--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1882.95 -1890.84
2 -1883.10 -1894.20
--------------------------------------
TOTAL -1883.02 -1893.54
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.593403 0.119181 1.035792 2.255171 1.534519 914.69 989.55 1.000
r(A<->C){all} 0.072455 0.001157 0.004917 0.133179 0.070168 640.91 745.04 1.000
r(A<->G){all} 0.249989 0.002208 0.163143 0.347027 0.247219 676.06 817.13 1.001
r(A<->T){all} 0.166072 0.001216 0.106764 0.242086 0.163527 807.67 878.70 1.006
r(C<->G){all} 0.069358 0.000860 0.015276 0.128055 0.067342 711.69 715.39 1.004
r(C<->T){all} 0.391897 0.003159 0.289216 0.506545 0.389361 573.65 757.16 1.002
r(G<->T){all} 0.050229 0.000567 0.006093 0.096339 0.048682 721.36 792.31 1.000
pi(A){all} 0.232285 0.000248 0.200703 0.262167 0.231561 984.72 1004.81 1.001
pi(C){all} 0.207299 0.000207 0.178112 0.233535 0.207368 980.89 1018.14 1.000
pi(G){all} 0.267607 0.000278 0.234106 0.298766 0.267708 1064.10 1167.73 1.000
pi(T){all} 0.292809 0.000263 0.260784 0.324208 0.293287 1178.88 1232.60 1.000
alpha{1,2} 0.349619 0.009320 0.198967 0.524270 0.335241 1302.51 1333.99 1.000
alpha{3} 2.944915 1.684925 1.009183 5.618096 2.668002 1344.27 1360.88 1.002
pinvar{all} 0.093194 0.003813 0.000014 0.208211 0.084885 1323.45 1408.12 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
-- Starting log on Wed Oct 26 00:49:06 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=175
C1 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDMPMQEALEVVKNELRKP
C2 MEGVPGPSKLRSMVTITLKWIDPNIMPSVTGWDMPMCEALEIVKDELRKP
C3 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDVSMQEALELVKAELRKP
C4 MEGVPDPPKLKSMVVTTLKWCDPFANPNVTGWDIPIEEALEYAKQQLRTP
*****.*.**:***. *:** ** *.*****:.: **** .* :**.*
C1 EPQLVFVPKYLCHTPLIGEDRIVVTDSTFRATNMGWVPIRELAFDENRIR
C2 EPDLVFVPKYLCHTPLIGRNRVVITDATYRTTVLGWIPIRELAYDESETR
C3 TPKLVFVPNYLCHTPLIGRDRIVITDSIYRATVMGWIPIRELAFDENNIR
C4 EPQLVFVPYYLSHAPGISGDRVVITDSIWYATNFGWQPIRELAMDKDGVR
*.***** **.*:* *. :*:*:**: : :* :** ****** *:. *
C1 FGRSGTFGVLLPMQDAKYIMGHIDIDMRKYGVGAGGDKDEPLLWDGYIDT
C2 YGRSGTYGVLLPMQDSKYIMGSIDIDMRKYGAGAGSDRPEPMLWDGFVDL
C3 CGRSGTFGVLLPEQDPKYVMGEVDIDMRKYGVGACSEKPVPLLWDGYIDT
C4 YGRGGTHGVLLPMQDPSFIMGDIDIQIRKYGIGANSPPDVLPLWDGFSDP
**.**.***** **..::** :**::**** ** . ****: *
C1 PYPEDDYLDFPDNSRPAKPKAKRGG
C2 PRSQKQYLDYPDNCRPTKPKAKRGG
C3 PYPEDDYLDFPDMCRPAKPKAKRGG
C4 GPDVGPYLDFPDNCCPTKPKAKRGG
***:** . *:********
-- Starting log on Wed Oct 26 00:49:48 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=994, Nseq=4, Len=175
C1 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDMPMQEALEVVKNELRKP
C2 MEGVPGPSKLRSMVTITLKWIDPNIMPSVTGWDMPMCEALEIVKDELRKP
C3 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDVSMQEALELVKAELRKP
C4 MEGVPDPPKLKSMVVTTLKWCDPFANPNVTGWDIPIEEALEYAKQQLRTP
*****.*.**:***. *:** ** *.*****:.: **** .* :**.*
C1 EPQLVFVPKYLCHTPLIGEDRIVVTDSTFRATNMGWVPIRELAFDENRIR
C2 EPDLVFVPKYLCHTPLIGRNRVVITDATYRTTVLGWIPIRELAYDESETR
C3 TPKLVFVPNYLCHTPLIGRDRIVITDSIYRATVMGWIPIRELAFDENNIR
C4 EPQLVFVPYYLSHAPGISGDRVVITDSIWYATNFGWQPIRELAMDKDGVR
*.***** **.*:* *. :*:*:**: : :* :** ****** *:. *
C1 FGRSGTFGVLLPMQDAKYIMGHIDIDMRKYGVGAGGDKDEPLLWDGYIDT
C2 YGRSGTYGVLLPMQDSKYIMGSIDIDMRKYGAGAGSDRPEPMLWDGFVDL
C3 CGRSGTFGVLLPEQDPKYVMGEVDIDMRKYGVGACSEKPVPLLWDGYIDT
C4 YGRGGTHGVLLPMQDPSFIMGDIDIQIRKYGIGANSPPDVLPLWDGFSDP
**.**.***** **..::** :**::**** ** . ****: *
C1 PYPEDDYLDFPDNSRPAKPKAKRGG
C2 PRSQKQYLDYPDNCRPTKPKAKRGG
C3 PYPEDDYLDFPDMCRPAKPKAKRGG
C4 GPDVGPYLDFPDNCCPTKPKAKRGG
***:** . *:********
-- Starting log on Wed Oct 26 00:49:06 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=175
C1 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDMPMQEALEVVKNELRKP
C2 MEGVPGPSKLRSMVTITLKWIDPNIMPSVTGWDMPMCEALEIVKDELRKP
C3 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDVSMQEALELVKAELRKP
C4 MEGVPDPPKLKSMVVTTLKWCDPFANPNVTGWDIPIEEALEYAKQQLRTP
*****.*.**:***. *:** ** *.*****:.: **** .* :**.*
C1 EPQLVFVPKYLCHTPLIGEDRIVVTDSTFRATNMGWVPIRELAFDENRIR
C2 EPDLVFVPKYLCHTPLIGRNRVVITDATYRTTVLGWIPIRELAYDESETR
C3 TPKLVFVPNYLCHTPLIGRDRIVITDSIYRATVMGWIPIRELAFDENNIR
C4 EPQLVFVPYYLSHAPGISGDRVVITDSIWYATNFGWQPIRELAMDKDGVR
*.***** **.*:* *. :*:*:**: : :* :** ****** *:. *
C1 FGRSGTFGVLLPMQDAKYIMGHIDIDMRKYGVGAGGDKDEPLLWDGYIDT
C2 YGRSGTYGVLLPMQDSKYIMGSIDIDMRKYGAGAGSDRPEPMLWDGFVDL
C3 CGRSGTFGVLLPEQDPKYVMGEVDIDMRKYGVGACSEKPVPLLWDGYIDT
C4 YGRGGTHGVLLPMQDPSFIMGDIDIQIRKYGIGANSPPDVLPLWDGFSDP
**.**.***** **..::** :**::**** ** . ****: *
C1 PYPEDDYLDFPDNSRPAKPKAKRGG
C2 PRSQKQYLDYPDNCRPTKPKAKRGG
C3 PYPEDDYLDFPDMCRPAKPKAKRGG
C4 GPDVGPYLDFPDNCCPTKPKAKRGG
***:** . *:********
-- Starting log on Wed Oct 26 01:29:27 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/gapped_alignment/fubar,BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 525 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666747769
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 629400138
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5901331290
Seed = 390686540
Swapseed = 1666747769
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.00 % Dirichlet(Revmat{all})
1.00 % Slider(Revmat{all})
1.00 % Dirichlet(Pi{all})
1.00 % Slider(Pi{all})
2.00 % Multiplier(Alpha{1,2})
2.00 % Multiplier(Alpha{3})
2.00 % Slider(Pinvar{all})
10.00 % ExtSPR(Tau{all},V{all})
10.00 % NNI(Tau{all},V{all})
10.00 % ParsSPR(Tau{all},V{all})
40.00 % Multiplier(V{all})
14.00 % Nodeslider(V{all})
6.00 % TLMultiplier(V{all})
Division 1 has 50 unique site patterns
Division 2 has 34 unique site patterns
Division 3 has 68 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2327.733514 -- 13.556448
Chain 2 -- -2326.398784 -- 13.556448
Chain 3 -- -2326.398784 -- 13.556448
Chain 4 -- -2326.398784 -- 13.556448
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2327.733514 -- 13.556448
Chain 2 -- -2327.733514 -- 13.556448
Chain 3 -- -2296.311413 -- 13.556448
Chain 4 -- -2296.311413 -- 13.556448
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2327.734] (-2326.399) (-2326.399) (-2326.399) * [-2327.734] (-2327.734) (-2296.311) (-2296.311)
1000 -- [-1894.512] (-1899.929) (-1901.084) (-1904.336) * (-1904.933) [-1907.549] (-1912.067) (-1909.854) -- 0:00:00
2000 -- (-1894.291) (-1888.719) [-1891.214] (-1899.437) * (-1896.142) (-1891.267) (-1904.851) [-1887.092] -- 0:00:00
3000 -- (-1894.947) [-1883.938] (-1883.506) (-1902.357) * (-1885.303) [-1894.043] (-1890.947) (-1890.850) -- 0:00:00
4000 -- (-1890.054) [-1881.260] (-1889.192) (-1900.210) * (-1882.480) (-1889.114) [-1893.091] (-1886.982) -- 0:00:00
5000 -- (-1894.243) [-1880.637] (-1890.158) (-1890.802) * (-1884.232) [-1883.030] (-1886.401) (-1884.944) -- 0:03:19
Average standard deviation of split frequencies: 0.104757
6000 -- (-1893.765) (-1889.818) [-1880.137] (-1896.337) * (-1893.313) (-1884.097) [-1882.908] (-1883.062) -- 0:02:45
7000 -- [-1889.339] (-1883.419) (-1884.823) (-1891.333) * (-1893.472) (-1881.782) [-1884.741] (-1889.915) -- 0:02:21
8000 -- (-1890.614) [-1883.497] (-1886.131) (-1888.842) * (-1891.431) (-1884.355) [-1886.778] (-1887.838) -- 0:02:04
9000 -- [-1884.622] (-1885.107) (-1887.091) (-1887.798) * (-1889.813) (-1884.083) [-1889.090] (-1885.797) -- 0:03:40
10000 -- [-1893.178] (-1883.048) (-1891.049) (-1887.824) * (-1889.153) [-1888.742] (-1891.222) (-1891.038) -- 0:03:18
Average standard deviation of split frequencies: 0.117851
11000 -- (-1884.838) (-1885.329) (-1884.006) [-1886.442] * [-1884.595] (-1887.673) (-1889.150) (-1887.139) -- 0:02:59
12000 -- [-1882.863] (-1886.162) (-1885.497) (-1892.914) * (-1891.504) (-1883.623) [-1888.194] (-1890.182) -- 0:02:44
13000 -- (-1887.228) (-1890.606) [-1888.625] (-1889.304) * (-1889.119) (-1887.530) (-1885.951) [-1888.748] -- 0:02:31
14000 -- (-1883.373) (-1880.288) [-1884.938] (-1888.435) * (-1885.531) [-1885.649] (-1891.908) (-1891.765) -- 0:03:31
15000 -- (-1885.683) [-1881.212] (-1886.651) (-1888.405) * [-1881.943] (-1889.034) (-1884.177) (-1892.208) -- 0:03:17
Average standard deviation of split frequencies: 0.078567
16000 -- (-1883.421) (-1885.783) (-1882.605) [-1886.643] * (-1885.721) (-1885.303) [-1885.596] (-1887.620) -- 0:03:04
17000 -- (-1884.359) (-1879.415) (-1883.675) [-1884.264] * (-1887.756) (-1886.506) [-1880.416] (-1883.684) -- 0:02:53
18000 -- (-1886.676) [-1886.775] (-1886.047) (-1885.147) * (-1883.624) [-1884.583] (-1887.970) (-1888.028) -- 0:03:38
19000 -- (-1886.210) [-1884.709] (-1882.609) (-1884.905) * (-1885.496) (-1887.542) (-1887.542) [-1887.105] -- 0:03:26
20000 -- (-1885.707) [-1886.145] (-1891.333) (-1884.704) * [-1886.025] (-1890.806) (-1897.351) (-1885.089) -- 0:03:16
Average standard deviation of split frequencies: 0.060826
21000 -- [-1884.185] (-1890.876) (-1888.246) (-1890.623) * [-1882.259] (-1887.799) (-1887.668) (-1882.405) -- 0:03:06
22000 -- (-1887.306) (-1900.647) (-1886.312) [-1885.830] * (-1885.739) (-1886.176) [-1888.505] (-1888.044) -- 0:03:42
23000 -- (-1892.603) (-1887.297) (-1891.780) [-1882.499] * (-1891.193) [-1885.230] (-1890.550) (-1882.646) -- 0:03:32
24000 -- (-1889.093) [-1884.667] (-1893.257) (-1885.231) * (-1889.301) (-1888.861) (-1888.018) [-1887.291] -- 0:03:23
25000 -- (-1890.252) [-1883.440] (-1891.971) (-1882.787) * [-1887.031] (-1884.836) (-1883.492) (-1886.200) -- 0:03:15
Average standard deviation of split frequencies: 0.108786
26000 -- (-1889.233) [-1884.072] (-1881.689) (-1884.042) * (-1888.268) (-1888.548) [-1881.361] (-1886.603) -- 0:03:07
27000 -- (-1885.630) (-1883.496) (-1890.432) [-1884.762] * (-1885.478) [-1883.960] (-1883.383) (-1889.720) -- 0:03:36
28000 -- (-1889.096) [-1884.175] (-1885.650) (-1884.637) * (-1885.387) [-1895.444] (-1884.607) (-1886.657) -- 0:03:28
29000 -- (-1886.431) [-1883.186] (-1893.194) (-1885.864) * (-1885.924) (-1886.486) (-1888.722) [-1885.466] -- 0:03:20
30000 -- (-1889.525) [-1880.087] (-1895.341) (-1888.636) * (-1883.315) [-1886.387] (-1886.437) (-1887.709) -- 0:03:14
Average standard deviation of split frequencies: 0.184463
31000 -- (-1886.942) [-1885.728] (-1886.298) (-1891.188) * (-1883.322) (-1885.342) (-1886.968) [-1884.200] -- 0:03:38
32000 -- [-1886.175] (-1885.616) (-1885.375) (-1891.061) * [-1879.713] (-1885.778) (-1886.081) (-1884.927) -- 0:03:31
33000 -- [-1883.668] (-1894.030) (-1887.779) (-1886.756) * (-1883.346) [-1886.709] (-1885.617) (-1885.142) -- 0:03:25
34000 -- (-1885.125) (-1880.074) [-1888.702] (-1891.968) * (-1885.616) (-1886.490) (-1882.702) [-1883.174] -- 0:03:18
35000 -- (-1890.674) [-1881.935] (-1885.342) (-1890.490) * [-1883.539] (-1887.387) (-1883.723) (-1890.070) -- 0:03:13
Average standard deviation of split frequencies: 0.113486
36000 -- (-1886.032) (-1884.824) [-1883.921] (-1888.781) * (-1891.393) (-1886.312) [-1883.408] (-1885.433) -- 0:03:34
37000 -- (-1892.498) [-1883.153] (-1890.740) (-1891.235) * (-1887.724) (-1882.629) [-1885.043] (-1884.683) -- 0:03:28
38000 -- (-1896.291) [-1886.802] (-1885.036) (-1891.615) * (-1885.492) (-1890.592) [-1883.196] (-1882.602) -- 0:03:22
39000 -- (-1886.060) [-1885.490] (-1882.265) (-1891.075) * (-1884.056) (-1886.459) [-1881.825] (-1890.204) -- 0:03:17
40000 -- [-1885.287] (-1882.897) (-1884.751) (-1895.095) * (-1886.838) [-1891.270] (-1887.964) (-1883.864) -- 0:03:36
Average standard deviation of split frequencies: 0.121715
41000 -- (-1883.565) [-1882.565] (-1888.366) (-1892.141) * (-1891.160) (-1885.767) (-1887.222) [-1886.874] -- 0:03:30
42000 -- [-1888.869] (-1889.155) (-1881.663) (-1889.237) * (-1887.618) (-1884.582) (-1883.353) [-1882.584] -- 0:03:25
43000 -- (-1896.642) [-1886.478] (-1886.325) (-1885.200) * (-1893.734) (-1885.532) (-1887.157) [-1885.360] -- 0:03:20
44000 -- (-1892.926) [-1880.462] (-1883.284) (-1896.651) * (-1895.406) (-1884.736) [-1888.100] (-1886.847) -- 0:03:15
45000 -- (-1885.370) [-1881.799] (-1892.678) (-1896.824) * (-1886.517) (-1885.719) (-1893.827) [-1886.717] -- 0:03:32
Average standard deviation of split frequencies: 0.088815
46000 -- (-1890.316) [-1884.066] (-1884.107) (-1890.585) * (-1888.476) (-1884.264) (-1886.097) [-1888.698] -- 0:03:27
47000 -- (-1886.750) [-1891.961] (-1882.272) (-1884.274) * (-1883.742) (-1884.687) [-1883.713] (-1887.036) -- 0:03:22
48000 -- (-1891.408) (-1887.612) (-1887.395) [-1882.427] * [-1888.564] (-1887.167) (-1881.186) (-1886.518) -- 0:03:18
49000 -- [-1886.641] (-1888.373) (-1889.858) (-1889.454) * (-1898.435) (-1887.340) (-1885.772) [-1881.016] -- 0:03:33
50000 -- (-1887.298) (-1886.179) [-1886.989] (-1892.517) * (-1883.620) (-1881.040) (-1887.865) [-1886.552] -- 0:03:29
Average standard deviation of split frequencies: 0.068230
51000 -- (-1886.295) (-1884.083) (-1888.808) [-1883.753] * (-1888.422) [-1881.869] (-1885.463) (-1888.040) -- 0:03:24
52000 -- (-1896.247) (-1893.273) (-1885.447) [-1890.392] * (-1885.076) (-1884.724) (-1879.826) [-1885.428] -- 0:03:20
53000 -- (-1883.706) (-1883.446) (-1886.979) [-1882.347] * (-1885.704) (-1882.586) [-1885.471] (-1889.363) -- 0:03:16
54000 -- (-1883.760) (-1893.584) (-1892.068) [-1889.923] * (-1885.079) [-1892.742] (-1890.771) (-1886.371) -- 0:03:30
55000 -- (-1891.851) [-1886.073] (-1885.389) (-1885.804) * [-1881.844] (-1888.328) (-1886.205) (-1885.406) -- 0:03:26
Average standard deviation of split frequencies: 0.072955
56000 -- [-1891.441] (-1880.423) (-1882.223) (-1888.690) * (-1887.661) [-1890.352] (-1890.077) (-1887.524) -- 0:03:22
57000 -- (-1891.011) (-1888.459) [-1885.544] (-1894.757) * (-1885.104) (-1894.574) (-1884.409) [-1887.166] -- 0:03:18
58000 -- (-1883.668) (-1885.199) (-1890.756) [-1885.002] * (-1885.832) (-1887.771) [-1880.033] (-1890.264) -- 0:03:31
59000 -- (-1884.550) (-1888.335) (-1882.214) [-1883.192] * (-1893.594) (-1886.148) (-1881.426) [-1888.210] -- 0:03:27
60000 -- (-1891.399) (-1883.164) [-1883.340] (-1886.082) * [-1889.729] (-1889.698) (-1887.972) (-1893.521) -- 0:03:23
Average standard deviation of split frequencies: 0.077704
61000 -- (-1893.795) [-1886.465] (-1883.751) (-1894.833) * (-1889.281) (-1885.200) [-1882.629] (-1884.850) -- 0:03:20
62000 -- (-1885.413) (-1885.178) [-1881.208] (-1888.886) * (-1890.519) (-1888.107) (-1885.106) [-1888.249] -- 0:03:31
63000 -- (-1891.659) (-1887.310) [-1885.702] (-1882.278) * [-1887.007] (-1885.858) (-1885.468) (-1884.665) -- 0:03:28
64000 -- (-1888.680) [-1887.668] (-1883.478) (-1885.807) * (-1886.668) (-1887.950) (-1894.162) [-1883.677] -- 0:03:24
65000 -- (-1883.209) (-1889.167) [-1888.499] (-1886.250) * (-1887.269) (-1883.110) (-1887.896) [-1891.306] -- 0:03:21
Average standard deviation of split frequencies: 0.057140
66000 -- (-1894.162) (-1888.158) [-1885.476] (-1883.504) * (-1888.865) (-1881.606) (-1885.551) [-1891.067] -- 0:03:18
67000 -- (-1892.486) [-1895.743] (-1885.125) (-1886.729) * (-1884.467) (-1882.079) (-1886.567) [-1882.755] -- 0:03:28
68000 -- (-1889.262) (-1887.055) [-1885.933] (-1885.363) * [-1883.640] (-1884.407) (-1888.108) (-1890.051) -- 0:03:25
69000 -- (-1885.556) (-1884.266) (-1887.881) [-1886.634] * (-1891.454) [-1881.812] (-1890.866) (-1889.198) -- 0:03:22
70000 -- (-1890.429) (-1889.781) [-1884.497] (-1884.280) * [-1882.344] (-1887.480) (-1889.550) (-1886.415) -- 0:03:19
Average standard deviation of split frequencies: 0.062261
71000 -- (-1889.697) (-1889.085) (-1885.360) [-1886.782] * (-1890.177) [-1884.611] (-1889.836) (-1886.865) -- 0:03:29
72000 -- (-1894.769) (-1883.102) (-1886.697) [-1881.723] * (-1884.706) [-1882.491] (-1889.393) (-1882.601) -- 0:03:26
73000 -- (-1886.830) [-1887.353] (-1886.413) (-1884.148) * (-1882.394) (-1885.302) [-1890.219] (-1887.103) -- 0:03:23
74000 -- [-1887.729] (-1890.432) (-1885.941) (-1889.101) * (-1882.993) (-1883.589) (-1889.662) [-1882.721] -- 0:03:20
75000 -- (-1882.722) (-1891.898) (-1886.288) [-1885.442] * [-1887.819] (-1885.170) (-1883.906) (-1883.866) -- 0:03:17
Average standard deviation of split frequencies: 0.086838
76000 -- (-1886.393) (-1888.300) [-1888.671] (-1905.054) * (-1891.082) (-1886.528) [-1882.456] (-1888.103) -- 0:03:26
77000 -- (-1884.709) [-1885.819] (-1889.665) (-1888.625) * (-1894.070) (-1890.197) (-1886.122) [-1886.345] -- 0:03:23
78000 -- (-1881.967) [-1883.812] (-1884.866) (-1883.474) * [-1883.615] (-1884.297) (-1890.862) (-1885.363) -- 0:03:20
79000 -- (-1885.388) [-1890.246] (-1892.239) (-1883.248) * (-1888.615) [-1882.185] (-1883.449) (-1886.252) -- 0:03:18
80000 -- [-1884.268] (-1888.551) (-1892.320) (-1884.650) * (-1884.456) (-1883.713) (-1884.321) [-1884.323] -- 0:03:27
Average standard deviation of split frequencies: 0.073048
81000 -- (-1887.450) [-1882.839] (-1884.475) (-1884.312) * [-1886.427] (-1885.235) (-1885.308) (-1892.844) -- 0:03:24
82000 -- (-1884.212) [-1885.645] (-1885.011) (-1886.019) * (-1893.306) (-1886.115) [-1889.333] (-1884.805) -- 0:03:21
83000 -- (-1886.951) (-1881.880) [-1887.050] (-1888.153) * (-1895.958) (-1884.986) (-1885.723) [-1885.986] -- 0:03:18
84000 -- (-1884.416) [-1882.146] (-1887.279) (-1883.392) * (-1885.857) (-1886.597) (-1887.479) [-1885.327] -- 0:03:16
85000 -- (-1882.544) (-1894.382) (-1891.105) [-1884.985] * (-1888.423) [-1886.987] (-1892.241) (-1888.866) -- 0:03:24
Average standard deviation of split frequencies: 0.065777
86000 -- (-1893.005) (-1890.651) [-1886.750] (-1885.742) * (-1889.502) [-1887.267] (-1884.690) (-1890.731) -- 0:03:21
87000 -- (-1885.786) (-1882.181) (-1893.024) [-1889.393] * (-1884.182) (-1887.208) [-1885.536] (-1893.416) -- 0:03:19
88000 -- (-1886.258) (-1882.178) (-1887.810) [-1887.493] * [-1888.491] (-1889.284) (-1887.546) (-1883.854) -- 0:03:16
89000 -- (-1891.296) [-1883.589] (-1895.001) (-1890.142) * [-1882.345] (-1888.916) (-1886.608) (-1886.087) -- 0:03:24
90000 -- (-1888.453) [-1883.475] (-1895.527) (-1896.219) * (-1888.390) [-1886.159] (-1885.359) (-1884.133) -- 0:03:22
Average standard deviation of split frequencies: 0.054593
91000 -- (-1885.000) (-1887.449) [-1888.328] (-1886.248) * (-1885.170) (-1884.974) [-1883.900] (-1891.235) -- 0:03:19
92000 -- (-1892.610) [-1883.434] (-1890.268) (-1881.106) * (-1890.914) (-1882.063) (-1882.125) [-1888.678] -- 0:03:17
93000 -- (-1885.320) (-1884.217) (-1887.314) [-1881.929] * (-1886.386) (-1885.816) (-1887.997) [-1887.254] -- 0:03:24
94000 -- (-1888.515) [-1883.797] (-1889.041) (-1885.429) * [-1887.590] (-1883.605) (-1881.633) (-1884.827) -- 0:03:22
95000 -- (-1884.432) [-1888.545] (-1888.913) (-1887.402) * [-1886.186] (-1887.898) (-1887.605) (-1889.820) -- 0:03:20
Average standard deviation of split frequencies: 0.027008
96000 -- (-1888.356) [-1884.720] (-1882.074) (-1890.123) * [-1882.708] (-1883.341) (-1887.180) (-1882.815) -- 0:03:17
97000 -- (-1888.821) (-1882.131) (-1890.560) [-1886.455] * (-1888.996) [-1884.261] (-1885.305) (-1884.016) -- 0:03:15
98000 -- (-1884.655) [-1887.543] (-1892.176) (-1892.148) * (-1881.877) (-1888.250) (-1892.237) [-1883.530] -- 0:03:22
99000 -- [-1883.639] (-1891.845) (-1884.860) (-1886.756) * (-1885.612) [-1886.484] (-1882.260) (-1891.682) -- 0:03:20
100000 -- (-1888.630) (-1890.368) (-1888.334) [-1886.944] * (-1882.903) (-1887.437) [-1883.353] (-1895.325) -- 0:03:18
Average standard deviation of split frequencies: 0.016390
101000 -- (-1887.414) [-1883.313] (-1881.341) (-1883.048) * (-1882.683) (-1883.555) (-1885.110) [-1888.261] -- 0:03:15
102000 -- (-1883.811) (-1883.707) (-1884.442) [-1884.371] * [-1882.292] (-1884.946) (-1882.976) (-1889.519) -- 0:03:22
103000 -- (-1894.250) (-1896.429) (-1884.118) [-1883.180] * (-1888.397) (-1888.441) [-1885.933] (-1894.441) -- 0:03:20
104000 -- (-1885.796) [-1886.701] (-1887.066) (-1888.164) * (-1883.246) [-1888.838] (-1894.596) (-1892.898) -- 0:03:18
105000 -- (-1890.656) (-1885.543) [-1885.110] (-1892.633) * [-1888.967] (-1886.646) (-1889.469) (-1887.932) -- 0:03:16
Average standard deviation of split frequencies: 0.017789
106000 -- (-1883.691) (-1889.431) (-1887.369) [-1881.451] * (-1891.528) (-1888.239) (-1882.330) [-1883.170] -- 0:03:13
107000 -- (-1887.170) (-1894.063) [-1886.040] (-1895.191) * (-1891.394) (-1886.973) (-1882.403) [-1882.929] -- 0:03:20
108000 -- (-1891.344) (-1889.504) [-1887.504] (-1884.144) * [-1890.253] (-1888.415) (-1882.057) (-1894.246) -- 0:03:18
109000 -- (-1895.945) (-1887.387) [-1883.308] (-1888.807) * (-1888.573) [-1886.489] (-1887.123) (-1884.099) -- 0:03:16
110000 -- (-1894.424) [-1889.661] (-1896.769) (-1886.874) * (-1887.274) (-1885.158) [-1886.300] (-1884.094) -- 0:03:14
Average standard deviation of split frequencies: 0.028398
111000 -- (-1892.837) [-1885.113] (-1885.867) (-1883.241) * (-1889.634) [-1881.086] (-1891.459) (-1882.994) -- 0:03:20
112000 -- (-1885.687) (-1893.478) (-1885.792) [-1883.168] * (-1888.883) (-1882.872) [-1885.152] (-1890.844) -- 0:03:18
113000 -- [-1886.363] (-1885.590) (-1886.661) (-1890.144) * (-1887.279) [-1885.419] (-1884.771) (-1886.268) -- 0:03:16
114000 -- (-1889.005) (-1890.342) [-1887.077] (-1892.928) * (-1883.413) (-1884.629) (-1890.098) [-1886.024] -- 0:03:14
115000 -- [-1893.866] (-1888.508) (-1885.843) (-1888.087) * [-1886.279] (-1892.506) (-1886.388) (-1891.037) -- 0:03:12
Average standard deviation of split frequencies: 0.027092
116000 -- (-1899.997) [-1882.674] (-1887.953) (-1890.238) * (-1887.779) (-1883.116) [-1887.035] (-1883.627) -- 0:03:18
117000 -- (-1890.726) (-1882.782) (-1883.498) [-1887.278] * [-1885.695] (-1885.608) (-1888.962) (-1883.832) -- 0:03:16
118000 -- [-1884.926] (-1882.125) (-1884.168) (-1883.624) * (-1887.831) [-1880.971] (-1892.184) (-1887.773) -- 0:03:14
119000 -- (-1887.515) (-1882.829) (-1885.523) [-1883.433] * [-1886.100] (-1885.799) (-1892.118) (-1881.631) -- 0:03:12
120000 -- (-1881.408) (-1885.023) [-1887.049] (-1886.098) * (-1883.466) (-1883.692) [-1893.417] (-1884.557) -- 0:03:18
Average standard deviation of split frequencies: 0.023440
121000 -- (-1883.290) (-1880.328) (-1882.916) [-1889.677] * [-1883.876] (-1886.649) (-1883.919) (-1885.034) -- 0:03:16
122000 -- (-1890.004) (-1884.683) (-1885.462) [-1889.447] * (-1881.915) (-1887.655) [-1884.106] (-1890.275) -- 0:03:14
123000 -- [-1885.347] (-1894.834) (-1888.141) (-1882.482) * (-1889.326) (-1886.269) (-1888.093) [-1888.935] -- 0:03:12
124000 -- (-1890.079) [-1892.871] (-1883.914) (-1884.125) * [-1884.881] (-1883.372) (-1894.998) (-1892.477) -- 0:03:17
125000 -- (-1890.991) [-1892.216] (-1887.685) (-1888.191) * (-1885.157) (-1883.765) [-1886.004] (-1890.338) -- 0:03:16
Average standard deviation of split frequencies: 0.024942
126000 -- (-1890.328) [-1886.998] (-1885.764) (-1885.769) * (-1889.301) [-1882.170] (-1886.101) (-1884.853) -- 0:03:14
127000 -- [-1891.848] (-1883.698) (-1886.830) (-1883.863) * [-1885.744] (-1884.657) (-1881.810) (-1884.886) -- 0:03:12
128000 -- (-1889.313) (-1897.507) (-1886.548) [-1882.441] * (-1886.697) [-1884.363] (-1885.494) (-1890.462) -- 0:03:10
129000 -- [-1883.289] (-1883.957) (-1885.676) (-1889.349) * [-1882.943] (-1882.245) (-1884.868) (-1897.866) -- 0:03:15
130000 -- (-1887.528) (-1886.557) [-1885.898] (-1891.850) * [-1885.160] (-1886.825) (-1884.364) (-1886.607) -- 0:03:14
Average standard deviation of split frequencies: 0.026456
131000 -- (-1886.321) (-1885.798) [-1884.318] (-1889.382) * (-1885.800) (-1884.302) (-1887.506) [-1889.122] -- 0:03:12
132000 -- (-1885.979) [-1887.521] (-1884.792) (-1886.399) * [-1885.787] (-1885.701) (-1884.211) (-1885.108) -- 0:03:10
133000 -- (-1886.112) (-1886.365) [-1887.895] (-1884.290) * (-1880.923) (-1885.267) [-1885.517] (-1885.688) -- 0:03:15
134000 -- (-1883.482) [-1890.724] (-1891.105) (-1888.895) * [-1882.331] (-1881.285) (-1890.554) (-1888.933) -- 0:03:13
135000 -- (-1885.330) (-1889.690) [-1884.291] (-1888.229) * [-1887.561] (-1888.107) (-1887.714) (-1886.182) -- 0:03:12
Average standard deviation of split frequencies: 0.030040
136000 -- (-1880.932) [-1884.977] (-1886.474) (-1891.402) * (-1888.194) (-1885.861) [-1889.440] (-1885.918) -- 0:03:10
137000 -- (-1883.526) [-1892.433] (-1888.225) (-1887.314) * (-1890.295) (-1891.921) (-1887.421) [-1883.541] -- 0:03:08
138000 -- (-1886.188) [-1890.321] (-1885.758) (-1890.722) * (-1881.945) (-1886.635) (-1889.120) [-1886.409] -- 0:03:13
139000 -- (-1887.466) [-1890.504] (-1888.440) (-1893.789) * (-1883.872) (-1888.257) (-1888.673) [-1882.149] -- 0:03:12
140000 -- [-1882.705] (-1884.732) (-1883.724) (-1890.644) * (-1884.452) (-1884.414) [-1884.136] (-1887.487) -- 0:03:10
Average standard deviation of split frequencies: 0.033512
141000 -- (-1882.620) (-1886.682) [-1888.946] (-1885.911) * (-1886.438) [-1887.264] (-1885.642) (-1887.015) -- 0:03:08
142000 -- (-1882.364) (-1890.158) [-1886.924] (-1886.024) * [-1882.726] (-1887.912) (-1884.513) (-1891.836) -- 0:03:13
143000 -- (-1886.292) [-1884.865] (-1888.222) (-1883.960) * (-1884.244) [-1887.539] (-1889.128) (-1885.057) -- 0:03:11
144000 -- (-1882.510) (-1890.670) [-1891.499] (-1887.631) * (-1882.090) (-1891.548) (-1892.359) [-1885.053] -- 0:03:10
145000 -- (-1884.934) (-1888.598) [-1888.103] (-1893.332) * (-1889.581) (-1883.671) [-1888.316] (-1885.739) -- 0:03:08
Average standard deviation of split frequencies: 0.036593
146000 -- [-1886.169] (-1885.106) (-1886.789) (-1892.920) * (-1888.011) [-1886.419] (-1883.837) (-1892.380) -- 0:03:07
147000 -- (-1889.581) (-1879.956) [-1887.713] (-1893.499) * (-1886.713) [-1883.100] (-1885.587) (-1890.152) -- 0:03:11
148000 -- (-1883.625) (-1882.220) [-1884.476] (-1889.342) * (-1886.072) (-1883.704) (-1886.030) [-1887.995] -- 0:03:09
149000 -- (-1889.001) (-1893.221) [-1888.458] (-1887.766) * (-1888.621) (-1887.708) [-1884.731] (-1893.156) -- 0:03:08
150000 -- (-1881.642) (-1887.916) (-1886.369) [-1884.106] * (-1886.825) (-1885.074) (-1885.514) [-1882.371] -- 0:03:07
Average standard deviation of split frequencies: 0.037545
151000 -- (-1886.660) (-1885.839) (-1883.719) [-1881.310] * [-1885.894] (-1883.961) (-1883.424) (-1887.275) -- 0:03:11
152000 -- (-1887.974) [-1884.184] (-1891.059) (-1885.107) * (-1885.511) (-1896.230) (-1891.077) [-1882.958] -- 0:03:09
153000 -- (-1891.268) (-1884.826) [-1883.963] (-1887.385) * (-1888.929) (-1891.724) (-1887.638) [-1888.791] -- 0:03:08
154000 -- (-1887.309) [-1885.747] (-1886.753) (-1887.424) * (-1884.359) [-1881.314] (-1883.288) (-1887.370) -- 0:03:06
155000 -- (-1889.939) [-1884.843] (-1887.826) (-1888.812) * (-1892.699) (-1886.747) (-1883.478) [-1884.933] -- 0:03:05
Average standard deviation of split frequencies: 0.038276
156000 -- (-1890.633) (-1882.567) [-1887.567] (-1886.785) * [-1885.655] (-1885.608) (-1888.163) (-1888.173) -- 0:03:09
157000 -- (-1885.519) (-1887.134) [-1882.781] (-1881.502) * [-1884.720] (-1886.085) (-1890.385) (-1889.887) -- 0:03:07
158000 -- (-1883.791) (-1882.814) (-1882.144) [-1886.305] * [-1884.189] (-1889.258) (-1884.787) (-1888.697) -- 0:03:06
159000 -- (-1885.285) [-1882.793] (-1882.539) (-1882.945) * (-1887.228) (-1884.443) (-1884.073) [-1888.742] -- 0:03:05
160000 -- (-1884.960) (-1883.447) (-1889.741) [-1883.609] * (-1887.370) [-1884.811] (-1891.026) (-1888.652) -- 0:03:09
Average standard deviation of split frequencies: 0.037165
161000 -- (-1885.030) (-1886.786) (-1884.116) [-1881.122] * [-1888.739] (-1895.329) (-1887.608) (-1890.658) -- 0:03:07
162000 -- (-1886.630) (-1883.068) (-1887.065) [-1880.161] * (-1886.617) (-1889.431) (-1893.889) [-1883.807] -- 0:03:06
163000 -- (-1883.246) (-1885.528) (-1887.661) [-1885.490] * (-1897.749) [-1886.355] (-1886.007) (-1890.098) -- 0:03:04
164000 -- (-1882.367) [-1884.513] (-1884.199) (-1886.886) * (-1886.721) [-1886.230] (-1893.633) (-1884.219) -- 0:03:03
165000 -- [-1883.407] (-1892.765) (-1888.125) (-1887.965) * (-1890.283) (-1889.064) [-1882.328] (-1883.419) -- 0:03:07
Average standard deviation of split frequencies: 0.037864
166000 -- [-1885.542] (-1887.128) (-1888.481) (-1888.266) * (-1893.032) (-1884.831) (-1889.097) [-1885.548] -- 0:03:05
167000 -- (-1887.261) (-1886.638) [-1885.747] (-1888.501) * [-1888.749] (-1880.599) (-1886.220) (-1888.271) -- 0:03:04
168000 -- (-1884.468) [-1883.011] (-1880.524) (-1882.279) * (-1889.771) [-1881.453] (-1887.512) (-1885.712) -- 0:03:03
169000 -- (-1886.220) (-1887.484) (-1886.719) [-1885.908] * (-1888.403) [-1891.333] (-1884.512) (-1885.049) -- 0:03:06
170000 -- (-1889.714) [-1891.609] (-1886.111) (-1887.605) * (-1900.221) (-1887.938) [-1885.847] (-1885.148) -- 0:03:05
Average standard deviation of split frequencies: 0.038670
171000 -- (-1890.305) (-1895.241) [-1886.315] (-1885.879) * (-1888.841) (-1885.322) (-1887.974) [-1889.623] -- 0:03:04
172000 -- (-1885.152) (-1896.175) (-1886.192) [-1884.686] * (-1886.861) (-1887.759) (-1885.860) [-1883.632] -- 0:03:02
173000 -- (-1886.051) (-1895.403) [-1882.480] (-1887.481) * [-1885.385] (-1884.622) (-1894.355) (-1881.840) -- 0:03:01
174000 -- (-1889.919) (-1886.853) (-1885.825) [-1886.553] * (-1883.837) (-1884.401) (-1882.296) [-1881.766] -- 0:03:05
175000 -- (-1891.731) (-1885.431) (-1888.532) [-1884.901] * [-1884.959] (-1885.870) (-1886.960) (-1888.748) -- 0:03:03
Average standard deviation of split frequencies: 0.033927
176000 -- [-1884.078] (-1886.178) (-1885.840) (-1887.522) * (-1887.206) (-1888.301) (-1890.769) [-1885.694] -- 0:03:02
177000 -- (-1887.852) (-1882.386) [-1885.830] (-1889.573) * [-1885.890] (-1881.386) (-1885.273) (-1885.637) -- 0:03:01
178000 -- [-1891.201] (-1887.690) (-1891.038) (-1894.284) * (-1886.799) (-1885.022) [-1888.287] (-1887.093) -- 0:03:04
179000 -- (-1884.131) [-1883.589] (-1896.756) (-1886.432) * (-1886.888) [-1887.997] (-1890.323) (-1886.746) -- 0:03:03
180000 -- (-1885.222) (-1884.072) (-1888.422) [-1882.063] * (-1882.691) (-1894.125) [-1887.853] (-1883.208) -- 0:03:02
Average standard deviation of split frequencies: 0.029572
181000 -- (-1886.829) (-1887.258) (-1883.883) [-1884.929] * [-1886.450] (-1886.042) (-1889.687) (-1891.239) -- 0:03:00
182000 -- (-1886.911) (-1885.575) [-1890.050] (-1885.326) * (-1893.087) (-1884.483) [-1885.983] (-1883.166) -- 0:02:59
183000 -- [-1883.059] (-1892.025) (-1885.774) (-1883.426) * (-1886.240) [-1881.819] (-1892.336) (-1883.576) -- 0:03:03
184000 -- (-1888.235) (-1890.245) [-1887.888] (-1886.662) * [-1888.629] (-1885.712) (-1893.192) (-1889.240) -- 0:03:01
185000 -- (-1890.529) (-1885.759) (-1893.021) [-1887.008] * [-1886.680] (-1884.160) (-1895.205) (-1885.752) -- 0:03:00
Average standard deviation of split frequencies: 0.032103
186000 -- (-1885.446) (-1885.980) [-1887.226] (-1886.480) * (-1887.797) [-1883.179] (-1896.156) (-1884.375) -- 0:02:59
187000 -- (-1891.344) [-1883.757] (-1892.990) (-1883.627) * (-1888.445) [-1883.495] (-1888.373) (-1881.533) -- 0:03:02
188000 -- (-1888.292) [-1885.368] (-1891.913) (-1882.903) * (-1890.594) (-1883.907) (-1883.659) [-1883.483] -- 0:03:01
189000 -- (-1887.295) (-1887.810) [-1885.188] (-1891.719) * (-1893.179) [-1883.155] (-1888.222) (-1882.684) -- 0:03:00
190000 -- (-1891.580) (-1891.078) (-1884.826) [-1886.026] * (-1886.092) (-1887.021) (-1883.488) [-1888.385] -- 0:02:59
Average standard deviation of split frequencies: 0.029669
191000 -- (-1885.917) (-1890.054) [-1883.986] (-1884.374) * [-1884.842] (-1886.069) (-1886.259) (-1901.288) -- 0:02:57
192000 -- [-1884.167] (-1887.718) (-1881.658) (-1890.506) * (-1886.006) [-1888.726] (-1886.632) (-1894.857) -- 0:03:00
193000 -- (-1887.144) (-1891.610) [-1883.339] (-1893.339) * (-1893.428) (-1883.593) (-1884.322) [-1894.174] -- 0:02:59
194000 -- [-1888.302] (-1888.087) (-1884.049) (-1886.007) * (-1884.402) (-1886.533) [-1888.819] (-1887.844) -- 0:02:58
195000 -- (-1893.417) (-1880.884) (-1884.958) [-1883.261] * (-1883.696) (-1881.502) (-1887.026) [-1882.504] -- 0:02:57
Average standard deviation of split frequencies: 0.030465
196000 -- (-1886.413) [-1886.535] (-1886.546) (-1889.047) * (-1886.571) [-1885.287] (-1887.986) (-1892.853) -- 0:03:00
197000 -- (-1886.937) (-1889.578) (-1887.128) [-1886.846] * (-1886.286) (-1887.090) [-1883.677] (-1889.345) -- 0:02:59
198000 -- [-1883.418] (-1883.971) (-1888.218) (-1884.309) * (-1884.787) [-1883.218] (-1890.135) (-1884.794) -- 0:02:58
199000 -- (-1884.521) [-1886.130] (-1885.816) (-1889.754) * (-1888.390) (-1885.248) [-1884.107] (-1884.897) -- 0:02:57
200000 -- (-1890.648) [-1881.431] (-1883.305) (-1892.111) * (-1882.495) [-1885.684] (-1885.094) (-1889.008) -- 0:02:56
Average standard deviation of split frequencies: 0.031323
201000 -- [-1885.590] (-1883.828) (-1887.516) (-1886.256) * (-1883.000) (-1890.245) [-1883.910] (-1890.484) -- 0:02:58
202000 -- (-1881.082) [-1881.607] (-1891.961) (-1882.618) * (-1886.884) (-1886.535) [-1885.230] (-1890.189) -- 0:02:57
203000 -- (-1889.804) (-1884.600) [-1887.600] (-1893.745) * (-1886.109) (-1889.547) (-1884.821) [-1885.769] -- 0:02:56
204000 -- (-1890.731) (-1882.961) [-1883.506] (-1886.336) * [-1883.216] (-1888.314) (-1898.430) (-1882.686) -- 0:02:55
205000 -- (-1893.936) [-1887.630] (-1887.605) (-1899.557) * [-1883.083] (-1884.055) (-1884.504) (-1887.611) -- 0:02:58
Average standard deviation of split frequencies: 0.030512
206000 -- (-1880.646) [-1883.571] (-1890.048) (-1894.090) * (-1887.255) (-1888.631) [-1882.848] (-1884.178) -- 0:02:57
207000 -- [-1883.317] (-1891.595) (-1887.158) (-1882.923) * [-1887.064] (-1884.833) (-1884.472) (-1883.404) -- 0:02:56
208000 -- (-1884.507) [-1887.861] (-1891.902) (-1881.072) * (-1892.307) (-1892.095) [-1889.309] (-1886.328) -- 0:02:55
209000 -- (-1885.380) (-1888.398) (-1896.787) [-1882.964] * (-1886.757) (-1886.359) (-1886.962) [-1884.825] -- 0:02:57
210000 -- (-1884.237) [-1883.362] (-1893.829) (-1883.396) * (-1883.045) [-1884.459] (-1885.656) (-1891.348) -- 0:02:56
Average standard deviation of split frequencies: 0.029836
211000 -- (-1886.023) (-1884.463) [-1887.856] (-1884.417) * (-1895.885) (-1883.987) [-1881.612] (-1888.206) -- 0:02:55
212000 -- [-1887.851] (-1893.844) (-1891.862) (-1886.792) * (-1894.061) (-1883.528) (-1888.818) [-1885.912] -- 0:02:54
213000 -- (-1888.826) (-1888.410) (-1884.467) [-1884.069] * (-1888.842) [-1884.920] (-1889.997) (-1887.153) -- 0:02:53
214000 -- (-1883.758) [-1890.295] (-1889.629) (-1885.007) * (-1881.930) (-1882.476) [-1882.611] (-1883.657) -- 0:02:56
215000 -- (-1886.612) (-1891.499) [-1889.160] (-1884.285) * [-1885.373] (-1882.888) (-1883.996) (-1884.841) -- 0:02:55
Average standard deviation of split frequencies: 0.030554
216000 -- (-1885.281) (-1887.672) (-1889.990) [-1886.637] * (-1883.439) (-1887.084) [-1884.531] (-1885.418) -- 0:02:54
217000 -- (-1886.065) (-1886.346) [-1891.978] (-1885.059) * [-1885.824] (-1886.763) (-1889.591) (-1886.955) -- 0:02:53
218000 -- (-1887.593) [-1891.476] (-1888.628) (-1886.317) * (-1895.275) (-1886.177) (-1887.090) [-1890.188] -- 0:02:55
219000 -- (-1884.083) (-1885.729) [-1885.755] (-1882.782) * (-1889.723) (-1885.197) [-1880.222] (-1883.742) -- 0:02:54
220000 -- (-1888.068) (-1886.213) [-1890.108] (-1889.132) * [-1882.446] (-1897.947) (-1887.312) (-1885.766) -- 0:02:53
Average standard deviation of split frequencies: 0.034180
221000 -- [-1885.686] (-1886.086) (-1885.380) (-1884.003) * [-1887.645] (-1886.449) (-1888.818) (-1882.436) -- 0:02:52
222000 -- (-1886.309) (-1887.951) (-1891.595) [-1886.230] * [-1885.959] (-1884.941) (-1882.218) (-1884.961) -- 0:02:51
223000 -- [-1880.564] (-1888.873) (-1886.449) (-1884.590) * [-1882.903] (-1886.803) (-1889.622) (-1886.634) -- 0:02:54
224000 -- (-1886.063) (-1885.415) (-1888.539) [-1885.476] * (-1887.037) (-1889.633) (-1882.449) [-1887.962] -- 0:02:53
225000 -- (-1883.595) (-1885.288) [-1888.976] (-1888.442) * (-1887.017) (-1884.538) [-1886.202] (-1884.388) -- 0:02:52
Average standard deviation of split frequencies: 0.033374
226000 -- (-1882.598) (-1881.971) (-1884.743) [-1883.350] * (-1884.621) (-1886.589) [-1880.296] (-1885.959) -- 0:02:51
227000 -- (-1883.184) [-1880.714] (-1892.819) (-1885.086) * [-1884.126] (-1883.186) (-1883.112) (-1886.957) -- 0:02:53
228000 -- (-1883.564) (-1887.122) (-1892.718) [-1884.388] * (-1891.296) (-1886.621) [-1883.745] (-1884.658) -- 0:02:52
229000 -- (-1886.332) [-1883.212] (-1880.535) (-1892.585) * (-1893.975) [-1880.559] (-1884.202) (-1884.275) -- 0:02:51
230000 -- (-1888.123) [-1883.907] (-1889.877) (-1892.620) * [-1882.966] (-1892.819) (-1885.995) (-1891.780) -- 0:02:50
Average standard deviation of split frequencies: 0.034061
231000 -- (-1886.010) [-1884.650] (-1891.818) (-1885.456) * (-1883.882) (-1883.406) [-1883.026] (-1880.097) -- 0:02:49
232000 -- (-1885.553) [-1885.526] (-1890.143) (-1886.048) * (-1888.655) [-1880.987] (-1883.706) (-1885.291) -- 0:02:52
233000 -- [-1885.185] (-1897.916) (-1888.488) (-1892.449) * (-1885.340) (-1892.696) [-1885.936] (-1883.256) -- 0:02:51
234000 -- [-1885.006] (-1886.103) (-1882.720) (-1891.726) * (-1885.955) (-1883.236) [-1890.974] (-1881.788) -- 0:02:50
235000 -- (-1888.529) (-1885.193) [-1882.016] (-1887.407) * (-1886.523) (-1886.274) (-1884.090) [-1884.783] -- 0:02:49
Average standard deviation of split frequencies: 0.033291
236000 -- [-1882.810] (-1895.979) (-1887.216) (-1889.485) * [-1883.638] (-1889.134) (-1884.891) (-1888.458) -- 0:02:51
237000 -- [-1888.053] (-1881.383) (-1888.906) (-1881.380) * [-1893.660] (-1889.976) (-1890.204) (-1884.641) -- 0:02:50
238000 -- [-1885.344] (-1888.652) (-1883.792) (-1884.854) * (-1893.517) (-1902.111) [-1889.007] (-1883.116) -- 0:02:49
239000 -- [-1885.399] (-1888.439) (-1885.082) (-1888.439) * [-1886.424] (-1889.159) (-1885.782) (-1883.068) -- 0:02:48
240000 -- (-1889.457) (-1891.595) (-1886.262) [-1883.428] * (-1883.499) (-1888.961) (-1884.311) [-1885.317] -- 0:02:47
Average standard deviation of split frequencies: 0.031340
241000 -- (-1898.955) [-1887.102] (-1888.748) (-1885.504) * (-1885.199) (-1889.337) (-1891.013) [-1884.377] -- 0:02:50
242000 -- (-1886.150) [-1889.897] (-1889.711) (-1884.288) * (-1890.824) (-1883.775) [-1887.822] (-1890.389) -- 0:02:49
243000 -- (-1883.997) (-1891.743) [-1885.472] (-1886.951) * (-1892.328) (-1889.834) (-1882.320) [-1883.312] -- 0:02:48
244000 -- (-1888.256) (-1890.149) [-1885.281] (-1885.364) * [-1888.972] (-1888.262) (-1882.958) (-1883.077) -- 0:02:47
245000 -- [-1885.191] (-1886.938) (-1889.684) (-1883.335) * (-1890.435) (-1886.933) [-1884.295] (-1880.795) -- 0:02:49
Average standard deviation of split frequencies: 0.030660
246000 -- (-1886.469) [-1885.316] (-1890.246) (-1892.003) * (-1885.297) (-1889.598) (-1885.152) [-1882.350] -- 0:02:48
247000 -- [-1883.436] (-1886.742) (-1889.251) (-1887.281) * (-1886.699) (-1887.771) [-1885.043] (-1882.358) -- 0:02:47
248000 -- (-1886.470) [-1888.781] (-1884.410) (-1885.221) * (-1881.920) (-1886.120) [-1888.428] (-1887.805) -- 0:02:46
249000 -- (-1886.935) (-1887.484) (-1897.660) [-1884.226] * (-1888.373) (-1887.884) [-1886.848] (-1887.791) -- 0:02:45
250000 -- [-1888.993] (-1888.356) (-1884.452) (-1886.785) * (-1883.437) (-1891.931) [-1886.727] (-1887.297) -- 0:02:48
Average standard deviation of split frequencies: 0.033851
251000 -- (-1883.719) [-1882.238] (-1885.943) (-1886.017) * [-1886.758] (-1887.460) (-1895.213) (-1883.690) -- 0:02:47
252000 -- (-1886.594) (-1886.798) (-1888.475) [-1882.912] * (-1885.457) (-1891.168) (-1884.113) [-1885.932] -- 0:02:46
253000 -- [-1882.855] (-1885.333) (-1893.459) (-1885.282) * (-1886.108) (-1890.729) [-1882.118] (-1887.030) -- 0:02:45
254000 -- (-1886.732) (-1885.843) (-1891.383) [-1886.125] * [-1885.690] (-1885.457) (-1881.647) (-1886.039) -- 0:02:47
255000 -- (-1885.992) (-1884.577) (-1884.367) [-1891.361] * [-1887.297] (-1889.467) (-1887.832) (-1889.770) -- 0:02:46
Average standard deviation of split frequencies: 0.030690
256000 -- (-1887.909) [-1890.152] (-1883.636) (-1882.870) * (-1884.355) (-1886.504) (-1881.729) [-1884.394] -- 0:02:45
257000 -- (-1889.835) (-1888.414) (-1881.701) [-1885.596] * (-1889.776) [-1887.840] (-1882.896) (-1887.950) -- 0:02:44
258000 -- (-1889.664) [-1886.204] (-1884.449) (-1884.677) * (-1885.538) (-1884.840) (-1884.868) [-1883.752] -- 0:02:43
259000 -- (-1887.598) (-1884.051) [-1882.716] (-1887.731) * (-1889.703) [-1883.317] (-1882.318) (-1885.068) -- 0:02:45
260000 -- [-1886.180] (-1887.770) (-1886.041) (-1888.572) * [-1883.507] (-1889.652) (-1886.928) (-1889.155) -- 0:02:45
Average standard deviation of split frequencies: 0.030141
261000 -- (-1884.590) [-1884.473] (-1887.169) (-1886.053) * (-1890.392) (-1889.103) (-1887.457) [-1887.254] -- 0:02:44
262000 -- (-1885.669) (-1893.813) [-1891.891] (-1885.525) * [-1888.285] (-1884.458) (-1884.214) (-1894.398) -- 0:02:43
263000 -- [-1883.683] (-1892.266) (-1884.923) (-1895.146) * (-1887.292) (-1891.117) [-1885.264] (-1887.951) -- 0:02:45
264000 -- (-1882.676) (-1884.546) [-1882.405] (-1886.788) * (-1887.708) (-1892.231) (-1883.816) [-1886.494] -- 0:02:44
265000 -- (-1882.753) (-1886.461) [-1886.131] (-1885.818) * [-1884.074] (-1888.283) (-1886.834) (-1888.086) -- 0:02:43
Average standard deviation of split frequencies: 0.030718
266000 -- (-1885.018) (-1886.120) [-1881.707] (-1887.356) * (-1894.000) [-1884.489] (-1888.010) (-1885.720) -- 0:02:42
267000 -- [-1886.899] (-1894.217) (-1883.033) (-1886.832) * [-1884.763] (-1886.089) (-1889.113) (-1885.055) -- 0:02:44
268000 -- [-1883.816] (-1892.757) (-1885.531) (-1885.998) * [-1885.374] (-1886.031) (-1884.015) (-1885.930) -- 0:02:43
269000 -- (-1888.398) (-1890.709) (-1888.140) [-1886.227] * [-1890.243] (-1885.754) (-1889.816) (-1894.711) -- 0:02:43
270000 -- [-1884.392] (-1902.879) (-1882.965) (-1892.068) * [-1885.450] (-1887.170) (-1887.364) (-1897.999) -- 0:02:42
Average standard deviation of split frequencies: 0.031350
271000 -- (-1887.114) (-1892.945) (-1884.005) [-1886.033] * (-1886.093) (-1891.296) (-1887.642) [-1887.439] -- 0:02:41
272000 -- (-1882.623) (-1889.275) (-1883.935) [-1884.384] * [-1888.382] (-1889.201) (-1888.714) (-1892.162) -- 0:02:43
273000 -- [-1885.002] (-1894.083) (-1884.886) (-1886.461) * (-1882.096) (-1886.182) (-1886.269) [-1886.754] -- 0:02:42
274000 -- (-1885.068) (-1896.352) [-1884.769] (-1889.605) * (-1886.542) (-1888.872) [-1881.845] (-1882.139) -- 0:02:41
275000 -- (-1885.586) (-1896.644) (-1887.048) [-1886.844] * (-1883.429) (-1890.114) (-1894.112) [-1885.150] -- 0:02:40
Average standard deviation of split frequencies: 0.033021
276000 -- [-1881.979] (-1898.611) (-1882.277) (-1889.740) * (-1882.929) [-1890.080] (-1889.057) (-1883.468) -- 0:02:42
277000 -- (-1888.762) (-1899.603) [-1885.713] (-1899.233) * (-1891.637) (-1883.667) (-1901.518) [-1893.632] -- 0:02:41
278000 -- (-1892.762) (-1888.748) [-1886.055] (-1883.293) * (-1884.258) (-1885.529) (-1887.038) [-1888.475] -- 0:02:41
279000 -- (-1885.776) (-1890.966) [-1884.800] (-1887.790) * (-1888.777) (-1885.623) [-1886.380] (-1889.162) -- 0:02:40
280000 -- [-1884.369] (-1881.649) (-1893.633) (-1888.401) * (-1889.251) (-1882.249) [-1886.871] (-1897.257) -- 0:02:39
Average standard deviation of split frequencies: 0.033592
281000 -- (-1886.311) [-1888.969] (-1883.932) (-1884.217) * (-1880.922) [-1889.477] (-1883.401) (-1896.716) -- 0:02:41
282000 -- [-1882.437] (-1884.702) (-1886.533) (-1890.738) * (-1903.212) [-1888.914] (-1893.843) (-1889.834) -- 0:02:40
283000 -- (-1893.486) (-1886.838) (-1885.062) [-1884.946] * [-1881.352] (-1884.002) (-1892.378) (-1886.205) -- 0:02:39
284000 -- (-1891.239) (-1892.184) [-1885.316] (-1880.048) * (-1887.804) (-1885.109) [-1888.583] (-1883.047) -- 0:02:38
285000 -- (-1884.307) (-1887.121) (-1892.774) [-1889.147] * [-1885.312] (-1880.313) (-1889.348) (-1890.105) -- 0:02:40
Average standard deviation of split frequencies: 0.032965
286000 -- (-1886.921) (-1887.823) (-1884.832) [-1882.701] * (-1887.716) [-1883.405] (-1885.761) (-1893.503) -- 0:02:39
287000 -- (-1883.995) (-1887.392) (-1883.784) [-1881.962] * (-1886.766) [-1884.201] (-1888.696) (-1884.109) -- 0:02:38
288000 -- [-1885.655] (-1883.087) (-1885.464) (-1889.965) * [-1884.531] (-1883.397) (-1884.494) (-1885.896) -- 0:02:38
289000 -- (-1888.149) (-1883.409) [-1891.679] (-1882.821) * (-1886.700) [-1885.136] (-1886.793) (-1895.266) -- 0:02:37
290000 -- (-1884.465) (-1885.277) (-1885.409) [-1887.640] * (-1889.015) (-1885.250) (-1888.033) [-1892.786] -- 0:02:39
Average standard deviation of split frequencies: 0.031355
291000 -- [-1885.188] (-1894.602) (-1888.848) (-1886.240) * (-1893.760) (-1883.882) [-1884.506] (-1889.496) -- 0:02:38
292000 -- [-1886.184] (-1888.183) (-1885.590) (-1893.424) * (-1892.256) (-1881.644) (-1882.994) [-1882.484] -- 0:02:37
293000 -- (-1887.865) [-1882.564] (-1887.630) (-1882.830) * (-1893.566) (-1883.712) [-1889.183] (-1883.698) -- 0:02:36
294000 -- (-1882.850) (-1886.024) [-1890.087] (-1886.058) * (-1885.287) [-1886.387] (-1887.534) (-1882.925) -- 0:02:38
295000 -- (-1884.018) [-1882.752] (-1886.239) (-1888.213) * (-1887.858) (-1895.147) [-1883.992] (-1887.980) -- 0:02:37
Average standard deviation of split frequencies: 0.029728
296000 -- [-1885.375] (-1888.629) (-1883.702) (-1890.048) * (-1889.416) (-1887.625) [-1884.273] (-1887.520) -- 0:02:36
297000 -- [-1883.013] (-1883.427) (-1885.322) (-1887.441) * [-1883.220] (-1889.888) (-1889.113) (-1884.263) -- 0:02:36
298000 -- [-1882.670] (-1884.825) (-1888.068) (-1886.234) * [-1882.313] (-1889.031) (-1884.689) (-1888.506) -- 0:02:35
299000 -- (-1883.426) [-1889.068] (-1885.810) (-1883.782) * (-1885.090) (-1889.808) (-1893.027) [-1884.202] -- 0:02:37
300000 -- [-1889.332] (-1885.836) (-1886.144) (-1885.347) * (-1884.342) (-1890.196) (-1887.024) [-1883.301] -- 0:02:36
Average standard deviation of split frequencies: 0.028222
301000 -- (-1885.788) (-1883.820) [-1883.017] (-1884.844) * (-1882.441) (-1882.492) (-1890.199) [-1884.810] -- 0:02:35
302000 -- (-1888.272) [-1882.561] (-1884.767) (-1889.225) * [-1883.094] (-1885.301) (-1885.097) (-1894.151) -- 0:02:34
303000 -- [-1882.750] (-1887.067) (-1890.201) (-1889.150) * [-1881.083] (-1884.116) (-1889.170) (-1890.956) -- 0:02:36
304000 -- (-1882.192) (-1890.041) (-1889.745) [-1881.679] * (-1882.268) [-1887.051] (-1894.675) (-1887.965) -- 0:02:35
305000 -- (-1888.138) (-1885.217) [-1883.692] (-1882.755) * (-1887.159) [-1883.473] (-1893.220) (-1886.703) -- 0:02:34
Average standard deviation of split frequencies: 0.020027
306000 -- (-1884.488) (-1887.726) [-1884.366] (-1882.060) * [-1883.724] (-1886.489) (-1892.331) (-1887.380) -- 0:02:34
307000 -- [-1883.392] (-1891.035) (-1889.384) (-1885.679) * (-1884.519) (-1884.666) (-1891.949) [-1886.068] -- 0:02:33
308000 -- (-1888.965) (-1890.033) [-1883.196] (-1885.243) * [-1880.499] (-1885.054) (-1890.679) (-1887.713) -- 0:02:35
309000 -- [-1895.431] (-1885.781) (-1890.227) (-1881.483) * (-1881.312) (-1882.674) [-1883.807] (-1885.400) -- 0:02:34
310000 -- (-1884.533) (-1881.801) (-1888.071) [-1886.871] * [-1884.798] (-1892.187) (-1883.234) (-1882.770) -- 0:02:33
Average standard deviation of split frequencies: 0.018209
311000 -- (-1889.422) (-1881.603) [-1882.685] (-1896.400) * [-1892.687] (-1888.080) (-1883.592) (-1883.803) -- 0:02:32
312000 -- (-1888.657) [-1883.941] (-1887.801) (-1893.234) * (-1892.042) (-1883.867) [-1887.977] (-1882.851) -- 0:02:34
313000 -- (-1893.383) [-1884.796] (-1886.278) (-1891.488) * (-1886.844) [-1885.503] (-1890.565) (-1883.764) -- 0:02:33
314000 -- (-1887.001) (-1888.991) (-1890.868) [-1885.120] * [-1887.529] (-1891.698) (-1893.517) (-1885.527) -- 0:02:32
315000 -- [-1884.904] (-1885.118) (-1890.354) (-1882.781) * (-1890.400) [-1885.884] (-1887.536) (-1887.141) -- 0:02:32
Average standard deviation of split frequencies: 0.023869
316000 -- (-1884.453) (-1884.954) [-1886.257] (-1891.897) * (-1883.465) [-1888.152] (-1889.455) (-1887.784) -- 0:02:31
317000 -- [-1887.180] (-1887.064) (-1886.443) (-1882.186) * [-1885.804] (-1890.548) (-1886.843) (-1882.751) -- 0:02:32
318000 -- (-1881.939) (-1891.210) [-1889.003] (-1884.172) * (-1890.343) (-1892.188) [-1881.227] (-1883.101) -- 0:02:32
319000 -- (-1885.622) [-1886.499] (-1884.653) (-1881.549) * (-1896.584) (-1883.846) (-1889.138) [-1881.081] -- 0:02:31
320000 -- (-1886.259) (-1884.307) [-1889.331] (-1884.897) * (-1888.370) (-1888.640) (-1882.803) [-1886.860] -- 0:02:30
Average standard deviation of split frequencies: 0.024501
321000 -- (-1884.404) (-1888.544) [-1885.795] (-1883.038) * (-1889.181) (-1888.078) [-1882.320] (-1889.229) -- 0:02:32
322000 -- [-1884.502] (-1885.153) (-1887.783) (-1889.938) * (-1892.454) (-1887.300) (-1884.497) [-1885.105] -- 0:02:31
323000 -- (-1890.330) [-1885.771] (-1886.509) (-1883.484) * (-1885.887) [-1895.878] (-1884.169) (-1884.269) -- 0:02:30
324000 -- (-1886.202) (-1884.580) [-1888.134] (-1885.822) * (-1891.034) (-1888.965) [-1885.259] (-1884.902) -- 0:02:30
325000 -- (-1901.161) (-1887.214) (-1885.935) [-1890.755] * (-1881.197) (-1887.315) (-1887.693) [-1886.002] -- 0:02:29
Average standard deviation of split frequencies: 0.024100
326000 -- [-1890.611] (-1897.561) (-1885.480) (-1885.026) * [-1885.651] (-1885.077) (-1884.090) (-1891.104) -- 0:02:30
327000 -- [-1885.618] (-1885.945) (-1889.808) (-1882.033) * [-1882.456] (-1889.688) (-1886.352) (-1884.574) -- 0:02:30
328000 -- (-1882.301) (-1880.983) [-1881.851] (-1895.364) * [-1882.202] (-1888.984) (-1888.938) (-1886.298) -- 0:02:29
329000 -- (-1886.361) [-1887.753] (-1885.924) (-1884.938) * [-1881.831] (-1888.945) (-1888.198) (-1891.538) -- 0:02:28
330000 -- (-1885.695) (-1885.848) (-1894.088) [-1886.946] * (-1883.231) (-1883.447) [-1886.339] (-1888.873) -- 0:02:30
Average standard deviation of split frequencies: 0.022810
331000 -- (-1895.446) [-1887.812] (-1885.332) (-1893.170) * [-1881.789] (-1899.936) (-1884.205) (-1882.623) -- 0:02:29
332000 -- [-1886.276] (-1885.036) (-1884.820) (-1887.360) * (-1893.360) (-1890.647) [-1892.482] (-1889.698) -- 0:02:28
333000 -- [-1885.127] (-1883.149) (-1887.405) (-1883.073) * [-1886.240] (-1886.854) (-1885.245) (-1883.590) -- 0:02:28
334000 -- (-1887.471) (-1889.659) (-1883.724) [-1882.624] * (-1887.229) (-1884.483) (-1886.621) [-1889.995] -- 0:02:27
335000 -- (-1884.936) [-1888.031] (-1883.552) (-1888.179) * (-1889.185) [-1882.309] (-1888.339) (-1887.406) -- 0:02:28
Average standard deviation of split frequencies: 0.021513
336000 -- (-1887.002) [-1881.794] (-1884.828) (-1891.825) * (-1895.102) (-1883.106) [-1882.189] (-1887.188) -- 0:02:28
337000 -- (-1883.267) (-1885.655) (-1890.683) [-1882.750] * (-1900.091) [-1883.686] (-1886.185) (-1885.066) -- 0:02:27
338000 -- (-1890.501) [-1887.351] (-1883.304) (-1880.541) * (-1886.173) (-1888.804) [-1887.087] (-1883.473) -- 0:02:26
339000 -- (-1892.092) (-1890.306) [-1879.798] (-1886.360) * [-1884.353] (-1885.507) (-1889.368) (-1884.637) -- 0:02:28
340000 -- [-1882.988] (-1887.643) (-1884.579) (-1883.211) * (-1882.311) [-1881.229] (-1884.284) (-1895.751) -- 0:02:27
Average standard deviation of split frequencies: 0.022140
341000 -- (-1887.612) (-1890.666) (-1885.893) [-1886.666] * (-1887.073) (-1884.948) [-1883.542] (-1881.376) -- 0:02:26
342000 -- (-1886.650) (-1888.549) (-1883.695) [-1881.133] * (-1889.043) [-1882.502] (-1894.935) (-1882.172) -- 0:02:26
343000 -- [-1889.913] (-1887.613) (-1886.843) (-1889.289) * [-1886.722] (-1887.027) (-1888.242) (-1883.988) -- 0:02:27
344000 -- (-1884.307) (-1887.136) [-1882.780] (-1884.207) * (-1882.674) (-1886.270) (-1891.670) [-1888.002] -- 0:02:26
345000 -- [-1884.404] (-1891.662) (-1887.608) (-1884.538) * [-1884.074] (-1883.676) (-1884.333) (-1886.392) -- 0:02:26
Average standard deviation of split frequencies: 0.024524
346000 -- (-1884.266) (-1882.444) (-1887.231) [-1887.618] * (-1885.653) (-1883.137) [-1886.028] (-1886.554) -- 0:02:25
347000 -- (-1884.658) (-1883.979) [-1887.485] (-1884.501) * (-1892.285) (-1884.691) (-1882.444) [-1888.792] -- 0:02:24
348000 -- (-1890.022) (-1880.781) (-1884.346) [-1881.750] * (-1889.642) (-1887.124) (-1888.206) [-1886.582] -- 0:02:26
349000 -- (-1888.688) (-1885.476) [-1888.160] (-1883.414) * [-1887.575] (-1884.869) (-1882.571) (-1885.228) -- 0:02:25
350000 -- (-1886.245) [-1884.166] (-1889.149) (-1892.448) * (-1887.910) (-1892.905) [-1885.224] (-1888.692) -- 0:02:24
Average standard deviation of split frequencies: 0.023301
351000 -- (-1884.750) [-1886.408] (-1885.533) (-1884.227) * [-1883.187] (-1887.317) (-1886.265) (-1884.306) -- 0:02:24
352000 -- (-1883.481) (-1891.802) (-1890.709) [-1885.442] * [-1883.081] (-1891.417) (-1884.555) (-1890.049) -- 0:02:25
353000 -- [-1886.180] (-1894.421) (-1882.612) (-1886.183) * (-1891.917) [-1880.515] (-1885.831) (-1892.182) -- 0:02:24
354000 -- (-1884.529) [-1887.609] (-1885.185) (-1888.032) * (-1881.084) [-1883.640] (-1887.336) (-1884.659) -- 0:02:24
355000 -- (-1896.131) [-1882.979] (-1893.269) (-1880.260) * (-1893.237) [-1881.031] (-1887.549) (-1891.325) -- 0:02:23
Average standard deviation of split frequencies: 0.021187
356000 -- (-1893.082) (-1893.300) [-1880.339] (-1884.572) * (-1887.184) (-1889.337) (-1886.155) [-1882.363] -- 0:02:22
357000 -- (-1889.674) [-1893.666] (-1893.696) (-1882.184) * (-1883.823) (-1881.981) [-1886.986] (-1888.291) -- 0:02:24
358000 -- (-1885.434) (-1889.259) [-1886.904] (-1885.989) * (-1883.230) (-1886.091) [-1883.871] (-1885.991) -- 0:02:23
359000 -- (-1887.995) [-1885.641] (-1891.290) (-1881.679) * (-1886.663) (-1888.750) [-1886.387] (-1889.923) -- 0:02:22
360000 -- [-1890.420] (-1884.184) (-1889.745) (-1885.761) * (-1888.359) [-1884.826] (-1885.733) (-1889.809) -- 0:02:22
Average standard deviation of split frequencies: 0.021784
361000 -- [-1886.760] (-1883.653) (-1879.879) (-1887.602) * (-1890.563) [-1884.935] (-1889.422) (-1891.678) -- 0:02:23
362000 -- [-1892.511] (-1880.642) (-1882.825) (-1894.153) * (-1889.047) [-1883.048] (-1892.250) (-1884.460) -- 0:02:22
363000 -- (-1888.383) (-1885.291) (-1894.359) [-1887.591] * (-1883.375) (-1883.455) [-1883.926] (-1886.420) -- 0:02:22
364000 -- (-1888.084) (-1890.921) (-1881.026) [-1884.247] * (-1888.318) (-1885.732) (-1888.411) [-1889.061] -- 0:02:21
365000 -- (-1882.353) (-1883.423) [-1884.471] (-1887.834) * (-1884.989) (-1890.080) (-1887.481) [-1893.303] -- 0:02:20
Average standard deviation of split frequencies: 0.019749
366000 -- (-1888.443) (-1896.138) (-1887.645) [-1886.008] * (-1889.834) (-1888.416) [-1894.836] (-1884.145) -- 0:02:22
367000 -- [-1883.239] (-1888.011) (-1890.843) (-1887.049) * (-1882.816) (-1888.794) (-1890.609) [-1883.737] -- 0:02:21
368000 -- (-1886.296) (-1884.141) (-1887.030) [-1885.597] * (-1886.467) (-1885.273) (-1884.415) [-1889.189] -- 0:02:20
369000 -- (-1881.040) (-1893.198) (-1884.760) [-1888.035] * [-1886.385] (-1884.320) (-1889.843) (-1888.608) -- 0:02:20
370000 -- (-1887.476) [-1894.058] (-1887.910) (-1884.832) * (-1884.984) (-1890.310) (-1888.450) [-1882.830] -- 0:02:21
Average standard deviation of split frequencies: 0.020984
371000 -- [-1883.935] (-1883.560) (-1892.606) (-1888.726) * (-1887.167) (-1888.815) (-1885.236) [-1886.117] -- 0:02:20
372000 -- (-1885.625) (-1886.021) (-1888.197) [-1885.983] * (-1881.858) (-1885.638) (-1884.690) [-1888.693] -- 0:02:20
373000 -- [-1892.726] (-1889.025) (-1890.636) (-1889.335) * (-1885.864) (-1883.667) (-1884.500) [-1889.761] -- 0:02:19
374000 -- (-1889.054) (-1887.964) [-1883.816] (-1887.304) * (-1892.415) (-1890.017) (-1886.049) [-1884.308] -- 0:02:18
375000 -- (-1886.178) (-1881.472) (-1893.260) [-1889.755] * (-1891.602) (-1883.326) [-1885.818] (-1882.614) -- 0:02:20
Average standard deviation of split frequencies: 0.018806
376000 -- [-1885.385] (-1884.938) (-1886.189) (-1889.312) * (-1891.312) (-1884.995) (-1885.884) [-1884.258] -- 0:02:19
377000 -- (-1886.331) (-1885.716) [-1886.378] (-1896.287) * (-1889.365) (-1882.929) (-1884.177) [-1880.766] -- 0:02:18
378000 -- (-1888.588) (-1887.287) [-1889.695] (-1885.976) * (-1883.710) [-1886.520] (-1887.047) (-1886.076) -- 0:02:18
379000 -- (-1887.888) [-1887.139] (-1882.092) (-1886.471) * (-1888.386) (-1880.752) [-1886.108] (-1882.418) -- 0:02:19
380000 -- (-1882.454) [-1881.323] (-1892.068) (-1885.247) * (-1887.452) [-1885.472] (-1882.811) (-1885.766) -- 0:02:18
Average standard deviation of split frequencies: 0.022291
381000 -- (-1881.585) [-1880.731] (-1889.225) (-1883.770) * (-1882.631) (-1885.224) (-1889.181) [-1884.378] -- 0:02:18
382000 -- [-1882.040] (-1887.005) (-1886.948) (-1893.487) * (-1885.155) (-1886.142) [-1888.243] (-1884.703) -- 0:02:17
383000 -- (-1885.483) [-1892.564] (-1887.632) (-1893.237) * (-1883.642) (-1890.281) [-1884.169] (-1894.551) -- 0:02:16
384000 -- [-1884.628] (-1890.309) (-1893.918) (-1883.185) * [-1885.801] (-1885.818) (-1883.820) (-1883.991) -- 0:02:17
385000 -- (-1884.952) (-1889.996) (-1887.009) [-1885.510] * (-1883.643) [-1883.698] (-1884.759) (-1882.184) -- 0:02:17
Average standard deviation of split frequencies: 0.023814
386000 -- (-1888.193) (-1890.933) (-1881.909) [-1888.651] * [-1884.417] (-1880.344) (-1888.823) (-1887.297) -- 0:02:16
387000 -- (-1882.561) (-1887.799) [-1882.455] (-1882.376) * (-1883.079) [-1886.480] (-1888.105) (-1885.829) -- 0:02:16
388000 -- (-1893.206) (-1892.188) [-1887.321] (-1886.131) * [-1880.520] (-1888.254) (-1890.179) (-1888.869) -- 0:02:17
389000 -- (-1889.311) (-1884.931) (-1890.251) [-1887.466] * (-1886.994) [-1881.867] (-1889.845) (-1887.993) -- 0:02:16
390000 -- (-1884.451) [-1887.142] (-1892.828) (-1886.662) * (-1881.962) [-1886.549] (-1885.218) (-1885.781) -- 0:02:16
Average standard deviation of split frequencies: 0.027150
391000 -- (-1887.757) [-1884.787] (-1892.027) (-1879.922) * (-1894.347) (-1883.103) [-1883.257] (-1886.476) -- 0:02:15
392000 -- (-1889.412) [-1887.281] (-1888.769) (-1882.565) * (-1892.117) [-1885.711] (-1889.366) (-1881.799) -- 0:02:14
393000 -- (-1890.503) (-1884.810) (-1886.387) [-1885.122] * (-1887.666) (-1883.396) (-1887.707) [-1882.606] -- 0:02:15
394000 -- (-1884.468) [-1886.587] (-1889.745) (-1881.590) * (-1892.844) (-1886.319) (-1893.485) [-1882.390] -- 0:02:15
395000 -- (-1881.779) (-1890.974) [-1887.964] (-1885.775) * (-1889.129) (-1890.353) [-1885.462] (-1888.331) -- 0:02:14
Average standard deviation of split frequencies: 0.029760
396000 -- (-1881.176) [-1887.239] (-1886.450) (-1883.261) * (-1884.067) (-1898.365) (-1883.101) [-1883.993] -- 0:02:14
397000 -- [-1883.167] (-1884.486) (-1883.397) (-1883.785) * (-1882.813) (-1887.808) [-1885.484] (-1883.312) -- 0:02:15
398000 -- (-1885.815) (-1888.499) (-1885.719) [-1885.708] * (-1886.402) (-1888.475) [-1884.154] (-1885.363) -- 0:02:14
399000 -- (-1883.012) (-1892.172) [-1884.618] (-1888.792) * (-1886.695) (-1881.640) [-1891.592] (-1886.099) -- 0:02:14
400000 -- (-1891.903) (-1888.080) (-1882.535) [-1884.534] * (-1887.602) (-1887.182) (-1883.404) [-1888.357] -- 0:02:13
Average standard deviation of split frequencies: 0.025884
401000 -- (-1886.444) [-1883.376] (-1885.332) (-1890.163) * (-1884.238) (-1889.343) [-1888.052] (-1886.453) -- 0:02:12
402000 -- (-1885.735) (-1891.260) [-1884.106] (-1888.564) * (-1880.984) [-1882.475] (-1884.681) (-1885.796) -- 0:02:13
403000 -- [-1883.168] (-1884.636) (-1883.115) (-1884.708) * [-1887.319] (-1882.649) (-1891.354) (-1882.691) -- 0:02:13
404000 -- [-1884.872] (-1883.422) (-1888.824) (-1887.994) * (-1885.868) [-1882.897] (-1886.790) (-1883.260) -- 0:02:12
405000 -- [-1884.149] (-1887.764) (-1885.000) (-1883.195) * (-1890.964) (-1889.396) [-1881.360] (-1888.728) -- 0:02:12
Average standard deviation of split frequencies: 0.026705
406000 -- [-1880.780] (-1882.362) (-1880.363) (-1887.345) * (-1889.294) [-1888.840] (-1886.201) (-1891.654) -- 0:02:13
407000 -- (-1891.470) [-1885.101] (-1886.782) (-1890.897) * [-1884.135] (-1887.967) (-1887.259) (-1888.426) -- 0:02:12
408000 -- (-1883.478) (-1882.021) [-1881.471] (-1883.999) * (-1887.235) (-1886.841) (-1884.196) [-1883.201] -- 0:02:12
409000 -- (-1892.370) (-1888.149) (-1882.852) [-1893.161] * (-1881.606) (-1884.218) (-1885.399) [-1891.709] -- 0:02:11
410000 -- (-1895.478) [-1886.096] (-1885.100) (-1883.867) * (-1885.399) (-1883.956) [-1884.387] (-1886.908) -- 0:02:10
Average standard deviation of split frequencies: 0.024680
411000 -- [-1889.751] (-1885.864) (-1892.225) (-1889.407) * (-1886.153) [-1886.830] (-1881.761) (-1883.720) -- 0:02:11
412000 -- (-1885.131) [-1883.552] (-1894.395) (-1883.260) * (-1883.592) (-1887.897) (-1887.521) [-1888.144] -- 0:02:11
413000 -- (-1887.849) [-1889.022] (-1886.635) (-1887.921) * (-1883.292) [-1890.662] (-1885.877) (-1890.003) -- 0:02:10
414000 -- (-1890.494) (-1887.343) [-1885.822] (-1888.313) * (-1884.311) (-1886.832) (-1883.706) [-1888.174] -- 0:02:10
415000 -- [-1888.163] (-1891.727) (-1890.336) (-1887.217) * (-1882.393) (-1894.532) (-1891.098) [-1882.264] -- 0:02:11
Average standard deviation of split frequencies: 0.022097
416000 -- (-1888.399) (-1888.479) (-1884.909) [-1884.897] * (-1883.038) [-1885.078] (-1890.304) (-1884.262) -- 0:02:10
417000 -- [-1884.969] (-1883.747) (-1887.937) (-1889.385) * (-1890.523) (-1884.903) (-1885.616) [-1882.159] -- 0:02:10
418000 -- (-1893.196) (-1887.178) [-1885.141] (-1884.128) * (-1892.066) [-1883.604] (-1886.908) (-1887.794) -- 0:02:09
419000 -- (-1888.220) (-1883.020) (-1892.943) [-1880.253] * (-1887.578) (-1884.430) (-1885.577) [-1885.045] -- 0:02:08
420000 -- [-1886.886] (-1885.943) (-1888.315) (-1887.819) * (-1886.671) (-1888.622) (-1887.272) [-1886.881] -- 0:02:09
Average standard deviation of split frequencies: 0.022973
421000 -- (-1887.058) [-1884.445] (-1885.229) (-1886.131) * (-1887.754) (-1883.847) (-1882.301) [-1883.874] -- 0:02:09
422000 -- (-1885.821) [-1886.798] (-1886.051) (-1886.370) * (-1890.154) (-1888.290) [-1886.623] (-1885.417) -- 0:02:08
423000 -- [-1883.574] (-1892.198) (-1887.845) (-1887.384) * (-1888.081) [-1884.119] (-1887.590) (-1884.548) -- 0:02:08
424000 -- [-1885.823] (-1886.945) (-1883.657) (-1891.834) * (-1885.399) (-1888.328) [-1881.905] (-1884.840) -- 0:02:09
425000 -- [-1886.601] (-1883.991) (-1886.796) (-1882.391) * (-1883.054) (-1889.919) [-1883.882] (-1880.199) -- 0:02:08
Average standard deviation of split frequencies: 0.026558
426000 -- (-1888.689) [-1882.779] (-1889.097) (-1890.022) * (-1889.801) [-1888.895] (-1886.376) (-1888.546) -- 0:02:08
427000 -- [-1887.535] (-1886.284) (-1882.821) (-1889.716) * (-1886.845) (-1885.228) [-1885.606] (-1884.979) -- 0:02:07
428000 -- (-1884.806) (-1884.845) (-1889.583) [-1881.987] * [-1888.270] (-1888.896) (-1884.900) (-1892.297) -- 0:02:08
429000 -- (-1884.461) (-1883.955) (-1883.541) [-1884.563] * (-1886.553) (-1884.929) (-1884.038) [-1882.844] -- 0:02:07
430000 -- (-1883.534) (-1884.973) [-1882.957] (-1884.057) * (-1884.476) (-1880.984) (-1888.140) [-1884.770] -- 0:02:07
Average standard deviation of split frequencies: 0.030101
431000 -- (-1884.018) (-1885.901) [-1880.463] (-1882.298) * (-1891.617) (-1889.280) [-1889.685] (-1889.860) -- 0:02:06
432000 -- (-1885.820) [-1886.363] (-1882.051) (-1886.628) * (-1888.623) (-1885.012) (-1887.591) [-1884.538] -- 0:02:06
433000 -- (-1887.738) [-1886.065] (-1884.358) (-1890.159) * (-1883.599) (-1892.754) [-1884.105] (-1884.022) -- 0:02:07
434000 -- (-1887.340) [-1891.040] (-1892.074) (-1884.088) * (-1881.548) (-1887.244) [-1890.500] (-1885.237) -- 0:02:06
435000 -- [-1882.775] (-1885.616) (-1885.769) (-1888.455) * [-1885.393] (-1883.222) (-1886.908) (-1882.920) -- 0:02:05
Average standard deviation of split frequencies: 0.033157
436000 -- [-1882.347] (-1888.991) (-1886.311) (-1882.123) * (-1887.237) (-1883.440) (-1888.722) [-1886.327] -- 0:02:05
437000 -- (-1886.927) (-1890.586) [-1889.255] (-1882.731) * (-1882.379) [-1887.602] (-1884.502) (-1888.577) -- 0:02:06
438000 -- [-1885.544] (-1885.224) (-1884.806) (-1886.128) * (-1883.208) (-1889.611) [-1882.264] (-1884.488) -- 0:02:05
439000 -- (-1883.075) (-1888.097) [-1883.044] (-1893.492) * (-1893.222) (-1884.277) (-1888.550) [-1881.922] -- 0:02:05
440000 -- (-1884.368) (-1889.777) [-1885.434] (-1887.898) * (-1881.043) [-1883.994] (-1893.055) (-1890.175) -- 0:02:04
Average standard deviation of split frequencies: 0.030666
441000 -- [-1885.128] (-1889.440) (-1886.783) (-1881.838) * [-1883.376] (-1886.017) (-1889.081) (-1888.468) -- 0:02:04
442000 -- (-1885.223) (-1882.397) [-1884.252] (-1887.625) * (-1884.987) [-1885.382] (-1887.056) (-1888.257) -- 0:02:04
443000 -- [-1882.211] (-1883.817) (-1886.674) (-1888.498) * [-1884.853] (-1883.586) (-1884.547) (-1884.235) -- 0:02:04
444000 -- (-1892.402) (-1894.996) [-1885.362] (-1888.733) * (-1883.507) [-1887.793] (-1891.159) (-1885.816) -- 0:02:03
445000 -- (-1897.311) (-1891.609) [-1886.308] (-1887.045) * [-1890.736] (-1889.204) (-1891.460) (-1885.197) -- 0:02:03
Average standard deviation of split frequencies: 0.026776
446000 -- (-1888.250) (-1893.349) [-1887.980] (-1892.147) * (-1883.313) [-1882.664] (-1882.473) (-1883.567) -- 0:02:04
447000 -- (-1887.540) (-1891.749) [-1884.932] (-1884.830) * (-1890.973) (-1884.325) [-1892.206] (-1888.339) -- 0:02:03
448000 -- (-1888.479) (-1888.298) (-1882.813) [-1883.917] * (-1892.716) [-1887.082] (-1884.689) (-1889.427) -- 0:02:03
449000 -- (-1885.776) [-1886.896] (-1885.789) (-1886.777) * (-1887.749) [-1885.687] (-1882.837) (-1885.442) -- 0:02:02
450000 -- [-1882.189] (-1885.993) (-1884.788) (-1884.941) * (-1888.686) (-1889.956) (-1887.309) [-1889.492] -- 0:02:02
Average standard deviation of split frequencies: 0.027196
451000 -- (-1889.578) [-1881.892] (-1886.347) (-1883.915) * [-1886.624] (-1887.283) (-1881.838) (-1887.531) -- 0:02:02
452000 -- (-1887.837) (-1886.846) [-1884.658] (-1887.748) * (-1880.746) (-1887.381) [-1882.542] (-1888.236) -- 0:02:02
453000 -- (-1885.246) [-1889.996] (-1887.956) (-1890.197) * (-1884.910) [-1883.545] (-1880.919) (-1890.975) -- 0:02:01
454000 -- (-1896.139) (-1884.564) [-1884.714] (-1888.223) * (-1882.743) (-1885.171) [-1883.646] (-1885.327) -- 0:02:01
455000 -- (-1890.770) (-1884.203) [-1886.209] (-1883.648) * (-1897.488) (-1883.374) (-1885.686) [-1884.427] -- 0:02:02
Average standard deviation of split frequencies: 0.023432
456000 -- (-1890.177) (-1885.733) [-1882.821] (-1890.774) * (-1887.467) (-1889.041) (-1889.686) [-1882.128] -- 0:02:01
457000 -- (-1885.754) (-1882.032) (-1886.092) [-1887.570] * (-1891.952) (-1885.414) (-1888.013) [-1883.558] -- 0:02:01
458000 -- (-1888.576) [-1884.986] (-1886.518) (-1888.327) * (-1885.811) [-1890.056] (-1889.842) (-1886.753) -- 0:02:00
459000 -- (-1886.416) (-1887.062) (-1889.768) [-1883.095] * (-1894.313) [-1887.523] (-1887.035) (-1885.112) -- 0:02:00
460000 -- [-1882.743] (-1882.129) (-1884.310) (-1880.853) * (-1888.324) [-1885.454] (-1891.595) (-1882.504) -- 0:02:00
Average standard deviation of split frequencies: 0.025242
461000 -- (-1893.889) (-1885.841) (-1886.332) [-1885.820] * (-1881.783) (-1887.310) (-1885.301) [-1888.480] -- 0:02:00
462000 -- (-1883.405) [-1886.733] (-1887.621) (-1899.199) * (-1881.458) (-1891.220) (-1886.123) [-1886.391] -- 0:01:59
463000 -- (-1884.065) (-1889.830) (-1893.075) [-1885.361] * (-1885.489) (-1881.655) (-1881.705) [-1885.140] -- 0:01:59
464000 -- (-1886.484) [-1884.769] (-1884.733) (-1887.428) * (-1889.406) [-1884.708] (-1888.539) (-1889.903) -- 0:02:00
465000 -- [-1882.165] (-1891.068) (-1882.351) (-1893.137) * (-1881.210) (-1881.310) (-1895.849) [-1882.489] -- 0:01:59
Average standard deviation of split frequencies: 0.025627
466000 -- (-1884.820) [-1894.573] (-1883.405) (-1890.852) * (-1889.469) [-1882.569] (-1891.550) (-1887.090) -- 0:01:59
467000 -- (-1886.053) (-1884.033) (-1884.288) [-1885.079] * [-1885.126] (-1891.416) (-1886.121) (-1886.610) -- 0:01:58
468000 -- [-1884.137] (-1884.411) (-1883.517) (-1886.789) * (-1889.995) (-1881.142) (-1894.304) [-1887.295] -- 0:01:58
469000 -- (-1886.926) (-1880.858) [-1883.720] (-1888.390) * (-1889.192) (-1885.781) [-1891.911] (-1891.563) -- 0:01:58
470000 -- [-1888.981] (-1882.823) (-1888.122) (-1883.056) * (-1887.112) [-1884.525] (-1886.178) (-1892.067) -- 0:01:58
Average standard deviation of split frequencies: 0.021367
471000 -- [-1888.175] (-1894.240) (-1882.497) (-1882.280) * (-1889.933) (-1886.810) [-1885.960] (-1885.578) -- 0:01:57
472000 -- (-1888.268) (-1888.574) (-1889.151) [-1884.600] * [-1886.925] (-1883.215) (-1886.084) (-1884.060) -- 0:01:57
473000 -- (-1886.726) (-1883.925) [-1883.909] (-1883.838) * (-1886.294) [-1883.155] (-1889.982) (-1887.284) -- 0:01:58
474000 -- [-1885.350] (-1884.525) (-1881.799) (-1887.433) * (-1884.892) [-1889.435] (-1887.560) (-1892.403) -- 0:01:57
475000 -- (-1885.948) (-1894.275) [-1884.500] (-1886.284) * (-1887.011) (-1886.756) [-1887.802] (-1887.595) -- 0:01:57
Average standard deviation of split frequencies: 0.022448
476000 -- (-1890.579) (-1893.795) [-1884.763] (-1884.632) * (-1883.272) (-1889.228) (-1884.491) [-1882.255] -- 0:01:56
477000 -- (-1889.255) (-1895.273) (-1884.472) [-1884.806] * (-1887.799) (-1890.437) (-1884.171) [-1886.619] -- 0:01:57
478000 -- [-1886.477] (-1893.266) (-1884.841) (-1881.723) * [-1886.046] (-1885.035) (-1888.055) (-1882.319) -- 0:01:56
479000 -- (-1884.117) (-1892.085) [-1882.738] (-1889.253) * (-1894.360) [-1883.450] (-1895.949) (-1883.336) -- 0:01:56
480000 -- [-1883.708] (-1883.564) (-1884.671) (-1883.512) * (-1892.932) (-1882.789) (-1891.755) [-1882.119] -- 0:01:55
Average standard deviation of split frequencies: 0.021576
481000 -- (-1887.469) (-1888.467) (-1889.404) [-1889.998] * (-1887.747) [-1883.548] (-1890.744) (-1886.216) -- 0:01:55
482000 -- [-1883.478] (-1882.521) (-1892.659) (-1886.387) * (-1885.811) (-1886.832) [-1886.526] (-1894.741) -- 0:01:56
483000 -- (-1886.032) (-1886.562) (-1881.017) [-1883.110] * [-1885.279] (-1882.087) (-1883.368) (-1889.163) -- 0:01:55
484000 -- [-1887.381] (-1887.839) (-1886.731) (-1886.709) * (-1894.148) (-1889.821) [-1885.669] (-1886.334) -- 0:01:55
485000 -- [-1886.788] (-1888.959) (-1881.751) (-1880.238) * (-1893.759) [-1887.491] (-1887.800) (-1884.721) -- 0:01:54
Average standard deviation of split frequencies: 0.021986
486000 -- (-1883.502) (-1886.168) (-1887.149) [-1882.829] * (-1882.526) [-1885.662] (-1885.656) (-1895.602) -- 0:01:55
487000 -- (-1881.608) (-1888.861) (-1884.897) [-1886.850] * [-1886.790] (-1887.150) (-1892.780) (-1882.229) -- 0:01:54
488000 -- (-1892.207) (-1885.522) [-1881.037] (-1895.415) * (-1885.195) [-1882.850] (-1886.639) (-1880.765) -- 0:01:54
489000 -- (-1883.667) [-1884.364] (-1888.616) (-1884.298) * [-1884.609] (-1887.673) (-1888.892) (-1891.517) -- 0:01:53
490000 -- (-1885.397) [-1885.542] (-1883.119) (-1885.552) * [-1883.133] (-1890.072) (-1887.842) (-1890.123) -- 0:01:53
Average standard deviation of split frequencies: 0.022417
491000 -- (-1884.543) (-1883.838) (-1884.021) [-1885.047] * (-1889.946) (-1883.897) [-1885.191] (-1909.488) -- 0:01:54
492000 -- (-1888.486) (-1888.864) [-1885.721] (-1884.799) * (-1887.890) (-1884.208) [-1884.766] (-1889.128) -- 0:01:53
493000 -- (-1884.190) (-1884.287) [-1886.968] (-1884.471) * (-1886.686) [-1882.093] (-1881.406) (-1886.773) -- 0:01:53
494000 -- (-1889.178) (-1888.826) [-1884.541] (-1883.686) * [-1883.992] (-1885.158) (-1890.540) (-1883.014) -- 0:01:52
495000 -- (-1884.749) (-1887.363) (-1892.959) [-1885.264] * (-1887.842) (-1885.078) (-1884.008) [-1885.908] -- 0:01:53
Average standard deviation of split frequencies: 0.022176
496000 -- (-1890.347) (-1890.416) [-1890.393] (-1884.093) * (-1887.626) [-1885.670] (-1882.512) (-1890.979) -- 0:01:52
497000 -- (-1885.167) [-1881.916] (-1886.519) (-1887.923) * (-1886.277) (-1881.483) [-1885.709] (-1882.461) -- 0:01:52
498000 -- [-1883.420] (-1882.114) (-1896.332) (-1882.453) * (-1883.899) [-1883.077] (-1887.467) (-1884.374) -- 0:01:51
499000 -- [-1884.754] (-1890.296) (-1892.227) (-1890.387) * (-1885.813) [-1885.392] (-1887.022) (-1880.544) -- 0:01:51
500000 -- (-1885.878) [-1884.909] (-1882.496) (-1884.773) * [-1886.073] (-1884.892) (-1887.448) (-1887.619) -- 0:01:52
Average standard deviation of split frequencies: 0.015065
501000 -- (-1884.355) [-1886.718] (-1880.949) (-1884.008) * (-1887.718) (-1885.220) [-1887.577] (-1887.194) -- 0:01:51
502000 -- [-1883.203] (-1886.471) (-1885.622) (-1886.877) * (-1887.379) (-1888.459) (-1884.623) [-1892.103] -- 0:01:51
503000 -- (-1883.096) (-1887.652) (-1886.311) [-1882.808] * (-1885.809) (-1885.892) [-1886.256] (-1884.929) -- 0:01:50
504000 -- [-1883.779] (-1886.841) (-1885.296) (-1890.164) * (-1880.584) (-1884.029) (-1886.952) [-1885.841] -- 0:01:51
505000 -- (-1882.526) (-1887.772) (-1894.268) [-1888.008] * [-1886.227] (-1885.030) (-1886.636) (-1883.643) -- 0:01:50
Average standard deviation of split frequencies: 0.013974
506000 -- [-1887.992] (-1884.982) (-1887.759) (-1889.600) * (-1887.560) [-1885.037] (-1887.689) (-1890.688) -- 0:01:50
507000 -- (-1885.294) [-1889.661] (-1896.256) (-1891.453) * (-1883.071) [-1883.993] (-1888.313) (-1885.534) -- 0:01:49
508000 -- (-1886.690) (-1885.415) [-1885.241] (-1889.054) * (-1885.275) (-1895.192) (-1892.400) [-1884.701] -- 0:01:49
509000 -- (-1895.267) [-1883.205] (-1896.242) (-1890.886) * (-1886.308) (-1890.031) [-1885.796] (-1884.118) -- 0:01:49
510000 -- [-1886.962] (-1888.101) (-1887.475) (-1887.685) * (-1887.343) (-1886.007) (-1892.329) [-1887.172] -- 0:01:49
Average standard deviation of split frequencies: 0.013385
511000 -- [-1887.683] (-1889.073) (-1893.570) (-1882.234) * (-1885.081) [-1893.048] (-1889.407) (-1885.930) -- 0:01:49
512000 -- (-1889.634) [-1883.921] (-1886.100) (-1884.580) * (-1892.013) (-1886.868) (-1896.290) [-1884.867] -- 0:01:48
513000 -- [-1890.696] (-1886.327) (-1886.323) (-1891.447) * (-1883.398) (-1891.188) (-1889.244) [-1892.419] -- 0:01:49
514000 -- (-1881.290) (-1891.868) (-1883.183) [-1885.028] * (-1889.981) [-1884.700] (-1889.315) (-1886.584) -- 0:01:48
515000 -- (-1894.933) (-1885.603) [-1883.054] (-1883.652) * (-1892.728) (-1885.140) [-1883.527] (-1884.789) -- 0:01:48
Average standard deviation of split frequencies: 0.012790
516000 -- (-1887.226) [-1885.381] (-1886.389) (-1888.965) * (-1889.453) (-1883.237) (-1887.113) [-1884.044] -- 0:01:47
517000 -- [-1893.768] (-1886.740) (-1882.245) (-1892.855) * (-1882.666) [-1886.789] (-1893.724) (-1888.698) -- 0:01:47
518000 -- (-1889.417) (-1886.213) (-1888.371) [-1886.625] * [-1885.324] (-1881.334) (-1884.288) (-1883.447) -- 0:01:47
519000 -- (-1883.463) (-1887.975) (-1893.220) [-1886.096] * (-1888.850) (-1885.807) (-1886.937) [-1885.627] -- 0:01:47
520000 -- [-1890.934] (-1886.680) (-1895.380) (-1886.113) * (-1887.192) (-1892.514) (-1891.431) [-1885.167] -- 0:01:47
Average standard deviation of split frequencies: 0.013128
521000 -- (-1890.225) (-1889.127) [-1883.256] (-1891.879) * (-1887.943) (-1887.438) [-1888.858] (-1885.613) -- 0:01:46
522000 -- (-1886.002) [-1889.328] (-1893.213) (-1899.278) * (-1887.325) (-1886.361) [-1887.205] (-1885.375) -- 0:01:47
523000 -- (-1883.788) (-1888.672) (-1891.659) [-1881.867] * (-1888.405) (-1885.568) [-1881.939] (-1887.855) -- 0:01:46
524000 -- (-1884.553) (-1884.676) (-1882.707) [-1884.569] * (-1889.651) [-1883.918] (-1887.722) (-1886.914) -- 0:01:46
525000 -- (-1886.837) [-1881.208] (-1889.661) (-1885.129) * (-1892.067) [-1886.005] (-1883.659) (-1887.953) -- 0:01:45
Average standard deviation of split frequencies: 0.011651
526000 -- (-1884.024) [-1886.520] (-1888.473) (-1881.965) * (-1886.193) [-1881.882] (-1887.911) (-1884.462) -- 0:01:45
527000 -- [-1881.537] (-1883.984) (-1885.853) (-1892.236) * (-1885.097) (-1884.020) (-1887.394) [-1882.887] -- 0:01:45
528000 -- (-1884.247) (-1894.200) [-1896.699] (-1890.001) * [-1884.749] (-1882.686) (-1883.874) (-1886.317) -- 0:01:45
529000 -- [-1885.976] (-1885.845) (-1890.366) (-1883.778) * (-1883.983) (-1887.130) (-1888.493) [-1885.059] -- 0:01:45
530000 -- (-1887.174) (-1885.550) (-1883.987) [-1885.713] * (-1889.702) [-1884.078] (-1887.531) (-1889.356) -- 0:01:44
Average standard deviation of split frequencies: 0.011104
531000 -- (-1889.670) (-1888.347) [-1885.071] (-1889.296) * (-1890.974) (-1888.545) [-1882.380] (-1884.380) -- 0:01:45
532000 -- (-1884.107) [-1885.810] (-1886.175) (-1884.266) * (-1894.784) (-1886.345) (-1883.029) [-1887.115] -- 0:01:44
533000 -- (-1891.496) [-1889.845] (-1900.330) (-1891.537) * (-1893.931) [-1887.797] (-1883.795) (-1885.707) -- 0:01:44
534000 -- (-1896.298) (-1892.296) (-1885.367) [-1883.852] * [-1886.239] (-1889.694) (-1894.857) (-1883.335) -- 0:01:43
535000 -- (-1890.126) [-1889.152] (-1886.008) (-1888.870) * (-1886.587) (-1885.829) [-1890.345] (-1889.085) -- 0:01:43
Average standard deviation of split frequencies: 0.011433
536000 -- (-1880.742) [-1890.788] (-1887.271) (-1889.362) * (-1885.442) (-1888.737) [-1884.254] (-1888.374) -- 0:01:43
537000 -- (-1888.078) [-1890.949] (-1887.232) (-1887.427) * (-1885.914) (-1885.364) [-1881.386] (-1883.890) -- 0:01:43
538000 -- (-1888.836) [-1893.035] (-1891.525) (-1884.733) * [-1891.138] (-1896.263) (-1885.490) (-1885.556) -- 0:01:43
539000 -- (-1888.605) [-1886.249] (-1885.090) (-1883.557) * [-1887.322] (-1885.138) (-1887.025) (-1884.265) -- 0:01:42
540000 -- (-1885.551) (-1891.634) [-1880.976] (-1882.537) * (-1894.334) [-1885.787] (-1887.312) (-1889.297) -- 0:01:43
Average standard deviation of split frequencies: 0.011335
541000 -- (-1891.205) (-1887.453) (-1883.428) [-1885.067] * (-1887.943) [-1885.820] (-1881.905) (-1893.070) -- 0:01:42
542000 -- (-1889.012) (-1882.856) (-1886.111) [-1885.733] * (-1887.924) [-1883.478] (-1882.764) (-1886.510) -- 0:01:42
543000 -- (-1887.875) [-1890.612] (-1886.844) (-1883.900) * (-1883.534) [-1886.527] (-1892.232) (-1890.501) -- 0:01:41
544000 -- (-1891.941) (-1884.394) (-1887.679) [-1885.797] * (-1885.614) [-1890.803] (-1884.439) (-1888.012) -- 0:01:42
545000 -- (-1891.147) [-1883.766] (-1889.417) (-1886.152) * (-1887.144) (-1890.182) (-1883.512) [-1881.322] -- 0:01:41
Average standard deviation of split frequencies: 0.011224
546000 -- [-1881.039] (-1887.807) (-1884.918) (-1885.097) * (-1884.572) (-1888.042) (-1886.710) [-1884.486] -- 0:01:41
547000 -- (-1882.973) (-1884.986) [-1892.406] (-1885.705) * (-1887.982) [-1885.930] (-1891.378) (-1884.747) -- 0:01:41
548000 -- (-1884.527) [-1882.340] (-1888.758) (-1889.384) * (-1887.003) (-1886.758) [-1890.918] (-1884.580) -- 0:01:40
549000 -- [-1880.176] (-1887.261) (-1883.544) (-1886.569) * (-1889.418) (-1891.627) (-1899.126) [-1880.559] -- 0:01:41
550000 -- (-1888.845) [-1886.965] (-1882.373) (-1893.251) * (-1888.254) [-1887.533] (-1888.885) (-1889.171) -- 0:01:40
Average standard deviation of split frequencies: 0.009417
551000 -- (-1888.056) (-1883.766) [-1890.227] (-1891.000) * [-1882.000] (-1883.305) (-1884.889) (-1886.695) -- 0:01:40
552000 -- (-1883.158) (-1892.533) [-1884.814] (-1891.335) * [-1887.451] (-1884.177) (-1887.807) (-1889.083) -- 0:01:39
553000 -- [-1882.404] (-1889.042) (-1880.683) (-1893.768) * (-1886.773) (-1886.692) [-1890.062] (-1887.064) -- 0:01:40
554000 -- (-1884.838) (-1888.427) (-1886.328) [-1883.176] * (-1885.427) (-1886.701) [-1890.963] (-1887.298) -- 0:01:39
555000 -- [-1883.884] (-1889.398) (-1894.576) (-1889.129) * (-1890.987) (-1883.707) (-1890.160) [-1889.312] -- 0:01:39
Average standard deviation of split frequencies: 0.009326
556000 -- [-1883.951] (-1886.089) (-1883.835) (-1883.203) * (-1889.192) [-1882.845] (-1887.534) (-1890.109) -- 0:01:39
557000 -- [-1886.676] (-1886.746) (-1884.833) (-1887.867) * (-1889.544) (-1881.314) [-1888.273] (-1894.136) -- 0:01:38
558000 -- (-1881.693) (-1889.597) [-1886.100] (-1884.512) * (-1887.368) (-1885.358) (-1885.737) [-1884.591] -- 0:01:39
559000 -- (-1885.788) (-1882.139) [-1883.700] (-1881.844) * (-1885.434) (-1883.968) [-1888.480] (-1883.486) -- 0:01:38
560000 -- [-1886.189] (-1889.890) (-1884.798) (-1886.956) * (-1882.984) (-1883.882) [-1884.123] (-1885.243) -- 0:01:38
Average standard deviation of split frequencies: 0.009669
561000 -- (-1896.769) (-1893.038) (-1885.688) [-1889.449] * (-1888.086) [-1885.357] (-1887.432) (-1885.596) -- 0:01:37
562000 -- (-1885.898) [-1887.940] (-1892.876) (-1885.805) * (-1883.926) (-1884.140) (-1886.646) [-1882.876] -- 0:01:38
563000 -- (-1891.756) (-1884.173) (-1885.989) [-1880.192] * (-1886.937) (-1884.144) (-1888.552) [-1883.943] -- 0:01:37
564000 -- (-1882.859) (-1883.510) (-1883.053) [-1884.638] * (-1890.568) (-1902.059) [-1889.316] (-1885.116) -- 0:01:37
565000 -- (-1893.255) [-1884.299] (-1883.319) (-1890.657) * (-1886.743) (-1887.695) [-1888.860] (-1882.966) -- 0:01:37
Average standard deviation of split frequencies: 0.009162
566000 -- (-1885.519) [-1887.314] (-1888.989) (-1889.036) * (-1884.783) [-1892.412] (-1887.026) (-1896.697) -- 0:01:36
567000 -- (-1892.479) (-1885.073) [-1885.942] (-1885.460) * (-1887.630) (-1891.978) [-1884.349] (-1891.220) -- 0:01:36
568000 -- (-1885.287) (-1888.201) [-1884.374] (-1889.916) * (-1884.373) [-1882.861] (-1888.591) (-1887.593) -- 0:01:36
569000 -- (-1886.187) (-1884.062) [-1882.139] (-1881.082) * (-1885.682) (-1880.461) (-1883.571) [-1886.174] -- 0:01:36
570000 -- (-1881.988) (-1887.613) (-1883.999) [-1879.979] * [-1885.248] (-1886.150) (-1883.255) (-1884.526) -- 0:01:35
Average standard deviation of split frequencies: 0.009500
571000 -- [-1887.017] (-1882.937) (-1886.398) (-1884.097) * (-1884.664) [-1884.987] (-1884.409) (-1887.199) -- 0:01:36
572000 -- (-1885.723) [-1885.927] (-1887.369) (-1887.000) * (-1888.248) [-1883.363] (-1886.545) (-1887.172) -- 0:01:35
573000 -- (-1888.144) [-1886.484] (-1891.938) (-1888.712) * (-1885.810) (-1890.080) (-1882.571) [-1883.945] -- 0:01:35
574000 -- (-1887.027) (-1886.814) (-1883.997) [-1886.398] * (-1888.361) (-1884.992) [-1888.026] (-1885.700) -- 0:01:34
575000 -- (-1884.406) (-1886.981) [-1884.799] (-1888.314) * (-1888.799) (-1880.327) [-1884.379] (-1888.269) -- 0:01:34
Average standard deviation of split frequencies: 0.009821
576000 -- (-1888.235) [-1881.034] (-1882.669) (-1883.606) * [-1888.494] (-1887.332) (-1890.024) (-1886.752) -- 0:01:34
577000 -- (-1882.458) (-1891.076) [-1890.028] (-1889.888) * (-1885.620) [-1889.390] (-1886.674) (-1887.382) -- 0:01:34
578000 -- [-1891.940] (-1884.621) (-1886.584) (-1887.156) * [-1881.143] (-1883.642) (-1887.118) (-1885.025) -- 0:01:34
579000 -- (-1894.824) (-1893.435) [-1883.406] (-1887.127) * (-1885.487) (-1887.460) [-1887.273] (-1884.300) -- 0:01:33
580000 -- (-1890.699) (-1885.074) [-1883.714] (-1887.413) * (-1887.581) (-1888.416) [-1887.363] (-1888.550) -- 0:01:34
Average standard deviation of split frequencies: 0.008524
581000 -- (-1886.535) [-1886.841] (-1890.287) (-1888.499) * [-1885.592] (-1888.691) (-1887.610) (-1886.119) -- 0:01:33
582000 -- (-1882.429) (-1882.252) [-1889.250] (-1889.869) * [-1882.877] (-1893.346) (-1892.268) (-1887.716) -- 0:01:33
583000 -- [-1883.357] (-1887.715) (-1893.767) (-1888.792) * (-1890.716) (-1885.977) (-1887.456) [-1886.811] -- 0:01:32
584000 -- [-1882.338] (-1886.487) (-1887.411) (-1888.620) * [-1882.383] (-1884.103) (-1882.302) (-1882.002) -- 0:01:33
585000 -- (-1887.341) (-1888.197) (-1890.184) [-1886.396] * (-1888.043) (-1882.139) [-1886.984] (-1885.622) -- 0:01:32
Average standard deviation of split frequencies: 0.008849
586000 -- (-1883.964) (-1881.778) [-1885.044] (-1885.232) * (-1894.994) (-1887.787) (-1888.363) [-1884.630] -- 0:01:32
587000 -- (-1891.109) [-1892.116] (-1886.082) (-1880.752) * (-1892.126) (-1884.136) (-1882.167) [-1886.616] -- 0:01:32
588000 -- (-1889.235) [-1890.097] (-1889.261) (-1889.730) * (-1889.553) [-1882.799] (-1882.651) (-1883.130) -- 0:01:31
589000 -- (-1883.805) (-1885.360) (-1888.754) [-1887.224] * (-1892.811) (-1879.559) [-1882.116] (-1892.411) -- 0:01:32
590000 -- (-1890.077) (-1883.050) (-1889.496) [-1880.880] * (-1889.608) (-1894.037) [-1885.733] (-1890.856) -- 0:01:31
Average standard deviation of split frequencies: 0.008380
591000 -- (-1882.245) (-1895.088) (-1888.491) [-1879.245] * (-1887.927) (-1882.672) [-1891.781] (-1886.065) -- 0:01:31
592000 -- [-1885.705] (-1893.474) (-1894.349) (-1883.906) * (-1882.862) (-1884.084) [-1885.588] (-1888.091) -- 0:01:30
593000 -- [-1888.175] (-1889.842) (-1884.284) (-1882.551) * (-1889.449) (-1885.605) [-1883.221] (-1886.757) -- 0:01:31
594000 -- (-1886.117) (-1886.186) [-1886.816] (-1884.825) * (-1890.024) (-1892.788) [-1888.506] (-1888.220) -- 0:01:30
595000 -- (-1890.321) (-1890.702) (-1888.117) [-1889.925] * [-1886.120] (-1887.751) (-1886.830) (-1888.416) -- 0:01:30
Average standard deviation of split frequencies: 0.009096
596000 -- (-1885.238) (-1888.932) (-1881.355) [-1892.676] * (-1885.964) (-1885.549) [-1883.396] (-1890.020) -- 0:01:30
597000 -- [-1883.707] (-1895.940) (-1888.304) (-1886.885) * (-1892.739) (-1884.828) (-1889.543) [-1886.427] -- 0:01:29
598000 -- [-1886.835] (-1886.774) (-1885.939) (-1887.633) * (-1888.673) [-1882.925] (-1888.821) (-1896.392) -- 0:01:30
599000 -- (-1883.760) [-1896.680] (-1889.993) (-1884.575) * (-1892.826) (-1883.140) [-1885.996] (-1884.517) -- 0:01:29
600000 -- (-1886.350) [-1886.525] (-1889.877) (-1883.007) * (-1888.280) (-1886.968) [-1882.705] (-1885.920) -- 0:01:29
Average standard deviation of split frequencies: 0.008240
601000 -- (-1888.234) [-1882.822] (-1882.581) (-1886.946) * (-1890.856) (-1886.064) [-1883.593] (-1891.775) -- 0:01:28
602000 -- [-1883.556] (-1887.563) (-1890.275) (-1884.506) * (-1886.967) [-1883.333] (-1887.531) (-1893.468) -- 0:01:29
603000 -- (-1895.560) [-1886.501] (-1887.630) (-1890.061) * (-1887.272) (-1888.859) (-1883.300) [-1888.942] -- 0:01:28
604000 -- [-1895.877] (-1886.369) (-1886.488) (-1888.089) * [-1883.578] (-1886.693) (-1884.106) (-1886.627) -- 0:01:28
605000 -- (-1884.972) (-1894.185) [-1889.210] (-1887.262) * [-1883.029] (-1886.630) (-1890.537) (-1884.142) -- 0:01:28
Average standard deviation of split frequencies: 0.007779
606000 -- [-1891.423] (-1885.850) (-1888.052) (-1885.582) * (-1884.129) [-1888.243] (-1889.049) (-1884.138) -- 0:01:27
607000 -- [-1884.045] (-1882.995) (-1884.604) (-1887.896) * (-1891.637) [-1889.261] (-1883.578) (-1885.906) -- 0:01:28
608000 -- (-1884.010) (-1884.042) [-1884.620] (-1886.168) * (-1884.593) (-1893.115) [-1884.220] (-1888.533) -- 0:01:27
609000 -- (-1882.518) [-1884.723] (-1884.314) (-1887.861) * (-1884.417) (-1885.319) [-1885.279] (-1891.680) -- 0:01:27
610000 -- [-1886.718] (-1886.914) (-1884.494) (-1885.753) * (-1887.439) (-1885.680) [-1887.058] (-1892.729) -- 0:01:26
Average standard deviation of split frequencies: 0.007720
611000 -- [-1885.952] (-1891.477) (-1887.635) (-1885.564) * [-1885.587] (-1887.708) (-1891.330) (-1887.499) -- 0:01:27
612000 -- (-1888.384) (-1890.856) (-1881.613) [-1882.391] * [-1885.247] (-1887.858) (-1885.917) (-1892.462) -- 0:01:26
613000 -- [-1884.805] (-1891.592) (-1888.344) (-1887.537) * (-1886.104) [-1883.844] (-1881.064) (-1883.939) -- 0:01:26
614000 -- (-1880.082) [-1880.938] (-1889.768) (-1888.850) * (-1884.754) (-1887.805) (-1884.524) [-1885.274] -- 0:01:26
615000 -- (-1885.699) (-1879.495) (-1898.094) [-1887.189] * (-1885.004) [-1891.323] (-1892.577) (-1883.343) -- 0:01:25
Average standard deviation of split frequencies: 0.007653
616000 -- (-1884.823) (-1885.111) [-1884.086] (-1886.967) * [-1889.140] (-1888.345) (-1888.850) (-1891.665) -- 0:01:26
617000 -- (-1886.996) (-1883.250) [-1883.509] (-1880.034) * (-1890.386) (-1885.345) (-1886.759) [-1884.760] -- 0:01:25
618000 -- [-1885.020] (-1884.711) (-1887.100) (-1886.641) * (-1884.705) (-1888.368) [-1885.544] (-1882.109) -- 0:01:25
619000 -- (-1885.595) (-1886.939) [-1887.890] (-1884.492) * (-1886.282) (-1884.181) [-1886.570] (-1882.489) -- 0:01:24
620000 -- (-1884.858) [-1881.887] (-1886.056) (-1888.743) * [-1884.333] (-1883.524) (-1883.771) (-1885.240) -- 0:01:25
Average standard deviation of split frequencies: 0.007975
621000 -- [-1887.851] (-1884.516) (-1883.951) (-1889.325) * (-1885.357) [-1883.606] (-1880.754) (-1886.327) -- 0:01:24
622000 -- (-1886.468) (-1883.919) (-1887.390) [-1884.491] * (-1884.872) (-1887.450) [-1884.944] (-1887.886) -- 0:01:24
623000 -- (-1886.693) (-1886.969) [-1885.281] (-1884.304) * [-1885.202] (-1883.361) (-1889.906) (-1886.592) -- 0:01:24
624000 -- [-1884.116] (-1889.933) (-1884.377) (-1885.202) * (-1884.147) [-1883.590] (-1884.673) (-1882.371) -- 0:01:23
625000 -- [-1890.968] (-1881.516) (-1889.815) (-1886.950) * (-1883.689) (-1892.452) (-1885.354) [-1881.583] -- 0:01:24
Average standard deviation of split frequencies: 0.008283
626000 -- (-1887.731) (-1883.779) (-1883.884) [-1898.674] * (-1888.881) (-1890.565) [-1882.548] (-1889.461) -- 0:01:23
627000 -- (-1892.003) (-1884.564) [-1885.387] (-1890.499) * (-1886.131) (-1891.530) [-1885.193] (-1883.786) -- 0:01:23
628000 -- (-1882.658) [-1881.966] (-1889.391) (-1895.397) * [-1886.002] (-1883.887) (-1881.136) (-1890.317) -- 0:01:22
629000 -- (-1882.380) [-1885.902] (-1891.540) (-1888.930) * (-1883.219) [-1887.241] (-1885.415) (-1888.722) -- 0:01:23
630000 -- (-1887.291) (-1888.909) (-1884.435) [-1887.402] * [-1896.398] (-1886.131) (-1883.764) (-1887.283) -- 0:01:22
Average standard deviation of split frequencies: 0.008222
631000 -- (-1884.927) [-1880.228] (-1889.641) (-1887.768) * [-1884.623] (-1884.418) (-1889.232) (-1882.761) -- 0:01:22
632000 -- [-1888.191] (-1887.171) (-1887.440) (-1891.137) * (-1883.689) (-1884.904) (-1895.942) [-1887.740] -- 0:01:22
633000 -- [-1887.630] (-1886.408) (-1886.150) (-1887.674) * (-1883.753) (-1894.564) [-1888.057] (-1892.240) -- 0:01:21
634000 -- [-1886.182] (-1886.509) (-1901.124) (-1881.974) * (-1887.841) (-1887.213) [-1886.189] (-1887.949) -- 0:01:21
635000 -- (-1885.109) (-1892.207) [-1888.995] (-1888.266) * (-1884.209) (-1883.536) (-1888.972) [-1884.617] -- 0:01:21
Average standard deviation of split frequencies: 0.007412
636000 -- (-1883.262) (-1888.917) [-1890.472] (-1892.106) * (-1884.889) (-1893.890) (-1884.089) [-1885.711] -- 0:01:21
637000 -- (-1887.222) (-1883.523) (-1891.605) [-1889.833] * [-1882.981] (-1883.737) (-1888.566) (-1887.678) -- 0:01:20
638000 -- [-1900.114] (-1887.964) (-1886.997) (-1887.145) * [-1882.741] (-1887.517) (-1892.382) (-1886.113) -- 0:01:21
639000 -- (-1891.508) [-1880.038] (-1887.432) (-1887.045) * (-1887.653) (-1884.647) (-1894.620) [-1885.717] -- 0:01:20
640000 -- (-1887.271) (-1881.206) (-1883.758) [-1885.012] * (-1891.805) [-1882.905] (-1887.529) (-1885.952) -- 0:01:20
Average standard deviation of split frequencies: 0.008094
641000 -- [-1886.402] (-1887.164) (-1886.836) (-1886.406) * (-1887.485) [-1884.285] (-1890.557) (-1884.276) -- 0:01:20
642000 -- (-1891.338) (-1885.237) [-1884.403] (-1887.716) * (-1893.380) [-1888.803] (-1888.499) (-1884.324) -- 0:01:19
643000 -- (-1888.534) (-1887.521) [-1885.823] (-1883.532) * [-1885.679] (-1886.102) (-1890.666) (-1890.306) -- 0:01:19
644000 -- [-1882.671] (-1886.268) (-1886.423) (-1884.304) * [-1885.128] (-1886.063) (-1890.275) (-1883.531) -- 0:01:19
645000 -- (-1883.440) [-1882.659] (-1879.948) (-1888.806) * (-1887.500) (-1882.462) [-1889.558] (-1887.112) -- 0:01:19
Average standard deviation of split frequencies: 0.008027
646000 -- (-1886.464) [-1887.534] (-1884.896) (-1888.944) * (-1887.770) [-1885.581] (-1883.771) (-1883.026) -- 0:01:18
647000 -- [-1889.548] (-1886.414) (-1884.706) (-1884.892) * (-1887.448) [-1884.209] (-1880.499) (-1887.389) -- 0:01:19
648000 -- (-1883.295) (-1885.833) [-1883.800] (-1889.787) * (-1882.384) [-1882.897] (-1885.175) (-1882.623) -- 0:01:18
649000 -- (-1889.356) [-1885.080] (-1887.264) (-1887.669) * (-1885.541) (-1892.054) [-1884.784] (-1891.652) -- 0:01:18
650000 -- (-1884.002) [-1884.804] (-1887.220) (-1886.148) * (-1890.106) [-1882.730] (-1885.364) (-1885.122) -- 0:01:18
Average standard deviation of split frequencies: 0.008332
651000 -- (-1885.130) [-1882.497] (-1884.785) (-1884.793) * (-1883.490) (-1882.565) [-1882.403] (-1886.583) -- 0:01:17
652000 -- (-1889.744) [-1886.105] (-1884.321) (-1891.470) * (-1881.487) [-1885.268] (-1887.252) (-1885.158) -- 0:01:17
653000 -- (-1886.374) [-1892.750] (-1888.213) (-1882.859) * (-1890.313) (-1884.070) [-1888.668] (-1891.938) -- 0:01:17
654000 -- (-1883.130) (-1884.761) [-1887.008] (-1891.407) * (-1883.618) [-1888.659] (-1888.118) (-1882.714) -- 0:01:17
655000 -- (-1890.000) [-1884.219] (-1887.971) (-1888.640) * (-1884.974) [-1882.542] (-1885.815) (-1887.271) -- 0:01:16
Average standard deviation of split frequencies: 0.008264
656000 -- [-1883.228] (-1884.886) (-1892.791) (-1886.390) * (-1891.037) (-1883.489) [-1894.772] (-1887.238) -- 0:01:17
657000 -- (-1886.888) (-1888.650) [-1885.105] (-1884.243) * (-1883.620) (-1885.074) [-1889.134] (-1888.550) -- 0:01:16
658000 -- (-1882.059) [-1885.040] (-1881.803) (-1889.674) * (-1881.760) [-1883.324] (-1889.552) (-1898.741) -- 0:01:16
659000 -- (-1887.310) [-1883.832] (-1883.873) (-1885.368) * [-1886.727] (-1885.067) (-1885.525) (-1887.955) -- 0:01:16
660000 -- (-1881.454) [-1889.509] (-1886.061) (-1892.843) * (-1884.855) (-1886.432) [-1883.410] (-1890.625) -- 0:01:15
Average standard deviation of split frequencies: 0.007849
661000 -- [-1885.490] (-1885.543) (-1883.879) (-1890.258) * (-1883.460) (-1889.420) (-1883.734) [-1890.675] -- 0:01:15
662000 -- (-1886.510) (-1891.672) [-1884.821] (-1890.952) * (-1887.158) (-1890.274) [-1886.055] (-1898.038) -- 0:01:15
663000 -- (-1890.701) (-1888.297) [-1882.299] (-1887.661) * [-1887.278] (-1888.443) (-1885.543) (-1885.011) -- 0:01:15
664000 -- (-1887.229) (-1886.733) [-1882.221] (-1893.258) * (-1886.019) (-1885.300) [-1882.273] (-1893.447) -- 0:01:14
665000 -- [-1886.576] (-1882.038) (-1885.967) (-1895.229) * (-1887.331) (-1889.546) [-1882.806] (-1892.833) -- 0:01:15
Average standard deviation of split frequencies: 0.007786
666000 -- (-1888.040) (-1884.254) (-1888.504) [-1886.464] * (-1881.351) (-1883.638) (-1885.690) [-1885.342] -- 0:01:14
667000 -- (-1887.491) (-1890.362) (-1888.291) [-1891.115] * (-1883.315) [-1886.553] (-1888.775) (-1890.910) -- 0:01:14
668000 -- [-1886.454] (-1885.573) (-1884.375) (-1890.107) * (-1891.345) (-1888.596) [-1886.042] (-1884.443) -- 0:01:14
669000 -- [-1889.870] (-1901.518) (-1886.014) (-1884.669) * (-1889.416) (-1886.801) [-1883.654] (-1881.144) -- 0:01:13
670000 -- [-1887.352] (-1890.484) (-1886.901) (-1883.217) * (-1890.129) [-1892.467] (-1883.007) (-1887.717) -- 0:01:13
Average standard deviation of split frequencies: 0.009489
671000 -- (-1886.544) (-1881.642) [-1891.672] (-1884.133) * (-1888.469) [-1883.002] (-1882.975) (-1887.182) -- 0:01:13
672000 -- (-1886.902) (-1885.541) [-1883.115] (-1885.059) * (-1885.061) (-1888.072) [-1889.760] (-1884.368) -- 0:01:13
673000 -- (-1887.261) (-1891.531) (-1888.146) [-1885.932] * (-1888.337) (-1884.622) [-1887.882] (-1891.153) -- 0:01:12
674000 -- (-1882.255) [-1884.095] (-1889.231) (-1887.260) * [-1889.209] (-1883.118) (-1886.828) (-1889.380) -- 0:01:13
675000 -- (-1893.386) (-1883.101) (-1881.823) [-1886.073] * [-1894.122] (-1890.579) (-1885.672) (-1885.607) -- 0:01:12
Average standard deviation of split frequencies: 0.008717
676000 -- (-1886.823) [-1882.849] (-1886.690) (-1884.877) * (-1892.675) (-1886.583) (-1887.447) [-1885.633] -- 0:01:12
677000 -- [-1888.276] (-1883.576) (-1886.450) (-1882.544) * [-1885.200] (-1882.825) (-1883.805) (-1888.034) -- 0:01:12
678000 -- [-1888.193] (-1883.489) (-1891.950) (-1886.142) * [-1882.879] (-1888.301) (-1888.857) (-1889.799) -- 0:01:12
679000 -- [-1887.879] (-1886.414) (-1886.848) (-1891.696) * (-1888.128) [-1892.125] (-1886.460) (-1893.906) -- 0:01:11
680000 -- (-1883.789) (-1886.303) (-1884.749) [-1884.422] * (-1886.477) [-1883.714] (-1884.328) (-1882.936) -- 0:01:11
Average standard deviation of split frequencies: 0.008657
681000 -- (-1883.178) [-1883.823] (-1889.331) (-1885.564) * (-1888.850) (-1881.040) [-1890.907] (-1885.640) -- 0:01:11
682000 -- (-1887.500) (-1886.814) [-1887.369] (-1889.586) * [-1884.585] (-1887.313) (-1884.042) (-1885.461) -- 0:01:10
683000 -- (-1888.531) (-1886.957) [-1883.409] (-1885.744) * (-1883.807) [-1881.988] (-1892.676) (-1891.059) -- 0:01:11
684000 -- (-1884.337) [-1881.723] (-1887.313) (-1883.797) * [-1880.236] (-1888.460) (-1885.575) (-1888.422) -- 0:01:10
685000 -- (-1884.281) (-1889.397) (-1890.365) [-1885.992] * (-1888.016) (-1895.288) (-1889.268) [-1893.268] -- 0:01:10
Average standard deviation of split frequencies: 0.007215
686000 -- (-1884.043) [-1887.292] (-1885.346) (-1885.203) * (-1886.463) (-1887.354) (-1884.151) [-1884.779] -- 0:01:10
687000 -- [-1889.517] (-1884.674) (-1889.412) (-1885.989) * (-1886.582) (-1885.906) (-1882.585) [-1885.655] -- 0:01:10
688000 -- [-1888.326] (-1887.685) (-1886.580) (-1898.347) * [-1885.338] (-1886.375) (-1886.693) (-1890.836) -- 0:01:09
689000 -- (-1886.348) (-1887.914) [-1885.546] (-1888.500) * (-1887.062) (-1890.726) (-1883.332) [-1882.946] -- 0:01:09
690000 -- (-1886.556) [-1888.267] (-1889.064) (-1885.449) * (-1885.156) (-1889.445) [-1886.776] (-1886.785) -- 0:01:09
Average standard deviation of split frequencies: 0.007849
691000 -- (-1887.072) (-1887.779) [-1883.333] (-1885.501) * (-1888.945) [-1881.078] (-1884.466) (-1890.232) -- 0:01:08
692000 -- (-1884.388) (-1888.474) [-1884.957] (-1882.584) * (-1888.626) [-1890.188] (-1881.388) (-1895.190) -- 0:01:08
693000 -- (-1885.521) [-1885.308] (-1882.942) (-1892.289) * (-1891.724) (-1887.253) [-1883.587] (-1883.862) -- 0:01:08
694000 -- (-1891.168) (-1882.448) [-1887.376] (-1892.458) * (-1889.410) [-1886.073] (-1883.244) (-1884.761) -- 0:01:08
695000 -- (-1888.056) (-1886.442) [-1886.872] (-1885.928) * (-1896.758) (-1883.112) [-1882.144] (-1889.046) -- 0:01:08
Average standard deviation of split frequencies: 0.007450
696000 -- (-1888.460) (-1897.247) [-1886.202] (-1885.218) * (-1884.559) [-1886.050] (-1888.308) (-1888.727) -- 0:01:08
697000 -- (-1886.385) (-1891.967) (-1887.728) [-1884.496] * (-1888.789) (-1885.547) [-1887.381] (-1888.908) -- 0:01:07
698000 -- (-1893.224) (-1887.489) [-1886.804] (-1888.006) * (-1888.010) [-1884.645] (-1885.941) (-1888.460) -- 0:01:07
699000 -- (-1891.191) [-1886.174] (-1884.994) (-1882.683) * (-1886.707) (-1885.043) (-1888.385) [-1884.168] -- 0:01:07
700000 -- [-1885.016] (-1884.085) (-1886.130) (-1882.743) * (-1887.641) (-1883.428) (-1884.552) [-1881.457] -- 0:01:06
Average standard deviation of split frequencies: 0.007737
701000 -- (-1883.625) [-1888.790] (-1883.109) (-1881.655) * (-1887.911) (-1883.172) (-1897.833) [-1887.370] -- 0:01:06
702000 -- [-1883.843] (-1886.065) (-1887.771) (-1887.503) * (-1884.202) [-1886.066] (-1886.376) (-1891.063) -- 0:01:06
703000 -- (-1886.401) (-1882.744) (-1890.638) [-1881.002] * (-1882.688) [-1886.734] (-1882.062) (-1888.083) -- 0:01:06
704000 -- (-1885.445) (-1886.641) (-1888.210) [-1883.828] * (-1888.888) (-1886.950) [-1884.809] (-1891.482) -- 0:01:06
705000 -- (-1881.893) (-1885.352) [-1884.534] (-1885.745) * [-1881.455] (-1892.444) (-1891.641) (-1883.247) -- 0:01:06
Average standard deviation of split frequencies: 0.008013
706000 -- [-1883.360] (-1887.823) (-1886.670) (-1880.061) * (-1890.537) (-1892.972) (-1886.176) [-1883.629] -- 0:01:05
707000 -- (-1889.933) (-1880.369) (-1885.085) [-1886.914] * (-1887.992) (-1889.960) [-1883.254] (-1888.750) -- 0:01:05
708000 -- [-1887.472] (-1888.621) (-1889.914) (-1885.197) * [-1882.265] (-1883.824) (-1887.002) (-1885.304) -- 0:01:05
709000 -- [-1883.148] (-1885.246) (-1886.173) (-1888.313) * [-1882.728] (-1893.856) (-1888.423) (-1879.457) -- 0:01:04
710000 -- (-1883.280) [-1886.052] (-1886.028) (-1889.751) * [-1888.057] (-1883.037) (-1883.585) (-1881.476) -- 0:01:04
Average standard deviation of split frequencies: 0.008292
711000 -- [-1886.401] (-1887.773) (-1885.040) (-1884.028) * (-1891.818) (-1882.378) [-1880.205] (-1884.607) -- 0:01:04
712000 -- (-1884.036) (-1886.473) (-1883.189) [-1887.290] * [-1886.837] (-1886.504) (-1887.547) (-1888.056) -- 0:01:04
713000 -- (-1886.310) (-1885.897) (-1889.053) [-1887.758] * [-1885.280] (-1885.243) (-1887.948) (-1886.791) -- 0:01:04
714000 -- (-1886.935) [-1884.563] (-1884.205) (-1885.095) * (-1885.462) (-1887.597) [-1887.413] (-1887.414) -- 0:01:04
715000 -- (-1888.782) (-1884.504) (-1889.997) [-1882.609] * (-1883.085) [-1883.786] (-1885.664) (-1889.827) -- 0:01:03
Average standard deviation of split frequencies: 0.008230
716000 -- (-1884.203) [-1881.973] (-1884.149) (-1886.337) * (-1885.901) [-1886.409] (-1887.084) (-1880.336) -- 0:01:03
717000 -- (-1884.978) (-1883.721) (-1889.850) [-1887.095] * [-1887.218] (-1886.648) (-1885.826) (-1885.259) -- 0:01:03
718000 -- (-1895.234) (-1885.216) [-1888.461] (-1885.468) * [-1885.921] (-1886.228) (-1889.063) (-1886.090) -- 0:01:03
719000 -- (-1887.479) (-1886.642) (-1885.928) [-1885.553] * (-1882.537) (-1890.282) (-1882.648) [-1882.829] -- 0:01:02
720000 -- (-1887.224) (-1882.115) [-1881.930] (-1882.198) * [-1885.451] (-1882.445) (-1887.994) (-1897.229) -- 0:01:02
Average standard deviation of split frequencies: 0.009485
721000 -- (-1886.544) (-1883.663) [-1884.696] (-1887.343) * [-1880.076] (-1888.090) (-1888.752) (-1884.687) -- 0:01:02
722000 -- (-1888.069) [-1882.655] (-1888.373) (-1886.044) * [-1883.299] (-1887.291) (-1891.341) (-1887.866) -- 0:01:01
723000 -- [-1889.373] (-1886.064) (-1884.555) (-1883.627) * (-1886.092) (-1885.676) (-1885.329) [-1881.593] -- 0:01:02
724000 -- (-1885.484) [-1887.156] (-1883.317) (-1886.849) * (-1884.723) (-1887.031) [-1885.931] (-1888.655) -- 0:01:01
725000 -- (-1888.057) [-1885.696] (-1889.576) (-1887.049) * (-1886.701) (-1886.983) (-1885.392) [-1884.170] -- 0:01:01
Average standard deviation of split frequencies: 0.012986
726000 -- [-1891.921] (-1885.046) (-1885.480) (-1887.931) * [-1887.936] (-1888.078) (-1884.616) (-1894.389) -- 0:01:01
727000 -- (-1887.778) (-1883.500) (-1886.433) [-1887.477] * (-1883.101) (-1888.545) (-1889.502) [-1887.085] -- 0:01:01
728000 -- (-1883.008) (-1881.810) [-1887.260] (-1882.809) * (-1881.850) [-1885.872] (-1881.737) (-1885.146) -- 0:01:00
729000 -- (-1892.419) (-1891.205) [-1888.514] (-1883.641) * (-1889.880) (-1896.728) (-1881.501) [-1884.139] -- 0:01:00
730000 -- [-1886.193] (-1895.848) (-1891.704) (-1882.623) * (-1890.336) [-1893.566] (-1883.563) (-1882.417) -- 0:01:00
Average standard deviation of split frequencies: 0.009032
731000 -- (-1888.861) (-1887.691) [-1886.366] (-1883.496) * (-1889.549) (-1887.755) (-1885.864) [-1888.345] -- 0:00:59
732000 -- (-1884.059) (-1894.369) (-1887.985) [-1884.827] * (-1885.366) [-1884.467] (-1885.580) (-1884.597) -- 0:01:00
733000 -- (-1886.740) [-1885.422] (-1886.670) (-1883.319) * [-1883.589] (-1885.829) (-1881.526) (-1890.005) -- 0:00:59
734000 -- (-1885.771) [-1891.735] (-1888.005) (-1883.172) * (-1886.432) [-1887.181] (-1885.855) (-1890.975) -- 0:00:59
735000 -- (-1896.313) (-1887.917) (-1889.451) [-1884.686] * (-1887.318) (-1886.018) [-1889.269] (-1883.251) -- 0:00:59
Average standard deviation of split frequencies: 0.007686
736000 -- (-1886.624) (-1898.109) [-1886.853] (-1887.529) * (-1886.252) (-1882.829) (-1891.126) [-1885.121] -- 0:00:59
737000 -- (-1882.476) (-1885.586) [-1881.345] (-1885.869) * (-1890.418) [-1887.604] (-1885.481) (-1883.979) -- 0:00:58
738000 -- (-1882.691) (-1887.829) [-1882.447] (-1888.834) * (-1893.304) (-1889.532) (-1883.686) [-1882.581] -- 0:00:58
739000 -- (-1885.924) (-1883.572) [-1888.118] (-1891.335) * (-1888.626) (-1882.577) [-1887.561] (-1883.613) -- 0:00:58
740000 -- (-1894.551) [-1883.632] (-1888.712) (-1894.801) * (-1889.383) [-1883.582] (-1888.044) (-1887.080) -- 0:00:57
Average standard deviation of split frequencies: 0.007319
741000 -- (-1880.788) (-1887.466) (-1890.771) [-1883.421] * (-1888.454) [-1889.164] (-1883.326) (-1879.697) -- 0:00:58
742000 -- (-1886.023) (-1890.144) [-1880.812] (-1882.985) * (-1883.995) (-1889.418) (-1884.821) [-1881.693] -- 0:00:57
743000 -- (-1882.946) [-1882.609] (-1884.436) (-1891.327) * (-1889.361) (-1886.682) [-1881.727] (-1889.434) -- 0:00:57
744000 -- (-1882.964) (-1886.939) (-1883.900) [-1886.785] * (-1883.413) (-1891.247) (-1888.388) [-1892.118] -- 0:00:57
745000 -- (-1888.226) (-1890.701) [-1885.524] (-1884.253) * (-1888.949) [-1889.460] (-1885.775) (-1886.155) -- 0:00:57
Average standard deviation of split frequencies: 0.006951
746000 -- (-1888.920) [-1887.399] (-1888.297) (-1894.226) * (-1885.200) [-1887.089] (-1886.478) (-1885.821) -- 0:00:56
747000 -- (-1889.236) [-1886.962] (-1889.310) (-1887.767) * (-1882.815) (-1883.344) (-1883.559) [-1887.131] -- 0:00:56
748000 -- [-1887.253] (-1885.432) (-1883.641) (-1889.260) * (-1887.133) (-1889.223) (-1886.189) [-1891.834] -- 0:00:56
749000 -- [-1883.178] (-1891.851) (-1886.140) (-1888.664) * (-1891.748) (-1883.138) [-1885.488] (-1886.272) -- 0:00:55
750000 -- (-1887.747) [-1886.839] (-1882.484) (-1892.465) * (-1886.257) (-1885.160) [-1888.973] (-1890.963) -- 0:00:56
Average standard deviation of split frequencies: 0.006908
751000 -- (-1884.525) [-1883.793] (-1887.382) (-1883.907) * [-1884.539] (-1895.257) (-1890.145) (-1885.390) -- 0:00:55
752000 -- (-1894.650) (-1886.117) [-1885.685] (-1885.090) * [-1883.132] (-1883.711) (-1888.197) (-1882.589) -- 0:00:55
753000 -- (-1884.018) [-1888.090] (-1887.125) (-1881.176) * (-1892.831) (-1888.358) [-1883.492] (-1888.096) -- 0:00:55
754000 -- [-1885.632] (-1888.578) (-1883.146) (-1880.802) * (-1883.995) (-1889.780) [-1889.897] (-1884.396) -- 0:00:55
755000 -- [-1886.227] (-1886.828) (-1883.769) (-1884.717) * (-1882.801) (-1887.841) [-1884.589] (-1881.554) -- 0:00:54
Average standard deviation of split frequencies: 0.006859
756000 -- [-1881.648] (-1890.455) (-1884.118) (-1887.760) * (-1884.657) (-1890.180) (-1890.458) [-1886.175] -- 0:00:54
757000 -- (-1892.203) (-1892.630) [-1886.833] (-1888.547) * (-1892.501) [-1884.086] (-1890.457) (-1883.461) -- 0:00:54
758000 -- (-1886.286) (-1886.634) (-1896.824) [-1885.622] * (-1885.716) (-1888.320) [-1883.151] (-1887.464) -- 0:00:53
759000 -- [-1890.444] (-1883.119) (-1884.087) (-1887.320) * (-1886.557) (-1885.039) (-1885.448) [-1887.328] -- 0:00:53
760000 -- (-1888.370) (-1887.376) [-1887.169] (-1883.710) * (-1887.473) (-1887.166) (-1885.754) [-1890.813] -- 0:00:53
Average standard deviation of split frequencies: 0.007127
761000 -- (-1885.237) (-1884.782) (-1882.842) [-1883.987] * (-1892.317) [-1886.473] (-1884.770) (-1881.644) -- 0:00:53
762000 -- [-1885.683] (-1890.670) (-1888.402) (-1885.544) * (-1886.630) (-1885.704) [-1881.810] (-1886.056) -- 0:00:53
763000 -- (-1893.235) (-1885.518) (-1889.441) [-1884.645] * [-1884.697] (-1890.633) (-1884.963) (-1887.308) -- 0:00:53
764000 -- (-1885.461) (-1891.328) [-1886.920] (-1889.655) * (-1882.680) (-1889.058) (-1888.566) [-1887.255] -- 0:00:52
765000 -- (-1888.558) (-1887.407) (-1891.014) [-1888.220] * (-1882.935) [-1883.030] (-1883.206) (-1885.948) -- 0:00:52
Average standard deviation of split frequencies: 0.006770
766000 -- (-1888.837) (-1882.818) (-1880.439) [-1889.089] * (-1884.245) [-1880.212] (-1887.225) (-1888.536) -- 0:00:52
767000 -- (-1889.442) [-1884.186] (-1892.635) (-1887.654) * [-1886.026] (-1885.185) (-1884.274) (-1890.148) -- 0:00:51
768000 -- (-1885.456) (-1889.307) [-1882.516] (-1890.789) * [-1884.013] (-1885.717) (-1889.557) (-1884.827) -- 0:00:51
769000 -- [-1883.626] (-1889.116) (-1881.425) (-1895.034) * [-1884.131] (-1892.231) (-1883.616) (-1888.254) -- 0:00:51
770000 -- [-1884.391] (-1885.687) (-1891.394) (-1889.416) * [-1883.630] (-1892.864) (-1890.238) (-1886.103) -- 0:00:51
Average standard deviation of split frequencies: 0.006729
771000 -- (-1888.369) (-1887.302) [-1888.685] (-1891.778) * (-1888.072) (-1891.694) [-1887.142] (-1894.080) -- 0:00:51
772000 -- [-1888.155] (-1891.519) (-1885.081) (-1884.675) * (-1887.336) (-1891.311) [-1881.594] (-1900.025) -- 0:00:51
773000 -- (-1889.002) [-1886.986] (-1891.525) (-1888.906) * (-1890.999) (-1885.193) (-1886.773) [-1885.660] -- 0:00:50
774000 -- (-1890.273) (-1882.485) [-1887.987] (-1880.774) * (-1885.592) [-1883.714] (-1890.596) (-1894.447) -- 0:00:50
775000 -- [-1883.902] (-1884.129) (-1887.761) (-1888.104) * (-1888.058) (-1883.780) [-1888.239] (-1886.914) -- 0:00:50
Average standard deviation of split frequencies: 0.008505
776000 -- [-1884.047] (-1889.542) (-1889.202) (-1885.833) * (-1889.725) [-1890.150] (-1883.083) (-1886.433) -- 0:00:49
777000 -- (-1884.707) [-1888.228] (-1883.561) (-1887.269) * [-1885.812] (-1889.274) (-1880.920) (-1891.490) -- 0:00:49
778000 -- (-1882.934) (-1888.550) [-1884.231] (-1882.799) * (-1883.055) (-1883.322) [-1884.710] (-1892.125) -- 0:00:49
779000 -- (-1881.891) (-1887.148) [-1882.545] (-1885.629) * (-1886.092) (-1888.345) (-1881.186) [-1879.843] -- 0:00:49
780000 -- (-1890.567) (-1887.290) (-1889.980) [-1882.282] * [-1889.847] (-1884.703) (-1887.103) (-1881.495) -- 0:00:49
Average standard deviation of split frequencies: 0.008152
781000 -- (-1889.406) (-1887.677) [-1884.470] (-1884.444) * (-1888.624) (-1884.643) (-1887.154) [-1884.229] -- 0:00:49
782000 -- (-1889.727) [-1885.844] (-1885.526) (-1889.703) * (-1887.324) (-1885.637) (-1892.540) [-1881.243] -- 0:00:48
783000 -- (-1890.294) [-1882.815] (-1886.773) (-1889.363) * (-1891.756) (-1881.160) [-1888.016] (-1888.454) -- 0:00:48
784000 -- [-1886.541] (-1887.471) (-1883.224) (-1886.393) * [-1881.909] (-1884.726) (-1884.914) (-1882.906) -- 0:00:48
785000 -- (-1889.114) (-1889.383) [-1884.096] (-1888.664) * (-1880.323) (-1881.175) [-1884.814] (-1897.412) -- 0:00:47
Average standard deviation of split frequencies: 0.005698
786000 -- [-1883.131] (-1893.469) (-1886.184) (-1886.651) * [-1883.585] (-1889.428) (-1884.308) (-1884.434) -- 0:00:47
787000 -- [-1886.795] (-1888.721) (-1890.128) (-1881.392) * (-1888.048) [-1888.300] (-1889.588) (-1882.548) -- 0:00:47
788000 -- (-1883.139) (-1885.254) [-1887.263] (-1892.437) * (-1888.500) (-1886.890) [-1892.655] (-1881.161) -- 0:00:47
789000 -- [-1883.350] (-1889.466) (-1888.813) (-1896.351) * (-1886.965) (-1887.312) (-1885.855) [-1883.955] -- 0:00:47
790000 -- [-1887.006] (-1883.382) (-1888.138) (-1884.749) * (-1884.924) (-1887.591) [-1884.110] (-1889.528) -- 0:00:47
Average standard deviation of split frequencies: 0.006260
791000 -- (-1885.078) (-1884.389) (-1887.682) [-1883.510] * (-1883.119) (-1883.926) [-1882.683] (-1886.149) -- 0:00:46
792000 -- (-1887.018) (-1889.291) [-1890.622] (-1886.026) * [-1882.271] (-1885.242) (-1889.505) (-1885.726) -- 0:00:46
793000 -- [-1886.153] (-1892.036) (-1893.767) (-1884.641) * (-1880.961) (-1882.082) [-1885.276] (-1881.414) -- 0:00:46
794000 -- (-1880.975) [-1885.624] (-1892.350) (-1885.083) * [-1888.076] (-1883.795) (-1885.834) (-1881.993) -- 0:00:46
795000 -- (-1887.337) (-1891.931) (-1882.730) [-1885.629] * (-1882.776) [-1881.620] (-1891.386) (-1882.458) -- 0:00:45
Average standard deviation of split frequencies: 0.005330
796000 -- [-1885.017] (-1886.902) (-1884.904) (-1882.537) * (-1888.201) (-1884.453) (-1883.644) [-1891.911] -- 0:00:45
797000 -- (-1888.265) (-1890.888) (-1882.193) [-1883.588] * (-1889.476) [-1882.911] (-1884.305) (-1885.469) -- 0:00:45
798000 -- (-1896.589) (-1883.700) [-1882.937] (-1896.431) * [-1882.604] (-1884.426) (-1885.179) (-1890.652) -- 0:00:45
799000 -- (-1887.623) (-1887.829) (-1882.741) [-1883.517] * (-1888.949) [-1883.819] (-1886.151) (-1887.630) -- 0:00:45
800000 -- (-1883.166) (-1888.830) [-1884.417] (-1887.453) * (-1889.601) (-1884.036) (-1889.802) [-1888.948] -- 0:00:44
Average standard deviation of split frequencies: 0.006476
801000 -- (-1883.779) (-1888.063) (-1882.400) [-1887.319] * [-1887.927] (-1884.851) (-1885.997) (-1887.237) -- 0:00:44
802000 -- [-1887.076] (-1882.079) (-1889.033) (-1880.631) * (-1887.252) (-1882.198) (-1887.454) [-1889.769] -- 0:00:44
803000 -- (-1884.621) (-1883.495) [-1881.389] (-1883.795) * (-1889.532) (-1896.714) (-1887.357) [-1887.430] -- 0:00:44
804000 -- (-1892.855) [-1884.206] (-1884.053) (-1885.499) * (-1895.164) (-1887.623) (-1893.906) [-1887.383] -- 0:00:43
805000 -- (-1889.813) (-1890.710) (-1889.265) [-1884.448] * (-1892.826) (-1893.946) (-1884.178) [-1889.298] -- 0:00:43
Average standard deviation of split frequencies: 0.006141
806000 -- (-1892.713) (-1883.557) [-1887.571] (-1885.505) * (-1889.241) (-1889.606) [-1886.528] (-1895.875) -- 0:00:43
807000 -- [-1892.718] (-1884.339) (-1883.505) (-1886.104) * (-1886.241) (-1893.303) (-1897.124) [-1885.671] -- 0:00:43
808000 -- (-1882.269) (-1879.960) (-1889.592) [-1887.473] * (-1889.750) [-1883.995] (-1887.905) (-1888.706) -- 0:00:43
809000 -- [-1883.662] (-1885.816) (-1890.942) (-1886.643) * (-1887.295) (-1882.249) (-1882.276) [-1885.991] -- 0:00:42
810000 -- (-1891.742) (-1885.933) [-1881.882] (-1881.395) * (-1888.914) (-1889.075) [-1885.416] (-1884.698) -- 0:00:42
Average standard deviation of split frequencies: 0.007850
811000 -- [-1884.103] (-1887.056) (-1887.832) (-1892.318) * (-1889.740) (-1883.679) (-1885.929) [-1882.077] -- 0:00:42
812000 -- (-1889.170) (-1884.662) [-1889.792] (-1883.270) * (-1885.279) (-1887.881) [-1880.475] (-1884.219) -- 0:00:42
813000 -- (-1888.264) [-1886.575] (-1883.027) (-1885.488) * (-1883.440) (-1887.235) [-1888.138] (-1886.240) -- 0:00:41
814000 -- [-1884.109] (-1885.306) (-1888.158) (-1887.098) * (-1892.118) (-1889.582) (-1885.965) [-1887.935] -- 0:00:41
815000 -- (-1889.657) (-1885.731) [-1888.089] (-1893.891) * (-1887.486) (-1883.489) [-1886.564] (-1889.805) -- 0:00:41
Average standard deviation of split frequencies: 0.008088
816000 -- (-1890.442) [-1885.112] (-1883.439) (-1887.161) * (-1888.981) (-1886.350) (-1889.938) [-1891.616] -- 0:00:41
817000 -- (-1891.359) (-1892.584) (-1891.551) [-1887.776] * [-1886.503] (-1883.468) (-1882.568) (-1896.100) -- 0:00:40
818000 -- (-1884.863) (-1888.741) [-1889.365] (-1898.950) * [-1883.714] (-1886.766) (-1882.954) (-1889.665) -- 0:00:40
819000 -- [-1889.451] (-1894.163) (-1890.233) (-1886.295) * (-1880.186) (-1886.080) (-1885.498) [-1886.532] -- 0:00:40
820000 -- [-1885.524] (-1886.139) (-1887.251) (-1885.617) * [-1886.590] (-1885.106) (-1883.520) (-1881.207) -- 0:00:40
Average standard deviation of split frequencies: 0.010627
821000 -- [-1883.153] (-1888.430) (-1883.759) (-1888.327) * [-1887.469] (-1885.770) (-1885.949) (-1885.549) -- 0:00:40
822000 -- (-1883.603) [-1889.001] (-1881.077) (-1884.153) * (-1891.678) [-1882.667] (-1895.077) (-1890.584) -- 0:00:39
823000 -- (-1886.986) (-1883.594) (-1888.640) [-1882.728] * (-1886.863) [-1882.763] (-1886.245) (-1882.461) -- 0:00:39
824000 -- [-1880.951] (-1886.843) (-1891.499) (-1886.204) * (-1883.826) (-1883.936) (-1883.259) [-1884.451] -- 0:00:39
825000 -- (-1885.103) [-1881.140] (-1891.772) (-1887.360) * [-1884.395] (-1887.448) (-1894.626) (-1882.346) -- 0:00:39
Average standard deviation of split frequencies: 0.008846
826000 -- (-1890.286) (-1885.915) [-1885.060] (-1888.271) * (-1883.386) (-1884.800) [-1889.244] (-1884.542) -- 0:00:38
827000 -- (-1884.556) (-1885.626) (-1882.233) [-1883.310] * (-1888.287) [-1885.181] (-1891.848) (-1886.117) -- 0:00:38
828000 -- (-1894.736) (-1886.419) (-1883.824) [-1890.803] * (-1888.450) [-1884.302] (-1892.857) (-1884.809) -- 0:00:38
829000 -- (-1885.826) [-1887.540] (-1884.160) (-1882.275) * (-1885.555) (-1887.053) (-1884.939) [-1892.882] -- 0:00:38
830000 -- (-1887.126) (-1891.669) (-1894.629) [-1886.220] * (-1881.561) [-1885.485] (-1885.705) (-1886.173) -- 0:00:38
Average standard deviation of split frequencies: 0.007378
831000 -- (-1888.061) [-1883.057] (-1884.331) (-1886.351) * (-1886.876) (-1889.390) [-1884.476] (-1884.623) -- 0:00:37
832000 -- (-1887.497) (-1885.863) [-1885.994] (-1884.449) * [-1883.172] (-1893.927) (-1884.234) (-1891.297) -- 0:00:37
833000 -- (-1880.671) (-1885.160) [-1887.792] (-1886.790) * (-1886.438) (-1887.778) [-1888.515] (-1885.900) -- 0:00:37
834000 -- (-1880.587) [-1886.185] (-1885.226) (-1884.272) * [-1887.442] (-1891.053) (-1885.732) (-1882.456) -- 0:00:37
835000 -- [-1884.682] (-1885.313) (-1883.961) (-1885.485) * (-1883.382) (-1886.153) [-1884.195] (-1884.529) -- 0:00:36
Average standard deviation of split frequencies: 0.007330
836000 -- (-1888.509) [-1886.104] (-1889.508) (-1886.124) * (-1886.028) (-1886.103) [-1886.845] (-1886.967) -- 0:00:36
837000 -- [-1885.645] (-1885.406) (-1885.378) (-1890.665) * (-1886.040) (-1894.391) (-1885.285) [-1884.348] -- 0:00:36
838000 -- (-1887.397) [-1888.314] (-1883.591) (-1888.686) * (-1888.930) (-1887.353) [-1883.906] (-1886.250) -- 0:00:36
839000 -- (-1882.835) (-1885.820) (-1887.347) [-1884.880] * (-1891.950) (-1883.982) [-1881.918] (-1890.139) -- 0:00:36
840000 -- (-1883.813) (-1887.028) [-1885.961] (-1888.442) * (-1897.224) [-1880.290] (-1885.510) (-1895.168) -- 0:00:35
Average standard deviation of split frequencies: 0.006168
841000 -- (-1886.679) [-1890.440] (-1887.535) (-1885.155) * (-1885.960) [-1882.633] (-1884.857) (-1896.082) -- 0:00:35
842000 -- (-1888.915) (-1879.556) (-1887.336) [-1886.387] * [-1885.493] (-1885.004) (-1888.081) (-1891.097) -- 0:00:35
843000 -- (-1885.759) (-1882.447) (-1886.330) [-1886.495] * (-1884.478) (-1891.863) [-1886.134] (-1883.592) -- 0:00:35
844000 -- (-1897.323) (-1885.996) (-1892.316) [-1884.614] * (-1884.282) (-1890.436) [-1887.360] (-1889.225) -- 0:00:34
845000 -- [-1884.932] (-1887.734) (-1891.195) (-1883.358) * (-1884.618) (-1899.994) (-1884.753) [-1892.218] -- 0:00:34
Average standard deviation of split frequencies: 0.005015
846000 -- (-1891.477) (-1889.476) [-1883.339] (-1884.189) * (-1886.824) (-1890.321) (-1890.804) [-1889.535] -- 0:00:34
847000 -- [-1883.553] (-1882.771) (-1880.612) (-1884.242) * (-1891.001) (-1891.565) (-1885.535) [-1885.199] -- 0:00:34
848000 -- [-1885.152] (-1882.819) (-1884.055) (-1883.209) * [-1885.451] (-1890.220) (-1885.506) (-1886.956) -- 0:00:34
849000 -- (-1881.738) (-1885.478) [-1884.349] (-1888.040) * (-1889.261) (-1886.001) [-1885.798] (-1883.503) -- 0:00:33
850000 -- (-1892.423) (-1884.586) (-1883.784) [-1887.852] * (-1900.772) (-1888.206) [-1883.527] (-1882.616) -- 0:00:33
Average standard deviation of split frequencies: 0.005542
851000 -- [-1882.388] (-1885.332) (-1891.473) (-1884.443) * (-1886.737) [-1886.281] (-1890.657) (-1890.411) -- 0:00:33
852000 -- [-1887.679] (-1891.618) (-1891.016) (-1882.188) * [-1882.536] (-1886.105) (-1890.546) (-1883.175) -- 0:00:33
853000 -- [-1889.542] (-1889.349) (-1882.531) (-1884.910) * (-1887.784) (-1888.216) (-1888.076) [-1881.395] -- 0:00:32
854000 -- [-1885.873] (-1885.912) (-1889.536) (-1888.713) * (-1894.780) (-1891.981) (-1885.549) [-1881.085] -- 0:00:32
855000 -- [-1887.997] (-1887.518) (-1897.589) (-1889.134) * (-1888.058) (-1890.342) (-1884.979) [-1885.643] -- 0:00:32
Average standard deviation of split frequencies: 0.004956
856000 -- (-1881.620) (-1888.547) [-1882.863] (-1884.292) * (-1892.287) (-1887.337) [-1887.419] (-1888.899) -- 0:00:32
857000 -- (-1891.172) (-1883.443) [-1891.063] (-1888.445) * (-1884.860) [-1883.323] (-1891.979) (-1886.050) -- 0:00:32
858000 -- [-1882.546] (-1885.470) (-1885.328) (-1882.582) * (-1886.184) (-1885.028) [-1884.077] (-1887.880) -- 0:00:31
859000 -- [-1884.450] (-1883.336) (-1883.414) (-1881.103) * [-1881.718] (-1885.762) (-1885.306) (-1884.696) -- 0:00:31
860000 -- (-1887.843) (-1885.421) [-1885.084] (-1882.726) * (-1885.092) (-1888.650) [-1883.353] (-1882.849) -- 0:00:31
Average standard deviation of split frequencies: 0.005203
861000 -- [-1882.084] (-1893.821) (-1890.235) (-1888.155) * (-1882.515) (-1898.357) (-1885.531) [-1884.192] -- 0:00:30
862000 -- (-1881.765) (-1893.412) (-1883.801) [-1886.225] * (-1890.686) (-1887.684) [-1885.597] (-1888.189) -- 0:00:30
863000 -- (-1887.576) [-1883.959] (-1887.208) (-1890.910) * (-1886.261) (-1892.350) [-1890.320] (-1885.313) -- 0:00:30
864000 -- (-1887.178) [-1883.500] (-1881.963) (-1891.868) * (-1885.364) (-1886.309) (-1891.966) [-1886.571] -- 0:00:30
865000 -- [-1882.024] (-1881.618) (-1884.892) (-1885.854) * (-1886.300) [-1887.591] (-1886.195) (-1887.562) -- 0:00:30
Average standard deviation of split frequencies: 0.005443
866000 -- (-1887.435) (-1882.767) [-1884.962] (-1883.985) * (-1888.858) [-1881.825] (-1892.157) (-1890.348) -- 0:00:30
867000 -- (-1883.273) [-1888.398] (-1887.771) (-1885.504) * (-1893.160) (-1886.950) (-1885.416) [-1888.875] -- 0:00:29
868000 -- (-1887.463) (-1891.474) (-1894.023) [-1883.518] * (-1888.713) (-1886.980) [-1881.940] (-1882.887) -- 0:00:29
869000 -- (-1884.168) (-1884.286) [-1884.907] (-1886.732) * (-1889.264) (-1887.462) (-1887.703) [-1893.550] -- 0:00:29
870000 -- (-1892.961) [-1883.621] (-1887.903) (-1883.797) * (-1881.688) (-1886.840) (-1893.528) [-1885.334] -- 0:00:28
Average standard deviation of split frequencies: 0.004602
871000 -- (-1888.097) [-1883.960] (-1884.745) (-1882.740) * (-1882.432) (-1886.808) [-1887.998] (-1890.105) -- 0:00:28
872000 -- (-1885.818) [-1888.476] (-1889.321) (-1885.088) * (-1884.025) (-1889.515) [-1889.472] (-1889.790) -- 0:00:28
873000 -- (-1882.950) (-1879.758) (-1888.674) [-1894.790] * (-1879.653) (-1887.257) [-1883.089] (-1885.095) -- 0:00:28
874000 -- [-1886.491] (-1883.738) (-1882.316) (-1890.067) * (-1882.624) [-1885.706] (-1886.288) (-1895.288) -- 0:00:28
875000 -- [-1885.594] (-1886.161) (-1889.122) (-1885.186) * (-1886.715) [-1888.456] (-1889.233) (-1894.585) -- 0:00:28
Average standard deviation of split frequencies: 0.005650
876000 -- (-1882.823) (-1888.959) (-1890.943) [-1886.505] * (-1897.342) (-1887.982) (-1883.244) [-1886.561] -- 0:00:27
877000 -- (-1882.490) (-1891.594) (-1885.778) [-1886.124] * (-1884.070) [-1887.607] (-1894.321) (-1896.304) -- 0:00:27
878000 -- (-1883.387) (-1890.718) [-1884.635] (-1886.880) * (-1881.018) (-1882.063) (-1894.375) [-1887.477] -- 0:00:27
879000 -- [-1885.519] (-1889.552) (-1889.248) (-1889.171) * (-1882.071) (-1880.950) (-1887.189) [-1882.033] -- 0:00:26
880000 -- (-1888.607) (-1886.847) (-1887.998) [-1883.480] * (-1885.216) (-1885.761) [-1883.611] (-1890.306) -- 0:00:26
Average standard deviation of split frequencies: 0.008029
881000 -- (-1887.553) (-1887.396) [-1883.566] (-1884.761) * [-1888.143] (-1885.850) (-1887.903) (-1883.723) -- 0:00:26
882000 -- (-1887.415) (-1887.959) [-1884.167] (-1887.109) * [-1892.873] (-1885.661) (-1884.928) (-1886.050) -- 0:00:26
883000 -- [-1887.949] (-1887.569) (-1887.848) (-1883.198) * (-1891.985) [-1889.128] (-1887.925) (-1885.149) -- 0:00:26
884000 -- [-1880.837] (-1879.629) (-1890.570) (-1883.451) * (-1886.971) (-1888.154) (-1889.736) [-1880.459] -- 0:00:25
885000 -- [-1885.602] (-1884.984) (-1891.784) (-1888.134) * [-1884.573] (-1886.280) (-1887.533) (-1883.563) -- 0:00:25
Average standard deviation of split frequencies: 0.006917
886000 -- [-1885.367] (-1892.395) (-1885.731) (-1885.200) * (-1891.242) [-1887.533] (-1885.002) (-1885.777) -- 0:00:25
887000 -- (-1884.738) [-1881.730] (-1886.739) (-1886.822) * (-1895.386) [-1884.564] (-1894.086) (-1883.577) -- 0:00:25
888000 -- (-1884.373) (-1882.024) [-1885.845] (-1888.628) * (-1891.645) (-1883.662) [-1886.390] (-1893.230) -- 0:00:24
889000 -- (-1890.823) (-1887.499) (-1882.072) [-1886.467] * (-1891.157) [-1890.796] (-1892.971) (-1886.629) -- 0:00:24
890000 -- (-1884.390) [-1887.463] (-1885.203) (-1890.246) * (-1884.312) (-1881.899) [-1886.002] (-1887.497) -- 0:00:24
Average standard deviation of split frequencies: 0.007410
891000 -- (-1888.975) (-1880.436) (-1886.349) [-1890.653] * (-1881.511) [-1882.192] (-1891.904) (-1885.183) -- 0:00:24
892000 -- (-1883.640) (-1884.432) [-1885.780] (-1883.676) * (-1884.109) (-1890.592) (-1884.829) [-1885.827] -- 0:00:24
893000 -- [-1882.187] (-1888.288) (-1888.488) (-1883.501) * [-1885.135] (-1885.859) (-1887.543) (-1889.528) -- 0:00:23
894000 -- (-1888.613) (-1885.944) (-1884.602) [-1890.118] * [-1893.308] (-1883.269) (-1885.940) (-1891.615) -- 0:00:23
895000 -- (-1884.716) (-1881.429) (-1885.482) [-1887.938] * (-1894.262) [-1890.716] (-1888.702) (-1889.981) -- 0:00:23
Average standard deviation of split frequencies: 0.007366
896000 -- [-1885.136] (-1887.777) (-1884.740) (-1884.829) * [-1884.594] (-1882.650) (-1892.507) (-1884.942) -- 0:00:23
897000 -- [-1884.437] (-1889.642) (-1884.255) (-1888.157) * (-1885.989) [-1882.851] (-1883.341) (-1889.538) -- 0:00:22
898000 -- (-1881.335) (-1890.845) [-1882.474] (-1885.723) * (-1887.918) (-1889.632) (-1884.968) [-1884.115] -- 0:00:22
899000 -- (-1886.888) (-1886.157) [-1885.748] (-1891.218) * (-1887.630) [-1882.966] (-1885.750) (-1885.132) -- 0:00:22
900000 -- (-1891.189) [-1885.827] (-1885.927) (-1888.239) * (-1884.620) [-1889.568] (-1882.021) (-1885.398) -- 0:00:22
Average standard deviation of split frequencies: 0.007589
901000 -- (-1886.355) (-1887.505) [-1883.299] (-1885.865) * (-1886.775) [-1888.388] (-1883.262) (-1884.731) -- 0:00:22
902000 -- (-1889.629) (-1888.673) [-1884.196] (-1886.644) * (-1883.559) [-1883.734] (-1889.049) (-1881.213) -- 0:00:21
903000 -- (-1895.287) (-1888.864) (-1885.627) [-1888.372] * [-1884.386] (-1893.249) (-1887.730) (-1881.109) -- 0:00:21
904000 -- (-1887.686) [-1887.094] (-1885.570) (-1886.682) * (-1887.684) (-1890.373) [-1885.597] (-1891.051) -- 0:00:21
905000 -- (-1885.294) [-1884.370] (-1884.453) (-1886.493) * (-1883.433) [-1884.844] (-1895.096) (-1894.194) -- 0:00:21
Average standard deviation of split frequencies: 0.008325
906000 -- (-1886.881) [-1887.423] (-1887.748) (-1884.802) * (-1886.373) (-1886.166) [-1883.390] (-1885.274) -- 0:00:20
907000 -- [-1882.929] (-1890.583) (-1887.254) (-1885.743) * (-1884.464) (-1882.305) (-1888.884) [-1883.811] -- 0:00:20
908000 -- (-1883.488) (-1886.257) (-1887.983) [-1886.653] * [-1885.145] (-1884.926) (-1886.488) (-1885.867) -- 0:00:20
909000 -- (-1882.865) (-1884.703) [-1886.924] (-1884.137) * (-1886.622) (-1886.709) [-1889.913] (-1885.968) -- 0:00:20
910000 -- [-1882.423] (-1881.919) (-1886.863) (-1889.840) * [-1887.103] (-1884.367) (-1887.247) (-1885.059) -- 0:00:20
Average standard deviation of split frequencies: 0.009576
911000 -- (-1895.921) (-1896.120) [-1884.225] (-1883.205) * (-1884.193) (-1886.803) [-1882.167] (-1881.962) -- 0:00:19
912000 -- [-1888.877] (-1883.626) (-1884.573) (-1889.815) * (-1887.162) [-1890.550] (-1888.148) (-1885.646) -- 0:00:19
913000 -- (-1898.600) (-1889.903) (-1886.261) [-1883.859] * (-1885.792) (-1894.301) (-1886.339) [-1884.944] -- 0:00:19
914000 -- (-1891.041) [-1887.571] (-1886.571) (-1884.182) * [-1881.478] (-1889.909) (-1891.401) (-1886.433) -- 0:00:19
915000 -- (-1886.062) (-1882.492) [-1882.094] (-1888.753) * (-1885.319) [-1886.918] (-1885.456) (-1893.066) -- 0:00:18
Average standard deviation of split frequencies: 0.009778
916000 -- (-1883.302) (-1889.115) [-1885.571] (-1886.279) * (-1892.907) [-1883.731] (-1884.019) (-1891.119) -- 0:00:18
917000 -- (-1886.894) [-1892.593] (-1885.452) (-1887.756) * (-1884.632) (-1886.718) (-1881.405) [-1881.965] -- 0:00:18
918000 -- (-1883.192) (-1886.123) (-1885.011) [-1884.449] * (-1891.767) [-1883.649] (-1886.317) (-1893.424) -- 0:00:18
919000 -- (-1886.011) [-1884.322] (-1891.377) (-1889.360) * [-1894.997] (-1884.043) (-1886.395) (-1886.827) -- 0:00:18
920000 -- [-1884.024] (-1883.937) (-1884.426) (-1888.089) * (-1888.256) (-1886.153) [-1880.313] (-1889.888) -- 0:00:17
Average standard deviation of split frequencies: 0.011009
921000 -- (-1886.371) (-1885.546) [-1885.977] (-1886.405) * [-1884.593] (-1883.032) (-1887.474) (-1887.786) -- 0:00:17
922000 -- [-1884.869] (-1888.170) (-1887.977) (-1888.902) * (-1887.739) (-1887.554) (-1883.411) [-1884.968] -- 0:00:17
923000 -- (-1893.887) (-1891.783) (-1886.756) [-1883.824] * [-1884.026] (-1885.764) (-1881.872) (-1887.886) -- 0:00:17
924000 -- (-1884.045) [-1886.369] (-1892.515) (-1884.322) * (-1882.123) (-1882.178) [-1884.989] (-1888.285) -- 0:00:16
925000 -- (-1888.121) (-1886.688) [-1885.117] (-1889.532) * (-1889.169) (-1884.518) [-1887.418] (-1885.721) -- 0:00:16
Average standard deviation of split frequencies: 0.009672
926000 -- (-1891.306) (-1888.349) [-1882.535] (-1888.796) * (-1888.451) (-1885.876) [-1884.832] (-1882.626) -- 0:00:16
927000 -- [-1889.339] (-1886.087) (-1894.621) (-1885.761) * (-1886.104) [-1882.318] (-1885.059) (-1885.684) -- 0:00:16
928000 -- (-1890.585) (-1885.411) [-1887.339] (-1888.695) * [-1884.311] (-1881.585) (-1889.502) (-1886.693) -- 0:00:16
929000 -- [-1881.862] (-1884.927) (-1883.656) (-1887.586) * (-1888.165) [-1883.017] (-1885.961) (-1889.755) -- 0:00:15
930000 -- [-1887.758] (-1888.443) (-1884.226) (-1888.178) * [-1888.579] (-1891.250) (-1884.469) (-1885.098) -- 0:00:15
Average standard deviation of split frequencies: 0.012157
931000 -- (-1888.074) (-1895.903) (-1885.295) [-1882.553] * (-1884.467) (-1882.528) (-1890.198) [-1886.141] -- 0:00:15
932000 -- [-1883.116] (-1884.762) (-1884.873) (-1880.742) * [-1885.447] (-1892.754) (-1889.596) (-1885.033) -- 0:00:15
933000 -- (-1886.883) [-1883.677] (-1890.108) (-1887.030) * (-1885.095) (-1894.774) [-1880.943] (-1885.028) -- 0:00:14
934000 -- (-1887.189) (-1893.115) (-1889.329) [-1886.413] * [-1890.615] (-1885.316) (-1886.884) (-1889.298) -- 0:00:14
935000 -- [-1881.124] (-1886.190) (-1887.163) (-1881.661) * (-1890.618) (-1892.781) [-1884.270] (-1885.749) -- 0:00:14
Average standard deviation of split frequencies: 0.012087
936000 -- [-1892.469] (-1884.624) (-1884.408) (-1881.303) * (-1887.555) [-1886.670] (-1885.617) (-1890.604) -- 0:00:14
937000 -- (-1887.661) (-1896.556) [-1883.013] (-1885.675) * (-1888.157) [-1885.067] (-1882.223) (-1886.444) -- 0:00:14
938000 -- [-1894.216] (-1887.384) (-1887.569) (-1885.791) * (-1885.124) [-1884.067] (-1887.272) (-1886.061) -- 0:00:13
939000 -- [-1882.884] (-1887.978) (-1880.823) (-1886.342) * (-1886.888) (-1890.246) [-1883.926] (-1886.573) -- 0:00:13
940000 -- (-1885.648) (-1889.665) (-1889.453) [-1882.860] * (-1886.568) (-1881.294) (-1883.999) [-1888.248] -- 0:00:13
Average standard deviation of split frequencies: 0.012278
941000 -- [-1888.366] (-1890.983) (-1885.035) (-1886.242) * [-1883.691] (-1887.056) (-1885.565) (-1886.111) -- 0:00:13
942000 -- (-1883.433) [-1884.705] (-1881.440) (-1884.898) * (-1891.385) (-1886.238) [-1886.339] (-1884.890) -- 0:00:12
943000 -- (-1886.037) (-1881.714) [-1882.997] (-1883.570) * (-1889.763) [-1884.988] (-1884.315) (-1886.819) -- 0:00:12
944000 -- (-1882.543) [-1881.409] (-1884.575) (-1892.124) * [-1890.451] (-1884.842) (-1884.218) (-1890.341) -- 0:00:12
945000 -- [-1883.062] (-1888.835) (-1882.663) (-1889.392) * (-1887.155) (-1886.474) (-1882.138) [-1887.531] -- 0:00:12
Average standard deviation of split frequencies: 0.012458
946000 -- (-1885.774) (-1888.760) (-1885.172) [-1891.239] * (-1891.540) (-1887.602) [-1883.693] (-1891.495) -- 0:00:12
947000 -- (-1883.741) (-1887.491) (-1884.286) [-1885.451] * (-1889.723) (-1885.434) [-1894.403] (-1893.655) -- 0:00:11
948000 -- (-1886.635) (-1887.880) [-1884.328] (-1885.070) * (-1891.587) [-1884.381] (-1885.246) (-1889.684) -- 0:00:11
949000 -- (-1883.964) (-1884.283) [-1885.545] (-1892.695) * (-1891.083) (-1882.559) (-1887.750) [-1882.856] -- 0:00:11
950000 -- (-1886.877) (-1891.229) (-1887.331) [-1887.565] * (-1886.763) [-1882.856] (-1887.137) (-1883.944) -- 0:00:11
Average standard deviation of split frequencies: 0.013388
951000 -- (-1884.601) (-1891.049) (-1883.866) [-1883.362] * (-1887.178) (-1882.374) [-1884.841] (-1884.664) -- 0:00:10
952000 -- (-1884.720) (-1887.568) [-1885.368] (-1890.700) * [-1887.352] (-1882.115) (-1883.451) (-1888.743) -- 0:00:10
953000 -- [-1881.930] (-1884.844) (-1884.193) (-1888.693) * (-1886.189) (-1891.000) [-1883.976] (-1888.804) -- 0:00:10
954000 -- (-1885.023) (-1884.125) [-1884.465] (-1888.948) * (-1883.551) (-1892.164) (-1882.352) [-1889.801] -- 0:00:10
955000 -- [-1883.545] (-1881.413) (-1885.849) (-1885.552) * (-1885.789) [-1881.504] (-1895.784) (-1889.576) -- 0:00:10
Average standard deviation of split frequencies: 0.012821
956000 -- (-1887.613) (-1887.990) [-1883.561] (-1888.198) * [-1886.780] (-1891.185) (-1887.535) (-1883.455) -- 0:00:09
957000 -- (-1887.271) (-1886.030) (-1889.485) [-1882.966] * (-1888.088) (-1891.127) [-1886.165] (-1884.099) -- 0:00:09
958000 -- [-1888.540] (-1894.178) (-1885.948) (-1882.951) * [-1883.959] (-1885.600) (-1884.222) (-1884.124) -- 0:00:09
959000 -- (-1885.038) [-1883.564] (-1888.743) (-1888.989) * (-1881.445) (-1892.592) (-1888.242) [-1883.372] -- 0:00:09
960000 -- [-1882.113] (-1886.016) (-1887.435) (-1885.257) * (-1880.828) (-1887.165) (-1887.795) [-1882.629] -- 0:00:08
Average standard deviation of split frequencies: 0.013985
961000 -- (-1884.915) [-1882.208] (-1890.751) (-1885.255) * (-1892.013) [-1885.387] (-1884.655) (-1889.043) -- 0:00:08
962000 -- [-1887.092] (-1885.593) (-1890.961) (-1882.710) * (-1884.800) (-1890.078) (-1885.258) [-1885.021] -- 0:00:08
963000 -- (-1888.379) (-1885.086) [-1886.364] (-1884.138) * [-1886.767] (-1885.995) (-1886.005) (-1886.637) -- 0:00:08
964000 -- (-1881.852) (-1888.080) (-1886.007) [-1885.479] * (-1892.054) (-1886.450) (-1884.869) [-1880.865] -- 0:00:08
965000 -- [-1888.027] (-1883.745) (-1884.658) (-1896.851) * (-1890.060) [-1882.180] (-1882.580) (-1886.815) -- 0:00:07
Average standard deviation of split frequencies: 0.014884
966000 -- (-1885.100) (-1887.396) [-1882.056] (-1889.816) * (-1901.178) [-1885.278] (-1886.629) (-1885.193) -- 0:00:07
967000 -- (-1882.290) (-1884.123) (-1889.479) [-1882.560] * [-1887.031] (-1885.380) (-1885.147) (-1882.441) -- 0:00:07
968000 -- (-1885.713) (-1881.887) (-1888.980) [-1887.273] * (-1887.209) (-1887.874) [-1886.140] (-1885.052) -- 0:00:07
969000 -- (-1889.036) (-1887.433) (-1884.248) [-1888.167] * (-1885.526) (-1887.124) (-1883.832) [-1883.973] -- 0:00:06
970000 -- (-1887.688) (-1887.254) [-1886.327] (-1892.182) * (-1884.748) [-1886.181] (-1890.318) (-1883.587) -- 0:00:06
Average standard deviation of split frequencies: 0.013841
971000 -- (-1885.259) (-1890.616) [-1880.478] (-1883.844) * [-1887.865] (-1891.167) (-1882.799) (-1887.479) -- 0:00:06
972000 -- [-1884.812] (-1881.422) (-1885.089) (-1885.033) * (-1882.073) [-1887.797] (-1886.075) (-1887.063) -- 0:00:06
973000 -- (-1886.565) (-1879.818) [-1887.720] (-1885.038) * (-1885.549) (-1888.554) [-1885.743] (-1887.596) -- 0:00:06
974000 -- (-1888.529) [-1887.004] (-1891.763) (-1884.630) * (-1888.561) (-1887.622) [-1883.472] (-1892.969) -- 0:00:05
975000 -- (-1882.625) [-1885.624] (-1884.747) (-1885.951) * (-1884.197) (-1887.040) (-1888.687) [-1888.680] -- 0:00:05
Average standard deviation of split frequencies: 0.014490
976000 -- (-1887.543) (-1884.721) [-1886.069] (-1884.819) * (-1882.730) [-1885.760] (-1885.096) (-1895.386) -- 0:00:05
977000 -- (-1884.608) [-1884.441] (-1884.378) (-1887.274) * (-1882.464) (-1887.757) [-1887.528] (-1888.558) -- 0:00:05
978000 -- (-1889.459) [-1881.540] (-1884.323) (-1885.049) * (-1885.321) [-1888.405] (-1884.456) (-1890.713) -- 0:00:04
979000 -- (-1881.189) (-1883.765) (-1885.528) [-1883.258] * [-1885.170] (-1885.859) (-1886.218) (-1883.910) -- 0:00:04
980000 -- (-1885.757) (-1885.559) (-1882.125) [-1882.451] * (-1885.632) (-1886.554) [-1886.030] (-1883.984) -- 0:00:04
Average standard deviation of split frequencies: 0.014421
981000 -- (-1882.352) (-1882.076) [-1885.091] (-1887.407) * (-1890.182) (-1888.695) [-1882.885] (-1885.533) -- 0:00:04
982000 -- (-1886.750) (-1888.016) [-1880.522] (-1890.834) * (-1882.620) (-1892.078) (-1884.559) [-1885.952] -- 0:00:04
983000 -- (-1883.666) [-1884.253] (-1892.807) (-1886.223) * [-1885.259] (-1882.348) (-1888.696) (-1884.589) -- 0:00:03
984000 -- [-1880.966] (-1888.637) (-1886.554) (-1896.328) * (-1890.487) (-1884.963) (-1895.767) [-1881.930] -- 0:00:03
985000 -- [-1887.492] (-1888.775) (-1887.765) (-1887.007) * [-1881.130] (-1886.065) (-1892.768) (-1881.487) -- 0:00:03
Average standard deviation of split frequencies: 0.015777
986000 -- [-1881.794] (-1889.758) (-1885.715) (-1883.125) * (-1885.267) (-1885.089) (-1891.608) [-1885.661] -- 0:00:03
987000 -- (-1884.408) [-1884.456] (-1886.609) (-1892.726) * [-1881.037] (-1887.222) (-1882.619) (-1883.829) -- 0:00:02
988000 -- [-1882.535] (-1890.807) (-1887.268) (-1882.941) * (-1882.287) [-1885.429] (-1892.328) (-1885.635) -- 0:00:02
989000 -- (-1889.313) (-1891.276) [-1881.784] (-1883.906) * (-1884.699) (-1887.280) [-1890.459] (-1884.881) -- 0:00:02
990000 -- (-1890.096) (-1889.324) (-1892.489) [-1885.026] * [-1883.069] (-1884.265) (-1885.886) (-1885.719) -- 0:00:02
Average standard deviation of split frequencies: 0.016893
991000 -- (-1889.136) (-1887.352) [-1885.171] (-1886.006) * (-1885.827) (-1885.807) (-1882.813) [-1882.292] -- 0:00:02
992000 -- [-1889.918] (-1883.717) (-1884.508) (-1889.543) * (-1884.325) (-1885.148) (-1883.893) [-1883.459] -- 0:00:01
993000 -- (-1882.467) (-1884.221) [-1890.127] (-1886.415) * (-1881.775) (-1885.277) [-1885.861] (-1880.949) -- 0:00:01
994000 -- (-1883.922) (-1882.900) [-1884.196] (-1894.212) * (-1885.541) [-1887.957] (-1886.143) (-1885.596) -- 0:00:01
995000 -- (-1880.942) (-1886.804) (-1882.093) [-1883.571] * (-1890.133) (-1889.258) (-1887.437) [-1885.895] -- 0:00:01
Average standard deviation of split frequencies: 0.015146
996000 -- (-1886.979) (-1890.199) (-1881.814) [-1883.060] * (-1886.509) (-1889.405) (-1886.793) [-1885.154] -- 0:00:00
997000 -- (-1894.760) (-1885.249) [-1886.456] (-1882.425) * (-1887.299) (-1885.152) [-1886.973] (-1890.670) -- 0:00:00
998000 -- (-1887.769) (-1887.159) (-1887.409) [-1883.421] * (-1883.803) (-1887.981) [-1885.601] (-1889.498) -- 0:00:00
999000 -- (-1887.852) (-1887.919) (-1888.919) [-1883.629] * (-1887.813) (-1883.007) [-1880.495] (-1883.008) -- 0:00:00
1000000 -- (-1886.617) (-1891.811) [-1890.598] (-1883.941) * (-1887.785) (-1883.078) [-1884.129] (-1885.464) -- 0:00:00
Average standard deviation of split frequencies: 0.016488
Analysis completed in 3 mins 44 seconds
Analysis used 223.79 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1878.41
Likelihood of best state for "cold" chain of run 2 was -1878.52
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
52.7 % ( 51 %) Dirichlet(Revmat{all})
69.6 % ( 67 %) Slider(Revmat{all})
26.4 % ( 27 %) Dirichlet(Pi{all})
28.6 % ( 24 %) Slider(Pi{all})
32.8 % ( 25 %) Multiplier(Alpha{1,2})
50.8 % ( 18 %) Multiplier(Alpha{3})
62.5 % ( 34 %) Slider(Pinvar{all})
33.8 % ( 36 %) ExtSPR(Tau{all},V{all})
34.1 % ( 45 %) NNI(Tau{all},V{all})
28.4 % ( 28 %) ParsSPR(Tau{all},V{all})
25.9 % ( 35 %) Multiplier(V{all})
26.4 % ( 23 %) Nodeslider(V{all})
25.5 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
53.6 % ( 52 %) Dirichlet(Revmat{all})
68.6 % ( 53 %) Slider(Revmat{all})
26.2 % ( 27 %) Dirichlet(Pi{all})
29.3 % ( 23 %) Slider(Pi{all})
33.0 % ( 24 %) Multiplier(Alpha{1,2})
50.9 % ( 33 %) Multiplier(Alpha{3})
62.2 % ( 30 %) Slider(Pinvar{all})
33.5 % ( 25 %) ExtSPR(Tau{all},V{all})
33.9 % ( 31 %) NNI(Tau{all},V{all})
28.6 % ( 18 %) ParsSPR(Tau{all},V{all})
25.9 % ( 24 %) Multiplier(V{all})
26.4 % ( 26 %) Nodeslider(V{all})
25.5 % ( 15 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 166988 0.85 0.72
3 | 166913 166478 0.86
4 | 166637 166131 166853
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 166355 0.85 0.72
3 | 166995 166669 0.86
4 | 167013 166893 166075
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1883.88
| 1 |
| |
| 2 2 1 2 |
| 21 2 1 2 2 2 2 1 |
| 2 1 1 1 2 1 2 |
| 1 1 2 2 2 1 11 1 1 2 1|
| 2 ** 2 2 2 2 1 2 2 1 2 1 1 |
| 2 2* 11 1 2* 22 12 1* 1 1 1 21 1 1 22|
|2 2 2 2 2 2 1 2 21 1 2 |
| 1 1 1 1 1 11 1 2 122 21 |
| 1 2 11 2 2 |
|1 1 2 1 2 2 1 |
| * 1 2 |
| 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1887.27
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1883.08 -1893.15
2 -1883.09 -1890.59
--------------------------------------
TOTAL -1883.09 -1892.53
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.600302 0.116425 1.084637 2.259006 1.537875 855.62 972.86 1.000
r(A<->C){all} 0.071863 0.001168 0.009945 0.138994 0.069820 673.20 677.14 1.000
r(A<->G){all} 0.247792 0.002072 0.165128 0.339537 0.245237 599.18 798.80 1.000
r(A<->T){all} 0.166203 0.001236 0.096164 0.232886 0.163975 867.68 1011.07 1.000
r(C<->G){all} 0.069476 0.000813 0.015545 0.124430 0.068257 708.89 747.58 1.000
r(C<->T){all} 0.394502 0.003056 0.284330 0.502726 0.393030 542.74 696.37 1.000
r(G<->T){all} 0.050162 0.000493 0.008070 0.093250 0.048786 708.34 746.47 1.000
pi(A){all} 0.232471 0.000236 0.202399 0.262349 0.232185 1219.24 1224.83 1.000
pi(C){all} 0.207412 0.000212 0.177690 0.234133 0.207246 1002.23 1122.26 1.000
pi(G){all} 0.268036 0.000262 0.237100 0.299432 0.268018 1131.71 1149.55 1.000
pi(T){all} 0.292081 0.000260 0.259247 0.323027 0.292015 1399.12 1438.03 1.000
alpha{1,2} 0.346867 0.007668 0.201873 0.524947 0.332095 1183.34 1189.57 1.001
alpha{3} 2.909344 1.663323 0.956245 5.528710 2.625553 1417.12 1438.96 1.000
pinvar{all} 0.094214 0.003756 0.000338 0.203009 0.086182 1168.69 1266.59 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .*.*
6 -- ..**
----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 1432 0.477015 0.014133 0.467022 0.487009 2
6 1334 0.444370 0.018844 0.431046 0.457695 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.192192 0.001876 0.119329 0.282006 0.187940 1.002 2
length{all}[2] 0.228508 0.004132 0.101441 0.352210 0.225071 1.000 2
length{all}[3] 0.150607 0.002591 0.053378 0.253210 0.150151 1.002 2
length{all}[4] 0.966816 0.073816 0.541184 1.471015 0.912831 1.000 2
length{all}[5] 0.066701 0.002237 0.000329 0.152114 0.057592 0.999 2
length{all}[6] 0.063652 0.001826 0.000082 0.142568 0.055563 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.016488
Maximum standard deviation of split frequencies = 0.018844
Average PSRF for parameter values (excluding NA and >10.0) = 1.001
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\------------------------------------------------------------------------ C4 (4)
Phylogram (based on average branch lengths):
/--------------- C1 (1)
|
|------------------ C2 (2)
+
|------------ C3 (3)
|
\------------------------------------------------------------------------ C4 (4)
|--------------| 0.200 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 2 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
Running FUBAR...
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\
***************** TYPES OF STANDARD ANALYSES *****************
(1) Selection Analyses
(2) Evolutionary Hypothesis Testing
(3) Relative evolutionary rate inference
(4) Coevolutionary analysis
(5) Basic Analyses
(6) Codon Selection Analyses
(7) Compartmentalization
(8) Data File Tools
(9) Miscellaneous
(10) Model Comparison
(11) Kernel Analysis Tools
(12) Molecular Clock
(13) Phylogeny Reconstruction
(14) Positive Selection
(15) Recombination
(16) Selection/Recombination
(17) Relative Rate
(18) Relative Ratio
(19) Substitution Rates
Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' *****************
(1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution).
(2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood).
(3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting).
(4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection).
(5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification).
(6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood).
(7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation).
Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types):
Analysis Description
--------------------
Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a
coding sequence alignment to determine whether some sites have been
subject to pervasive purifying or diversifying selection. v2.1
introduces two more methods for estimating the posterior distribution of
grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation
Bayes approximation (fastest). Please note that a FUBAR analysis
generates a cache and a results JSON file in the same directory as
directory as the original alignment. HyPhy needs to have write
privileges to this directory. For example if the original file is in
/home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there
will also exist FUBAR-generated files
/home/sergei/FUBAR/data/pol.nex.FUBAR.json,
/home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide
checkpointing so that a partially completed analysis can be restarted.
- __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree
(one per partition)
- __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring
selection (2013), Mol Biol Evol. 30(5):1196-205
- __Written by__: Sergei L Kosakovsky Pond
- __Contact Information__: spond@temple.edu
- __Analysis Version__: 2.1
####Choose Genetic Code
1. [**Universal**] Universal code. (Genebank transl_table=1).
2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2).
3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3).
4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4).
5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5).
6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6).
7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9).
8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10).
9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12).
10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13).
11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14).
12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15).
13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16).
14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21).
15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22).
16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23).
17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24).
18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25).
19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26).
>Please choose an option (or press q to cancel selection):
>Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`)
>A tree was found in the data file: `(C1,C2,C3,C4)`
>Would you like to use it (y/n)?
>Loaded a multiple sequence alignment with **4** sequences, **175** codons, and **1** partitions from `/data//pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/fubar/results/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1.fna`
> FUBAR will write cache and result files to _/data//pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/fubar/results/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/fubar/results/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1.fna.FUBAR.json_, respectively
> Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer):
####Posterior estimation method
1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation)
2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed)
3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default)
>Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5):
### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model
* Log(L) = -1908.63, AIC-c = 3841.42 (12 estimated parameters)
* Tree length (expected substitutions/site) for partition 1 : 0.781
### Computing the phylogenetic likelihood function on the grid
* Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid
* Best scaling achieved for
* synonymous rate = 2.815
* non-synonymous rate = 0.643
* Computing conditional site likelihoods on a 20 x 20 rate grid
### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights
* Using the following settings
* Dirichlet alpha : 0.5
### Tabulating site-level results
| Codon | Partition | alpha | beta |Posterior prob for positive selection|
|:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:|
| 139 | 1 | 2.567 | 14.489 | Pos. posterior = 0.9171 |
----
## FUBAR inferred 1 sites subject to diversifying positive selection at posterior probability >= 0.9
Of these, 0.08 are expected to be false positives (95% confidence interval of 0-1 )
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=175
BF_141I_orf1ab_VIPR_P_124389505_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDMPMQEALEVVKNELRKP
BF_493I_orf1ab_VIPR_P_124389496_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MEGVPGPSKLRSMVTITLKWIDPNIMPSVTGWDMPMCEALEIVKDELRKP
BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDVSMQEALELVKAELRKP
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MEGVPDPPKLKSMVVTTLKWCDPFANPNVTGWDIPIEEALEYAKQQLRTP
*****.*.**:***. *:** ** *.*****:.: **** .* :**.*
BF_141I_orf1ab_VIPR_P_124389505_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 EPQLVFVPKYLCHTPLIGEDRIVVTDSTFRATNMGWVPIRELAFDENRIR
BF_493I_orf1ab_VIPR_P_124389496_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 EPDLVFVPKYLCHTPLIGRNRVVITDATYRTTVLGWIPIRELAYDESETR
BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 TPKLVFVPNYLCHTPLIGRDRIVITDSIYRATVMGWIPIRELAFDENNIR
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 EPQLVFVPYYLSHAPGISGDRVVITDSIWYATNFGWQPIRELAMDKDGVR
*.***** **.*:* *. :*:*:**: : :* :** ****** *:. *
BF_141I_orf1ab_VIPR_P_124389505_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 FGRSGTFGVLLPMQDAKYIMGHIDIDMRKYGVGAGGDKDEPLLWDGYIDT
BF_493I_orf1ab_VIPR_P_124389496_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 YGRSGTYGVLLPMQDSKYIMGSIDIDMRKYGAGAGSDRPEPMLWDGFVDL
BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 CGRSGTFGVLLPEQDPKYVMGEVDIDMRKYGVGACSEKPVPLLWDGYIDT
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 YGRGGTHGVLLPMQDPSFIMGDIDIQIRKYGIGANSPPDVLPLWDGFSDP
**.**.***** **..::** :**::**** ** . ****: *
BF_141I_orf1ab_VIPR_P_124389505_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 PYPEDDYLDFPDNSRPAKPKAKRGG
BF_493I_orf1ab_VIPR_P_124389496_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 PRSQKQYLDYPDNCRPTKPKAKRGG
BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 PYPEDDYLDFPDMCRPAKPKAKRGG
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 GPDVGPYLDFPDNCCPTKPKAKRGG
***:** . *:********
>BF_141I_orf1ab_VIPR_P_124389505_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 ATGGAAGGTGTGCCTGACCCACCTAAGCTTAAAAGTATGGTGACTGTCACTTTTAAGTGGATAGATCCCAATATTATGCCCAGCGTCACTGGCTGGGATATGCCTATGCAAGAGGCTTTAGAGGTCGTTAAGAACGAGCTTCGTAAGCCTGAACCTCAATTGGTGTTTGTGCCTAAGTATTTGTGTCACACACCTTTAATTGGTGAGGACCGTATAGTAGTTACGGACTCTACCTTTAGGGCCACTAACATGGGTTGGGTTCCTATACGGGAGCTTGCCTTTGACGAAAACCGTATACGGTTTGGTCGTAGTGGCACTTTTGGCGTACTGCTACCTATGCAAGACGCCAAGTATATAATGGGTCACATTGACATTGACATGCGTAAATACGGTGTCGGTGCTGGTGGTGACAAGGATGAACCTTTACTCTGGGATGGTTACATTGATACACCATATCCGGAGGATGATTATCTGGATTTTCCTGACAATAGCCGTCCTGCAAAGCCTAAGGCTAAGCGTGGCGGT >BF_493I_orf1ab_VIPR_P_124389496_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 ATGGAGGGTGTGCCTGGTCCATCTAAGCTTAGAAGTATGGTGACTATCACTCTTAAGTGGATAGATCCCAATATTATGCCCAGTGTCACTGGCTGGGATATGCCTATGTGTGAGGCTTTGGAGATCGTTAAGGACGAGCTCCGTAAGCCTGAACCTGACTTGGTGTTTGTGCCCAAGTATTTGTGCCATACACCACTTATAGGTAGGAATCGCGTTGTTATAACCGATGCCACCTACCGTACCACTGTTCTCGGGTGGATCCCTATACGGGAGCTCGCCTATGATGAGAGTGAGACTAGATATGGTCGCAGTGGTACTTATGGTGTTCTGCTACCCATGCAGGATTCCAAGTATATTATGGGTTCTATTGACATCGACATGCGTAAGTACGGTGCCGGTGCTGGGTCTGATAGGCCTGAACCAATGTTGTGGGATGGATTTGTAGACCTCCCACGTTCCCAGAAGCAGTATCTGGATTATCCAGACAACTGCCGCCCCACAAAGCCTAAGGCTAAACGTGGTGGT >BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 ATGGAAGGTGTACCTGACCCACCTAAGCTTAAAAGTATGGTGACTGTCACTTTTAAGTGGATAGATCCCAACATTATGCCCAGCGTCACTGGCTGGGATGTTTCTATGCAAGAGGCTTTGGAGCTCGTTAAGGCTGAGCTCCGTAAGCCTACACCTAAATTGGTGTTTGTGCCCAATTATTTGTGCCATACACCACTTATAGGTAGAGATCGGATTGTTATAACCGACTCTATTTACCGTGCCACTGTCATGGGTTGGATTCCTATTAGGGAACTAGCCTTTGACGAAAATAATATTCGTTGTGGTCGCAGTGGTACGTTTGGTGTTTTGCTCCCTGAGCAGGACCCCAAGTATGTTATGGGCGAGGTCGACATTGACATGCGTAAGTATGGTGTCGGTGCCTGTTCTGAGAAACCTGTTCCATTGCTTTGGGATGGTTATATAGATACTCCATACCCAGAGGATGATTATTTGGATTTTCCTGACATGTGTCGCCCAGCGAAGCCTAAAGCTAAGCGAGGCGGC >HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 ATGGAGGGTGTGCCTGACCCACCTAAGCTTAAAAGTATGGTGGTTACCACTTTGAAGTGGTGCGATCCTTTTGCTAATCCCAACGTCACTGGTTGGGATATTCCTATTGAGGAGGCTCTGGAATATGCGAAACAGCAGTTGCGCACTCCGGAACCTCAGTTGGTGTTTGTGCCTTATTATTTGAGCCATGCACCTGGTATTAGTGGTGACCGCGTTGTCATAACTGATAGCATTTGGTACGCTACTAATTTTGGATGGCAGCCCATTAGGGAGCTTGCCATGGATAAGGATGGTGTTCGTTATGGTAGGGGAGGAACACATGGTGTTTTGCTTCCCATGCAGGACCCGTCCTTTATTATGGGTGATATTGATATCCAAATCCGTAAGTACGGTATTGGGGCCAACTCACCGCCTGATGTATTACCGCTCTGGGATGGGTTTTCAGACCCAGGTCCGGATGTGGGGCCTTATTTAGATTTCCCTGATAATTGCTGCCCTACAAAGCCTAAAGCGAAGAGGGGCGGC
>BF_141I_orf1ab_VIPR_P_124389505_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDMPMQEALEVVKNELRKP EPQLVFVPKYLCHTPLIGEDRIVVTDSTFRATNMGWVPIRELAFDENRIR FGRSGTFGVLLPMQDAKYIMGHIDIDMRKYGVGAGGDKDEPLLWDGYIDT PYPEDDYLDFPDNSRPAKPKAKRGG >BF_493I_orf1ab_VIPR_P_124389496_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MEGVPGPSKLRSMVTITLKWIDPNIMPSVTGWDMPMCEALEIVKDELRKP EPDLVFVPKYLCHTPLIGRNRVVITDATYRTTVLGWIPIRELAYDESETR YGRSGTYGVLLPMQDSKYIMGSIDIDMRKYGAGAGSDRPEPMLWDGFVDL PRSQKQYLDYPDNCRPTKPKAKRGG >BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDVSMQEALELVKAELRKP TPKLVFVPNYLCHTPLIGRDRIVITDSIYRATVMGWIPIRELAFDENNIR CGRSGTFGVLLPEQDPKYVMGEVDIDMRKYGVGACSEKPVPLLWDGYIDT PYPEDDYLDFPDMCRPAKPKAKRGG >HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MEGVPDPPKLKSMVVTTLKWCDPFANPNVTGWDIPIEEALEYAKQQLRTP EPQLVFVPYYLSHAPGISGDRVVITDSIWYATNFGWQPIRELAMDKDGVR YGRGGTHGVLLPMQDPSFIMGDIDIQIRKYGIGANSPPDVLPLWDGFSDP GPDVGPYLDFPDNCCPTKPKAKRGG
Reading sequence file /data//pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/fubar/fasta/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1
Found 4 sequences of length 525
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 27.6%
Found 40 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 6
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 161 polymorphic sites
**p-Value(s)**
----------
NSS: 6.50e-02 (1000 permutations)
Max Chi^2: 3.92e-01 (1000 permutations)
PHI (Permutation): 6.54e-01 (1000 permutations)
PHI (Normal): 6.40e-01
#NEXUS
[ID: 5901331290]
begin taxa;
dimensions ntax=4;
taxlabels
BF_141I_orf1ab_VIPR_P_124389505_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
BF_493I_orf1ab_VIPR_P_124389496_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
;
end;
begin trees;
translate
1 BF_141I_orf1ab_VIPR_P_124389505_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9,
2 BF_493I_orf1ab_VIPR_P_124389496_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9,
3 BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9,
4 HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:1.879395e-01,2:2.250710e-01,3:1.501513e-01,4:9.128309e-01);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:1.879395e-01,2:2.250710e-01,3:1.501513e-01,4:9.128309e-01);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1882.95 -1890.84
2 -1883.10 -1894.20
--------------------------------------
TOTAL -1883.02 -1893.54
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.593403 0.119181 1.035792 2.255171 1.534519 914.69 989.55 1.000
r(A<->C){all} 0.072455 0.001157 0.004917 0.133179 0.070168 640.91 745.04 1.000
r(A<->G){all} 0.249989 0.002208 0.163143 0.347027 0.247219 676.06 817.13 1.001
r(A<->T){all} 0.166072 0.001216 0.106764 0.242086 0.163527 807.67 878.70 1.006
r(C<->G){all} 0.069358 0.000860 0.015276 0.128055 0.067342 711.69 715.39 1.004
r(C<->T){all} 0.391897 0.003159 0.289216 0.506545 0.389361 573.65 757.16 1.002
r(G<->T){all} 0.050229 0.000567 0.006093 0.096339 0.048682 721.36 792.31 1.000
pi(A){all} 0.232285 0.000248 0.200703 0.262167 0.231561 984.72 1004.81 1.001
pi(C){all} 0.207299 0.000207 0.178112 0.233535 0.207368 980.89 1018.14 1.000
pi(G){all} 0.267607 0.000278 0.234106 0.298766 0.267708 1064.10 1167.73 1.000
pi(T){all} 0.292809 0.000263 0.260784 0.324208 0.293287 1178.88 1232.60 1.000
alpha{1,2} 0.349619 0.009320 0.198967 0.524270 0.335241 1302.51 1333.99 1.000
alpha{3} 2.944915 1.684925 1.009183 5.618096 2.668002 1344.27 1360.88 1.002
pinvar{all} 0.093194 0.003813 0.000014 0.208211 0.084885 1323.45 1408.12 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C2,C3,C4)` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **4** sequences, **175** codons, and **1** partitions from `/data//pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/fubar/results/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/fubar/results/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/fubar/results/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -1908.63, AIC-c = 3841.42 (12 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.781 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 2.815 * non-synonymous rate = 0.643 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results | Codon | Partition | alpha | beta |Posterior prob for positive selection| |:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:| | 139 | 1 | 2.567 | 14.489 | Pos. posterior = 0.9171 | ---- ## FUBAR inferred 1 sites subject to diversifying positive selection at posterior probability >= 0.9 Of these, 0.08 are expected to be false positives (95% confidence interval of 0-1 )
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
