGELPVAILNDRLYIKEEGVDKLLFTNNTCLP
BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 SLENVAYNVLKSGHFMAVAGELPVAILNDRLYIKEDGVDKLLFTNNTCLP
BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 SLENVAYNVLKSGHFTPVAGELPVAIFNDRLYIREDGVDKLLFTNNTCLP
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 SLENVAYNVLKSGHFTAVAGELPVAILNDRLYIKEDGADKLLFTNNTCLP
*************** .:********:******:*:*.************
BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 TNVAFELWAKRSVNVVPEVKLLHNLGVTCTYNLVIWDYECNAPLVPNTVG
BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYENNAPLVPNTVG
BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYEHNAPLVPNTVG
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYESNAPLVPNTVG
**********************:**************** **********
BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 VCTYTDLTKLDDQIVLVDGRQLDSYSKFCQLKNAVYFSPSKPKCICTKGP
BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 ICNYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPSKPKCVCTKGP
BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 VCTYTDLINLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPTKPKCISARGP
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 ICTYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAIYFSPSKPKCVCTRGP
:*.**** :****:*********:**********:****:****:.::**
BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 PHASINGVIVEAADRGTAFWYAMRKDGAFVQLTDGYFTQSRTLNDFQPRT
BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 THASINGVVVEAPDKGTAFWYAVRKDGAFVQPTDGYFTQSRTLDDFQPRT
BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MHASINGVVVEAPDKGTAFWYAVRKDGAFVQPADGYFTQSRTLDNFQPRT
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 THASINGVVVEAPDRGTAFWYAMRKDGAFVQPTDGYFTQSRTVDDFQPRT
*******:***.*:*******:******** :*********:::*****
BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 QLEIDFLDLEQSCFLDKYDLHDLGLEHIAYGQFDGTIGGLHLLIGAVRRK
BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 QLELDFLDLEQSCFLDKYDLHDLGLEHIAYGQFEGTIGGLHLLIGAVRRK
BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 QLELDFLDLDESCFLDRYDLHDLGLEHIAYGQFEGTIGGLHLLLGAVRRR
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 QLEIDFLDLEQSCFLDKYDLHDLGLEHIVYGQFDGTIGGLHLLIGAVRRK
***:*****::*****:***********.****:*********:*****:
BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 RTANLVMETVLGTDTVTAYAVIDQPTASSKQVCSVFDMVLDDFIELIRAQ
BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 RTANLVMETVLGTDTVTSYAVIDQPTASSKQVCSVFDMILDDFIELIKAQ
BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 RTANLVMETVLGTDTVTSYAVIDQPTAANKQVCSVFDMVLDDFVALIKSQ
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 RTAHLVMETVLGTDTVTSYAVIDQPTASSKQVCSVVDIILDDFIALIKAQ
***:*************:*********:.******.*::****: **::*
BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 DRSVVSKVVQCCLDFKMFRFMLWCKDGKVATFYPQLQ
BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 DRSVVSKVVQCCLDFKVFRFMLWCKDGKVATFYPQLQ
BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 DRTVVSKVVQCCLDFKMFRFMLWCKDGKIATFYPQLQ
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 DRSVVSKVVQCCLDFKVFRFMLWCKGGKISTFYPQLQ
**:*************:********.**::*******
>BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 TCCTTGGAGAATGTGGCTTACAATGTACTAAAATCTGGACATTTTACGGCTATAGCAGGTGAGTTACCTGTGGCTATTCTTAATGACCGCCTCTATATAAAAGAGGAAGGTGTTGATAAATTGTTATTTACTAACAATACATGCTTGCCTACTAATGTGGCATTTGAGCTGTGGGCGAAGCGATCTGTAAATGTGGTCCCAGAAGTCAAGTTGTTACACAACCTTGGTGTTACGTGTACATATAACTTGGTAATCTGGGATTATGAGTGTAATGCGCCATTAGTGCCTAACACTGTAGGTGTGTGTACTTACACTGACTTAACGAAGTTGGACGATCAGATTGTTTTAGTCGATGGTAGACAGTTGGATTCATATAGTAAGTTTTGTCAGTTGAAAAATGCAGTTTATTTTTCGCCAAGCAAACCGAAGTGCATATGTACTAAAGGTCCTCCACACGCCTCTATAAACGGCGTTATTGTTGAGGCTGCAGATAGAGGTACTGCATTTTGGTATGCTATGAGAAAGGACGGTGCATTTGTGCAACTTACAGATGGGTATTTTACTCAGTCTCGTACGCTGAATGATTTTCAGCCACGTACTCAATTAGAGATTGATTTCCTGGATCTGGAACAGTCATGTTTTCTTGATAAATATGACTTACATGATTTAGGTCTTGAGCATATTGCATATGGTCAATTTGATGGTACCATAGGCGGTTTACATTTGTTAATTGGTGCAGTGCGTCGTAAACGTACTGCAAATTTAGTAATGGAAACTGTGTTAGGTACTGACACAGTGACAGCATATGCTGTCATAGACCAGCCAACTGCATCTAGTAAGCAGGTATGTAGTGTCTTTGACATGGTTTTAGATGATTTTATTGAGCTTATAAGGGCTCAAGATAGGTCAGTGGTTAGTAAAGTAGTTCAATGCTGCCTTGATTTTAAGATGTTTAGATTTATGTTGTGGTGTAAGGATGGCAAGGTAGCCACCTTTTACCCTCAGTTGCAA >BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 TCCTTGGAGAATGTTGCTTACAACGTTCTAAAATCTGGTCACTTCATGGCAGTTGCTGGTGAATTACCTGTGGCCATCCTCAATGACCGCCTCTATATAAAGGAGGATGGTGTTGACAAATTGTTATTTACTAACAATACATGCCTACCCACTAATGTAGCTTTCGAGCTGTGGGCAAAGCGTTCTGTAAATGTGGTACCAGAAGTTAAATTACTACGTAACCTTGGTGTTACGTGTACATATAATTTAGTCATCTGGGATTATGAGAATAATGCACCATTAGTACCTAATACTGTGGGCATTTGTAACTACACTGATCTAACTAAGTTAGACGACCAGGTTGTATTAGTTGATGGCAGACAGCTAGATGCTTACAGCAAGTTTTGTCAGTTGAAGAATGCAGTCTACTTTTCTCCTAGTAAACCAAAGTGCGTGTGTACCAAGGGTCCTACGCATGCGTCTATAAATGGCGTAGTTGTAGAGGCCCCAGATAAGGGCACAGCATTCTGGTATGCAGTGAGAAAAGATGGTGCATTCGTGCAACCTACTGACGGGTATTTTACCCAATCTCGTACACTGGATGATTTTCAGCCACGTACTCAATTAGAGCTAGATTTTCTTGATCTTGAGCAGTCATGTTTTCTTGATAAATATGACTTACATGATCTAGGCTTAGAGCACATCGCGTATGGACAATTTGAAGGAACCATAGGCGGTTTACATTTATTAATAGGTGCAGTGCGTCGGAAACGTACTGCGAATTTAGTTATGGAAACTGTATTAGGAACTGATACCGTTACATCTTATGCTGTCATAGACCAGCCAACTGCTTCTAGTAAGCAAGTTTGTAGTGTTTTTGATATGATTTTAGATGACTTCATCGAGCTTATTAAAGCTCAAGATAGGTCAGTAGTTAGTAAGGTAGTACAGTGCTGCCTAGATTTTAAAGTGTTTAGGTTTATGCTATGGTGTAAGGATGGTAAGGTTGCCACCTTCTATCCACAATTGCAG >BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 TCTTTGGAGAATGTGGCCTACAATGTGTTAAAGTCCGGGCACTTTACACCAGTAGCAGGTGAATTACCTGTAGCTATTTTTAATGACCGCCTCTATATAAGGGAAGACGGTGTTGATAAATTGTTATTTACTAATAATACATGCTTGCCCACTAATGTAGCCTTTGAGCTATGGGCAAAGCGTTCAGTAAATGTAGTACCAGAGGTTAAGTTATTACGTAACTTAGGTGTTACGTGTACATATAACTTAGTCATATGGGACTATGAACATAATGCGCCTTTAGTGCCAAATACTGTTGGCGTTTGTACTTACACTGATTTAATAAATTTGGATGACCAGGTTGTGTTAGTTGACGGCAGGCAGCTAGATGCTTATAGCAAGTTTTGCCAGTTGAAGAATGCCGTCTATTTCTCACCAACTAAGCCTAAATGCATTAGTGCCAGGGGCCCTATGCACGCGTCTATAAATGGCGTAGTCGTAGAAGCGCCAGACAAAGGTACAGCGTTTTGGTATGCGGTGAGAAAGGATGGTGCATTCGTGCAGCCAGCTGATGGTTATTTCACACAGTCTCGTACACTGGACAATTTTCAACCGCGCACTCAATTAGAGTTAGATTTCCTTGATCTTGATGAGTCATGTTTCCTTGATAGATACGACTTGCATGATCTAGGTTTGGAGCATATAGCCTATGGTCAGTTTGAAGGCACCATAGGTGGTTTACATTTGTTATTGGGTGCAGTGCGCCGTAGGCGCACTGCAAACTTGGTTATGGAGACGGTGTTAGGTACTGACACTGTCACCTCTTATGCTGTCATAGACCAGCCGACTGCTGCTAATAAGCAAGTATGTAGTGTCTTTGACATGGTCTTGGATGATTTTGTTGCCTTAATTAAGTCACAAGATAGAACAGTTGTTAGTAAGGTGGTTCAGTGTTGCCTTGATTTTAAGATGTTTAGATTCATGCTGTGGTGTAAAGATGGCAAGATAGCTACCTTTTATCCTCAGTTGCAG >HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 TCTCTAGAGAATGTAGCTTACAATGTCTTAAAGTCAGGCCATTTTACAGCAGTTGCCGGTGAGTTACCGGTAGCTATTTTAAATGACCGACTCTATATAAAGGAGGACGGTGCTGATAAATTGTTGTTTACTAATAATACATGTTTGCCCACTAATGTAGCTTTTGAGCTATGGGCTAAACGTTCAGTGAACGTAGTACCAGAAGTTAAGTTATTACGTAACTTAGGTGTTACGTGTACATATAACTTAGTTATCTGGGATTATGAAAGTAATGCTCCACTAGTGCCAAATACTGTGGGCATTTGTACTTATACTGATTTAACAAAGTTAGATGACCAGGTTGTGCTAGTTGATGGCAGACAGCTAGATGCCTATAGTAAGTTTTGTCAGTTGAAAAATGCCATTTACTTTTCACCTAGTAAACCTAAGTGCGTGTGTACCAGAGGACCAACTCACGCATCTATAAATGGTGTTGTTGTAGAGGCCCCTGATAGAGGTACTGCATTTTGGTATGCTATGAGAAAAGATGGTGCATTTGTGCAACCTACTGATGGCTATTTTACACAGTCCCGTACTGTGGACGATTTTCAGCCACGTACACAATTAGAAATAGATTTCCTTGATCTTGAGCAGTCATGTTTTCTTGATAAATATGACTTACATGATCTAGGTTTAGAACATATCGTGTATGGTCAATTTGATGGAACCATAGGCGGCTTGCATTTATTAATAGGTGCCGTACGCCGTAAGCGCACGGCGCATTTAGTTATGGAGACCGTGCTAGGTACTGACACGGTCACATCTTATGCTGTTATAGACCAACCAACTGCTTCTAGTAAGCAAGTTTGTAGTGTTGTTGATATTATTTTAGATGACTTTATTGCGCTTATAAAAGCTCAAGATAGGTCAGTTGTTAGTAAGGTAGTTCAGTGCTGCTTGGATTTTAAAGTGTTTAGGTTTATGTTATGGTGTAAGGGTGGTAAGATTTCCACCTTTTATCCTCAATTGCAG
>BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 SLENVAYNVLKSGHFTAIAGELPVAILNDRLYIKEEGVDKLLFTNNTCLP TNVAFELWAKRSVNVVPEVKLLHNLGVTCTYNLVIWDYECNAPLVPNTVG VCTYTDLTKLDDQIVLVDGRQLDSYSKFCQLKNAVYFSPSKPKCICTKGP PHASINGVIVEAADRGTAFWYAMRKDGAFVQLTDGYFTQSRTLNDFQPRT QLEIDFLDLEQSCFLDKYDLHDLGLEHIAYGQFDGTIGGLHLLIGAVRRK RTANLVMETVLGTDTVTAYAVIDQPTASSKQVCSVFDMVLDDFIELIRAQ DRSVVSKVVQCCLDFKMFRFMLWCKDGKVATFYPQLQ >BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 SLENVAYNVLKSGHFMAVAGELPVAILNDRLYIKEDGVDKLLFTNNTCLP TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYENNAPLVPNTVG ICNYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPSKPKCVCTKGP THASINGVVVEAPDKGTAFWYAVRKDGAFVQPTDGYFTQSRTLDDFQPRT QLELDFLDLEQSCFLDKYDLHDLGLEHIAYGQFEGTIGGLHLLIGAVRRK RTANLVMETVLGTDTVTSYAVIDQPTASSKQVCSVFDMILDDFIELIKAQ DRSVVSKVVQCCLDFKVFRFMLWCKDGKVATFYPQLQ >BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 SLENVAYNVLKSGHFTPVAGELPVAIFNDRLYIREDGVDKLLFTNNTCLP TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYEHNAPLVPNTVG VCTYTDLINLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPTKPKCISARGP MHASINGVVVEAPDKGTAFWYAVRKDGAFVQPADGYFTQSRTLDNFQPRT QLELDFLDLDESCFLDRYDLHDLGLEHIAYGQFEGTIGGLHLLLGAVRRR RTANLVMETVLGTDTVTSYAVIDQPTAANKQVCSVFDMVLDDFVALIKSQ DRTVVSKVVQCCLDFKMFRFMLWCKDGKIATFYPQLQ >HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 SLENVAYNVLKSGHFTAVAGELPVAILNDRLYIKEDGADKLLFTNNTCLP TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYESNAPLVPNTVG ICTYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAIYFSPSKPKCVCTRGP THASINGVVVEAPDRGTAFWYAMRKDGAFVQPTDGYFTQSRTVDDFQPRT QLEIDFLDLEQSCFLDKYDLHDLGLEHIVYGQFDGTIGGLHLLIGAVRRK RTAHLVMETVLGTDTVTSYAVIDQPTASSKQVCSVVDIILDDFIALIKAQ DRSVVSKVVQCCLDFKVFRFMLWCKGGKISTFYPQLQ
Reading sequence file /data//pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/fubar/fasta/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1
Found 4 sequences of length 1011
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 16.4%
Found 61 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 5
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 189 polymorphic sites
**p-Value(s)**
----------
NSS: 5.00e-03 (1000 permutations)
Max Chi^2: 3.30e-02 (1000 permutations)
PHI (Permutation): 0.00e+00 (1000 permutations)
PHI (Normal): 2.34e-05
#NEXUS
[ID: 5415592825]
begin taxa;
dimensions ntax=4;
taxlabels
BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
;
end;
begin trees;
translate
1 BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9,
2 BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9,
3 BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9,
4 HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:4.882763e-01,3:5.713311e-01,(2:1.712007e-01,4:3.574735e-01)0.567:9.619993e-02);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:4.882763e-01,3:5.713311e-01,(2:1.712007e-01,4:3.574735e-01):9.619993e-02);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2746.33 -2757.25
2 -2746.30 -2755.89
--------------------------------------
TOTAL -2746.32 -2756.79
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.758356 0.117618 1.209732 2.422642 1.702358 603.78 676.79 1.000
r(A<->C){all} 0.017884 0.000203 0.000003 0.046152 0.014845 734.76 796.80 1.000
r(A<->G){all} 0.382895 0.004558 0.251118 0.512757 0.382036 344.33 447.59 1.000
r(A<->T){all} 0.076631 0.000325 0.041542 0.112264 0.075618 463.55 658.83 1.000
r(C<->G){all} 0.010057 0.000080 0.000001 0.027860 0.007508 768.64 825.75 1.000
r(C<->T){all} 0.506121 0.005617 0.376491 0.669285 0.504561 153.86 242.89 1.000
r(G<->T){all} 0.006412 0.000030 0.000003 0.017079 0.005022 1063.50 1076.73 1.000
pi(A){all} 0.266054 0.000144 0.242359 0.290059 0.265924 1053.91 1202.96 1.000
pi(C){all} 0.166623 0.000097 0.147877 0.185854 0.166476 593.48 934.14 1.000
pi(G){all} 0.237042 0.000143 0.215824 0.262194 0.236852 1179.38 1235.16 1.000
pi(T){all} 0.330280 0.000170 0.304961 0.354783 0.330450 1101.74 1147.73 1.001
alpha{1,2} 0.070701 0.000443 0.014109 0.102596 0.075258 809.04 822.77 1.000
alpha{3} 4.062788 2.273282 1.552859 7.073329 3.833098 1412.76 1426.68 1.000
pinvar{all} 0.261553 0.002079 0.173867 0.351149 0.263047 915.10 1208.05 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C3,(C2,C4))` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **4** sequences, **337** codons, and **1** partitions from `/data//pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/fubar/results/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/fubar/results/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/fubar/results/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -2896.96, AIC-c = 5820.01 (13 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.406 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 2.815 * non-synonymous rate = 0.214 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results ---- ## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
