--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1212.27 -1218.77
2 -1212.12 -1216.37
--------------------------------------
TOTAL -1212.20 -1218.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 6.475232 78.548632 0.000010 25.627120 2.927722 40.88 66.29 1.002
r(A<->C){all} 0.164363 0.018219 0.000174 0.427855 0.131176 101.22 127.53 1.002
r(A<->G){all} 0.146867 0.016004 0.000045 0.404462 0.114653 69.08 133.82 1.000
r(A<->T){all} 0.147184 0.015947 0.000057 0.397870 0.112353 161.78 164.79 1.001
r(C<->G){all} 0.165770 0.019431 0.000034 0.450929 0.129907 132.72 155.82 1.000
r(C<->T){all} 0.166034 0.019519 0.000076 0.436496 0.129687 35.25 106.76 1.009
r(G<->T){all} 0.209783 0.025295 0.000048 0.520336 0.172740 76.55 79.56 1.004
pi(A){all} 0.291395 0.000230 0.260810 0.319845 0.291325 663.93 916.33 1.000
pi(C){all} 0.146830 0.000141 0.124085 0.170177 0.146535 1033.01 1056.76 1.000
pi(G){all} 0.206520 0.000175 0.179966 0.230575 0.206547 1089.49 1150.86 1.001
pi(T){all} 0.355255 0.000244 0.323334 0.384207 0.355431 1071.27 1156.70 1.000
alpha{1,2} 0.902051 0.920939 0.000659 2.780874 0.588855 699.35 917.23 1.001
alpha{3} 0.913965 0.973764 0.000068 2.900909 0.586969 926.56 1074.92 1.002
pinvar{all} 0.871093 0.055449 0.319857 0.999893 0.996366 10.58 14.43 1.011
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
-- Starting log on Fri Oct 21 22:38:34 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=300
C1 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C3 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C4 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
**************************************************
C1 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C2 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C3 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C4 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
**************************************************
C1 DYVSDADFSITGDCTHVYVEDKFDLLISYMYDGKIKSIDGDNVSKDGFFT
C2 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
C3 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
C4 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
**************************** *********************
C1 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C2 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C3 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C4 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
**************************************************
C1 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C2 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C3 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C4 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
**************************************************
C1 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C2 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C3 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C4 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
**************************************************
-- Starting log on Fri Oct 21 22:39:04 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=4, Len=300
C1 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C3 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C4 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
**************************************************
C1 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C2 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C3 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C4 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
**************************************************
C1 DYVSDADFSITGDCTHVYVEDKFDLLISYMYDGKIKSIDGDNVSKDGFFT
C2 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
C3 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
C4 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
**************************** *********************
C1 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C2 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C3 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C4 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
**************************************************
C1 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C2 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C3 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C4 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
**************************************************
C1 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C2 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C3 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C4 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
**************************************************
-- Starting log on Fri Oct 21 22:38:34 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=300
C1 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C3 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C4 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
**************************************************
C1 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C2 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C3 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C4 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
**************************************************
C1 DYVSDADFSITGDCTHVYVEDKFDLLISYMYDGKIKSIDGDNVSKDGFFT
C2 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
C3 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
C4 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
**************************** *********************
C1 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C2 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C3 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C4 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
**************************************************
C1 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C2 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C3 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C4 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
**************************************************
C1 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C2 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C3 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C4 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
**************************************************
-- Starting log on Fri Oct 21 22:51:27 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/gapped_alignment/fubar,HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 900 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666392689
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 20232895
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8466325032
Seed = 1937021834
Swapseed = 1666392689
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.00 % Dirichlet(Revmat{all})
1.00 % Slider(Revmat{all})
1.00 % Dirichlet(Pi{all})
1.00 % Slider(Pi{all})
2.00 % Multiplier(Alpha{1,2})
2.00 % Multiplier(Alpha{3})
2.00 % Slider(Pinvar{all})
10.00 % ExtSPR(Tau{all},V{all})
10.00 % NNI(Tau{all},V{all})
10.00 % ParsSPR(Tau{all},V{all})
40.00 % Multiplier(V{all})
14.00 % Nodeslider(V{all})
6.00 % TLMultiplier(V{all})
Division 1 has 5 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1339.015684 -- 13.556448
Chain 2 -- -1339.015684 -- 13.556448
Chain 3 -- -1339.015684 -- 13.556448
Chain 4 -- -1339.015684 -- 13.556448
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1339.015684 -- 13.556448
Chain 2 -- -1339.015684 -- 13.556448
Chain 3 -- -1339.015684 -- 13.556448
Chain 4 -- -1339.015684 -- 13.556448
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1339.016] (-1339.016) (-1339.016) (-1339.016) * [-1339.016] (-1339.016) (-1339.016) (-1339.016)
1000 -- (-1247.056) (-1214.127) [-1211.667] (-1219.463) * (-1211.696) [-1219.301] (-1220.052) (-1217.580) -- 0:00:00
2000 -- (-1222.488) (-1210.343) [-1209.967] (-1213.280) * [-1212.163] (-1213.925) (-1213.728) (-1210.483) -- 0:00:00
3000 -- [-1212.800] (-1209.789) (-1213.218) (-1213.457) * (-1211.912) [-1211.343] (-1216.945) (-1210.605) -- 0:00:00
4000 -- (-1215.451) (-1211.828) [-1212.486] (-1214.046) * (-1218.846) (-1217.223) [-1215.845] (-1211.931) -- 0:00:00
5000 -- [-1211.965] (-1211.082) (-1213.910) (-1210.318) * [-1211.248] (-1211.994) (-1217.490) (-1212.096) -- 0:00:00
Average standard deviation of split frequencies: 0.000000
6000 -- (-1212.826) (-1211.612) (-1213.523) [-1211.677] * [-1211.865] (-1212.535) (-1212.436) (-1213.974) -- 0:00:00
7000 -- (-1211.356) [-1210.914] (-1212.792) (-1212.239) * [-1211.735] (-1212.431) (-1222.389) (-1212.761) -- 0:00:00
8000 -- (-1213.689) (-1211.206) [-1216.662] (-1215.925) * (-1212.676) (-1212.640) [-1213.538] (-1212.425) -- 0:02:04
9000 -- (-1211.877) (-1211.725) (-1214.125) [-1210.342] * (-1212.625) (-1213.625) (-1212.588) [-1209.757] -- 0:01:50
10000 -- (-1215.703) (-1213.701) (-1213.348) [-1208.049] * (-1216.907) [-1211.539] (-1210.989) (-1213.163) -- 0:01:39
Average standard deviation of split frequencies: 0.088388
11000 -- (-1212.778) (-1214.388) (-1212.818) [-1212.058] * (-1210.432) (-1210.892) [-1212.008] (-1212.261) -- 0:01:29
12000 -- (-1211.511) [-1212.562] (-1212.444) (-1211.709) * (-1213.126) (-1212.325) (-1211.664) [-1212.722] -- 0:01:22
13000 -- (-1211.914) [-1209.692] (-1214.001) (-1211.585) * (-1216.018) (-1211.337) [-1210.477] (-1212.435) -- 0:01:15
14000 -- (-1211.066) (-1212.202) [-1213.105] (-1212.920) * (-1216.653) [-1210.625] (-1212.531) (-1213.539) -- 0:01:10
15000 -- (-1214.409) [-1209.055] (-1214.079) (-1211.448) * (-1212.691) (-1210.246) [-1210.282] (-1219.080) -- 0:01:05
Average standard deviation of split frequencies: 0.039284
16000 -- (-1211.467) (-1211.134) [-1213.439] (-1209.930) * (-1211.577) (-1217.054) (-1209.921) [-1212.440] -- 0:01:01
17000 -- (-1210.107) (-1213.132) [-1214.097] (-1209.457) * [-1210.272] (-1215.440) (-1210.705) (-1211.516) -- 0:00:57
18000 -- (-1215.749) (-1211.173) (-1212.501) [-1211.678] * (-1210.570) (-1216.794) [-1213.241] (-1216.747) -- 0:01:49
19000 -- (-1210.340) (-1217.968) [-1212.819] (-1212.732) * (-1211.308) [-1212.155] (-1212.294) (-1210.573) -- 0:01:43
20000 -- (-1212.417) (-1211.280) (-1214.340) [-1212.533] * (-1212.759) (-1212.721) (-1209.785) [-1215.159] -- 0:01:38
Average standard deviation of split frequencies: 0.060826
21000 -- (-1213.838) [-1214.842] (-1213.839) (-1209.746) * (-1218.726) [-1211.221] (-1211.008) (-1215.346) -- 0:01:33
22000 -- [-1214.995] (-1215.756) (-1216.847) (-1213.400) * (-1215.202) (-1218.163) (-1213.989) [-1212.507] -- 0:01:28
23000 -- (-1211.410) [-1210.890] (-1213.362) (-1209.401) * (-1213.445) (-1213.739) [-1212.057] (-1214.614) -- 0:01:24
24000 -- (-1211.380) [-1212.107] (-1214.752) (-1209.657) * (-1213.767) [-1214.421] (-1216.333) (-1213.824) -- 0:01:21
25000 -- [-1210.910] (-1211.465) (-1213.399) (-1211.069) * (-1212.286) [-1215.960] (-1211.240) (-1212.924) -- 0:01:18
Average standard deviation of split frequencies: 0.024175
26000 -- (-1210.413) [-1209.450] (-1213.828) (-1210.672) * (-1216.037) [-1211.732] (-1212.271) (-1216.616) -- 0:01:14
27000 -- (-1218.113) [-1211.984] (-1213.432) (-1213.095) * (-1214.623) (-1211.545) (-1216.424) [-1214.675] -- 0:01:12
28000 -- (-1211.530) (-1211.782) (-1215.968) [-1208.450] * (-1221.287) (-1213.545) (-1212.262) [-1213.036] -- 0:01:09
29000 -- (-1213.292) (-1211.705) (-1217.216) [-1210.274] * (-1214.931) (-1211.694) (-1212.934) [-1218.080] -- 0:01:40
30000 -- (-1213.364) (-1211.853) (-1213.120) [-1209.905] * (-1214.572) [-1213.076] (-1213.623) (-1214.098) -- 0:01:37
Average standard deviation of split frequencies: 0.051240
31000 -- (-1215.574) (-1214.101) (-1213.392) [-1215.930] * (-1214.249) (-1212.344) (-1215.911) [-1212.903] -- 0:01:33
32000 -- (-1211.744) (-1214.364) (-1215.766) [-1210.712] * (-1215.087) (-1211.800) [-1211.281] (-1214.391) -- 0:01:30
33000 -- (-1212.443) (-1213.872) (-1215.843) [-1215.736] * (-1212.381) (-1216.229) (-1213.861) [-1211.916] -- 0:01:27
34000 -- [-1212.088] (-1212.893) (-1216.442) (-1211.023) * (-1214.500) (-1213.675) [-1213.792] (-1212.364) -- 0:01:25
35000 -- (-1214.026) (-1215.322) (-1216.733) [-1210.865] * (-1216.427) (-1217.332) [-1210.922] (-1215.820) -- 0:01:22
Average standard deviation of split frequencies: 0.078567
36000 -- (-1214.390) [-1213.422] (-1216.225) (-1210.691) * (-1215.354) (-1214.035) (-1211.837) [-1211.142] -- 0:01:20
37000 -- (-1211.610) (-1214.390) (-1212.696) [-1215.215] * (-1213.892) (-1214.852) [-1212.137] (-1213.884) -- 0:01:18
38000 -- (-1214.930) (-1214.816) (-1214.892) [-1210.748] * (-1218.056) (-1215.234) [-1212.931] (-1213.690) -- 0:01:15
39000 -- (-1216.073) (-1214.388) (-1215.152) [-1213.882] * (-1213.658) (-1213.688) (-1211.504) [-1212.250] -- 0:01:13
40000 -- (-1213.501) (-1217.987) (-1217.099) [-1209.403] * (-1215.398) (-1213.933) (-1211.060) [-1215.338] -- 0:01:12
Average standard deviation of split frequencies: 0.061824
41000 -- (-1213.560) (-1216.491) (-1214.616) [-1212.852] * (-1216.261) (-1215.984) (-1209.550) [-1212.898] -- 0:01:33
42000 -- (-1213.221) (-1214.226) (-1214.562) [-1210.100] * (-1215.472) (-1214.348) [-1212.729] (-1212.494) -- 0:01:31
43000 -- (-1215.028) (-1212.817) (-1212.947) [-1212.413] * (-1214.171) (-1213.993) [-1215.991] (-1213.128) -- 0:01:29
44000 -- (-1214.980) (-1214.058) (-1213.073) [-1213.522] * (-1212.858) (-1217.528) [-1214.078] (-1211.049) -- 0:01:26
45000 -- (-1216.229) (-1216.275) (-1214.699) [-1212.387] * (-1214.683) (-1216.730) [-1210.753] (-1211.174) -- 0:01:24
Average standard deviation of split frequencies: 0.054656
46000 -- (-1213.451) (-1215.643) (-1215.547) [-1209.624] * (-1213.963) (-1217.174) [-1209.690] (-1213.938) -- 0:01:22
47000 -- (-1214.895) (-1215.139) (-1217.116) [-1209.983] * (-1214.389) (-1214.237) [-1210.857] (-1210.544) -- 0:01:21
48000 -- (-1213.604) (-1214.193) (-1217.304) [-1210.746] * (-1213.716) (-1213.380) [-1210.858] (-1215.612) -- 0:01:19
49000 -- (-1219.449) (-1216.280) (-1214.106) [-1209.618] * [-1212.973] (-1214.011) (-1211.052) (-1213.686) -- 0:01:17
50000 -- (-1214.152) (-1213.918) (-1215.187) [-1210.234] * (-1214.613) (-1214.894) [-1210.603] (-1218.200) -- 0:01:16
Average standard deviation of split frequencies: 0.068230
51000 -- (-1218.884) (-1213.259) (-1216.002) [-1217.166] * (-1215.759) (-1215.976) [-1212.935] (-1215.932) -- 0:01:14
52000 -- (-1212.661) (-1214.022) (-1213.129) [-1212.795] * (-1214.219) (-1214.462) [-1213.673] (-1214.132) -- 0:01:12
53000 -- (-1215.934) (-1214.925) (-1220.376) [-1213.282] * (-1215.373) [-1217.439] (-1214.931) (-1217.687) -- 0:01:29
54000 -- (-1216.655) (-1215.891) (-1214.864) [-1216.330] * (-1214.363) (-1214.174) (-1214.268) [-1214.637] -- 0:01:27
55000 -- (-1218.962) (-1213.106) (-1214.382) [-1211.973] * (-1213.576) (-1213.848) [-1216.066] (-1214.873) -- 0:01:25
Average standard deviation of split frequencies: 0.072955
56000 -- (-1215.791) (-1213.677) (-1215.906) [-1214.115] * (-1215.166) [-1215.925] (-1217.274) (-1215.297) -- 0:01:24
57000 -- (-1212.847) (-1213.683) (-1214.067) [-1212.260] * [-1213.758] (-1215.585) (-1217.859) (-1218.941) -- 0:01:22
58000 -- (-1212.805) (-1213.714) (-1212.592) [-1210.532] * [-1214.626] (-1212.605) (-1214.580) (-1213.481) -- 0:01:21
59000 -- (-1213.475) (-1214.006) (-1214.088) [-1210.055] * (-1212.255) (-1214.369) [-1214.544] (-1216.085) -- 0:01:19
60000 -- (-1213.299) (-1219.617) (-1214.614) [-1213.302] * [-1216.961] (-1213.925) (-1216.975) (-1214.494) -- 0:01:18
Average standard deviation of split frequencies: 0.082884
61000 -- (-1215.933) (-1214.142) (-1214.772) [-1213.731] * (-1215.812) (-1213.234) (-1212.391) [-1213.999] -- 0:01:16
62000 -- (-1215.599) (-1213.477) (-1213.858) [-1212.787] * (-1214.150) [-1213.628] (-1214.251) (-1212.759) -- 0:01:15
63000 -- (-1213.982) (-1213.717) (-1216.414) [-1210.008] * (-1216.614) [-1212.701] (-1213.978) (-1215.427) -- 0:01:14
64000 -- (-1218.212) (-1214.002) (-1214.292) [-1211.841] * (-1213.269) [-1215.093] (-1213.523) (-1214.491) -- 0:01:13
65000 -- (-1211.386) (-1213.412) (-1215.618) [-1213.441] * [-1214.628] (-1214.776) (-1213.436) (-1217.218) -- 0:01:11
Average standard deviation of split frequencies: 0.057140
66000 -- (-1215.293) (-1212.804) (-1214.509) [-1213.232] * (-1213.085) [-1213.337] (-1213.494) (-1213.778) -- 0:01:24
67000 -- (-1215.169) (-1216.216) (-1213.639) [-1213.518] * (-1215.586) (-1213.718) [-1214.097] (-1213.381) -- 0:01:23
68000 -- (-1213.364) (-1213.756) (-1214.286) [-1212.695] * (-1215.211) [-1212.854] (-1212.361) (-1214.466) -- 0:01:22
69000 -- (-1214.170) (-1216.701) (-1214.107) [-1212.250] * [-1213.120] (-1213.532) (-1213.039) (-1213.623) -- 0:01:20
70000 -- (-1214.159) (-1215.268) (-1213.425) [-1210.681] * [-1214.329] (-1215.844) (-1215.064) (-1212.696) -- 0:01:19
Average standard deviation of split frequencies: 0.066708
71000 -- (-1215.705) (-1213.986) (-1212.886) [-1211.532] * (-1216.591) (-1212.880) [-1213.112] (-1212.588) -- 0:01:18
72000 -- (-1214.813) (-1214.630) (-1214.909) [-1210.112] * [-1213.694] (-1214.041) (-1214.417) (-1214.709) -- 0:01:17
73000 -- (-1216.773) (-1213.584) (-1215.570) [-1211.896] * [-1216.557] (-1213.552) (-1213.379) (-1217.087) -- 0:01:16
74000 -- (-1215.042) (-1213.119) (-1217.431) [-1218.120] * (-1217.582) [-1216.010] (-1214.429) (-1213.080) -- 0:01:15
75000 -- (-1215.627) (-1215.769) (-1217.294) [-1211.529] * (-1213.731) (-1214.150) (-1216.372) [-1212.775] -- 0:01:14
Average standard deviation of split frequencies: 0.062027
76000 -- (-1217.233) (-1214.346) (-1213.867) [-1211.417] * (-1214.840) (-1217.708) [-1212.684] (-1213.131) -- 0:01:12
77000 -- (-1217.608) (-1213.851) (-1215.178) [-1211.346] * [-1214.322] (-1215.491) (-1214.554) (-1214.781) -- 0:01:23
78000 -- (-1215.361) (-1215.844) (-1214.092) [-1210.754] * (-1214.560) (-1216.904) [-1214.116] (-1214.788) -- 0:01:22
79000 -- (-1213.943) (-1213.466) (-1213.525) [-1209.507] * (-1214.743) (-1214.742) [-1212.828] (-1215.094) -- 0:01:21
80000 -- (-1214.559) (-1213.718) (-1215.933) [-1209.316] * (-1213.661) (-1216.139) (-1213.070) [-1215.113] -- 0:01:20
Average standard deviation of split frequencies: 0.066230
81000 -- (-1214.738) (-1214.649) (-1213.849) [-1210.073] * (-1213.373) [-1215.287] (-1213.398) (-1213.523) -- 0:01:19
82000 -- (-1214.505) (-1216.665) (-1213.474) [-1210.052] * (-1213.894) (-1213.399) [-1213.242] (-1215.758) -- 0:01:18
83000 -- (-1212.954) (-1214.204) (-1214.967) [-1210.611] * (-1215.391) (-1216.070) (-1212.667) [-1213.236] -- 0:01:17
84000 -- (-1214.347) (-1216.104) (-1216.128) [-1213.902] * (-1212.929) [-1212.536] (-1213.859) (-1213.620) -- 0:01:16
85000 -- (-1214.278) (-1217.669) (-1213.318) [-1210.618] * (-1213.358) (-1212.658) (-1215.729) [-1212.908] -- 0:01:15
Average standard deviation of split frequencies: 0.065777
86000 -- (-1216.013) (-1213.517) (-1218.233) [-1210.748] * (-1214.404) [-1213.867] (-1211.936) (-1214.332) -- 0:01:14
87000 -- (-1213.827) (-1214.398) (-1215.780) [-1215.664] * (-1215.122) [-1214.143] (-1214.417) (-1213.831) -- 0:01:13
88000 -- (-1216.139) (-1215.225) (-1213.049) [-1215.462] * [-1212.864] (-1213.448) (-1214.141) (-1213.823) -- 0:01:22
89000 -- (-1214.473) (-1215.228) (-1214.639) [-1212.879] * [-1213.585] (-1215.031) (-1212.898) (-1214.279) -- 0:01:21
90000 -- (-1216.885) (-1215.340) (-1212.978) [-1214.548] * [-1216.110] (-1214.457) (-1214.537) (-1215.584) -- 0:01:20
Average standard deviation of split frequencies: 0.058926
91000 -- (-1213.634) (-1216.940) (-1213.427) [-1212.347] * (-1214.329) (-1216.353) (-1216.559) [-1213.371] -- 0:01:19
92000 -- (-1215.857) (-1218.531) (-1212.535) [-1210.041] * (-1216.003) (-1213.502) [-1215.746] (-1214.122) -- 0:01:18
93000 -- (-1212.845) (-1214.727) (-1212.688) [-1213.256] * (-1216.267) [-1213.532] (-1212.841) (-1213.438) -- 0:01:18
94000 -- (-1214.152) (-1216.874) (-1212.726) [-1211.905] * (-1214.712) (-1214.627) (-1213.890) [-1213.682] -- 0:01:17
95000 -- (-1216.977) [-1214.561] (-1213.089) (-1210.928) * [-1214.088] (-1214.806) (-1216.071) (-1213.980) -- 0:01:16
Average standard deviation of split frequencies: 0.052378
96000 -- (-1214.933) (-1213.696) (-1212.576) [-1212.847] * [-1213.308] (-1217.872) (-1215.337) (-1214.368) -- 0:01:15
97000 -- (-1213.015) (-1215.277) (-1215.714) [-1211.773] * (-1213.456) (-1213.662) [-1213.735] (-1214.436) -- 0:01:14
98000 -- (-1211.998) (-1214.614) (-1214.494) [-1212.103] * [-1213.909] (-1212.751) (-1216.896) (-1214.269) -- 0:01:13
99000 -- (-1214.610) (-1213.658) (-1214.792) [-1212.074] * (-1216.958) [-1213.289] (-1215.497) (-1214.557) -- 0:01:12
100000 -- (-1213.604) (-1213.701) (-1214.586) [-1212.857] * [-1213.744] (-1214.615) (-1213.439) (-1215.054) -- 0:01:21
Average standard deviation of split frequencies: 0.046828
101000 -- (-1216.926) (-1216.040) (-1213.140) [-1213.238] * (-1215.620) (-1214.024) (-1215.795) [-1217.174] -- 0:01:20
102000 -- (-1213.462) (-1216.488) (-1213.089) [-1215.781] * (-1214.871) [-1213.534] (-1215.507) (-1217.998) -- 0:01:19
103000 -- (-1213.352) (-1216.996) (-1212.862) [-1212.642] * (-1214.599) [-1214.164] (-1215.020) (-1215.587) -- 0:01:18
104000 -- (-1213.166) (-1214.087) (-1213.345) [-1214.459] * [-1212.979] (-1213.244) (-1212.522) (-1214.522) -- 0:01:17
105000 -- (-1213.538) (-1214.903) (-1214.020) [-1210.977] * [-1214.845] (-1214.239) (-1220.183) (-1214.496) -- 0:01:16
Average standard deviation of split frequencies: 0.044472
106000 -- (-1216.955) (-1216.054) (-1212.707) [-1211.288] * (-1216.875) (-1217.855) (-1214.100) [-1216.120] -- 0:01:15
107000 -- (-1214.431) (-1215.256) (-1214.939) [-1213.614] * (-1214.915) (-1215.339) (-1213.241) [-1215.719] -- 0:01:15
108000 -- (-1215.325) (-1213.581) (-1216.094) [-1213.216] * [-1213.637] (-1216.050) (-1214.091) (-1213.639) -- 0:01:14
109000 -- (-1215.420) (-1214.599) (-1213.071) [-1213.569] * (-1214.019) [-1213.459] (-1214.851) (-1216.220) -- 0:01:13
110000 -- (-1218.060) (-1212.756) (-1213.281) [-1211.689] * (-1214.378) (-1215.031) [-1214.459] (-1212.460) -- 0:01:12
Average standard deviation of split frequencies: 0.048276
111000 -- (-1212.299) (-1215.123) (-1212.912) [-1213.509] * (-1214.543) (-1214.059) (-1214.935) [-1214.556] -- 0:01:12
112000 -- (-1214.474) (-1217.934) (-1214.858) [-1214.346] * (-1213.628) (-1213.942) (-1213.917) [-1212.632] -- 0:01:11
113000 -- (-1215.780) (-1218.496) [-1214.288] (-1215.648) * (-1214.246) (-1213.135) (-1215.910) [-1213.568] -- 0:01:18
114000 -- (-1214.648) (-1216.783) [-1216.053] (-1215.041) * [-1215.043] (-1215.407) (-1217.611) (-1214.462) -- 0:01:17
115000 -- (-1217.793) (-1213.527) (-1223.400) [-1214.269] * [-1213.945] (-1213.515) (-1215.748) (-1217.522) -- 0:01:16
Average standard deviation of split frequencies: 0.043348
116000 -- [-1213.839] (-1214.019) (-1215.268) (-1217.773) * (-1213.250) [-1213.194] (-1214.043) (-1215.356) -- 0:01:16
117000 -- (-1214.859) [-1213.931] (-1214.591) (-1217.067) * [-1214.047] (-1215.088) (-1213.549) (-1217.754) -- 0:01:15
118000 -- (-1214.223) (-1211.822) (-1213.118) [-1216.229] * [-1213.832] (-1214.426) (-1220.273) (-1214.651) -- 0:01:14
119000 -- (-1214.119) (-1216.197) [-1212.970] (-1213.196) * (-1213.904) (-1214.386) [-1213.493] (-1215.357) -- 0:01:14
120000 -- (-1215.423) (-1213.829) (-1213.797) [-1213.873] * (-1216.188) (-1215.337) (-1213.497) [-1215.981] -- 0:01:13
Average standard deviation of split frequencies: 0.039067
121000 -- (-1216.229) (-1216.124) (-1213.669) [-1215.154] * [-1214.787] (-1213.689) (-1214.695) (-1216.719) -- 0:01:12
122000 -- (-1212.118) [-1213.337] (-1214.500) (-1215.926) * [-1214.205] (-1213.601) (-1215.456) (-1215.755) -- 0:01:11
123000 -- (-1215.972) [-1214.142] (-1219.413) (-1212.778) * [-1216.402] (-1215.026) (-1214.453) (-1216.436) -- 0:01:11
124000 -- (-1212.747) (-1215.020) [-1213.425] (-1213.437) * [-1215.500] (-1213.560) (-1215.624) (-1212.953) -- 0:01:10
125000 -- (-1212.788) (-1218.596) (-1216.046) [-1214.214] * (-1213.287) (-1212.808) (-1214.433) [-1213.939] -- 0:01:10
Average standard deviation of split frequencies: 0.047390
126000 -- [-1212.821] (-1216.156) (-1212.988) (-1221.752) * [-1216.032] (-1216.326) (-1215.126) (-1217.360) -- 0:01:16
127000 -- (-1213.990) [-1216.580] (-1214.995) (-1213.512) * [-1213.384] (-1214.103) (-1213.889) (-1213.571) -- 0:01:15
128000 -- (-1213.726) (-1213.387) (-1214.061) [-1216.471] * [-1214.858] (-1212.917) (-1213.182) (-1214.336) -- 0:01:14
129000 -- (-1215.144) (-1214.407) (-1218.238) [-1214.073] * (-1217.231) (-1213.224) (-1221.881) [-1219.153] -- 0:01:14
130000 -- [-1212.746] (-1213.184) (-1216.063) (-1215.877) * (-1216.495) (-1216.850) (-1217.323) [-1214.916] -- 0:01:13
Average standard deviation of split frequencies: 0.048103
131000 -- (-1217.904) [-1213.936] (-1213.723) (-1214.392) * [-1216.631] (-1215.612) (-1213.483) (-1214.173) -- 0:01:12
132000 -- (-1214.432) (-1212.295) (-1213.167) [-1212.538] * (-1214.225) (-1214.232) (-1214.299) [-1213.814] -- 0:01:12
133000 -- (-1215.382) (-1215.456) [-1212.729] (-1213.257) * (-1216.005) [-1213.831] (-1214.081) (-1215.101) -- 0:01:11
134000 -- (-1215.309) [-1216.337] (-1214.341) (-1214.473) * (-1212.599) [-1216.622] (-1215.446) (-1215.611) -- 0:01:11
135000 -- (-1213.778) (-1214.293) (-1214.545) [-1212.833] * [-1214.719] (-1219.804) (-1212.966) (-1217.596) -- 0:01:10
Average standard deviation of split frequencies: 0.046216
136000 -- (-1213.640) [-1213.562] (-1213.271) (-1212.969) * (-1214.992) (-1215.194) [-1212.537] (-1214.379) -- 0:01:09
137000 -- (-1215.445) [-1214.157] (-1213.628) (-1215.475) * (-1213.860) (-1216.113) [-1213.721] (-1213.539) -- 0:01:09
138000 -- (-1219.583) (-1219.354) [-1215.761] (-1216.890) * (-1218.208) [-1215.826] (-1215.666) (-1214.106) -- 0:01:14
139000 -- (-1212.527) (-1215.197) [-1213.031] (-1213.988) * (-1214.473) (-1214.942) (-1214.711) [-1214.378] -- 0:01:14
140000 -- (-1212.541) [-1213.739] (-1213.855) (-1213.085) * [-1215.707] (-1214.199) (-1213.481) (-1215.257) -- 0:01:13
Average standard deviation of split frequencies: 0.042449
141000 -- [-1213.657] (-1213.628) (-1214.827) (-1213.294) * [-1214.881] (-1215.407) (-1213.799) (-1212.791) -- 0:01:13
142000 -- (-1214.688) (-1214.221) [-1217.761] (-1212.769) * (-1214.701) (-1216.342) [-1216.164] (-1215.505) -- 0:01:12
143000 -- (-1215.235) (-1214.864) [-1213.400] (-1213.161) * (-1218.163) [-1213.006] (-1217.365) (-1214.368) -- 0:01:11
144000 -- (-1215.174) [-1214.244] (-1216.574) (-1212.802) * [-1217.476] (-1214.540) (-1218.487) (-1216.573) -- 0:01:11
145000 -- (-1212.703) (-1213.511) [-1215.349] (-1212.904) * [-1217.817] (-1214.079) (-1213.895) (-1217.189) -- 0:01:10
Average standard deviation of split frequencies: 0.040898
146000 -- [-1212.548] (-1214.546) (-1213.767) (-1213.797) * (-1213.627) (-1215.273) (-1217.001) [-1213.015] -- 0:01:10
147000 -- (-1219.965) (-1214.609) [-1215.576] (-1216.976) * [-1215.398] (-1213.837) (-1215.490) (-1214.142) -- 0:01:09
148000 -- [-1216.452] (-1214.310) (-1218.266) (-1214.706) * (-1215.180) [-1213.088] (-1215.857) (-1216.424) -- 0:01:09
149000 -- (-1214.408) (-1215.310) (-1213.840) [-1215.647] * (-1219.003) (-1215.899) (-1214.504) [-1213.141] -- 0:01:08
150000 -- (-1213.103) (-1214.555) (-1213.133) [-1213.320] * (-1217.138) (-1213.792) [-1215.403] (-1217.533) -- 0:01:08
Average standard deviation of split frequencies: 0.041717
151000 -- [-1213.076] (-1214.214) (-1214.219) (-1212.105) * (-1212.739) (-1215.301) [-1214.277] (-1213.866) -- 0:01:13
152000 -- (-1216.076) (-1213.473) (-1215.991) [-1217.608] * (-1215.317) (-1214.224) (-1213.444) [-1215.808] -- 0:01:12
153000 -- (-1214.014) (-1215.636) (-1214.888) [-1214.934] * [-1213.138] (-1214.238) (-1215.315) (-1215.433) -- 0:01:11
154000 -- [-1212.920] (-1215.674) (-1216.914) (-1217.700) * (-1212.956) [-1216.864] (-1213.297) (-1212.337) -- 0:01:11
155000 -- (-1215.383) [-1214.956] (-1213.944) (-1215.033) * [-1213.345] (-1214.869) (-1215.046) (-1214.291) -- 0:01:10
Average standard deviation of split frequencies: 0.032233
156000 -- (-1215.106) (-1213.594) [-1215.433] (-1213.553) * (-1214.781) (-1213.697) [-1215.933] (-1213.096) -- 0:01:10
157000 -- [-1211.396] (-1213.068) (-1219.780) (-1215.921) * (-1216.385) [-1214.350] (-1215.385) (-1213.208) -- 0:01:09
158000 -- [-1217.232] (-1214.788) (-1218.673) (-1214.908) * (-1214.492) (-1213.279) [-1214.427] (-1217.923) -- 0:01:09
159000 -- [-1210.766] (-1215.431) (-1215.695) (-1213.915) * (-1213.669) [-1215.747] (-1214.257) (-1215.923) -- 0:01:08
160000 -- [-1210.254] (-1217.352) (-1216.806) (-1214.599) * (-1213.775) (-1214.936) [-1215.732] (-1213.710) -- 0:01:08
Average standard deviation of split frequencies: 0.031297
161000 -- [-1212.728] (-1213.493) (-1214.114) (-1220.463) * [-1213.208] (-1219.816) (-1213.525) (-1212.828) -- 0:01:07
162000 -- (-1216.819) (-1213.479) (-1213.466) [-1213.844] * (-1215.817) (-1213.467) (-1214.353) [-1214.678] -- 0:01:07
163000 -- [-1211.866] (-1214.230) (-1215.467) (-1213.983) * (-1213.805) [-1212.946] (-1216.523) (-1214.157) -- 0:01:06
164000 -- [-1212.152] (-1212.436) (-1214.083) (-1213.094) * (-1218.224) (-1213.808) (-1213.847) [-1213.567] -- 0:01:11
165000 -- [-1213.313] (-1216.177) (-1216.580) (-1214.401) * (-1213.732) (-1214.321) (-1212.811) [-1213.967] -- 0:01:10
Average standard deviation of split frequencies: 0.032184
166000 -- [-1214.380] (-1218.305) (-1213.634) (-1214.676) * (-1215.837) (-1212.687) (-1213.312) [-1213.692] -- 0:01:10
167000 -- [-1209.960] (-1214.734) (-1213.306) (-1214.748) * (-1214.825) (-1214.097) (-1212.636) [-1214.272] -- 0:01:09
168000 -- [-1214.003] (-1213.723) (-1216.743) (-1213.980) * (-1213.630) (-1213.404) (-1218.480) [-1213.415] -- 0:01:09
169000 -- [-1212.243] (-1214.369) (-1213.604) (-1214.557) * [-1214.580] (-1215.629) (-1213.903) (-1216.597) -- 0:01:08
170000 -- [-1215.722] (-1212.939) (-1213.263) (-1214.226) * (-1212.906) [-1215.214] (-1214.755) (-1213.146) -- 0:01:08
Average standard deviation of split frequencies: 0.027621
171000 -- [-1210.555] (-1215.178) (-1216.632) (-1213.153) * (-1216.115) (-1217.567) [-1216.026] (-1212.562) -- 0:01:07
172000 -- [-1211.804] (-1216.190) (-1216.289) (-1214.800) * [-1212.968] (-1213.606) (-1221.415) (-1212.934) -- 0:01:07
173000 -- (-1213.162) (-1218.419) (-1216.337) [-1214.988] * (-1212.924) (-1213.964) [-1212.701] (-1213.053) -- 0:01:06
174000 -- [-1212.531] (-1212.276) (-1215.672) (-1217.355) * (-1213.353) (-1217.940) [-1216.353] (-1215.735) -- 0:01:06
175000 -- [-1217.406] (-1215.533) (-1212.991) (-1218.068) * (-1213.198) [-1213.556] (-1215.567) (-1214.435) -- 0:01:06
Average standard deviation of split frequencies: 0.023213
176000 -- [-1215.043] (-1214.029) (-1215.456) (-1213.068) * [-1213.602] (-1214.947) (-1217.441) (-1215.496) -- 0:01:05
177000 -- [-1212.547] (-1213.127) (-1215.988) (-1216.995) * (-1220.803) (-1213.888) (-1213.383) [-1217.142] -- 0:01:09
178000 -- (-1219.056) [-1212.784] (-1214.198) (-1217.695) * (-1214.423) (-1212.939) [-1213.048] (-1220.301) -- 0:01:09
179000 -- (-1217.108) (-1217.231) [-1213.525] (-1216.721) * (-1213.115) (-1213.109) [-1215.360] (-1213.309) -- 0:01:08
180000 -- (-1216.399) (-1213.543) [-1213.114] (-1216.445) * (-1215.144) [-1215.725] (-1217.063) (-1216.119) -- 0:01:08
Average standard deviation of split frequencies: 0.027832
181000 -- [-1213.603] (-1215.192) (-1212.396) (-1214.504) * [-1214.600] (-1216.538) (-1215.748) (-1214.199) -- 0:01:07
182000 -- (-1213.488) (-1217.804) [-1214.391] (-1214.584) * (-1216.146) (-1216.281) [-1213.040] (-1214.551) -- 0:01:07
183000 -- [-1214.843] (-1214.363) (-1215.318) (-1214.802) * (-1212.656) (-1213.110) (-1217.675) [-1213.551] -- 0:01:06
184000 -- (-1214.599) [-1215.065] (-1214.260) (-1214.396) * (-1216.082) (-1214.144) (-1214.923) [-1216.782] -- 0:01:06
185000 -- (-1215.840) (-1212.896) (-1213.665) [-1213.293] * (-1215.682) [-1213.614] (-1218.071) (-1214.071) -- 0:01:06
Average standard deviation of split frequencies: 0.025344
186000 -- [-1213.071] (-1217.959) (-1215.549) (-1217.131) * (-1213.702) (-1213.570) (-1213.917) [-1213.101] -- 0:01:05
187000 -- (-1213.193) (-1212.915) (-1212.806) [-1215.099] * (-1212.767) (-1215.076) (-1222.059) [-1215.624] -- 0:01:05
188000 -- (-1217.555) (-1213.350) (-1214.743) [-1215.296] * (-1216.240) [-1214.818] (-1216.533) (-1214.914) -- 0:01:04
189000 -- [-1214.763] (-1213.453) (-1216.775) (-1215.019) * (-1213.239) (-1214.193) [-1215.646] (-1213.459) -- 0:01:04
190000 -- [-1213.946] (-1213.836) (-1213.296) (-1214.578) * (-1215.711) [-1212.077] (-1216.332) (-1213.630) -- 0:01:08
Average standard deviation of split frequencies: 0.028021
191000 -- (-1213.079) (-1213.503) [-1213.279] (-1214.947) * [-1216.238] (-1213.871) (-1213.543) (-1215.076) -- 0:01:07
192000 -- [-1214.083] (-1213.167) (-1216.411) (-1213.205) * (-1215.129) (-1218.544) (-1218.168) [-1213.073] -- 0:01:07
193000 -- (-1216.967) (-1212.996) [-1212.895] (-1215.290) * (-1213.021) (-1214.375) [-1211.987] (-1214.326) -- 0:01:06
194000 -- (-1215.667) (-1213.922) [-1215.108] (-1215.574) * (-1216.643) (-1216.813) (-1216.328) [-1215.203] -- 0:01:06
195000 -- (-1212.775) (-1212.865) [-1213.643] (-1216.463) * (-1214.583) [-1214.179] (-1214.989) (-1215.945) -- 0:01:06
Average standard deviation of split frequencies: 0.024051
196000 -- (-1213.131) (-1212.408) [-1213.656] (-1218.367) * (-1214.228) (-1215.771) (-1214.065) [-1215.784] -- 0:01:05
197000 -- (-1214.761) (-1213.898) [-1212.929] (-1213.714) * (-1212.828) [-1214.088] (-1216.439) (-1213.851) -- 0:01:05
198000 -- (-1213.336) [-1213.988] (-1213.638) (-1214.835) * (-1213.093) (-1216.805) (-1215.892) [-1212.880] -- 0:01:04
199000 -- (-1213.910) (-1214.608) (-1213.514) [-1218.610] * (-1213.845) (-1215.168) [-1216.448] (-1216.905) -- 0:01:04
200000 -- (-1217.689) (-1214.609) (-1212.727) [-1212.620] * (-1214.226) (-1215.931) (-1215.677) [-1215.813] -- 0:01:04
Average standard deviation of split frequencies: 0.021926
201000 -- (-1216.928) (-1214.069) [-1216.184] (-1213.494) * [-1212.874] (-1220.051) (-1216.820) (-1213.637) -- 0:01:03
202000 -- [-1216.965] (-1214.302) (-1215.013) (-1213.725) * (-1214.463) (-1213.448) [-1215.758] (-1214.733) -- 0:01:07
203000 -- (-1215.798) (-1218.128) [-1213.674] (-1212.622) * (-1218.883) [-1213.739] (-1212.891) (-1216.194) -- 0:01:06
204000 -- (-1215.632) (-1216.324) [-1214.574] (-1216.284) * (-1217.336) (-1214.901) (-1214.584) [-1213.311] -- 0:01:06
205000 -- [-1213.171] (-1214.260) (-1214.710) (-1214.803) * (-1214.155) (-1212.919) [-1214.504] (-1214.070) -- 0:01:05
Average standard deviation of split frequencies: 0.016781
206000 -- (-1214.403) (-1214.078) [-1214.281] (-1214.619) * (-1213.281) [-1212.874] (-1213.279) (-1214.374) -- 0:01:05
207000 -- [-1217.377] (-1213.309) (-1212.915) (-1212.846) * (-1214.137) (-1212.971) (-1215.350) [-1214.879] -- 0:01:05
208000 -- (-1215.700) (-1213.290) [-1213.187] (-1215.353) * (-1214.295) (-1213.710) (-1215.776) [-1213.107] -- 0:01:04
209000 -- (-1215.215) (-1212.994) [-1214.818] (-1213.172) * (-1216.850) [-1213.713] (-1213.387) (-1213.688) -- 0:01:04
210000 -- (-1215.328) [-1215.052] (-1214.270) (-1214.940) * [-1214.227] (-1216.324) (-1214.962) (-1213.648) -- 0:01:03
Average standard deviation of split frequencies: 0.014918
211000 -- (-1220.366) (-1215.442) [-1214.756] (-1216.318) * (-1213.677) (-1217.402) (-1214.190) [-1212.791] -- 0:01:03
212000 -- (-1214.100) [-1215.364] (-1219.623) (-1212.808) * [-1213.907] (-1215.888) (-1214.734) (-1212.343) -- 0:01:03
213000 -- (-1216.145) (-1214.612) (-1214.074) [-1213.129] * (-1212.890) [-1214.431] (-1216.625) (-1214.610) -- 0:01:02
214000 -- (-1214.293) (-1213.422) (-1212.766) [-1212.937] * (-1214.839) (-1214.374) [-1216.374] (-1216.413) -- 0:01:06
215000 -- (-1217.898) (-1214.405) [-1216.615] (-1218.484) * [-1215.046] (-1214.823) (-1213.449) (-1215.770) -- 0:01:05
Average standard deviation of split frequencies: 0.011640
216000 -- (-1216.231) (-1214.227) (-1215.183) [-1214.535] * [-1213.218] (-1213.821) (-1216.511) (-1217.271) -- 0:01:05
217000 -- (-1215.213) (-1218.182) [-1214.850] (-1215.658) * (-1214.192) [-1213.125] (-1216.377) (-1215.538) -- 0:01:04
218000 -- (-1216.958) (-1215.353) (-1217.001) [-1212.756] * [-1215.875] (-1217.313) (-1215.087) (-1214.703) -- 0:01:04
219000 -- (-1214.326) (-1217.566) (-1213.908) [-1210.228] * (-1213.534) [-1216.666] (-1213.015) (-1213.442) -- 0:01:04
220000 -- [-1215.701] (-1213.117) (-1217.231) (-1215.502) * (-1216.342) (-1218.895) (-1215.707) [-1215.148] -- 0:01:03
Average standard deviation of split frequencies: 0.011393
221000 -- [-1214.757] (-1214.077) (-1214.594) (-1215.383) * [-1212.834] (-1213.738) (-1216.953) (-1217.885) -- 0:01:03
222000 -- (-1213.319) (-1218.810) (-1214.045) [-1215.508] * (-1214.598) [-1214.647] (-1214.424) (-1213.729) -- 0:01:03
223000 -- (-1212.615) [-1216.525] (-1215.130) (-1217.005) * (-1214.765) [-1213.391] (-1213.207) (-1213.478) -- 0:01:02
224000 -- (-1213.712) (-1222.725) (-1213.552) [-1215.550] * (-1215.326) [-1213.391] (-1214.363) (-1214.279) -- 0:01:02
225000 -- (-1217.486) [-1213.600] (-1216.679) (-1215.197) * [-1216.461] (-1214.614) (-1214.368) (-1215.548) -- 0:01:02
Average standard deviation of split frequencies: 0.008343
226000 -- [-1215.455] (-1215.095) (-1216.402) (-1214.170) * [-1215.845] (-1213.936) (-1213.178) (-1212.730) -- 0:01:01
227000 -- (-1213.765) (-1221.078) [-1213.747] (-1213.714) * (-1213.714) [-1211.959] (-1215.990) (-1213.588) -- 0:01:04
228000 -- (-1214.073) (-1215.936) (-1220.601) [-1219.965] * (-1214.198) [-1212.190] (-1215.023) (-1214.148) -- 0:01:04
229000 -- (-1213.779) (-1216.502) [-1212.866] (-1215.440) * (-1213.866) [-1214.734] (-1218.407) (-1215.710) -- 0:01:03
230000 -- (-1214.807) (-1214.486) [-1213.270] (-1218.907) * (-1215.704) [-1211.850] (-1215.531) (-1218.111) -- 0:01:03
Average standard deviation of split frequencies: 0.005450
231000 -- (-1215.434) (-1214.921) [-1213.390] (-1215.641) * (-1214.956) [-1211.329] (-1215.080) (-1213.020) -- 0:01:03
232000 -- (-1214.666) (-1217.670) (-1214.301) [-1215.557] * (-1216.111) [-1210.547] (-1215.519) (-1213.894) -- 0:01:02
233000 -- (-1213.109) [-1218.380] (-1214.261) (-1213.740) * (-1214.009) [-1211.174] (-1214.435) (-1213.526) -- 0:01:02
234000 -- (-1212.583) (-1214.242) [-1214.077] (-1213.865) * (-1215.657) [-1210.301] (-1214.292) (-1216.842) -- 0:01:02
235000 -- (-1214.253) [-1214.440] (-1213.542) (-1213.758) * (-1214.300) [-1213.786] (-1215.430) (-1216.611) -- 0:01:01
Average standard deviation of split frequencies: 0.003995
236000 -- (-1216.964) [-1214.170] (-1212.729) (-1214.579) * (-1218.377) [-1211.899] (-1215.286) (-1213.638) -- 0:01:01
237000 -- (-1217.071) (-1217.354) [-1214.566] (-1214.189) * (-1217.502) [-1210.618] (-1212.926) (-1216.904) -- 0:01:01
238000 -- (-1215.039) (-1214.874) [-1212.589] (-1213.916) * (-1212.840) [-1210.133] (-1215.577) (-1220.268) -- 0:01:00
239000 -- (-1216.118) (-1213.672) (-1214.094) [-1213.931] * (-1213.257) (-1210.891) (-1216.183) [-1213.900] -- 0:01:00
240000 -- [-1215.163] (-1214.285) (-1213.957) (-1214.503) * (-1213.652) [-1210.663] (-1215.765) (-1215.053) -- 0:01:03
Average standard deviation of split frequencies: 0.006529
241000 -- [-1214.218] (-1215.068) (-1213.585) (-1217.048) * (-1216.319) [-1211.646] (-1214.864) (-1213.815) -- 0:01:02
242000 -- [-1219.281] (-1216.648) (-1215.796) (-1216.476) * (-1214.494) [-1211.395] (-1215.293) (-1213.998) -- 0:01:02
243000 -- (-1213.573) (-1214.464) [-1216.875] (-1214.476) * (-1212.985) [-1211.378] (-1212.850) (-1215.000) -- 0:01:02
244000 -- [-1213.946] (-1213.878) (-1213.910) (-1214.450) * (-1212.734) [-1213.357] (-1216.732) (-1214.231) -- 0:01:01
245000 -- (-1214.992) (-1215.853) [-1213.898] (-1212.800) * (-1212.754) [-1210.496] (-1215.725) (-1214.755) -- 0:01:01
Average standard deviation of split frequencies: 0.003833
246000 -- (-1214.127) [-1212.503] (-1215.515) (-1216.057) * (-1213.481) (-1214.804) (-1213.177) [-1213.935] -- 0:01:01
247000 -- [-1213.064] (-1219.244) (-1219.136) (-1218.569) * (-1212.942) (-1214.026) [-1214.044] (-1216.174) -- 0:01:00
248000 -- (-1214.190) (-1215.842) [-1216.241] (-1214.735) * (-1212.800) [-1214.794] (-1213.520) (-1215.405) -- 0:01:00
249000 -- (-1215.463) (-1217.010) (-1215.417) [-1214.226] * (-1214.284) (-1218.324) (-1214.157) [-1213.073] -- 0:01:00
250000 -- (-1213.789) (-1218.296) [-1213.376] (-1213.601) * [-1214.827] (-1212.496) (-1214.141) (-1213.023) -- 0:01:00
Average standard deviation of split frequencies: 0.005015
251000 -- (-1212.557) (-1213.856) [-1213.578] (-1213.445) * (-1214.945) (-1213.375) [-1213.023] (-1215.284) -- 0:00:59
252000 -- (-1213.001) (-1214.152) [-1212.979] (-1213.369) * (-1213.865) (-1214.445) (-1214.681) [-1213.964] -- 0:01:02
253000 -- [-1212.524] (-1215.114) (-1214.609) (-1216.085) * [-1216.483] (-1213.128) (-1219.347) (-1213.014) -- 0:01:02
254000 -- (-1215.192) (-1213.026) [-1214.677] (-1213.458) * (-1217.692) (-1215.947) (-1213.259) [-1213.321] -- 0:01:01
255000 -- (-1213.853) [-1213.332] (-1215.468) (-1213.924) * (-1214.443) (-1214.222) [-1213.675] (-1214.278) -- 0:01:01
Average standard deviation of split frequencies: 0.007366
256000 -- (-1215.649) (-1214.191) (-1213.706) [-1215.583] * (-1213.441) (-1212.778) (-1214.321) [-1214.224] -- 0:01:01
257000 -- (-1213.498) (-1216.125) (-1213.434) [-1213.036] * (-1217.290) [-1214.303] (-1221.579) (-1216.453) -- 0:01:00
258000 -- (-1212.726) [-1214.199] (-1213.988) (-1216.312) * (-1215.174) (-1215.058) (-1214.100) [-1213.700] -- 0:01:00
259000 -- (-1213.431) (-1212.685) [-1214.456] (-1213.997) * [-1212.521] (-1214.025) (-1214.002) (-1213.558) -- 0:01:00
260000 -- (-1213.294) [-1215.311] (-1214.171) (-1213.135) * (-1214.369) (-1214.984) [-1212.864] (-1214.918) -- 0:00:59
Average standard deviation of split frequencies: 0.009645
261000 -- (-1212.843) (-1213.507) (-1216.050) [-1212.591] * (-1213.780) [-1214.667] (-1215.141) (-1214.064) -- 0:00:59
262000 -- [-1211.406] (-1213.464) (-1212.715) (-1212.635) * (-1214.040) [-1214.030] (-1217.770) (-1213.913) -- 0:00:59
263000 -- [-1213.615] (-1214.456) (-1215.035) (-1214.605) * [-1216.452] (-1214.796) (-1216.417) (-1214.016) -- 0:00:58
264000 -- [-1213.158] (-1212.854) (-1214.731) (-1216.153) * [-1213.765] (-1213.007) (-1214.317) (-1212.797) -- 0:00:58
265000 -- (-1216.968) (-1214.908) [-1215.103] (-1213.794) * (-1214.376) (-1213.809) [-1212.677] (-1214.861) -- 0:01:01
Average standard deviation of split frequencies: 0.007089
266000 -- [-1213.570] (-1214.703) (-1213.734) (-1214.290) * (-1213.243) (-1213.769) [-1215.928] (-1213.615) -- 0:01:00
267000 -- (-1214.389) (-1213.776) (-1214.019) [-1212.831] * (-1213.749) (-1213.186) (-1213.342) [-1213.253] -- 0:01:00
268000 -- [-1213.497] (-1217.736) (-1214.467) (-1213.766) * (-1216.936) [-1213.237] (-1214.077) (-1215.394) -- 0:01:00
269000 -- (-1213.552) (-1215.922) [-1213.966] (-1215.619) * [-1217.252] (-1214.227) (-1219.257) (-1215.845) -- 0:00:59
270000 -- (-1214.877) [-1211.174] (-1216.250) (-1213.264) * (-1214.394) (-1213.603) (-1213.857) [-1217.624] -- 0:00:59
Average standard deviation of split frequencies: 0.006967
271000 -- [-1214.522] (-1215.794) (-1215.415) (-1214.608) * (-1214.881) (-1214.456) (-1215.075) [-1210.223] -- 0:00:59
272000 -- (-1214.206) (-1215.348) (-1214.383) [-1214.076] * (-1214.881) (-1215.576) [-1216.336] (-1213.783) -- 0:00:58
273000 -- [-1215.856] (-1214.088) (-1216.681) (-1213.603) * [-1212.803] (-1216.135) (-1213.868) (-1215.010) -- 0:00:58
274000 -- [-1215.341] (-1213.329) (-1212.777) (-1214.998) * [-1215.472] (-1216.643) (-1214.115) (-1216.033) -- 0:00:58
275000 -- [-1213.581] (-1213.281) (-1213.259) (-1221.144) * [-1214.284] (-1213.679) (-1213.070) (-1213.181) -- 0:00:58
Average standard deviation of split frequencies: 0.006832
276000 -- (-1214.014) (-1212.823) (-1213.240) [-1215.032] * (-1214.603) (-1213.247) [-1214.178] (-1214.273) -- 0:00:57
277000 -- [-1214.210] (-1213.343) (-1213.352) (-1213.444) * (-1213.154) [-1214.573] (-1214.999) (-1215.434) -- 0:00:57
278000 -- (-1216.128) (-1214.680) [-1213.154] (-1213.404) * [-1215.217] (-1213.104) (-1215.350) (-1214.169) -- 0:00:59
279000 -- (-1214.315) (-1212.434) [-1214.085] (-1216.585) * (-1214.643) (-1212.977) (-1216.462) [-1218.492] -- 0:00:59
280000 -- (-1213.529) (-1214.261) [-1216.806] (-1214.389) * (-1212.942) [-1213.586] (-1215.290) (-1214.715) -- 0:00:59
Average standard deviation of split frequencies: 0.002239
281000 -- (-1213.949) (-1214.140) (-1215.595) [-1212.900] * (-1212.877) (-1214.559) (-1215.153) [-1215.416] -- 0:00:58
282000 -- (-1216.495) (-1213.407) [-1215.962] (-1217.373) * (-1218.818) (-1216.622) [-1213.439] (-1218.025) -- 0:00:58
283000 -- [-1213.689] (-1214.338) (-1212.736) (-1216.378) * (-1212.745) (-1214.327) [-1215.747] (-1213.263) -- 0:00:58
284000 -- (-1214.515) (-1213.798) [-1213.881] (-1213.882) * (-1214.972) (-1216.348) [-1213.034] (-1212.767) -- 0:00:57
285000 -- (-1213.659) (-1214.343) (-1216.072) [-1213.246] * (-1214.242) [-1215.194] (-1213.177) (-1213.512) -- 0:00:57
Average standard deviation of split frequencies: 0.003297
286000 -- (-1220.849) (-1215.373) [-1215.551] (-1214.185) * [-1213.666] (-1219.880) (-1213.709) (-1216.840) -- 0:00:57
287000 -- (-1215.042) (-1213.924) (-1215.340) [-1214.587] * [-1213.754] (-1213.470) (-1213.996) (-1214.475) -- 0:00:57
288000 -- [-1214.678] (-1215.817) (-1215.263) (-1215.406) * (-1214.108) (-1212.733) [-1213.714] (-1217.116) -- 0:00:56
289000 -- [-1213.612] (-1214.022) (-1214.236) (-1216.863) * [-1213.072] (-1215.966) (-1220.887) (-1214.385) -- 0:00:56
290000 -- (-1216.038) (-1214.629) (-1214.222) [-1213.226] * (-1215.908) [-1214.488] (-1215.022) (-1213.690) -- 0:00:58
Average standard deviation of split frequencies: 0.003244
291000 -- (-1214.742) (-1213.542) (-1214.123) [-1212.882] * (-1212.497) (-1213.530) [-1213.044] (-1214.144) -- 0:00:58
292000 -- (-1213.633) [-1213.062] (-1215.400) (-1214.243) * [-1213.680] (-1214.260) (-1214.312) (-1213.703) -- 0:00:58
293000 -- [-1216.020] (-1213.202) (-1212.308) (-1217.295) * (-1213.509) (-1214.735) (-1214.492) [-1216.195] -- 0:00:57
294000 -- (-1216.759) (-1213.501) (-1213.890) [-1216.199] * (-1216.898) (-1214.183) [-1213.468] (-1213.563) -- 0:00:57
295000 -- (-1214.670) [-1213.073] (-1214.373) (-1214.776) * (-1217.842) (-1214.556) [-1216.605] (-1215.290) -- 0:00:57
Average standard deviation of split frequencies: 0.005309
296000 -- [-1213.030] (-1213.857) (-1218.788) (-1217.559) * (-1215.032) (-1216.090) (-1214.210) [-1213.549] -- 0:00:57
297000 -- (-1213.707) [-1214.558] (-1217.497) (-1213.776) * (-1215.150) (-1215.484) (-1214.040) [-1214.079] -- 0:00:56
298000 -- (-1214.512) [-1214.031] (-1214.414) (-1214.711) * (-1212.966) (-1212.754) [-1213.914] (-1212.949) -- 0:00:56
299000 -- [-1216.396] (-1215.714) (-1214.124) (-1217.720) * (-1213.816) (-1214.872) [-1218.346] (-1214.035) -- 0:00:56
300000 -- [-1214.515] (-1215.303) (-1214.746) (-1215.164) * (-1217.228) [-1213.644] (-1218.111) (-1215.144) -- 0:00:56
Average standard deviation of split frequencies: 0.003136
301000 -- (-1214.769) (-1212.172) [-1214.468] (-1215.637) * (-1216.221) (-1213.834) (-1213.758) [-1213.372] -- 0:00:55
302000 -- [-1216.361] (-1213.464) (-1217.125) (-1219.499) * (-1213.281) [-1214.068] (-1214.286) (-1213.834) -- 0:00:55
303000 -- (-1216.770) (-1215.350) (-1213.870) [-1213.173] * (-1213.145) [-1213.772] (-1215.033) (-1216.442) -- 0:00:55
304000 -- (-1215.451) (-1213.718) (-1216.170) [-1214.571] * (-1214.314) [-1214.324] (-1213.705) (-1213.424) -- 0:00:57
305000 -- (-1217.973) (-1216.077) (-1214.287) [-1216.246] * (-1213.458) [-1213.704] (-1213.783) (-1219.822) -- 0:00:56
Average standard deviation of split frequencies: 0.003081
306000 -- (-1215.265) (-1214.673) [-1216.242] (-1213.715) * (-1216.680) [-1213.401] (-1215.290) (-1215.451) -- 0:00:56
307000 -- [-1215.136] (-1219.003) (-1216.800) (-1215.116) * [-1213.237] (-1214.437) (-1216.548) (-1217.308) -- 0:00:56
308000 -- (-1212.659) [-1212.732] (-1219.330) (-1214.909) * (-1213.202) (-1212.601) (-1214.217) [-1213.198] -- 0:00:56
309000 -- (-1213.136) [-1213.582] (-1212.661) (-1216.949) * [-1210.731] (-1215.636) (-1214.475) (-1214.798) -- 0:00:55
310000 -- (-1213.990) [-1216.163] (-1216.224) (-1216.066) * [-1213.971] (-1219.194) (-1215.122) (-1214.245) -- 0:00:55
Average standard deviation of split frequencies: 0.004046
311000 -- [-1218.025] (-1216.214) (-1214.544) (-1213.483) * (-1215.130) [-1213.694] (-1215.017) (-1213.946) -- 0:00:55
312000 -- (-1213.566) [-1215.278] (-1214.808) (-1215.671) * [-1213.526] (-1213.319) (-1214.387) (-1213.432) -- 0:00:55
313000 -- (-1213.518) (-1215.421) [-1214.490] (-1217.643) * (-1215.720) (-1214.121) (-1218.909) [-1213.905] -- 0:00:54
314000 -- [-1214.087] (-1212.850) (-1213.851) (-1217.392) * (-1215.848) [-1215.214] (-1214.396) (-1216.449) -- 0:00:54
315000 -- (-1213.428) (-1213.636) [-1216.520] (-1216.248) * (-1214.447) (-1216.405) [-1217.559] (-1213.425) -- 0:00:54
Average standard deviation of split frequencies: 0.006962
316000 -- (-1213.971) [-1213.370] (-1213.591) (-1213.900) * (-1213.006) (-1215.790) [-1212.076] (-1214.884) -- 0:00:54
317000 -- (-1215.886) [-1212.784] (-1214.916) (-1214.032) * (-1218.238) (-1214.818) [-1212.986] (-1216.495) -- 0:00:56
318000 -- (-1217.919) [-1212.973] (-1213.981) (-1214.430) * (-1215.253) (-1214.754) [-1210.952] (-1216.481) -- 0:00:55
319000 -- (-1215.076) (-1214.658) [-1212.826] (-1213.164) * (-1213.296) (-1213.449) [-1211.058] (-1213.805) -- 0:00:55
320000 -- (-1217.129) [-1213.751] (-1218.906) (-1214.080) * (-1216.714) (-1214.717) [-1211.871] (-1218.292) -- 0:00:55
Average standard deviation of split frequencies: 0.009801
321000 -- [-1213.384] (-1213.377) (-1213.450) (-1213.027) * (-1214.959) (-1215.618) [-1210.902] (-1217.976) -- 0:00:54
322000 -- (-1213.784) [-1214.609] (-1217.983) (-1213.280) * (-1214.352) (-1215.379) [-1209.686] (-1214.386) -- 0:00:54
323000 -- (-1215.093) (-1218.968) (-1213.262) [-1214.141] * (-1214.888) (-1214.730) [-1212.037] (-1214.045) -- 0:00:54
324000 -- [-1215.326] (-1215.388) (-1213.122) (-1218.770) * (-1213.209) (-1216.722) [-1210.444] (-1215.269) -- 0:00:54
325000 -- (-1213.606) (-1213.309) (-1216.323) [-1213.335] * (-1215.232) (-1215.991) [-1210.919] (-1215.325) -- 0:00:54
Average standard deviation of split frequencies: 0.002892
326000 -- (-1213.623) (-1213.313) [-1214.116] (-1213.575) * (-1218.100) (-1216.210) [-1212.404] (-1215.945) -- 0:00:53
327000 -- [-1213.159] (-1215.275) (-1215.536) (-1213.205) * (-1217.074) (-1214.815) [-1211.674] (-1217.463) -- 0:00:53
328000 -- (-1213.532) (-1212.894) [-1213.183] (-1213.318) * (-1215.026) (-1216.962) [-1212.948] (-1212.904) -- 0:00:53
329000 -- (-1215.024) (-1214.185) (-1213.086) [-1217.091] * (-1216.849) (-1216.520) [-1211.727] (-1217.972) -- 0:00:55
330000 -- [-1215.345] (-1214.243) (-1216.264) (-1213.308) * (-1217.061) (-1214.718) [-1210.850] (-1213.167) -- 0:00:54
Average standard deviation of split frequencies: 0.002851
331000 -- [-1213.878] (-1215.070) (-1214.559) (-1216.481) * (-1214.611) (-1221.435) [-1211.585] (-1212.498) -- 0:00:54
332000 -- (-1213.966) [-1215.042] (-1214.950) (-1215.502) * (-1213.220) (-1214.423) [-1212.188] (-1214.768) -- 0:00:54
333000 -- (-1216.389) [-1214.346] (-1213.604) (-1218.033) * (-1213.886) (-1216.163) [-1211.032] (-1213.820) -- 0:00:54
334000 -- (-1216.226) (-1215.091) [-1214.628] (-1219.619) * (-1214.206) (-1215.345) [-1211.006] (-1215.475) -- 0:00:53
335000 -- (-1214.825) (-1216.880) [-1214.304] (-1214.872) * (-1216.415) (-1213.494) [-1213.096] (-1216.507) -- 0:00:53
Average standard deviation of split frequencies: 0.002806
336000 -- (-1214.231) (-1212.809) [-1221.574] (-1217.314) * (-1213.814) (-1215.131) [-1211.270] (-1215.203) -- 0:00:53
337000 -- (-1213.425) [-1213.675] (-1218.308) (-1214.500) * (-1215.331) (-1213.847) [-1209.667] (-1215.250) -- 0:00:53
338000 -- (-1213.409) [-1214.203] (-1214.569) (-1217.412) * (-1213.853) (-1214.278) [-1212.499] (-1213.276) -- 0:00:52
339000 -- (-1213.552) (-1216.198) [-1215.832] (-1214.032) * (-1216.504) (-1213.859) [-1211.549] (-1216.809) -- 0:00:52
340000 -- (-1218.366) [-1217.435] (-1214.354) (-1214.300) * [-1214.809] (-1214.173) (-1217.596) (-1213.702) -- 0:00:52
Average standard deviation of split frequencies: 0.000923
341000 -- (-1215.438) [-1213.204] (-1214.376) (-1213.117) * (-1214.416) [-1213.800] (-1216.204) (-1214.568) -- 0:00:52
342000 -- (-1213.617) (-1214.453) (-1214.021) [-1212.773] * (-1214.913) (-1218.490) [-1215.731] (-1213.810) -- 0:00:53
343000 -- (-1214.212) (-1215.853) (-1215.278) [-1213.105] * (-1215.693) [-1215.459] (-1216.244) (-1218.130) -- 0:00:53
344000 -- [-1215.204] (-1220.055) (-1212.534) (-1214.750) * (-1213.661) [-1212.476] (-1215.227) (-1216.061) -- 0:00:53
345000 -- (-1213.727) (-1218.192) (-1218.085) [-1214.744] * [-1214.390] (-1214.042) (-1213.949) (-1214.705) -- 0:00:53
Average standard deviation of split frequencies: 0.001817
346000 -- [-1211.979] (-1217.668) (-1214.434) (-1214.601) * (-1215.486) (-1214.486) (-1218.506) [-1212.642] -- 0:00:52
347000 -- (-1215.786) (-1213.044) [-1214.940] (-1215.993) * [-1214.895] (-1213.243) (-1214.186) (-1215.680) -- 0:00:52
348000 -- (-1215.831) (-1213.425) [-1214.383] (-1213.812) * (-1216.809) [-1212.656] (-1213.740) (-1213.013) -- 0:00:52
349000 -- [-1215.907] (-1212.977) (-1213.913) (-1214.198) * (-1216.532) (-1213.753) [-1215.223] (-1213.317) -- 0:00:52
350000 -- [-1213.462] (-1212.916) (-1215.713) (-1212.859) * (-1214.231) (-1214.894) [-1215.842] (-1212.727) -- 0:00:52
Average standard deviation of split frequencies: 0.002689
351000 -- (-1213.837) (-1218.522) (-1213.662) [-1214.933] * [-1213.675] (-1213.016) (-1214.890) (-1215.210) -- 0:00:51
352000 -- [-1214.154] (-1214.322) (-1213.056) (-1216.090) * (-1213.849) (-1215.691) [-1214.070] (-1215.293) -- 0:00:51
353000 -- (-1213.641) (-1215.428) (-1218.411) [-1214.348] * (-1215.098) (-1213.573) (-1212.357) [-1213.442] -- 0:00:53
354000 -- (-1213.990) (-1214.033) [-1216.492] (-1218.809) * [-1215.942] (-1213.645) (-1215.925) (-1213.169) -- 0:00:52
355000 -- (-1215.288) (-1215.285) [-1213.526] (-1213.360) * (-1213.077) (-1213.406) [-1212.430] (-1213.394) -- 0:00:52
Average standard deviation of split frequencies: 0.006179
356000 -- [-1213.042] (-1216.259) (-1213.340) (-1213.201) * [-1214.057] (-1214.997) (-1216.787) (-1214.490) -- 0:00:52
357000 -- (-1214.911) (-1214.886) (-1217.070) [-1212.608] * [-1213.958] (-1214.808) (-1214.349) (-1223.619) -- 0:00:52
358000 -- [-1215.972] (-1213.314) (-1213.431) (-1214.001) * (-1212.679) (-1213.997) [-1214.456] (-1216.064) -- 0:00:52
359000 -- (-1214.425) (-1214.668) [-1213.621] (-1214.399) * (-1217.116) (-1215.841) (-1214.137) [-1213.289] -- 0:00:51
360000 -- [-1214.050] (-1214.422) (-1214.889) (-1215.076) * (-1212.463) (-1219.921) (-1214.111) [-1212.697] -- 0:00:51
Average standard deviation of split frequencies: 0.010456
361000 -- (-1214.144) (-1213.923) [-1212.889] (-1213.031) * (-1217.419) (-1214.175) (-1216.370) [-1214.799] -- 0:00:51
362000 -- [-1212.885] (-1215.962) (-1214.338) (-1215.345) * [-1212.839] (-1214.628) (-1214.856) (-1213.407) -- 0:00:51
363000 -- [-1216.028] (-1213.152) (-1214.906) (-1222.293) * (-1215.312) (-1212.950) (-1215.052) [-1217.119] -- 0:00:50
364000 -- (-1218.419) [-1213.262] (-1213.201) (-1215.511) * [-1213.748] (-1214.715) (-1213.669) (-1215.254) -- 0:00:50
365000 -- [-1214.525] (-1213.837) (-1213.044) (-1215.203) * (-1213.255) (-1213.951) (-1220.212) [-1213.105] -- 0:00:50
Average standard deviation of split frequencies: 0.010304
366000 -- [-1214.404] (-1213.654) (-1212.638) (-1213.779) * [-1215.077] (-1215.246) (-1215.765) (-1217.976) -- 0:00:51
367000 -- (-1214.462) [-1214.518] (-1213.152) (-1214.036) * (-1213.248) (-1213.232) (-1214.354) [-1215.904] -- 0:00:51
368000 -- [-1213.582] (-1214.363) (-1218.163) (-1214.640) * (-1212.759) (-1217.763) (-1215.361) [-1213.100] -- 0:00:51
369000 -- (-1216.560) (-1213.899) (-1215.048) [-1216.511] * (-1215.867) [-1213.268] (-1215.100) (-1220.590) -- 0:00:51
370000 -- (-1215.023) [-1212.880] (-1217.331) (-1217.264) * (-1213.100) [-1212.334] (-1213.616) (-1213.207) -- 0:00:51
Average standard deviation of split frequencies: 0.010174
371000 -- (-1215.582) (-1216.038) [-1215.195] (-1217.767) * (-1217.396) [-1215.063] (-1218.354) (-1216.506) -- 0:00:50
372000 -- (-1213.547) (-1215.373) [-1215.056] (-1215.427) * [-1214.119] (-1215.068) (-1214.733) (-1217.232) -- 0:00:50
373000 -- (-1214.067) (-1213.176) (-1214.479) [-1214.164] * [-1215.297] (-1213.721) (-1217.251) (-1214.329) -- 0:00:50
374000 -- [-1216.783] (-1216.604) (-1213.328) (-1213.603) * (-1213.878) [-1213.488] (-1214.571) (-1213.144) -- 0:00:50
375000 -- (-1216.883) (-1213.119) (-1218.110) [-1216.413] * (-1212.711) (-1216.069) (-1216.813) [-1214.161] -- 0:00:50
Average standard deviation of split frequencies: 0.007522
376000 -- [-1214.513] (-1212.788) (-1217.832) (-1215.149) * (-1213.864) [-1214.874] (-1218.143) (-1213.146) -- 0:00:49
377000 -- (-1212.797) (-1215.115) (-1214.585) [-1213.186] * (-1214.938) [-1213.087] (-1213.434) (-1213.010) -- 0:00:49
378000 -- (-1214.173) (-1213.725) (-1213.492) [-1214.680] * [-1216.439] (-1214.304) (-1214.093) (-1214.330) -- 0:00:49
379000 -- (-1215.193) (-1214.105) [-1213.777] (-1213.862) * (-1216.713) (-1216.495) (-1214.663) [-1215.313] -- 0:00:50
380000 -- (-1214.234) [-1213.701] (-1214.269) (-1214.146) * [-1213.836] (-1214.807) (-1214.159) (-1214.828) -- 0:00:50
Average standard deviation of split frequencies: 0.004128
381000 -- (-1212.901) (-1216.654) [-1212.759] (-1216.392) * (-1214.488) [-1212.603] (-1220.017) (-1213.300) -- 0:00:50
382000 -- [-1212.205] (-1213.798) (-1214.512) (-1215.449) * [-1215.575] (-1215.610) (-1213.832) (-1213.105) -- 0:00:50
383000 -- (-1212.278) (-1212.956) (-1213.303) [-1214.578] * (-1216.022) (-1213.558) (-1213.413) [-1215.051] -- 0:00:49
384000 -- (-1214.647) (-1214.519) (-1215.625) [-1215.823] * [-1215.267] (-1214.160) (-1213.477) (-1214.883) -- 0:00:49
385000 -- (-1214.269) [-1212.708] (-1216.872) (-1214.258) * (-1215.423) (-1215.018) [-1215.158] (-1214.635) -- 0:00:49
Average standard deviation of split frequencies: 0.006513
386000 -- (-1214.806) (-1215.030) (-1213.490) [-1215.760] * (-1217.845) [-1213.828] (-1212.845) (-1214.522) -- 0:00:49
387000 -- (-1217.010) (-1213.943) [-1214.533] (-1218.488) * (-1213.058) (-1214.086) [-1214.609] (-1213.208) -- 0:00:49
388000 -- (-1213.206) [-1212.218] (-1214.376) (-1215.117) * (-1214.339) [-1213.661] (-1214.181) (-1215.697) -- 0:00:48
389000 -- (-1213.475) [-1210.551] (-1215.152) (-1214.342) * (-1214.440) (-1212.904) [-1215.213] (-1214.427) -- 0:00:48
390000 -- (-1214.937) [-1210.561] (-1211.875) (-1214.268) * (-1216.688) (-1213.320) [-1213.340] (-1215.788) -- 0:00:48
Average standard deviation of split frequencies: 0.010458
391000 -- (-1215.503) [-1211.304] (-1212.716) (-1214.337) * (-1214.399) (-1213.336) [-1213.671] (-1215.704) -- 0:00:48
392000 -- (-1214.232) [-1212.650] (-1214.554) (-1215.159) * (-1214.938) (-1214.720) (-1216.234) [-1214.965] -- 0:00:49
393000 -- (-1214.817) [-1210.808] (-1218.319) (-1214.962) * (-1213.524) (-1215.724) (-1214.325) [-1214.456] -- 0:00:49
394000 -- (-1212.733) [-1211.311] (-1216.492) (-1217.392) * (-1212.758) (-1218.788) [-1215.149] (-1213.545) -- 0:00:49
395000 -- (-1215.531) (-1216.079) [-1215.746] (-1214.460) * (-1213.590) (-1216.372) [-1215.131] (-1213.577) -- 0:00:49
Average standard deviation of split frequencies: 0.013491
396000 -- (-1215.678) [-1213.786] (-1214.822) (-1216.486) * (-1212.390) (-1217.583) [-1212.603] (-1215.407) -- 0:00:48
397000 -- [-1213.394] (-1213.976) (-1212.646) (-1214.118) * (-1213.956) (-1214.113) (-1217.122) [-1216.443] -- 0:00:48
398000 -- (-1213.657) (-1213.854) (-1214.684) [-1215.327] * (-1213.093) [-1213.424] (-1213.324) (-1218.381) -- 0:00:48
399000 -- (-1214.648) (-1215.698) (-1214.800) [-1214.842] * (-1214.354) (-1215.282) [-1214.348] (-1214.087) -- 0:00:48
400000 -- (-1216.805) [-1215.360] (-1217.458) (-1214.085) * [-1213.559] (-1214.782) (-1216.851) (-1215.509) -- 0:00:48
Average standard deviation of split frequencies: 0.010981
401000 -- [-1215.303] (-1216.088) (-1214.407) (-1214.643) * [-1214.022] (-1215.869) (-1218.075) (-1215.036) -- 0:00:47
402000 -- [-1215.285] (-1216.550) (-1221.540) (-1215.703) * (-1212.726) (-1213.023) [-1213.733] (-1213.328) -- 0:00:47
403000 -- (-1214.896) [-1213.505] (-1215.616) (-1213.835) * (-1216.384) (-1213.181) [-1213.905] (-1215.870) -- 0:00:47
404000 -- (-1213.644) (-1214.970) [-1212.097] (-1215.011) * (-1213.697) (-1213.335) [-1214.195] (-1212.869) -- 0:00:47
405000 -- (-1213.801) (-1213.105) [-1210.978] (-1214.272) * (-1213.312) [-1213.288] (-1214.566) (-1214.597) -- 0:00:48
Average standard deviation of split frequencies: 0.010837
406000 -- (-1216.804) [-1213.853] (-1215.545) (-1214.081) * (-1213.167) (-1217.130) [-1214.365] (-1216.170) -- 0:00:48
407000 -- (-1216.437) (-1213.190) [-1211.533] (-1213.375) * (-1216.284) (-1213.485) (-1213.633) [-1214.229] -- 0:00:48
408000 -- (-1212.791) (-1212.670) [-1212.623] (-1216.410) * (-1214.820) (-1212.555) (-1214.156) [-1214.107] -- 0:00:47
409000 -- (-1213.214) (-1215.182) [-1213.998] (-1218.011) * (-1213.207) [-1214.619] (-1216.390) (-1221.576) -- 0:00:47
410000 -- [-1213.939] (-1213.237) (-1213.388) (-1212.376) * (-1218.523) (-1213.227) [-1214.289] (-1214.229) -- 0:00:47
Average standard deviation of split frequencies: 0.013010
411000 -- (-1217.034) (-1215.698) (-1214.349) [-1216.320] * (-1215.982) (-1214.155) (-1214.655) [-1213.352] -- 0:00:47
412000 -- [-1213.389] (-1212.897) (-1213.940) (-1213.160) * (-1216.825) (-1214.649) (-1213.185) [-1216.712] -- 0:00:47
413000 -- (-1213.719) (-1215.796) [-1215.872] (-1212.561) * [-1213.627] (-1215.129) (-1214.818) (-1214.417) -- 0:00:46
414000 -- (-1212.782) (-1214.789) (-1219.812) [-1218.607] * (-1213.824) (-1216.271) [-1216.059] (-1215.559) -- 0:00:46
415000 -- (-1213.721) (-1214.611) (-1212.996) [-1217.452] * [-1213.382] (-1220.759) (-1216.085) (-1213.840) -- 0:00:46
Average standard deviation of split frequencies: 0.014354
416000 -- [-1213.370] (-1213.504) (-1213.153) (-1214.961) * (-1213.804) (-1215.166) [-1213.471] (-1217.423) -- 0:00:46
417000 -- (-1223.192) (-1213.746) (-1218.646) [-1213.169] * (-1215.027) (-1212.739) [-1213.823] (-1213.535) -- 0:00:46
418000 -- (-1213.734) (-1215.717) (-1216.767) [-1214.785] * [-1213.523] (-1212.651) (-1218.371) (-1216.931) -- 0:00:47
419000 -- [-1213.802] (-1214.052) (-1216.262) (-1213.151) * (-1219.510) [-1216.636] (-1214.102) (-1214.571) -- 0:00:47
420000 -- (-1214.935) (-1213.044) (-1213.204) [-1213.079] * (-1215.570) (-1217.998) [-1213.763] (-1215.674) -- 0:00:46
Average standard deviation of split frequencies: 0.016436
421000 -- (-1214.459) (-1217.651) [-1212.972] (-1213.747) * (-1214.655) (-1212.941) [-1215.013] (-1215.087) -- 0:00:46
422000 -- (-1216.012) (-1217.823) (-1213.022) [-1214.954] * (-1214.355) (-1217.743) [-1215.215] (-1214.441) -- 0:00:46
423000 -- (-1215.204) (-1220.250) (-1213.286) [-1213.593] * (-1218.110) (-1213.710) [-1213.005] (-1215.241) -- 0:00:46
424000 -- (-1215.782) (-1214.183) [-1213.450] (-1215.123) * (-1217.425) (-1216.880) [-1212.531] (-1212.841) -- 0:00:46
425000 -- (-1217.301) (-1213.142) (-1215.009) [-1216.350] * (-1219.840) [-1212.544] (-1215.421) (-1213.497) -- 0:00:46
Average standard deviation of split frequencies: 0.016968
426000 -- (-1215.392) (-1218.815) [-1214.425] (-1215.941) * (-1213.633) (-1214.923) [-1213.534] (-1217.631) -- 0:00:45
427000 -- [-1213.485] (-1212.737) (-1212.033) (-1213.290) * (-1212.452) (-1213.729) [-1214.296] (-1213.356) -- 0:00:45
428000 -- (-1213.683) (-1214.869) [-1216.273] (-1216.005) * (-1215.881) (-1214.557) (-1212.813) [-1213.444] -- 0:00:45
429000 -- (-1213.843) (-1213.718) [-1213.274] (-1214.533) * [-1212.758] (-1214.820) (-1216.298) (-1214.305) -- 0:00:45
430000 -- (-1213.309) [-1213.778] (-1214.428) (-1216.853) * (-1212.812) [-1215.724] (-1215.717) (-1215.424) -- 0:00:46
Average standard deviation of split frequencies: 0.012405
431000 -- [-1214.113] (-1215.616) (-1215.578) (-1213.534) * (-1214.213) (-1217.422) [-1214.023] (-1213.164) -- 0:00:46
432000 -- (-1215.192) (-1214.927) (-1214.661) [-1215.465] * [-1214.149] (-1214.364) (-1215.094) (-1215.922) -- 0:00:46
433000 -- (-1213.335) (-1213.991) [-1213.415] (-1213.194) * (-1215.718) [-1214.817] (-1213.673) (-1214.889) -- 0:00:45
434000 -- (-1214.217) [-1214.918] (-1214.563) (-1213.285) * [-1214.275] (-1213.877) (-1214.325) (-1214.157) -- 0:00:45
435000 -- (-1213.084) [-1213.764] (-1214.012) (-1214.712) * [-1217.650] (-1214.283) (-1213.097) (-1215.719) -- 0:00:45
Average standard deviation of split frequencies: 0.013695
436000 -- (-1213.820) (-1213.258) [-1213.869] (-1213.556) * (-1216.240) [-1214.317] (-1214.734) (-1213.558) -- 0:00:45
437000 -- [-1214.608] (-1215.589) (-1213.142) (-1213.910) * (-1214.618) (-1214.729) [-1214.912] (-1213.373) -- 0:00:45
438000 -- (-1213.623) [-1213.500] (-1213.468) (-1214.047) * (-1216.825) (-1213.203) [-1214.663] (-1216.761) -- 0:00:44
439000 -- (-1217.237) (-1214.004) (-1215.730) [-1215.795] * (-1216.824) [-1214.659] (-1211.808) (-1214.156) -- 0:00:44
440000 -- [-1213.204] (-1213.019) (-1214.833) (-1213.480) * (-1213.942) (-1215.417) [-1215.686] (-1213.074) -- 0:00:44
Average standard deviation of split frequencies: 0.010698
441000 -- (-1213.645) (-1213.117) (-1217.231) [-1213.559] * (-1213.392) (-1216.323) (-1213.244) [-1213.101] -- 0:00:44
442000 -- [-1212.348] (-1215.353) (-1215.091) (-1212.738) * (-1213.135) (-1217.283) (-1216.354) [-1215.137] -- 0:00:44
443000 -- (-1213.808) (-1215.627) (-1213.525) [-1213.756] * (-1215.220) (-1216.076) (-1215.598) [-1209.532] -- 0:00:45
444000 -- [-1214.664] (-1215.972) (-1215.133) (-1214.386) * (-1214.558) (-1218.499) (-1217.208) [-1211.621] -- 0:00:45
445000 -- [-1214.008] (-1213.465) (-1214.306) (-1215.433) * (-1215.556) (-1213.382) [-1213.097] (-1213.249) -- 0:00:44
Average standard deviation of split frequencies: 0.011274
446000 -- (-1214.079) (-1214.114) [-1212.764] (-1214.171) * [-1212.432] (-1213.394) (-1212.975) (-1214.581) -- 0:00:44
447000 -- (-1216.182) [-1215.217] (-1214.216) (-1215.132) * (-1213.438) (-1213.569) [-1213.856] (-1213.388) -- 0:00:44
448000 -- (-1217.788) (-1214.201) [-1213.371] (-1213.270) * (-1213.455) [-1214.467] (-1213.017) (-1212.680) -- 0:00:44
449000 -- (-1212.979) (-1214.764) (-1215.040) [-1214.001] * (-1215.610) (-1212.982) (-1222.885) [-1213.278] -- 0:00:44
450000 -- (-1213.241) (-1213.539) [-1217.813] (-1217.524) * (-1212.744) (-1212.594) (-1229.778) [-1217.616] -- 0:00:44
Average standard deviation of split frequencies: 0.009065
451000 -- (-1214.304) (-1214.740) (-1214.942) [-1213.038] * [-1213.199] (-1213.388) (-1223.602) (-1216.328) -- 0:00:43
452000 -- [-1214.050] (-1213.712) (-1214.133) (-1214.517) * (-1214.112) (-1213.873) [-1213.580] (-1214.015) -- 0:00:43
453000 -- (-1213.043) (-1216.436) (-1212.645) [-1214.600] * (-1214.067) (-1214.920) (-1214.820) [-1214.902] -- 0:00:43
454000 -- [-1214.552] (-1215.110) (-1215.721) (-1213.301) * [-1215.851] (-1216.275) (-1215.321) (-1213.581) -- 0:00:43
455000 -- (-1215.431) (-1217.805) (-1213.898) [-1215.873] * (-1216.457) (-1213.355) [-1215.345] (-1216.297) -- 0:00:43
Average standard deviation of split frequencies: 0.008959
456000 -- (-1214.370) (-1214.664) (-1221.047) [-1214.903] * (-1215.759) (-1214.703) (-1213.019) [-1214.548] -- 0:00:44
457000 -- (-1213.404) (-1213.782) (-1217.949) [-1214.431] * (-1216.375) (-1214.761) (-1216.340) [-1213.928] -- 0:00:43
458000 -- (-1213.647) [-1214.392] (-1214.486) (-1213.946) * (-1215.006) (-1212.979) (-1215.299) [-1213.710] -- 0:00:43
459000 -- [-1213.453] (-1212.564) (-1214.634) (-1213.048) * (-1214.650) (-1215.103) [-1214.166] (-1217.675) -- 0:00:43
460000 -- (-1214.171) [-1212.527] (-1215.188) (-1213.761) * (-1214.619) (-1213.107) (-1214.187) [-1213.858] -- 0:00:43
Average standard deviation of split frequencies: 0.008869
461000 -- (-1214.039) [-1214.001] (-1215.074) (-1217.099) * (-1214.493) (-1212.953) (-1214.576) [-1215.034] -- 0:00:43
462000 -- (-1214.466) (-1214.376) (-1214.502) [-1212.579] * [-1212.229] (-1216.942) (-1213.381) (-1222.145) -- 0:00:43
463000 -- (-1214.150) [-1214.415] (-1215.174) (-1212.827) * (-1215.176) [-1214.131] (-1214.268) (-1216.051) -- 0:00:42
464000 -- (-1214.586) [-1212.877] (-1215.542) (-1215.454) * (-1214.573) (-1215.096) [-1216.950] (-1215.718) -- 0:00:42
465000 -- (-1214.048) [-1213.336] (-1220.210) (-1216.031) * (-1214.684) [-1215.334] (-1215.015) (-1219.878) -- 0:00:42
Average standard deviation of split frequencies: 0.006744
466000 -- [-1213.427] (-1218.532) (-1213.053) (-1216.427) * (-1215.202) (-1214.576) [-1213.342] (-1217.686) -- 0:00:42
467000 -- (-1212.771) (-1213.939) [-1214.450] (-1214.387) * [-1216.005] (-1217.137) (-1214.575) (-1217.297) -- 0:00:42
468000 -- (-1215.504) (-1214.791) [-1217.030] (-1217.376) * (-1213.974) (-1215.330) (-1215.467) [-1213.887] -- 0:00:42
469000 -- [-1216.761] (-1212.643) (-1217.197) (-1213.295) * (-1214.608) [-1213.786] (-1214.290) (-1215.632) -- 0:00:43
470000 -- [-1212.789] (-1214.820) (-1213.050) (-1213.919) * (-1212.994) (-1213.943) [-1213.818] (-1213.736) -- 0:00:42
Average standard deviation of split frequencies: 0.010016
471000 -- (-1214.780) (-1214.202) [-1213.937] (-1217.218) * (-1214.118) (-1216.776) (-1215.283) [-1214.419] -- 0:00:42
472000 -- [-1213.435] (-1216.007) (-1217.426) (-1218.183) * (-1218.419) (-1215.886) (-1217.567) [-1214.279] -- 0:00:42
473000 -- (-1215.477) (-1214.710) [-1214.461] (-1214.104) * (-1214.145) (-1212.850) [-1214.463] (-1212.963) -- 0:00:42
474000 -- [-1213.541] (-1213.213) (-1214.771) (-1216.936) * (-1216.068) [-1213.530] (-1214.778) (-1214.901) -- 0:00:42
475000 -- (-1212.659) [-1213.746] (-1215.166) (-1218.495) * (-1216.776) [-1213.287] (-1214.183) (-1215.580) -- 0:00:42
Average standard deviation of split frequencies: 0.010564
476000 -- (-1213.178) [-1214.872] (-1212.742) (-1218.521) * (-1215.300) (-1214.364) [-1214.914] (-1213.709) -- 0:00:41
477000 -- (-1213.573) (-1213.876) [-1213.232] (-1214.821) * (-1214.395) (-1214.973) (-1217.390) [-1213.049] -- 0:00:41
478000 -- (-1213.532) (-1213.473) (-1212.990) [-1220.208] * (-1215.263) (-1218.511) [-1213.985] (-1214.998) -- 0:00:41
479000 -- (-1214.239) [-1214.281] (-1214.622) (-1215.932) * [-1215.662] (-1212.735) (-1217.793) (-1212.458) -- 0:00:41
480000 -- (-1214.247) (-1210.920) (-1213.626) [-1212.583] * [-1212.402] (-1217.095) (-1213.702) (-1215.352) -- 0:00:41
Average standard deviation of split frequencies: 0.012423
481000 -- (-1213.224) [-1213.010] (-1213.162) (-1211.335) * [-1212.892] (-1218.144) (-1213.975) (-1214.000) -- 0:00:42
482000 -- (-1213.769) (-1215.213) (-1214.740) [-1211.707] * (-1217.287) (-1213.494) [-1216.328] (-1213.250) -- 0:00:41
483000 -- (-1214.440) (-1213.086) [-1213.982] (-1213.221) * (-1213.219) [-1213.404] (-1215.971) (-1215.438) -- 0:00:41
484000 -- (-1218.207) (-1213.825) (-1213.313) [-1213.512] * [-1213.332] (-1213.744) (-1213.895) (-1216.438) -- 0:00:41
485000 -- (-1215.474) (-1213.560) [-1216.609] (-1219.124) * (-1214.496) (-1214.624) (-1214.021) [-1213.352] -- 0:00:41
Average standard deviation of split frequencies: 0.012286
486000 -- (-1219.137) (-1213.280) [-1220.883] (-1214.368) * (-1218.044) [-1213.929] (-1216.929) (-1215.678) -- 0:00:41
487000 -- (-1213.866) (-1215.908) [-1217.307] (-1212.446) * (-1214.757) (-1213.309) [-1215.500] (-1214.963) -- 0:00:41
488000 -- (-1215.818) [-1213.389] (-1216.102) (-1215.743) * [-1213.014] (-1212.737) (-1212.858) (-1214.000) -- 0:00:40
489000 -- [-1214.614] (-1217.394) (-1214.842) (-1213.669) * [-1213.775] (-1216.005) (-1216.804) (-1213.623) -- 0:00:40
490000 -- [-1214.498] (-1218.599) (-1214.482) (-1213.532) * [-1212.922] (-1216.306) (-1215.169) (-1212.972) -- 0:00:40
Average standard deviation of split frequencies: 0.010888
491000 -- [-1215.390] (-1214.940) (-1216.158) (-1213.550) * [-1211.010] (-1213.053) (-1214.206) (-1213.674) -- 0:00:40
492000 -- [-1213.322] (-1214.998) (-1213.601) (-1216.008) * (-1218.007) (-1214.227) [-1213.285] (-1215.603) -- 0:00:40
493000 -- (-1218.225) (-1215.975) [-1214.107] (-1215.130) * (-1215.324) (-1214.350) [-1214.480] (-1214.616) -- 0:00:41
494000 -- (-1215.920) [-1213.552] (-1214.086) (-1214.181) * [-1215.600] (-1214.210) (-1214.266) (-1214.079) -- 0:00:40
495000 -- (-1215.753) (-1215.770) (-1214.667) [-1217.492] * (-1212.856) (-1215.091) [-1213.631] (-1215.322) -- 0:00:40
Average standard deviation of split frequencies: 0.008871
496000 -- (-1213.668) (-1215.140) [-1214.439] (-1214.380) * (-1214.640) (-1214.725) [-1214.235] (-1214.719) -- 0:00:40
497000 -- (-1213.202) [-1215.056] (-1216.104) (-1216.076) * (-1213.538) (-1213.054) [-1213.443] (-1214.931) -- 0:00:40
498000 -- (-1215.919) [-1212.605] (-1217.205) (-1215.587) * (-1214.508) [-1214.481] (-1215.568) (-1216.675) -- 0:00:40
499000 -- (-1218.163) [-1212.294] (-1215.089) (-1212.925) * (-1213.917) (-1216.809) (-1213.498) [-1213.307] -- 0:00:40
500000 -- (-1213.742) (-1214.407) [-1215.213] (-1213.137) * (-1214.883) [-1214.475] (-1214.583) (-1213.327) -- 0:00:40
Average standard deviation of split frequencies: 0.008160
501000 -- (-1214.482) (-1215.665) [-1214.021] (-1215.316) * (-1216.193) [-1213.613] (-1213.176) (-1215.555) -- 0:00:39
502000 -- (-1218.462) [-1213.683] (-1213.740) (-1216.280) * (-1215.718) (-1213.023) [-1215.607] (-1217.768) -- 0:00:39
503000 -- (-1213.699) (-1216.168) [-1215.690] (-1213.150) * (-1213.410) (-1214.228) [-1214.341] (-1213.540) -- 0:00:39
504000 -- (-1213.144) [-1213.999] (-1216.789) (-1212.143) * (-1216.177) [-1216.685] (-1216.862) (-1216.988) -- 0:00:39
505000 -- (-1219.203) (-1214.556) (-1215.507) [-1214.970] * (-1215.899) [-1214.790] (-1214.949) (-1214.022) -- 0:00:39
Average standard deviation of split frequencies: 0.006832
506000 -- (-1215.733) [-1213.988] (-1212.815) (-1214.264) * [-1212.397] (-1214.476) (-1214.681) (-1214.274) -- 0:00:40
507000 -- (-1214.794) (-1219.002) (-1213.389) [-1214.956] * (-1213.893) (-1215.882) [-1215.800] (-1215.776) -- 0:00:39
508000 -- [-1213.327] (-1213.801) (-1214.895) (-1214.053) * (-1213.852) [-1217.036] (-1214.419) (-1216.286) -- 0:00:39
509000 -- (-1212.895) (-1216.872) (-1215.506) [-1213.905] * (-1214.228) (-1214.595) (-1212.430) [-1219.360] -- 0:00:39
510000 -- (-1213.045) (-1211.713) (-1213.797) [-1214.442] * (-1229.468) (-1213.075) (-1214.606) [-1215.000] -- 0:00:39
Average standard deviation of split frequencies: 0.008616
511000 -- (-1215.427) (-1214.260) (-1213.735) [-1219.543] * (-1216.450) (-1216.311) [-1215.815] (-1213.729) -- 0:00:39
512000 -- (-1213.784) (-1212.981) [-1214.928] (-1216.726) * (-1218.292) (-1213.830) (-1215.186) [-1217.789] -- 0:00:39
513000 -- [-1211.457] (-1215.064) (-1213.235) (-1214.112) * (-1216.382) (-1217.305) (-1214.873) [-1212.799] -- 0:00:38
514000 -- [-1213.951] (-1213.673) (-1216.318) (-1215.541) * (-1215.451) (-1215.486) (-1214.743) [-1214.635] -- 0:00:38
515000 -- (-1213.789) (-1217.249) (-1216.176) [-1213.242] * [-1214.357] (-1214.120) (-1218.434) (-1221.231) -- 0:00:38
Average standard deviation of split frequencies: 0.009136
516000 -- (-1214.897) (-1215.660) [-1213.296] (-1212.886) * (-1214.305) (-1215.848) (-1221.565) [-1213.846] -- 0:00:38
517000 -- [-1216.520] (-1216.793) (-1212.531) (-1213.516) * (-1214.455) (-1214.734) [-1218.371] (-1216.295) -- 0:00:38
518000 -- (-1212.895) (-1219.650) (-1213.450) [-1213.488] * [-1216.933] (-1216.029) (-1214.489) (-1214.075) -- 0:00:38
519000 -- (-1215.464) (-1212.948) [-1214.988] (-1213.089) * (-1213.257) (-1217.026) [-1213.751] (-1214.190) -- 0:00:38
520000 -- (-1213.989) (-1214.550) (-1214.598) [-1212.418] * (-1215.847) (-1213.882) [-1214.484] (-1214.344) -- 0:00:38
Average standard deviation of split frequencies: 0.010261
521000 -- [-1214.349] (-1215.082) (-1213.704) (-1216.111) * (-1217.705) (-1214.307) [-1214.757] (-1213.667) -- 0:00:38
522000 -- [-1218.601] (-1212.971) (-1216.328) (-1213.227) * [-1214.288] (-1218.295) (-1214.438) (-1213.958) -- 0:00:38
523000 -- (-1213.308) [-1213.656] (-1217.358) (-1213.130) * (-1215.545) (-1216.438) (-1213.225) [-1214.708] -- 0:00:38
524000 -- (-1213.276) [-1213.813] (-1214.590) (-1218.817) * (-1213.790) [-1213.829] (-1213.241) (-1213.885) -- 0:00:38
525000 -- [-1214.049] (-1213.492) (-1214.355) (-1212.945) * (-1217.782) (-1212.952) (-1214.981) [-1214.251] -- 0:00:38
Average standard deviation of split frequencies: 0.009560
526000 -- (-1216.081) [-1213.920] (-1214.894) (-1214.475) * (-1214.860) (-1213.895) [-1216.101] (-1214.537) -- 0:00:37
527000 -- (-1213.570) (-1212.984) (-1213.340) [-1213.998] * (-1214.571) (-1212.884) [-1214.288] (-1213.991) -- 0:00:37
528000 -- (-1217.058) (-1213.348) [-1214.857] (-1215.761) * (-1216.572) (-1212.826) (-1215.137) [-1212.831] -- 0:00:37
529000 -- (-1213.945) (-1214.235) (-1213.395) [-1213.799] * (-1212.676) (-1213.102) (-1214.967) [-1213.029] -- 0:00:37
530000 -- [-1212.916] (-1215.717) (-1213.319) (-1214.541) * (-1213.069) (-1215.162) [-1217.160] (-1214.216) -- 0:00:37
Average standard deviation of split frequencies: 0.010068
531000 -- (-1213.930) (-1213.614) [-1216.281] (-1213.280) * (-1215.126) (-1213.968) (-1215.393) [-1217.337] -- 0:00:37
532000 -- (-1213.395) [-1214.581] (-1214.775) (-1215.602) * (-1216.077) (-1215.755) (-1214.975) [-1212.137] -- 0:00:37
533000 -- (-1214.627) (-1214.561) (-1218.730) [-1216.011] * (-1214.671) (-1215.305) (-1215.081) [-1216.796] -- 0:00:37
534000 -- [-1213.714] (-1214.640) (-1214.011) (-1213.557) * (-1213.974) [-1215.657] (-1214.694) (-1214.443) -- 0:00:37
535000 -- [-1215.241] (-1216.511) (-1213.837) (-1214.924) * (-1213.869) [-1214.183] (-1217.190) (-1213.568) -- 0:00:37
Average standard deviation of split frequencies: 0.011726
536000 -- (-1213.958) (-1215.225) [-1214.472] (-1214.844) * (-1213.456) [-1216.508] (-1215.082) (-1214.385) -- 0:00:37
537000 -- (-1213.706) (-1213.172) [-1217.409] (-1216.361) * [-1213.850] (-1220.561) (-1217.029) (-1214.669) -- 0:00:37
538000 -- (-1218.563) (-1213.520) [-1214.192] (-1219.536) * (-1213.507) (-1211.929) [-1212.937] (-1215.203) -- 0:00:36
539000 -- (-1214.780) [-1214.343] (-1213.385) (-1215.790) * (-1217.005) [-1212.722] (-1213.758) (-1215.977) -- 0:00:36
540000 -- (-1213.990) (-1217.160) [-1217.288] (-1213.174) * (-1215.440) [-1212.322] (-1214.501) (-1214.571) -- 0:00:36
Average standard deviation of split frequencies: 0.012788
541000 -- (-1214.197) (-1213.597) (-1215.920) [-1214.200] * (-1212.722) (-1216.732) [-1215.446] (-1214.544) -- 0:00:36
542000 -- [-1212.882] (-1214.351) (-1213.168) (-1213.441) * (-1215.482) (-1212.675) (-1216.019) [-1209.930] -- 0:00:36
543000 -- (-1214.147) [-1212.789] (-1212.102) (-1212.698) * [-1214.170] (-1213.475) (-1213.082) (-1211.697) -- 0:00:36
544000 -- [-1213.128] (-1214.839) (-1213.670) (-1214.602) * (-1216.989) (-1212.906) (-1218.832) [-1209.907] -- 0:00:36
545000 -- (-1213.931) (-1214.883) [-1215.098] (-1216.241) * (-1218.071) (-1216.755) (-1213.131) [-1210.617] -- 0:00:36
Average standard deviation of split frequencies: 0.013814
546000 -- (-1212.887) [-1215.947] (-1216.940) (-1218.549) * (-1213.417) (-1215.168) (-1213.281) [-1212.911] -- 0:00:36
547000 -- (-1216.275) [-1214.485] (-1215.012) (-1213.886) * (-1215.637) [-1212.769] (-1218.765) (-1216.426) -- 0:00:36
548000 -- (-1214.023) (-1213.890) [-1213.205] (-1213.070) * (-1213.845) (-1213.394) (-1216.772) [-1214.277] -- 0:00:36
549000 -- (-1212.918) (-1216.237) (-1213.029) [-1214.649] * (-1214.853) (-1213.833) [-1213.721] (-1215.188) -- 0:00:36
550000 -- (-1216.030) (-1214.165) (-1213.900) [-1214.010] * (-1213.894) (-1218.033) [-1216.190] (-1214.109) -- 0:00:36
Average standard deviation of split frequencies: 0.014838
551000 -- [-1214.546] (-1213.799) (-1214.448) (-1215.521) * (-1213.223) [-1215.195] (-1214.072) (-1220.623) -- 0:00:35
552000 -- (-1216.312) [-1213.268] (-1212.858) (-1213.157) * (-1214.166) [-1215.314] (-1215.650) (-1212.962) -- 0:00:35
553000 -- (-1214.590) (-1215.949) (-1214.075) [-1213.220] * [-1213.179] (-1213.100) (-1213.030) (-1214.869) -- 0:00:35
554000 -- (-1213.786) [-1212.102] (-1213.724) (-1215.051) * (-1214.331) [-1213.425] (-1215.354) (-1212.547) -- 0:00:35
555000 -- [-1210.735] (-1214.042) (-1213.908) (-1213.494) * [-1216.816] (-1213.642) (-1212.857) (-1215.458) -- 0:00:35
Average standard deviation of split frequencies: 0.014131
556000 -- [-1211.024] (-1214.303) (-1215.605) (-1213.828) * (-1213.767) [-1213.140] (-1213.879) (-1214.188) -- 0:00:35
557000 -- [-1213.530] (-1213.883) (-1214.389) (-1212.795) * (-1213.613) [-1212.204] (-1212.667) (-1213.745) -- 0:00:35
558000 -- (-1220.543) (-1213.130) [-1217.434] (-1214.402) * [-1213.080] (-1213.011) (-1214.929) (-1212.961) -- 0:00:35
559000 -- [-1211.960] (-1214.299) (-1218.591) (-1215.524) * (-1213.000) [-1213.708] (-1214.030) (-1214.471) -- 0:00:35
560000 -- (-1215.111) [-1213.671] (-1218.310) (-1213.238) * (-1212.907) [-1213.636] (-1214.481) (-1214.569) -- 0:00:35
Average standard deviation of split frequencies: 0.013453
561000 -- [-1213.808] (-1215.909) (-1215.315) (-1211.493) * (-1216.611) [-1215.749] (-1216.728) (-1213.020) -- 0:00:35
562000 -- [-1215.642] (-1219.129) (-1214.180) (-1214.467) * [-1214.814] (-1215.894) (-1213.220) (-1218.136) -- 0:00:35
563000 -- [-1215.514] (-1211.840) (-1213.113) (-1213.757) * (-1217.336) (-1213.222) [-1213.585] (-1214.799) -- 0:00:34
564000 -- (-1213.598) [-1213.422] (-1215.930) (-1214.891) * (-1212.566) [-1213.543] (-1215.914) (-1215.109) -- 0:00:34
565000 -- (-1215.030) (-1219.658) (-1213.178) [-1215.024] * (-1217.179) [-1211.093] (-1213.229) (-1213.166) -- 0:00:34
Average standard deviation of split frequencies: 0.012215
566000 -- [-1216.612] (-1215.583) (-1213.106) (-1214.277) * (-1216.912) [-1214.958] (-1214.127) (-1215.946) -- 0:00:34
567000 -- (-1216.716) (-1214.881) [-1214.150] (-1214.878) * (-1215.522) [-1211.225] (-1213.951) (-1217.308) -- 0:00:34
568000 -- (-1217.994) (-1213.144) [-1215.269] (-1216.196) * (-1213.149) (-1213.581) (-1214.966) [-1214.557] -- 0:00:34
569000 -- (-1217.372) (-1214.506) [-1213.284] (-1217.457) * [-1213.110] (-1218.154) (-1214.221) (-1217.583) -- 0:00:34
570000 -- [-1212.687] (-1219.649) (-1213.794) (-1213.952) * [-1214.604] (-1216.737) (-1214.886) (-1213.960) -- 0:00:34
Average standard deviation of split frequencies: 0.012116
571000 -- [-1217.238] (-1213.191) (-1216.745) (-1214.783) * [-1215.198] (-1213.170) (-1213.941) (-1217.623) -- 0:00:34
572000 -- (-1213.438) [-1213.282] (-1212.845) (-1214.209) * (-1220.452) [-1213.874] (-1218.092) (-1216.141) -- 0:00:34
573000 -- [-1213.778] (-1214.069) (-1214.029) (-1212.984) * (-1213.967) (-1214.571) [-1217.241] (-1215.097) -- 0:00:34
574000 -- [-1214.316] (-1213.302) (-1217.450) (-1213.992) * (-1214.342) (-1214.161) [-1214.746] (-1213.622) -- 0:00:34
575000 -- (-1215.154) (-1217.930) (-1214.190) [-1213.785] * (-1214.975) [-1214.516] (-1213.871) (-1212.953) -- 0:00:34
Average standard deviation of split frequencies: 0.010912
576000 -- (-1214.029) (-1216.619) (-1215.809) [-1213.849] * [-1213.890] (-1214.930) (-1214.770) (-1219.514) -- 0:00:33
577000 -- [-1214.925] (-1216.551) (-1213.702) (-1218.217) * [-1212.487] (-1216.679) (-1213.004) (-1212.594) -- 0:00:33
578000 -- (-1213.212) (-1214.205) [-1213.693] (-1215.358) * (-1219.507) [-1213.616] (-1215.770) (-1212.011) -- 0:00:33
579000 -- (-1213.034) [-1213.288] (-1214.796) (-1218.709) * (-1216.768) (-1213.751) (-1213.567) [-1214.220] -- 0:00:33
580000 -- [-1212.643] (-1216.858) (-1218.374) (-1214.554) * (-1215.041) [-1214.105] (-1213.292) (-1214.884) -- 0:00:33
Average standard deviation of split frequencies: 0.014072
581000 -- (-1215.093) [-1215.494] (-1213.570) (-1213.008) * (-1213.124) [-1213.432] (-1214.441) (-1213.668) -- 0:00:33
582000 -- [-1213.351] (-1214.757) (-1216.970) (-1215.182) * (-1213.171) [-1216.569] (-1215.149) (-1213.165) -- 0:00:33
583000 -- (-1218.576) (-1215.621) (-1218.101) [-1213.333] * (-1213.694) [-1213.730] (-1214.794) (-1213.263) -- 0:00:33
584000 -- [-1213.317] (-1213.047) (-1215.498) (-1213.618) * (-1214.777) (-1214.551) (-1214.433) [-1212.227] -- 0:00:33
585000 -- (-1215.005) [-1216.383] (-1212.937) (-1213.647) * [-1216.747] (-1213.724) (-1213.771) (-1212.769) -- 0:00:33
Average standard deviation of split frequencies: 0.014480
586000 -- [-1216.390] (-1214.746) (-1217.276) (-1213.588) * [-1213.208] (-1212.902) (-1213.704) (-1213.222) -- 0:00:33
587000 -- (-1216.527) (-1214.742) [-1218.817] (-1214.185) * (-1213.647) (-1216.861) [-1212.977] (-1213.157) -- 0:00:33
588000 -- [-1213.826] (-1213.721) (-1216.489) (-1214.457) * (-1213.127) (-1216.008) [-1213.598] (-1214.669) -- 0:00:32
589000 -- [-1216.906] (-1213.513) (-1213.754) (-1213.697) * [-1215.721] (-1219.680) (-1214.316) (-1215.397) -- 0:00:32
590000 -- (-1217.737) (-1212.980) [-1212.633] (-1215.123) * (-1213.917) (-1213.570) (-1216.052) [-1216.413] -- 0:00:32
Average standard deviation of split frequencies: 0.012769
591000 -- [-1212.969] (-1214.589) (-1218.407) (-1215.566) * [-1212.413] (-1215.890) (-1214.387) (-1221.983) -- 0:00:32
592000 -- (-1213.391) (-1219.599) (-1213.438) [-1213.418] * (-1214.670) (-1215.524) (-1214.556) [-1214.665] -- 0:00:32
593000 -- (-1217.397) (-1215.798) (-1213.257) [-1213.345] * (-1216.422) (-1214.122) (-1216.486) [-1212.159] -- 0:00:32
594000 -- (-1214.850) (-1214.481) (-1217.384) [-1214.689] * (-1213.429) (-1214.753) [-1213.946] (-1216.265) -- 0:00:32
595000 -- (-1214.442) (-1214.436) [-1215.391] (-1214.196) * (-1215.466) [-1216.612] (-1212.994) (-1215.607) -- 0:00:32
Average standard deviation of split frequencies: 0.013710
596000 -- (-1214.675) (-1214.583) (-1215.692) [-1214.874] * [-1217.531] (-1217.339) (-1213.781) (-1213.909) -- 0:00:32
597000 -- (-1213.775) [-1216.306] (-1214.961) (-1213.933) * (-1214.858) (-1214.745) [-1219.172] (-1215.791) -- 0:00:32
598000 -- (-1216.774) [-1209.827] (-1214.885) (-1216.382) * (-1215.599) [-1213.988] (-1213.451) (-1217.259) -- 0:00:32
599000 -- (-1214.092) [-1209.799] (-1214.988) (-1216.384) * (-1214.181) (-1217.630) [-1217.039] (-1213.556) -- 0:00:32
600000 -- (-1215.398) [-1211.916] (-1214.287) (-1216.230) * (-1214.063) [-1213.408] (-1214.152) (-1215.730) -- 0:00:32
Average standard deviation of split frequencies: 0.014650
601000 -- (-1213.677) [-1209.740] (-1213.961) (-1214.332) * (-1215.220) [-1215.333] (-1213.582) (-1214.204) -- 0:00:31
602000 -- (-1214.635) [-1211.819] (-1214.493) (-1216.320) * [-1214.299] (-1214.382) (-1213.810) (-1214.303) -- 0:00:31
603000 -- [-1213.471] (-1212.517) (-1213.899) (-1215.251) * (-1213.850) (-1212.823) [-1213.508] (-1213.641) -- 0:00:31
604000 -- (-1213.917) [-1210.497] (-1213.988) (-1214.965) * (-1215.088) (-1213.135) [-1213.913] (-1213.625) -- 0:00:31
605000 -- (-1214.003) [-1209.723] (-1213.656) (-1215.839) * (-1215.282) (-1212.773) [-1213.871] (-1212.840) -- 0:00:31
Average standard deviation of split frequencies: 0.012446
606000 -- (-1217.822) [-1210.315] (-1213.742) (-1216.025) * [-1213.375] (-1215.808) (-1215.708) (-1213.222) -- 0:00:31
607000 -- (-1213.338) [-1211.374] (-1213.021) (-1216.347) * (-1213.962) (-1217.938) [-1214.319] (-1213.019) -- 0:00:31
608000 -- (-1214.724) [-1209.676] (-1215.140) (-1220.800) * [-1213.651] (-1220.148) (-1214.827) (-1214.030) -- 0:00:31
609000 -- (-1214.666) [-1211.322] (-1213.426) (-1216.791) * (-1213.500) (-1214.145) (-1213.909) [-1214.838] -- 0:00:31
610000 -- (-1215.747) [-1212.820] (-1215.327) (-1214.412) * (-1215.141) (-1214.805) (-1215.013) [-1212.725] -- 0:00:31
Average standard deviation of split frequencies: 0.010293
611000 -- (-1212.645) [-1210.569] (-1213.289) (-1215.229) * (-1213.738) [-1215.461] (-1217.240) (-1214.005) -- 0:00:31
612000 -- (-1217.161) [-1211.072] (-1216.329) (-1213.998) * (-1214.607) (-1213.877) [-1215.387] (-1218.191) -- 0:00:31
613000 -- (-1218.037) [-1212.124] (-1217.662) (-1215.332) * (-1212.484) [-1213.333] (-1212.918) (-1215.354) -- 0:00:30
614000 -- (-1213.457) [-1210.660] (-1213.491) (-1215.005) * (-1213.085) (-1214.760) [-1213.946] (-1215.971) -- 0:00:30
615000 -- (-1215.151) [-1210.126] (-1212.653) (-1212.847) * (-1216.085) (-1217.406) (-1216.092) [-1218.642] -- 0:00:30
Average standard deviation of split frequencies: 0.010204
616000 -- (-1213.931) [-1209.826] (-1216.106) (-1214.651) * (-1217.968) (-1213.135) (-1213.473) [-1213.827] -- 0:00:30
617000 -- (-1215.014) [-1212.959] (-1221.879) (-1213.198) * (-1215.953) (-1213.145) [-1216.998] (-1214.873) -- 0:00:30
618000 -- (-1215.725) [-1209.191] (-1213.543) (-1214.420) * (-1215.333) (-1212.848) (-1213.512) [-1213.696] -- 0:00:30
619000 -- (-1213.206) [-1213.152] (-1216.103) (-1213.010) * (-1213.417) (-1216.654) (-1217.877) [-1214.580] -- 0:00:30
620000 -- (-1213.401) [-1213.864] (-1216.125) (-1215.995) * (-1215.205) [-1214.179] (-1213.101) (-1212.370) -- 0:00:30
Average standard deviation of split frequencies: 0.009621
621000 -- (-1214.071) [-1213.215] (-1214.231) (-1216.553) * [-1212.822] (-1215.562) (-1215.630) (-1214.739) -- 0:00:30
622000 -- (-1214.147) [-1212.783] (-1217.499) (-1214.967) * [-1213.744] (-1214.641) (-1213.643) (-1213.338) -- 0:00:30
623000 -- (-1219.160) (-1215.171) (-1212.924) [-1217.923] * (-1214.555) (-1215.364) [-1214.032] (-1212.816) -- 0:00:30
624000 -- [-1219.842] (-1212.976) (-1217.359) (-1212.972) * (-1213.941) (-1217.426) (-1215.117) [-1213.522] -- 0:00:30
625000 -- (-1215.411) (-1216.362) [-1215.108] (-1214.286) * [-1213.647] (-1213.537) (-1216.220) (-1215.460) -- 0:00:30
Average standard deviation of split frequencies: 0.010041
626000 -- [-1213.032] (-1221.385) (-1213.567) (-1216.401) * (-1216.662) (-1217.471) [-1217.130] (-1214.751) -- 0:00:29
627000 -- [-1213.902] (-1213.277) (-1214.703) (-1214.358) * [-1214.978] (-1215.458) (-1214.222) (-1218.077) -- 0:00:29
628000 -- [-1213.791] (-1216.485) (-1215.709) (-1213.148) * (-1216.476) (-1215.501) [-1214.014] (-1213.136) -- 0:00:29
629000 -- (-1215.345) [-1210.773] (-1214.210) (-1214.584) * (-1215.921) (-1213.176) (-1218.625) [-1214.914] -- 0:00:29
630000 -- (-1213.895) (-1215.671) [-1215.280] (-1214.055) * (-1213.975) [-1213.748] (-1214.201) (-1214.125) -- 0:00:29
Average standard deviation of split frequencies: 0.010963
631000 -- (-1214.942) (-1215.467) [-1213.922] (-1213.887) * (-1215.932) [-1213.839] (-1214.681) (-1213.667) -- 0:00:29
632000 -- (-1214.359) [-1214.718] (-1216.312) (-1214.371) * (-1213.427) (-1220.771) (-1214.088) [-1213.094] -- 0:00:29
633000 -- (-1216.574) [-1221.052] (-1214.705) (-1214.711) * (-1218.459) (-1213.651) [-1213.141] (-1213.327) -- 0:00:29
634000 -- (-1218.010) (-1214.658) [-1213.393] (-1219.221) * (-1216.735) (-1213.961) (-1214.030) [-1213.754] -- 0:00:29
635000 -- (-1214.891) (-1216.633) (-1212.600) [-1213.229] * [-1213.916] (-1214.906) (-1214.093) (-1213.656) -- 0:00:29
Average standard deviation of split frequencies: 0.009883
636000 -- (-1217.144) [-1213.172] (-1212.738) (-1221.228) * (-1213.524) (-1216.289) [-1213.191] (-1213.521) -- 0:00:29
637000 -- (-1213.230) (-1213.368) [-1213.778] (-1213.550) * (-1213.468) (-1213.804) [-1212.602] (-1212.891) -- 0:00:29
638000 -- (-1213.985) (-1213.280) (-1214.603) [-1214.108] * (-1213.629) (-1213.734) (-1214.997) [-1213.022] -- 0:00:28
639000 -- [-1214.516] (-1214.145) (-1213.406) (-1214.107) * (-1213.748) (-1217.568) [-1216.293] (-1212.598) -- 0:00:28
640000 -- (-1218.152) (-1215.274) [-1212.566] (-1214.155) * (-1214.405) (-1214.009) [-1214.183] (-1218.001) -- 0:00:28
Average standard deviation of split frequencies: 0.008339
641000 -- [-1218.733] (-1215.666) (-1215.351) (-1217.629) * (-1214.377) (-1213.438) [-1214.923] (-1214.539) -- 0:00:28
642000 -- (-1214.179) (-1215.279) [-1216.457] (-1213.036) * (-1213.587) (-1213.604) [-1213.576] (-1218.365) -- 0:00:28
643000 -- (-1214.162) (-1213.557) (-1214.850) [-1213.044] * (-1215.527) (-1213.659) [-1213.125] (-1222.144) -- 0:00:28
644000 -- (-1213.811) (-1214.073) (-1214.305) [-1213.403] * [-1215.441] (-1212.669) (-1215.207) (-1217.715) -- 0:00:28
645000 -- (-1216.198) (-1214.935) (-1214.630) [-1214.145] * (-1214.432) (-1215.299) [-1213.673] (-1218.522) -- 0:00:28
Average standard deviation of split frequencies: 0.008757
646000 -- (-1213.416) (-1214.681) [-1216.783] (-1215.911) * (-1219.862) (-1214.523) [-1215.965] (-1214.615) -- 0:00:28
647000 -- (-1217.584) (-1214.604) (-1212.782) [-1216.484] * (-1214.534) (-1213.126) (-1213.471) [-1216.817] -- 0:00:28
648000 -- (-1217.144) (-1214.737) (-1213.961) [-1214.370] * (-1214.793) [-1213.425] (-1213.447) (-1212.879) -- 0:00:28
649000 -- (-1212.643) [-1213.630] (-1213.853) (-1213.352) * [-1213.893] (-1214.774) (-1215.030) (-1212.790) -- 0:00:28
650000 -- (-1215.605) [-1217.988] (-1216.117) (-1218.158) * (-1215.611) (-1214.143) [-1214.078] (-1212.422) -- 0:00:28
Average standard deviation of split frequencies: 0.007245
651000 -- [-1214.038] (-1213.577) (-1216.277) (-1213.409) * (-1214.255) (-1218.959) [-1213.005] (-1213.442) -- 0:00:27
652000 -- (-1213.529) [-1214.035] (-1215.053) (-1212.937) * (-1216.360) (-1215.027) [-1214.305] (-1213.941) -- 0:00:27
653000 -- (-1214.260) [-1212.640] (-1213.273) (-1212.784) * (-1215.638) [-1213.709] (-1213.821) (-1214.362) -- 0:00:27
654000 -- (-1213.645) (-1214.341) (-1215.489) [-1218.004] * (-1213.470) (-1213.129) (-1218.100) [-1215.241] -- 0:00:27
655000 -- (-1215.194) (-1213.243) [-1211.965] (-1213.308) * [-1215.015] (-1212.940) (-1213.909) (-1214.080) -- 0:00:27
Average standard deviation of split frequencies: 0.008623
656000 -- (-1215.587) (-1212.484) [-1217.217] (-1213.882) * (-1216.363) (-1213.385) (-1214.361) [-1213.579] -- 0:00:27
657000 -- [-1213.097] (-1214.454) (-1213.106) (-1216.232) * [-1214.353] (-1213.343) (-1214.945) (-1214.125) -- 0:00:27
658000 -- (-1213.122) (-1213.542) (-1216.462) [-1219.461] * (-1213.286) (-1216.030) (-1212.586) [-1213.966] -- 0:00:27
659000 -- [-1213.215] (-1214.391) (-1212.944) (-1213.156) * (-1212.822) (-1215.294) (-1212.631) [-1215.348] -- 0:00:27
660000 -- (-1213.413) (-1212.802) [-1214.010] (-1216.903) * (-1214.864) (-1215.778) [-1216.734] (-1212.559) -- 0:00:27
Average standard deviation of split frequencies: 0.008087
661000 -- [-1214.749] (-1212.655) (-1213.063) (-1212.566) * (-1215.840) (-1213.945) [-1213.070] (-1214.327) -- 0:00:27
662000 -- (-1214.749) (-1215.537) (-1213.036) [-1214.138] * (-1213.595) (-1213.332) (-1215.329) [-1213.577] -- 0:00:27
663000 -- [-1213.529] (-1213.186) (-1214.398) (-1213.312) * (-1213.872) [-1213.709] (-1214.594) (-1216.127) -- 0:00:26
664000 -- (-1213.298) [-1215.740] (-1215.099) (-1212.919) * (-1221.318) (-1214.380) (-1215.402) [-1219.687] -- 0:00:26
665000 -- [-1213.595] (-1214.278) (-1213.853) (-1221.684) * (-1217.358) [-1211.495] (-1212.896) (-1214.763) -- 0:00:26
Average standard deviation of split frequencies: 0.008022
666000 -- (-1213.365) [-1214.079] (-1213.816) (-1214.719) * (-1217.337) (-1214.541) [-1213.945] (-1213.951) -- 0:00:26
667000 -- (-1213.567) (-1212.916) [-1213.523] (-1217.992) * (-1218.127) (-1212.850) (-1213.556) [-1218.049] -- 0:00:26
668000 -- (-1215.655) (-1216.634) [-1216.600] (-1216.142) * (-1214.822) (-1214.535) (-1214.469) [-1212.438] -- 0:00:26
669000 -- [-1216.052] (-1215.370) (-1213.030) (-1216.435) * (-1214.049) [-1214.733] (-1215.913) (-1213.382) -- 0:00:26
670000 -- (-1214.838) (-1216.302) [-1216.054] (-1214.075) * (-1215.790) (-1213.136) (-1213.468) [-1214.517] -- 0:00:26
Average standard deviation of split frequencies: 0.007966
671000 -- (-1218.187) (-1216.062) (-1214.649) [-1213.740] * (-1219.054) (-1214.742) (-1213.204) [-1216.595] -- 0:00:26
672000 -- (-1213.188) (-1213.945) (-1213.442) [-1212.710] * [-1213.083] (-1218.576) (-1217.064) (-1214.150) -- 0:00:26
673000 -- (-1214.700) (-1214.738) [-1213.104] (-1213.001) * (-1215.485) (-1215.417) (-1213.395) [-1213.878] -- 0:00:26
674000 -- (-1213.511) (-1218.373) [-1213.645] (-1218.009) * [-1215.650] (-1221.310) (-1212.876) (-1215.539) -- 0:00:26
675000 -- [-1214.896] (-1214.063) (-1219.851) (-1213.018) * [-1212.685] (-1214.104) (-1213.004) (-1215.064) -- 0:00:26
Average standard deviation of split frequencies: 0.007438
676000 -- (-1215.366) (-1213.732) [-1214.376] (-1215.299) * (-1215.388) [-1214.537] (-1214.118) (-1213.284) -- 0:00:25
677000 -- [-1216.072] (-1212.917) (-1213.333) (-1215.733) * (-1213.533) (-1213.504) (-1213.678) [-1213.922] -- 0:00:25
678000 -- (-1214.668) [-1215.577] (-1213.125) (-1214.814) * (-1214.569) [-1213.250] (-1212.510) (-1213.931) -- 0:00:25
679000 -- (-1213.375) (-1214.847) [-1216.231] (-1213.604) * (-1212.528) (-1217.870) (-1212.915) [-1213.490] -- 0:00:25
680000 -- (-1214.643) (-1214.645) [-1216.147] (-1214.389) * [-1213.487] (-1213.117) (-1213.992) (-1215.181) -- 0:00:25
Average standard deviation of split frequencies: 0.008311
681000 -- (-1217.964) (-1214.258) (-1212.870) [-1213.276] * (-1212.526) (-1213.425) [-1218.297] (-1222.723) -- 0:00:25
682000 -- (-1222.160) (-1220.332) [-1214.464] (-1213.191) * [-1212.776] (-1215.158) (-1213.275) (-1219.840) -- 0:00:25
683000 -- (-1213.965) (-1213.949) [-1214.825] (-1213.347) * (-1213.312) (-1220.819) [-1213.476] (-1218.716) -- 0:00:25
684000 -- [-1213.152] (-1214.114) (-1218.687) (-1214.901) * (-1215.561) [-1217.846] (-1215.750) (-1216.291) -- 0:00:25
685000 -- (-1214.869) (-1217.320) (-1217.833) [-1214.577] * (-1214.041) (-1213.311) [-1213.157] (-1217.317) -- 0:00:25
Average standard deviation of split frequencies: 0.010079
686000 -- (-1213.152) [-1215.505] (-1214.906) (-1214.086) * (-1213.926) (-1215.867) [-1212.884] (-1215.882) -- 0:00:25
687000 -- (-1216.050) [-1214.318] (-1214.071) (-1214.215) * [-1213.014] (-1216.404) (-1217.522) (-1214.639) -- 0:00:25
688000 -- (-1218.319) [-1215.438] (-1217.197) (-1212.621) * (-1214.141) [-1214.671] (-1216.678) (-1213.160) -- 0:00:24
689000 -- (-1217.086) [-1212.977] (-1215.827) (-1213.586) * (-1215.477) (-1214.059) [-1213.429] (-1213.164) -- 0:00:24
690000 -- [-1212.821] (-1214.371) (-1216.633) (-1213.626) * [-1216.147] (-1215.356) (-1213.404) (-1215.310) -- 0:00:24
Average standard deviation of split frequencies: 0.008645
691000 -- (-1214.834) [-1213.898] (-1214.576) (-1214.714) * (-1213.905) (-1216.799) (-1215.072) [-1215.209] -- 0:00:24
692000 -- (-1213.808) [-1213.510] (-1214.202) (-1215.966) * (-1218.219) (-1215.450) (-1213.573) [-1212.982] -- 0:00:24
693000 -- (-1214.671) (-1215.820) (-1216.013) [-1213.048] * (-1215.885) (-1213.858) (-1213.617) [-1213.515] -- 0:00:24
694000 -- [-1211.630] (-1216.825) (-1219.069) (-1213.883) * [-1215.051] (-1216.815) (-1213.347) (-1216.337) -- 0:00:24
695000 -- (-1213.835) (-1214.845) (-1215.124) [-1215.443] * (-1215.328) (-1214.683) [-1212.537] (-1213.832) -- 0:00:24
Average standard deviation of split frequencies: 0.008579
696000 -- (-1212.958) (-1214.638) [-1215.171] (-1215.453) * (-1213.399) [-1214.621] (-1215.185) (-1214.145) -- 0:00:24
697000 -- [-1214.391] (-1215.373) (-1213.309) (-1215.083) * (-1215.569) [-1215.144] (-1215.010) (-1217.474) -- 0:00:24
698000 -- (-1214.726) (-1214.677) [-1215.975] (-1215.144) * (-1218.314) [-1215.566] (-1214.384) (-1213.140) -- 0:00:24
699000 -- (-1213.875) [-1212.644] (-1214.851) (-1213.780) * (-1215.200) (-1215.742) (-1212.921) [-1213.207] -- 0:00:24
700000 -- [-1216.715] (-1214.912) (-1217.732) (-1215.248) * (-1214.286) (-1216.118) (-1219.990) [-1214.294] -- 0:00:24
Average standard deviation of split frequencies: 0.008522
701000 -- (-1214.641) [-1215.656] (-1217.053) (-1214.678) * (-1213.017) (-1215.733) (-1213.835) [-1217.763] -- 0:00:23
702000 -- [-1219.564] (-1215.185) (-1214.955) (-1214.071) * [-1213.370] (-1213.804) (-1214.915) (-1212.542) -- 0:00:23
703000 -- (-1213.390) (-1214.292) [-1217.637] (-1217.415) * (-1216.605) (-1215.154) [-1213.262] (-1213.779) -- 0:00:23
704000 -- [-1216.928] (-1214.017) (-1213.304) (-1213.494) * (-1213.269) [-1216.828] (-1214.031) (-1214.214) -- 0:00:23
705000 -- (-1213.159) (-1217.279) (-1214.963) [-1215.831] * (-1215.601) (-1213.922) (-1218.306) [-1215.319] -- 0:00:23
Average standard deviation of split frequencies: 0.008458
706000 -- (-1217.371) (-1218.597) [-1215.061] (-1213.597) * (-1214.826) (-1212.595) [-1216.746] (-1214.048) -- 0:00:23
707000 -- [-1214.524] (-1216.121) (-1213.432) (-1215.001) * (-1215.298) [-1213.064] (-1214.794) (-1217.769) -- 0:00:23
708000 -- (-1213.310) [-1216.630] (-1214.313) (-1214.752) * [-1216.617] (-1214.701) (-1213.062) (-1212.747) -- 0:00:23
709000 -- (-1215.924) [-1215.035] (-1213.623) (-1213.707) * (-1213.481) [-1214.222] (-1214.020) (-1214.373) -- 0:00:23
710000 -- (-1213.269) [-1216.570] (-1216.191) (-1212.904) * (-1212.816) [-1213.584] (-1214.769) (-1213.593) -- 0:00:23
Average standard deviation of split frequencies: 0.008402
711000 -- (-1212.979) (-1218.848) (-1213.021) [-1217.896] * (-1212.918) (-1219.191) [-1216.602] (-1213.827) -- 0:00:23
712000 -- [-1214.770] (-1212.517) (-1213.278) (-1213.251) * (-1214.254) (-1214.009) (-1214.894) [-1213.183] -- 0:00:23
713000 -- (-1216.827) (-1213.321) (-1214.196) [-1213.324] * (-1215.018) [-1212.822] (-1213.281) (-1219.593) -- 0:00:22
714000 -- (-1213.100) [-1214.293] (-1213.826) (-1214.100) * (-1213.166) (-1215.186) (-1216.429) [-1217.993] -- 0:00:22
715000 -- (-1213.676) [-1213.726] (-1217.019) (-1212.376) * (-1213.132) [-1215.404] (-1212.909) (-1213.974) -- 0:00:22
Average standard deviation of split frequencies: 0.008340
716000 -- (-1213.145) (-1212.146) (-1213.820) [-1215.671] * [-1214.141] (-1216.790) (-1213.367) (-1212.827) -- 0:00:22
717000 -- [-1214.595] (-1213.127) (-1214.484) (-1213.647) * (-1219.570) (-1218.016) (-1215.865) [-1214.805] -- 0:00:22
718000 -- (-1215.952) (-1213.299) [-1218.156] (-1214.934) * (-1213.147) [-1213.505] (-1217.667) (-1213.175) -- 0:00:22
719000 -- (-1215.993) (-1214.477) [-1213.622] (-1216.571) * (-1217.355) [-1213.785] (-1214.647) (-1215.246) -- 0:00:22
720000 -- (-1213.423) [-1212.800] (-1213.304) (-1215.716) * [-1214.097] (-1213.480) (-1215.814) (-1214.181) -- 0:00:22
Average standard deviation of split frequencies: 0.008722
721000 -- [-1212.905] (-1215.474) (-1213.479) (-1214.539) * (-1214.002) [-1215.610] (-1216.779) (-1212.759) -- 0:00:22
722000 -- (-1212.955) (-1212.816) [-1217.060] (-1213.897) * (-1213.486) (-1216.971) (-1215.542) [-1213.973] -- 0:00:22
723000 -- (-1216.860) [-1214.755] (-1215.352) (-1214.457) * (-1212.928) [-1213.884] (-1213.724) (-1214.037) -- 0:00:22
724000 -- (-1213.107) (-1217.407) [-1214.922] (-1215.334) * (-1215.386) [-1215.167] (-1218.929) (-1213.634) -- 0:00:22
725000 -- (-1215.534) (-1213.464) (-1214.235) [-1215.028] * (-1214.402) (-1214.737) (-1215.838) [-1214.599] -- 0:00:22
Average standard deviation of split frequencies: 0.009090
726000 -- [-1212.498] (-1214.509) (-1218.079) (-1219.261) * [-1212.896] (-1214.872) (-1214.262) (-1215.124) -- 0:00:21
727000 -- (-1214.904) (-1214.264) [-1213.283] (-1215.966) * [-1214.735] (-1217.952) (-1213.908) (-1213.332) -- 0:00:21
728000 -- (-1214.709) (-1217.778) (-1213.671) [-1213.806] * (-1212.296) [-1214.155] (-1214.026) (-1213.377) -- 0:00:21
729000 -- (-1222.133) [-1214.106] (-1214.363) (-1215.368) * [-1213.342] (-1218.039) (-1214.511) (-1218.679) -- 0:00:21
730000 -- (-1214.761) [-1212.726] (-1213.653) (-1214.729) * [-1215.989] (-1213.233) (-1214.709) (-1215.273) -- 0:00:21
Average standard deviation of split frequencies: 0.009462
731000 -- (-1214.739) (-1217.159) [-1212.784] (-1215.789) * (-1216.917) (-1213.461) (-1216.180) [-1214.199] -- 0:00:21
732000 -- (-1214.614) [-1217.261] (-1213.392) (-1214.500) * (-1214.259) (-1215.726) (-1216.236) [-1214.759] -- 0:00:21
733000 -- (-1212.843) (-1215.739) [-1215.935] (-1214.516) * (-1215.493) [-1214.394] (-1215.753) (-1216.041) -- 0:00:21
734000 -- (-1215.836) (-1213.200) [-1214.195] (-1214.762) * (-1212.784) [-1214.175] (-1215.401) (-1216.664) -- 0:00:21
735000 -- [-1213.418] (-1217.946) (-1214.772) (-1215.924) * [-1214.554] (-1213.434) (-1212.925) (-1215.565) -- 0:00:21
Average standard deviation of split frequencies: 0.008540
736000 -- (-1214.354) (-1214.965) [-1214.302] (-1214.661) * (-1212.999) (-1213.305) [-1212.027] (-1215.412) -- 0:00:21
737000 -- [-1212.656] (-1214.864) (-1214.104) (-1215.469) * [-1217.201] (-1213.391) (-1215.040) (-1213.251) -- 0:00:21
738000 -- (-1213.423) (-1215.244) [-1213.008] (-1213.621) * (-1213.407) (-1214.109) (-1215.508) [-1214.216] -- 0:00:20
739000 -- (-1213.476) (-1216.097) [-1219.637] (-1213.824) * (-1214.813) [-1214.062] (-1214.756) (-1216.766) -- 0:00:20
740000 -- [-1214.711] (-1215.967) (-1213.878) (-1214.138) * (-1215.331) [-1214.155] (-1215.759) (-1217.739) -- 0:00:20
Average standard deviation of split frequencies: 0.008062
741000 -- (-1214.416) (-1217.570) [-1214.469] (-1217.365) * (-1213.205) [-1213.303] (-1213.684) (-1212.735) -- 0:00:20
742000 -- (-1217.347) [-1216.080] (-1215.792) (-1213.683) * (-1215.168) (-1213.556) [-1214.246] (-1212.963) -- 0:00:20
743000 -- [-1213.640] (-1215.957) (-1214.134) (-1214.194) * [-1213.573] (-1216.560) (-1214.348) (-1214.829) -- 0:00:20
744000 -- [-1213.873] (-1213.992) (-1214.437) (-1216.836) * (-1214.931) (-1213.533) (-1219.412) [-1213.645] -- 0:00:20
745000 -- (-1215.272) (-1214.482) [-1214.088] (-1215.408) * (-1215.343) [-1213.699] (-1213.936) (-1213.200) -- 0:00:20
Average standard deviation of split frequencies: 0.008847
746000 -- (-1215.803) (-1215.195) [-1214.905] (-1214.778) * (-1213.074) [-1213.908] (-1213.567) (-1212.971) -- 0:00:20
747000 -- (-1215.319) (-1214.730) (-1215.364) [-1217.446] * (-1214.471) (-1216.684) (-1216.000) [-1214.209] -- 0:00:20
748000 -- (-1213.215) (-1215.038) [-1216.858] (-1213.042) * [-1212.813] (-1215.446) (-1215.909) (-1215.092) -- 0:00:20
749000 -- (-1214.824) (-1219.605) (-1216.429) [-1212.528] * (-1214.479) (-1213.502) (-1214.255) [-1214.267] -- 0:00:20
750000 -- (-1215.916) [-1216.516] (-1214.377) (-1214.265) * (-1217.244) (-1213.788) [-1215.911] (-1216.125) -- 0:00:20
Average standard deviation of split frequencies: 0.008792
751000 -- [-1213.161] (-1217.689) (-1213.208) (-1214.810) * (-1213.319) (-1218.369) (-1218.390) [-1214.459] -- 0:00:19
752000 -- (-1213.982) [-1211.067] (-1215.759) (-1216.908) * (-1212.054) (-1214.609) [-1213.817] (-1214.106) -- 0:00:19
753000 -- [-1209.811] (-1213.990) (-1213.701) (-1214.715) * (-1213.742) (-1214.343) [-1213.389] (-1214.049) -- 0:00:19
754000 -- (-1215.225) [-1214.165] (-1213.170) (-1213.510) * [-1214.419] (-1215.521) (-1217.132) (-1214.595) -- 0:00:19
755000 -- [-1212.631] (-1215.047) (-1217.042) (-1216.721) * (-1212.616) (-1213.365) [-1214.199] (-1213.598) -- 0:00:19
Average standard deviation of split frequencies: 0.009145
756000 -- (-1212.602) [-1214.039] (-1214.179) (-1213.497) * (-1213.283) [-1214.027] (-1217.602) (-1216.130) -- 0:00:19
757000 -- [-1212.940] (-1213.831) (-1214.038) (-1212.555) * (-1213.136) [-1214.730] (-1215.726) (-1215.869) -- 0:00:19
758000 -- (-1215.047) (-1213.406) (-1213.311) [-1214.197] * (-1213.299) (-1212.738) (-1213.546) [-1213.725] -- 0:00:19
759000 -- (-1217.136) (-1217.356) [-1218.168] (-1212.987) * (-1214.210) (-1214.402) (-1216.308) [-1215.346] -- 0:00:19
760000 -- (-1215.441) (-1218.066) (-1217.866) [-1216.654] * (-1213.971) (-1215.495) (-1217.691) [-1214.939] -- 0:00:19
Average standard deviation of split frequencies: 0.008263
761000 -- (-1213.056) [-1216.669] (-1215.203) (-1212.860) * (-1216.565) (-1213.639) (-1215.236) [-1213.362] -- 0:00:19
762000 -- [-1213.192] (-1219.724) (-1215.268) (-1214.468) * (-1213.517) (-1214.576) [-1216.042] (-1214.786) -- 0:00:19
763000 -- (-1217.534) [-1217.016] (-1214.177) (-1213.809) * (-1215.699) (-1213.078) (-1216.913) [-1212.607] -- 0:00:18
764000 -- [-1213.308] (-1215.735) (-1213.385) (-1213.430) * (-1216.913) (-1218.131) [-1216.175] (-1216.546) -- 0:00:18
765000 -- (-1215.459) (-1212.762) (-1214.004) [-1214.985] * (-1216.161) [-1216.165] (-1216.586) (-1215.929) -- 0:00:18
Average standard deviation of split frequencies: 0.010257
766000 -- [-1214.891] (-1213.349) (-1214.036) (-1217.531) * [-1216.056] (-1213.271) (-1213.329) (-1212.691) -- 0:00:18
767000 -- (-1215.541) (-1214.499) [-1215.707] (-1212.669) * (-1216.519) (-1214.132) (-1212.701) [-1217.650] -- 0:00:18
768000 -- [-1212.806] (-1215.102) (-1219.011) (-1214.505) * [-1214.975] (-1214.229) (-1217.557) (-1215.917) -- 0:00:18
769000 -- (-1214.992) [-1214.875] (-1213.469) (-1212.609) * (-1213.512) (-1213.380) [-1214.088] (-1216.018) -- 0:00:18
770000 -- [-1215.040] (-1215.779) (-1214.805) (-1215.954) * (-1216.267) (-1213.938) [-1212.824] (-1214.865) -- 0:00:18
Average standard deviation of split frequencies: 0.008971
771000 -- [-1215.657] (-1218.800) (-1213.953) (-1213.286) * (-1215.846) (-1214.834) (-1214.056) [-1216.703] -- 0:00:18
772000 -- (-1214.770) (-1216.357) (-1213.242) [-1213.678] * [-1215.331] (-1213.296) (-1214.139) (-1215.871) -- 0:00:18
773000 -- (-1215.529) (-1215.258) [-1213.845] (-1213.631) * (-1218.609) (-1214.344) (-1217.308) [-1214.582] -- 0:00:18
774000 -- (-1215.318) (-1214.631) [-1213.342] (-1214.425) * (-1215.296) (-1213.766) (-1213.712) [-1217.882] -- 0:00:18
775000 -- (-1216.244) (-1213.071) [-1216.099] (-1213.660) * (-1216.600) (-1213.867) (-1213.012) [-1214.062] -- 0:00:18
Average standard deviation of split frequencies: 0.010935
776000 -- (-1225.002) (-1215.442) (-1213.743) [-1215.406] * (-1217.273) (-1214.696) [-1214.357] (-1215.924) -- 0:00:17
777000 -- (-1217.171) (-1212.624) [-1215.579] (-1216.982) * (-1214.525) [-1214.067] (-1218.083) (-1215.465) -- 0:00:17
778000 -- (-1214.029) (-1212.934) [-1215.192] (-1217.908) * [-1215.245] (-1217.176) (-1212.889) (-1214.254) -- 0:00:17
779000 -- (-1216.135) [-1213.870] (-1215.726) (-1213.291) * (-1213.936) (-1213.272) [-1213.306] (-1219.271) -- 0:00:17
780000 -- (-1217.248) (-1215.986) [-1215.116] (-1212.754) * (-1220.587) [-1212.141] (-1214.425) (-1217.829) -- 0:00:17
Average standard deviation of split frequencies: 0.010064
781000 -- (-1217.771) (-1213.161) [-1213.196] (-1213.201) * (-1215.338) (-1214.334) [-1215.892] (-1214.486) -- 0:00:17
782000 -- (-1214.643) (-1217.438) (-1214.356) [-1213.464] * (-1214.540) (-1213.964) [-1214.848] (-1213.917) -- 0:00:17
783000 -- (-1212.611) [-1213.011] (-1213.486) (-1213.283) * [-1214.290] (-1216.577) (-1216.070) (-1217.794) -- 0:00:17
784000 -- (-1219.929) [-1216.965] (-1215.038) (-1213.052) * [-1215.575] (-1216.533) (-1216.574) (-1218.981) -- 0:00:17
785000 -- (-1216.720) (-1214.913) [-1215.762] (-1212.921) * [-1213.359] (-1217.476) (-1213.357) (-1219.406) -- 0:00:17
Average standard deviation of split frequencies: 0.009596
786000 -- (-1214.495) [-1214.958] (-1214.441) (-1212.868) * (-1213.767) (-1212.675) [-1213.170] (-1213.587) -- 0:00:17
787000 -- [-1213.638] (-1218.311) (-1212.890) (-1212.525) * (-1216.407) (-1220.571) (-1215.438) [-1213.404] -- 0:00:17
788000 -- (-1214.892) [-1216.520] (-1214.343) (-1214.858) * (-1215.405) [-1214.104] (-1216.363) (-1213.699) -- 0:00:16
789000 -- (-1216.390) [-1214.099] (-1213.988) (-1215.399) * (-1214.901) (-1215.030) [-1212.893] (-1214.222) -- 0:00:16
790000 -- (-1214.112) (-1218.990) (-1216.931) [-1214.173] * (-1212.776) (-1214.341) (-1214.043) [-1213.315] -- 0:00:16
Average standard deviation of split frequencies: 0.007949
791000 -- [-1212.678] (-1214.122) (-1215.831) (-1215.012) * [-1214.143] (-1213.663) (-1214.103) (-1216.198) -- 0:00:16
792000 -- [-1213.806] (-1214.153) (-1213.534) (-1218.395) * (-1215.921) (-1213.707) [-1215.534] (-1215.002) -- 0:00:16
793000 -- (-1212.604) [-1214.918] (-1213.390) (-1212.781) * (-1212.720) (-1213.149) [-1217.000] (-1212.200) -- 0:00:16
794000 -- (-1214.021) [-1215.192] (-1215.253) (-1215.424) * (-1212.858) (-1213.487) (-1214.973) [-1214.462] -- 0:00:16
795000 -- (-1213.826) [-1213.608] (-1218.309) (-1215.580) * [-1213.186] (-1214.919) (-1218.525) (-1214.791) -- 0:00:16
Average standard deviation of split frequencies: 0.005922
796000 -- (-1214.754) [-1213.429] (-1214.132) (-1215.074) * (-1219.498) (-1214.362) [-1213.023] (-1225.585) -- 0:00:16
797000 -- [-1213.085] (-1215.818) (-1217.553) (-1212.504) * (-1213.585) (-1217.854) [-1217.882] (-1217.253) -- 0:00:16
798000 -- (-1213.374) [-1214.452] (-1217.374) (-1213.647) * (-1215.233) [-1215.088] (-1214.178) (-1212.794) -- 0:00:16
799000 -- (-1214.839) [-1214.198] (-1214.235) (-1220.544) * (-1213.009) (-1214.014) [-1212.985] (-1217.158) -- 0:00:16
800000 -- [-1215.004] (-1214.704) (-1216.951) (-1214.208) * (-1214.034) [-1212.638] (-1212.973) (-1213.914) -- 0:00:16
Average standard deviation of split frequencies: 0.005888
801000 -- (-1214.739) (-1218.751) [-1214.880] (-1212.960) * (-1213.075) (-1212.827) (-1215.084) [-1213.615] -- 0:00:15
802000 -- [-1212.740] (-1214.412) (-1212.406) (-1213.475) * (-1214.334) (-1213.632) (-1216.363) [-1213.556] -- 0:00:15
803000 -- [-1213.570] (-1213.425) (-1215.093) (-1213.631) * (-1213.670) (-1214.147) [-1213.378] (-1212.748) -- 0:00:15
804000 -- (-1212.726) (-1214.662) (-1213.167) [-1212.505] * (-1215.101) [-1215.250] (-1213.851) (-1213.863) -- 0:00:15
805000 -- (-1214.256) (-1214.388) [-1213.260] (-1214.716) * [-1213.330] (-1214.392) (-1212.621) (-1213.879) -- 0:00:15
Average standard deviation of split frequencies: 0.005849
806000 -- (-1215.876) [-1214.210] (-1214.340) (-1216.572) * (-1214.516) (-1215.181) (-1217.487) [-1213.874] -- 0:00:15
807000 -- [-1213.827] (-1214.366) (-1214.274) (-1213.245) * (-1213.072) [-1213.467] (-1213.166) (-1213.109) -- 0:00:15
808000 -- [-1213.741] (-1217.147) (-1212.953) (-1215.971) * [-1213.989] (-1215.751) (-1213.047) (-1213.320) -- 0:00:15
809000 -- (-1213.907) (-1214.610) [-1214.607] (-1215.671) * [-1212.818] (-1214.852) (-1213.587) (-1215.654) -- 0:00:15
810000 -- (-1213.720) (-1217.132) [-1213.470] (-1216.536) * (-1213.562) [-1213.257] (-1216.829) (-1217.374) -- 0:00:15
Average standard deviation of split frequencies: 0.005427
811000 -- (-1217.551) [-1213.301] (-1215.857) (-1212.918) * (-1217.357) (-1215.697) [-1213.049] (-1212.937) -- 0:00:15
812000 -- [-1214.386] (-1213.228) (-1214.712) (-1213.737) * (-1215.919) (-1216.846) [-1214.762] (-1213.695) -- 0:00:15
813000 -- (-1214.019) [-1213.300] (-1213.564) (-1214.196) * (-1212.769) [-1213.572] (-1216.055) (-1213.194) -- 0:00:14
814000 -- (-1213.312) [-1214.680] (-1213.284) (-1215.305) * [-1213.472] (-1213.533) (-1215.488) (-1215.085) -- 0:00:14
815000 -- [-1213.576] (-1213.505) (-1217.282) (-1215.704) * (-1215.765) (-1215.020) [-1215.419] (-1217.643) -- 0:00:14
Average standard deviation of split frequencies: 0.006162
816000 -- [-1217.312] (-1214.016) (-1217.673) (-1215.096) * (-1214.612) (-1214.915) [-1216.150] (-1212.842) -- 0:00:14
817000 -- (-1216.054) [-1217.612] (-1214.183) (-1215.693) * [-1214.787] (-1215.809) (-1216.937) (-1215.780) -- 0:00:14
818000 -- (-1213.855) (-1213.419) (-1217.806) [-1217.535] * (-1215.898) (-1217.579) [-1215.298] (-1213.616) -- 0:00:14
819000 -- [-1213.702] (-1213.917) (-1213.239) (-1213.156) * (-1215.449) (-1213.603) [-1213.253] (-1215.838) -- 0:00:14
820000 -- (-1213.732) (-1213.122) [-1214.707] (-1213.338) * (-1214.652) (-1215.300) (-1214.334) [-1214.376] -- 0:00:14
Average standard deviation of split frequencies: 0.006893
821000 -- (-1213.559) (-1214.051) (-1213.963) [-1212.524] * [-1215.350] (-1214.422) (-1213.467) (-1215.481) -- 0:00:14
822000 -- (-1213.662) (-1214.768) (-1214.336) [-1214.084] * (-1225.817) (-1214.777) [-1214.828] (-1216.313) -- 0:00:14
823000 -- (-1212.417) (-1216.948) [-1213.270] (-1213.668) * [-1213.168] (-1214.960) (-1214.839) (-1216.272) -- 0:00:14
824000 -- (-1214.648) (-1215.838) [-1215.491] (-1214.527) * [-1214.350] (-1213.823) (-1214.812) (-1212.661) -- 0:00:14
825000 -- [-1214.294] (-1215.817) (-1215.498) (-1212.920) * (-1211.827) (-1212.758) [-1221.047] (-1216.895) -- 0:00:14
Average standard deviation of split frequencies: 0.006468
826000 -- [-1215.154] (-1213.690) (-1214.391) (-1213.984) * [-1213.604] (-1215.243) (-1214.003) (-1217.205) -- 0:00:13
827000 -- (-1214.582) (-1216.051) [-1213.209] (-1213.599) * (-1212.208) (-1215.939) [-1213.976] (-1216.797) -- 0:00:13
828000 -- (-1214.336) (-1218.169) (-1213.662) [-1213.175] * (-1213.624) [-1214.126] (-1213.690) (-1217.218) -- 0:00:13
829000 -- (-1213.223) [-1213.078] (-1214.959) (-1214.775) * [-1213.289] (-1213.246) (-1213.881) (-1215.357) -- 0:00:13
830000 -- (-1213.132) [-1213.589] (-1216.872) (-1213.257) * (-1213.929) [-1212.901] (-1215.391) (-1214.743) -- 0:00:13
Average standard deviation of split frequencies: 0.007188
831000 -- (-1215.375) [-1213.851] (-1221.720) (-1216.676) * (-1212.446) (-1216.602) [-1216.194] (-1213.508) -- 0:00:13
832000 -- (-1214.143) (-1212.925) [-1219.853] (-1213.696) * (-1213.655) (-1213.907) [-1212.673] (-1215.818) -- 0:00:13
833000 -- (-1212.093) (-1214.418) (-1215.317) [-1212.817] * [-1214.634] (-1214.471) (-1213.237) (-1219.777) -- 0:00:13
834000 -- (-1216.361) [-1214.348] (-1215.439) (-1213.055) * (-1214.718) (-1213.802) (-1214.098) [-1213.128] -- 0:00:13
835000 -- (-1213.489) (-1214.094) (-1213.877) [-1214.422] * [-1215.371] (-1214.081) (-1214.390) (-1216.305) -- 0:00:13
Average standard deviation of split frequencies: 0.007894
836000 -- [-1214.314] (-1214.667) (-1214.880) (-1217.856) * [-1214.415] (-1214.805) (-1213.986) (-1214.246) -- 0:00:13
837000 -- (-1218.618) (-1215.022) [-1213.661] (-1213.136) * (-1214.577) (-1213.470) (-1214.024) [-1215.798] -- 0:00:13
838000 -- [-1215.011] (-1213.328) (-1212.967) (-1217.925) * (-1214.546) (-1214.481) (-1216.115) [-1213.161] -- 0:00:12
839000 -- [-1214.627] (-1213.904) (-1212.909) (-1214.881) * (-1216.463) (-1215.269) (-1215.523) [-1216.741] -- 0:00:12
840000 -- [-1214.979] (-1216.381) (-1214.700) (-1213.547) * (-1212.888) [-1215.656] (-1213.229) (-1215.797) -- 0:00:12
Average standard deviation of split frequencies: 0.008224
841000 -- (-1215.220) (-1213.016) [-1214.833] (-1212.581) * (-1213.113) [-1213.937] (-1213.666) (-1214.194) -- 0:00:12
842000 -- (-1215.013) [-1213.313] (-1216.903) (-1214.031) * (-1213.255) (-1213.734) (-1214.598) [-1213.426] -- 0:00:12
843000 -- (-1213.414) (-1213.306) [-1213.681] (-1216.642) * (-1216.556) [-1213.670] (-1218.403) (-1214.996) -- 0:00:12
844000 -- [-1215.510] (-1214.918) (-1214.138) (-1215.449) * [-1213.457] (-1213.129) (-1219.670) (-1217.293) -- 0:00:12
845000 -- (-1217.051) [-1215.262] (-1215.600) (-1215.169) * (-1214.516) (-1215.696) [-1216.534] (-1217.629) -- 0:00:12
Average standard deviation of split frequencies: 0.008172
846000 -- [-1213.859] (-1215.795) (-1214.884) (-1213.932) * (-1212.836) [-1220.747] (-1214.105) (-1213.435) -- 0:00:12
847000 -- (-1215.974) (-1214.809) (-1213.098) [-1215.889] * (-1212.819) (-1212.249) [-1213.354] (-1213.859) -- 0:00:12
848000 -- (-1213.961) [-1216.151] (-1213.376) (-1211.122) * (-1212.858) (-1214.815) [-1214.984] (-1212.609) -- 0:00:12
849000 -- (-1215.501) [-1212.603] (-1214.922) (-1213.430) * (-1214.645) (-1213.453) [-1213.610] (-1212.960) -- 0:00:12
850000 -- (-1214.587) (-1213.772) (-1213.893) [-1213.723] * (-1212.342) [-1213.694] (-1214.221) (-1216.990) -- 0:00:12
Average standard deviation of split frequencies: 0.008867
851000 -- (-1215.394) (-1215.239) [-1213.532] (-1216.263) * [-1214.251] (-1214.597) (-1213.081) (-1213.099) -- 0:00:11
852000 -- (-1213.490) (-1215.557) (-1214.139) [-1214.535] * (-1214.419) [-1214.143] (-1214.445) (-1213.275) -- 0:00:11
853000 -- (-1214.485) [-1214.758] (-1216.456) (-1214.624) * [-1213.653] (-1216.761) (-1215.139) (-1213.556) -- 0:00:11
854000 -- (-1214.855) (-1216.555) (-1214.060) [-1216.366] * [-1214.008] (-1216.654) (-1214.423) (-1215.549) -- 0:00:11
855000 -- (-1213.064) [-1213.141] (-1215.665) (-1215.151) * [-1212.549] (-1214.999) (-1213.012) (-1213.441) -- 0:00:11
Average standard deviation of split frequencies: 0.009178
856000 -- (-1214.366) (-1213.834) [-1213.437] (-1216.779) * (-1214.123) [-1213.154] (-1213.332) (-1216.117) -- 0:00:11
857000 -- (-1213.083) (-1213.419) (-1212.856) [-1213.643] * [-1216.492] (-1214.556) (-1216.774) (-1216.037) -- 0:00:11
858000 -- [-1213.555] (-1212.840) (-1213.610) (-1213.517) * [-1213.868] (-1212.871) (-1214.945) (-1213.637) -- 0:00:11
859000 -- (-1213.193) (-1214.986) [-1213.670] (-1217.978) * (-1215.862) [-1213.373] (-1213.248) (-1212.807) -- 0:00:11
860000 -- (-1214.028) [-1215.168] (-1213.998) (-1218.698) * [-1214.058] (-1213.079) (-1212.622) (-1214.693) -- 0:00:11
Average standard deviation of split frequencies: 0.008398
861000 -- (-1213.602) (-1216.769) (-1213.026) [-1215.528] * [-1213.086] (-1214.251) (-1214.740) (-1215.876) -- 0:00:11
862000 -- (-1215.117) (-1213.987) (-1215.791) [-1212.858] * (-1214.806) (-1214.324) [-1213.457] (-1214.306) -- 0:00:11
863000 -- (-1213.943) [-1215.535] (-1214.676) (-1215.027) * [-1212.908] (-1214.754) (-1213.964) (-1214.098) -- 0:00:10
864000 -- (-1212.953) (-1215.065) [-1213.939] (-1214.363) * (-1213.094) [-1213.200] (-1214.951) (-1213.386) -- 0:00:10
865000 -- (-1214.351) [-1213.887] (-1212.775) (-1214.009) * (-1217.153) (-1214.250) [-1213.649] (-1213.167) -- 0:00:10
Average standard deviation of split frequencies: 0.007621
866000 -- (-1214.689) [-1214.900] (-1215.114) (-1212.684) * (-1213.864) (-1215.289) [-1214.265] (-1215.938) -- 0:00:10
867000 -- (-1215.176) (-1213.766) [-1213.043] (-1213.629) * (-1213.105) (-1215.702) (-1215.371) [-1214.602] -- 0:00:10
868000 -- (-1215.860) [-1216.158] (-1213.144) (-1215.207) * (-1214.118) (-1215.458) (-1215.734) [-1213.849] -- 0:00:10
869000 -- [-1216.183] (-1215.475) (-1215.510) (-1213.785) * [-1213.462] (-1213.703) (-1214.059) (-1212.948) -- 0:00:10
870000 -- (-1215.745) (-1213.696) [-1213.950] (-1218.010) * (-1213.254) (-1212.986) [-1213.732] (-1213.523) -- 0:00:10
Average standard deviation of split frequencies: 0.008302
871000 -- (-1219.051) (-1213.500) (-1213.307) [-1213.785] * (-1213.818) [-1213.858] (-1213.373) (-1213.109) -- 0:00:10
872000 -- (-1213.132) (-1213.794) (-1213.739) [-1213.520] * [-1212.592] (-1213.332) (-1212.727) (-1215.907) -- 0:00:10
873000 -- (-1214.437) [-1213.345] (-1217.485) (-1213.248) * (-1214.345) [-1216.624] (-1212.989) (-1217.577) -- 0:00:10
874000 -- (-1214.080) (-1212.749) (-1213.040) [-1214.709] * [-1212.626] (-1217.223) (-1215.687) (-1215.158) -- 0:00:10
875000 -- (-1224.674) (-1214.811) [-1215.179] (-1215.005) * (-1214.296) (-1213.932) (-1215.418) [-1213.901] -- 0:00:10
Average standard deviation of split frequencies: 0.009328
876000 -- (-1215.631) (-1213.203) (-1213.900) [-1216.415] * (-1215.624) [-1214.299] (-1214.467) (-1213.711) -- 0:00:09
877000 -- [-1214.235] (-1213.510) (-1212.001) (-1215.289) * (-1215.419) [-1213.226] (-1216.053) (-1215.654) -- 0:00:09
878000 -- (-1213.666) (-1215.981) [-1212.820] (-1213.749) * (-1213.566) (-1213.392) [-1215.797] (-1213.638) -- 0:00:09
879000 -- (-1212.774) (-1216.823) [-1216.640] (-1218.526) * (-1215.465) (-1215.134) [-1213.419] (-1213.492) -- 0:00:09
880000 -- (-1217.207) (-1213.842) [-1212.386] (-1214.267) * [-1212.577] (-1218.311) (-1216.423) (-1213.697) -- 0:00:09
Average standard deviation of split frequencies: 0.009635
881000 -- (-1212.872) (-1215.000) [-1217.918] (-1214.228) * (-1213.209) (-1214.037) [-1212.898] (-1213.485) -- 0:00:09
882000 -- (-1214.802) (-1215.271) [-1214.533] (-1215.213) * (-1214.184) (-1213.144) (-1213.875) [-1214.041] -- 0:00:09
883000 -- (-1213.675) (-1212.712) [-1211.923] (-1213.800) * (-1213.203) (-1214.238) (-1216.527) [-1212.812] -- 0:00:09
884000 -- (-1216.610) (-1213.504) [-1211.502] (-1214.896) * (-1212.757) [-1212.734] (-1215.403) (-1212.691) -- 0:00:09
885000 -- (-1218.732) [-1213.602] (-1216.735) (-1213.822) * (-1215.332) [-1213.570] (-1214.383) (-1214.243) -- 0:00:09
Average standard deviation of split frequencies: 0.009222
886000 -- (-1213.219) (-1215.446) [-1213.970] (-1213.035) * (-1215.011) (-1215.724) [-1213.730] (-1212.718) -- 0:00:09
887000 -- (-1215.197) (-1214.869) [-1212.662] (-1213.218) * (-1214.223) [-1219.516] (-1214.261) (-1213.662) -- 0:00:09
888000 -- (-1213.358) (-1216.323) [-1212.628] (-1218.319) * (-1213.911) [-1213.827] (-1216.731) (-1214.186) -- 0:00:08
889000 -- (-1212.975) (-1214.137) [-1217.694] (-1214.651) * (-1213.453) (-1216.147) [-1215.162] (-1212.889) -- 0:00:08
890000 -- (-1214.619) (-1213.236) [-1211.350] (-1216.832) * [-1212.924] (-1214.473) (-1212.800) (-1212.600) -- 0:00:08
Average standard deviation of split frequencies: 0.009527
891000 -- (-1212.828) (-1214.240) [-1213.134] (-1213.321) * (-1212.921) (-1214.528) [-1216.968] (-1214.792) -- 0:00:08
892000 -- (-1214.119) [-1213.547] (-1214.733) (-1214.344) * [-1213.025] (-1215.709) (-1214.087) (-1213.395) -- 0:00:08
893000 -- (-1215.993) [-1215.425] (-1214.180) (-1214.591) * (-1213.547) (-1212.547) [-1213.660] (-1213.937) -- 0:00:08
894000 -- [-1214.741] (-1213.482) (-1213.973) (-1213.281) * (-1213.471) (-1213.605) (-1217.355) [-1213.437] -- 0:00:08
895000 -- [-1213.575] (-1213.027) (-1212.505) (-1218.529) * (-1215.737) [-1215.084] (-1214.672) (-1213.571) -- 0:00:08
Average standard deviation of split frequencies: 0.010522
896000 -- (-1217.205) [-1213.780] (-1220.108) (-1214.112) * (-1214.962) (-1212.687) (-1215.779) [-1212.731] -- 0:00:08
897000 -- (-1214.082) (-1214.423) (-1213.269) [-1215.341] * (-1215.140) (-1213.632) [-1217.976] (-1215.861) -- 0:00:08
898000 -- (-1215.699) (-1215.261) (-1214.971) [-1215.806] * (-1216.968) (-1213.203) (-1213.288) [-1213.136] -- 0:00:08
899000 -- (-1214.180) [-1215.069] (-1212.527) (-1215.083) * (-1215.453) [-1213.309] (-1215.119) (-1216.495) -- 0:00:08
900000 -- (-1214.743) (-1214.882) [-1213.726] (-1214.269) * (-1213.461) (-1212.712) [-1213.738] (-1213.548) -- 0:00:08
Average standard deviation of split frequencies: 0.010468
901000 -- (-1217.062) [-1214.142] (-1213.234) (-1217.247) * (-1214.218) (-1213.373) [-1216.674] (-1216.363) -- 0:00:07
902000 -- (-1213.900) (-1214.969) [-1216.111] (-1217.108) * [-1214.145] (-1213.906) (-1214.222) (-1215.420) -- 0:00:07
903000 -- [-1212.072] (-1215.566) (-1216.578) (-1214.925) * (-1214.012) [-1218.698] (-1216.633) (-1213.215) -- 0:00:07
904000 -- (-1212.960) (-1221.790) (-1217.263) [-1213.150] * (-1218.371) (-1218.681) (-1213.379) [-1216.879] -- 0:00:07
905000 -- [-1212.756] (-1214.276) (-1215.540) (-1213.731) * (-1215.984) (-1215.197) (-1220.498) [-1215.075] -- 0:00:07
Average standard deviation of split frequencies: 0.011100
906000 -- (-1213.848) [-1214.492] (-1213.885) (-1214.867) * (-1214.573) (-1214.763) (-1214.654) [-1212.863] -- 0:00:07
907000 -- [-1217.375] (-1212.984) (-1214.971) (-1221.226) * (-1215.943) (-1214.287) (-1213.650) [-1213.351] -- 0:00:07
908000 -- [-1216.435] (-1214.718) (-1213.287) (-1214.078) * [-1213.395] (-1213.509) (-1213.385) (-1214.037) -- 0:00:07
909000 -- [-1216.082] (-1215.533) (-1213.146) (-1213.807) * (-1212.952) (-1215.628) [-1213.457] (-1213.520) -- 0:00:07
910000 -- [-1214.040] (-1215.412) (-1213.030) (-1214.582) * (-1214.030) (-1213.288) (-1214.236) [-1213.715] -- 0:00:07
Average standard deviation of split frequencies: 0.011388
911000 -- (-1218.423) (-1215.857) [-1213.069] (-1212.103) * [-1216.902] (-1212.786) (-1224.456) (-1215.073) -- 0:00:07
912000 -- (-1214.284) (-1213.684) [-1214.211] (-1213.312) * (-1214.887) (-1213.682) [-1213.398] (-1215.117) -- 0:00:07
913000 -- (-1214.053) [-1215.232] (-1214.141) (-1214.800) * [-1214.120] (-1212.802) (-1216.709) (-1216.302) -- 0:00:06
914000 -- (-1215.283) (-1216.529) [-1214.491] (-1214.880) * [-1213.280] (-1214.046) (-1216.243) (-1216.877) -- 0:00:06
915000 -- [-1212.840] (-1215.035) (-1213.553) (-1213.656) * (-1215.632) [-1216.937] (-1213.520) (-1216.714) -- 0:00:06
Average standard deviation of split frequencies: 0.011665
916000 -- (-1214.297) (-1214.099) (-1215.367) [-1215.386] * (-1217.260) (-1216.208) (-1212.962) [-1215.751] -- 0:00:06
917000 -- [-1215.584] (-1216.619) (-1214.533) (-1213.741) * (-1213.378) (-1216.854) [-1212.613] (-1219.840) -- 0:00:06
918000 -- [-1212.639] (-1214.845) (-1218.111) (-1215.375) * (-1215.509) (-1217.085) (-1214.288) [-1213.661] -- 0:00:06
919000 -- (-1214.351) [-1214.820] (-1214.195) (-1215.201) * (-1215.834) [-1213.572] (-1213.013) (-1216.532) -- 0:00:06
920000 -- (-1214.578) (-1215.911) (-1213.125) [-1213.909] * (-1214.144) [-1213.802] (-1219.547) (-1219.249) -- 0:00:06
Average standard deviation of split frequencies: 0.011606
921000 -- [-1213.874] (-1213.243) (-1214.688) (-1214.713) * [-1214.692] (-1215.201) (-1218.135) (-1213.495) -- 0:00:06
922000 -- [-1215.332] (-1213.802) (-1213.596) (-1213.661) * (-1214.503) [-1216.777] (-1213.672) (-1215.015) -- 0:00:06
923000 -- (-1214.190) [-1213.658] (-1211.575) (-1214.453) * (-1213.662) [-1215.532] (-1214.377) (-1214.171) -- 0:00:06
924000 -- (-1215.339) (-1213.943) [-1213.427] (-1213.549) * (-1216.872) (-1213.052) [-1213.465] (-1215.810) -- 0:00:06
925000 -- (-1213.474) [-1213.642] (-1214.368) (-1213.267) * (-1214.544) (-1219.503) (-1217.094) [-1214.631] -- 0:00:06
Average standard deviation of split frequencies: 0.011539
926000 -- (-1213.683) (-1218.837) [-1213.951] (-1213.342) * (-1212.808) (-1217.135) (-1216.097) [-1211.910] -- 0:00:05
927000 -- [-1214.120] (-1213.951) (-1212.741) (-1215.254) * (-1213.009) [-1216.211] (-1218.016) (-1214.769) -- 0:00:05
928000 -- [-1213.220] (-1215.283) (-1213.652) (-1214.058) * (-1212.673) [-1215.252] (-1212.863) (-1213.859) -- 0:00:05
929000 -- (-1219.731) (-1216.216) [-1213.878] (-1212.629) * (-1223.053) (-1214.252) (-1212.684) [-1212.689] -- 0:00:05
930000 -- (-1214.754) [-1215.202] (-1215.763) (-1217.096) * (-1216.197) (-1216.039) (-1217.054) [-1214.239] -- 0:00:05
Average standard deviation of split frequencies: 0.011481
931000 -- [-1213.988] (-1213.421) (-1219.544) (-1215.279) * (-1213.557) (-1213.724) (-1214.236) [-1214.159] -- 0:00:05
932000 -- (-1213.514) (-1215.313) (-1214.184) [-1216.938] * (-1215.125) (-1212.563) (-1216.215) [-1213.487] -- 0:00:05
933000 -- [-1216.405] (-1215.834) (-1213.636) (-1217.771) * (-1213.679) (-1213.656) [-1214.338] (-1212.885) -- 0:00:05
934000 -- [-1214.011] (-1214.511) (-1212.782) (-1213.353) * (-1215.710) [-1215.979] (-1215.275) (-1215.741) -- 0:00:05
935000 -- (-1214.740) [-1212.789] (-1213.274) (-1216.621) * (-1215.082) (-1212.495) (-1214.386) [-1215.741] -- 0:00:05
Average standard deviation of split frequencies: 0.010744
936000 -- [-1214.186] (-1214.344) (-1214.019) (-1217.961) * [-1213.189] (-1218.232) (-1215.488) (-1219.660) -- 0:00:05
937000 -- [-1214.251] (-1215.400) (-1214.265) (-1214.556) * (-1213.580) (-1214.234) (-1213.212) [-1216.056] -- 0:00:04
938000 -- (-1214.228) [-1215.027] (-1214.739) (-1213.781) * (-1214.245) [-1215.158] (-1216.320) (-1214.259) -- 0:00:04
939000 -- (-1213.610) [-1213.539] (-1212.973) (-1218.035) * [-1213.303] (-1214.715) (-1212.815) (-1215.175) -- 0:00:04
940000 -- [-1215.121] (-1215.038) (-1215.530) (-1214.647) * (-1214.429) (-1218.676) [-1218.431] (-1228.982) -- 0:00:04
Average standard deviation of split frequencies: 0.011693
941000 -- (-1215.259) [-1216.172] (-1212.642) (-1218.638) * (-1216.158) (-1213.600) (-1215.198) [-1213.411] -- 0:00:04
942000 -- (-1215.871) (-1213.135) (-1215.861) [-1213.624] * (-1215.469) [-1214.883] (-1218.552) (-1212.798) -- 0:00:04
943000 -- (-1214.118) (-1214.335) [-1214.267] (-1216.054) * (-1221.366) (-1213.193) (-1214.324) [-1212.861] -- 0:00:04
944000 -- (-1216.152) (-1213.378) (-1214.156) [-1215.280] * [-1214.372] (-1216.369) (-1215.159) (-1213.303) -- 0:00:04
945000 -- (-1212.611) (-1214.795) [-1213.964] (-1214.432) * (-1214.361) (-1214.677) (-1214.083) [-1214.635] -- 0:00:04
Average standard deviation of split frequencies: 0.012956
946000 -- (-1213.319) (-1212.795) (-1213.102) [-1213.668] * (-1213.871) [-1215.202] (-1213.392) (-1215.891) -- 0:00:04
947000 -- (-1216.861) (-1214.504) (-1216.948) [-1215.860] * (-1217.484) (-1214.107) [-1214.331] (-1216.043) -- 0:00:04
948000 -- (-1216.575) [-1213.858] (-1215.540) (-1215.356) * [-1214.041] (-1213.341) (-1213.691) (-1214.142) -- 0:00:04
949000 -- [-1214.696] (-1216.236) (-1219.681) (-1215.465) * (-1213.993) (-1213.751) (-1214.536) [-1213.156] -- 0:00:04
950000 -- (-1217.504) (-1213.267) [-1216.173] (-1223.667) * (-1218.850) (-1213.122) (-1219.877) [-1215.071] -- 0:00:03
Average standard deviation of split frequencies: 0.012562
951000 -- [-1214.591] (-1216.157) (-1214.374) (-1216.209) * (-1215.925) (-1214.861) [-1215.237] (-1213.466) -- 0:00:03
952000 -- (-1213.036) (-1218.212) [-1213.854] (-1216.589) * (-1213.250) (-1217.542) [-1213.196] (-1214.535) -- 0:00:03
953000 -- (-1216.451) (-1213.277) [-1214.656] (-1214.338) * (-1214.089) (-1214.204) [-1215.716] (-1213.426) -- 0:00:03
954000 -- (-1212.638) [-1214.773] (-1214.079) (-1213.614) * (-1215.052) (-1213.377) (-1214.100) [-1213.550] -- 0:00:03
955000 -- (-1216.930) [-1214.624] (-1214.124) (-1214.887) * (-1217.211) (-1219.123) [-1216.820] (-1214.970) -- 0:00:03
Average standard deviation of split frequencies: 0.013478
956000 -- (-1214.049) (-1214.607) (-1219.104) [-1214.455] * (-1215.156) (-1213.714) (-1214.431) [-1212.269] -- 0:00:03
957000 -- (-1213.659) (-1214.148) [-1215.528] (-1214.487) * (-1215.596) [-1212.904] (-1216.896) (-1211.767) -- 0:00:03
958000 -- [-1213.689] (-1214.710) (-1217.113) (-1220.869) * (-1213.478) [-1211.991] (-1214.517) (-1215.321) -- 0:00:03
959000 -- (-1214.562) [-1214.055] (-1216.676) (-1213.423) * (-1215.781) (-1215.263) [-1213.782] (-1212.836) -- 0:00:03
960000 -- (-1214.961) (-1216.899) [-1212.673] (-1215.890) * (-1213.476) (-1218.535) [-1214.438] (-1214.501) -- 0:00:03
Average standard deviation of split frequencies: 0.013413
961000 -- [-1213.833] (-1213.667) (-1214.504) (-1217.029) * (-1214.042) (-1213.013) (-1212.746) [-1214.847] -- 0:00:03
962000 -- (-1216.756) (-1213.690) (-1214.701) [-1213.364] * (-1215.400) [-1213.210] (-1212.229) (-1215.010) -- 0:00:03
963000 -- (-1213.170) [-1212.627] (-1212.992) (-1214.570) * (-1214.770) [-1213.209] (-1213.505) (-1222.818) -- 0:00:02
964000 -- (-1214.189) [-1213.177] (-1213.834) (-1214.999) * [-1210.857] (-1217.253) (-1213.839) (-1213.863) -- 0:00:02
965000 -- (-1213.776) (-1213.895) (-1215.582) [-1215.711] * (-1214.870) [-1213.395] (-1215.563) (-1213.632) -- 0:00:02
Average standard deviation of split frequencies: 0.011712
966000 -- [-1215.280] (-1213.721) (-1213.372) (-1215.302) * (-1213.094) (-1216.580) (-1215.238) [-1215.272] -- 0:00:02
967000 -- [-1214.959] (-1213.458) (-1218.736) (-1218.209) * (-1213.985) (-1213.209) [-1213.815] (-1216.691) -- 0:00:02
968000 -- (-1220.929) [-1214.648] (-1214.427) (-1219.965) * [-1213.641] (-1214.810) (-1216.772) (-1215.247) -- 0:00:02
969000 -- (-1215.192) (-1213.686) [-1217.727] (-1214.701) * [-1213.345] (-1212.823) (-1215.654) (-1217.587) -- 0:00:02
970000 -- (-1215.049) (-1213.339) (-1211.706) [-1211.485] * (-1213.078) [-1213.752] (-1212.796) (-1214.473) -- 0:00:02
Average standard deviation of split frequencies: 0.011332
971000 -- (-1214.802) [-1213.213] (-1217.442) (-1216.016) * (-1217.371) (-1214.254) [-1212.970] (-1214.278) -- 0:00:02
972000 -- (-1215.261) (-1215.092) (-1213.998) [-1213.199] * (-1216.939) [-1216.929] (-1213.762) (-1214.809) -- 0:00:02
973000 -- [-1213.136] (-1215.484) (-1214.336) (-1213.436) * (-1213.653) [-1216.789] (-1215.367) (-1214.394) -- 0:00:02
974000 -- [-1214.607] (-1216.599) (-1213.905) (-1215.133) * (-1214.041) (-1218.648) (-1214.529) [-1214.109] -- 0:00:02
975000 -- (-1212.699) [-1212.963] (-1215.345) (-1213.694) * (-1212.823) (-1213.383) [-1216.902] (-1215.932) -- 0:00:01
Average standard deviation of split frequencies: 0.010948
976000 -- (-1217.013) (-1215.459) [-1215.272] (-1213.527) * (-1214.392) [-1214.564] (-1214.646) (-1213.752) -- 0:00:01
977000 -- (-1214.671) (-1214.441) (-1213.896) [-1216.511] * (-1213.047) (-1221.305) [-1213.252] (-1212.712) -- 0:00:01
978000 -- (-1214.228) (-1214.623) (-1214.194) [-1216.210] * [-1212.892] (-1217.407) (-1215.982) (-1214.755) -- 0:00:01
979000 -- [-1213.690] (-1216.448) (-1217.866) (-1215.072) * (-1214.621) (-1216.526) [-1213.829] (-1213.661) -- 0:00:01
980000 -- (-1214.355) [-1215.147] (-1214.255) (-1214.751) * (-1213.694) (-1217.028) [-1212.297] (-1212.691) -- 0:00:01
Average standard deviation of split frequencies: 0.010575
981000 -- (-1217.835) [-1216.153] (-1213.984) (-1213.601) * (-1216.693) (-1214.763) (-1214.591) [-1216.195] -- 0:00:01
982000 -- (-1215.801) (-1214.019) (-1215.163) [-1215.652] * (-1217.015) [-1212.589] (-1215.978) (-1216.938) -- 0:00:01
983000 -- (-1215.910) (-1212.583) (-1213.905) [-1214.388] * (-1216.350) (-1212.717) [-1215.283] (-1212.884) -- 0:00:01
984000 -- (-1216.620) [-1213.350] (-1214.730) (-1215.132) * [-1215.044] (-1216.234) (-1212.944) (-1215.877) -- 0:00:01
985000 -- (-1213.688) (-1214.662) (-1213.437) [-1212.584] * (-1215.323) [-1214.164] (-1213.580) (-1215.071) -- 0:00:01
Average standard deviation of split frequencies: 0.011156
986000 -- (-1213.758) [-1213.662] (-1215.241) (-1213.494) * (-1216.939) [-1213.595] (-1215.209) (-1214.079) -- 0:00:01
987000 -- (-1215.105) (-1218.632) [-1215.135] (-1213.552) * [-1213.003] (-1214.267) (-1216.522) (-1213.420) -- 0:00:01
988000 -- (-1214.693) (-1220.849) [-1212.424] (-1217.115) * (-1217.239) (-1215.263) [-1214.432] (-1213.153) -- 0:00:00
989000 -- (-1214.332) (-1213.774) [-1214.473] (-1215.663) * (-1218.614) [-1214.954] (-1212.742) (-1214.170) -- 0:00:00
990000 -- (-1214.462) (-1215.241) (-1216.441) [-1214.212] * (-1213.183) [-1213.315] (-1215.641) (-1214.171) -- 0:00:00
Average standard deviation of split frequencies: 0.010469
991000 -- (-1219.594) (-1218.112) [-1213.417] (-1213.825) * (-1220.778) (-1213.588) [-1212.809] (-1216.417) -- 0:00:00
992000 -- (-1213.447) [-1213.228] (-1213.659) (-1214.975) * (-1213.465) (-1214.757) [-1210.821] (-1213.714) -- 0:00:00
993000 -- (-1213.630) (-1220.255) [-1213.306] (-1215.834) * (-1214.431) (-1214.784) [-1212.068] (-1214.089) -- 0:00:00
994000 -- [-1212.768] (-1213.522) (-1214.240) (-1215.092) * (-1214.436) (-1213.767) [-1213.311] (-1214.686) -- 0:00:00
995000 -- (-1215.749) (-1214.220) (-1214.299) [-1217.737] * (-1214.134) (-1217.912) [-1213.476] (-1213.800) -- 0:00:00
Average standard deviation of split frequencies: 0.010728
996000 -- [-1215.304] (-1216.141) (-1213.302) (-1218.901) * (-1215.053) (-1215.068) [-1213.385] (-1212.339) -- 0:00:00
997000 -- (-1219.100) [-1212.785] (-1212.657) (-1214.220) * (-1213.713) (-1212.690) [-1210.707] (-1212.752) -- 0:00:00
998000 -- [-1213.846] (-1214.034) (-1213.088) (-1212.958) * (-1213.391) (-1212.996) [-1212.713] (-1213.210) -- 0:00:00
999000 -- [-1214.709] (-1213.584) (-1212.917) (-1214.978) * (-1213.448) (-1216.089) [-1212.078] (-1214.371) -- 0:00:00
1000000 -- (-1213.796) (-1217.634) (-1213.993) [-1213.285] * (-1213.519) (-1214.930) [-1212.629] (-1213.249) -- 0:00:00
Average standard deviation of split frequencies: 0.010050
Analysis completed in 1 mins 19 seconds
Analysis used 79.21 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1208.05
Likelihood of best state for "cold" chain of run 2 was -1208.05
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.1 % ( 81 %) Dirichlet(Revmat{all})
99.3 % ( 99 %) Slider(Revmat{all})
26.7 % ( 26 %) Dirichlet(Pi{all})
28.1 % ( 25 %) Slider(Pi{all})
77.9 % ( 49 %) Multiplier(Alpha{1,2})
79.2 % ( 60 %) Multiplier(Alpha{3})
31.5 % ( 19 %) Slider(Pinvar{all})
97.8 % ( 97 %) ExtSPR(Tau{all},V{all})
98.8 % ( 99 %) NNI(Tau{all},V{all})
72.9 % ( 69 %) ParsSPR(Tau{all},V{all})
31.0 % ( 31 %) Multiplier(V{all})
92.4 % ( 96 %) Nodeslider(V{all})
38.9 % ( 32 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 73 %) Dirichlet(Revmat{all})
99.4 % ( 98 %) Slider(Revmat{all})
26.3 % ( 23 %) Dirichlet(Pi{all})
28.2 % ( 30 %) Slider(Pi{all})
77.4 % ( 54 %) Multiplier(Alpha{1,2})
79.0 % ( 51 %) Multiplier(Alpha{3})
27.6 % ( 97 %) Slider(Pinvar{all})
97.9 % ( 98 %) ExtSPR(Tau{all},V{all})
98.8 % (100 %) NNI(Tau{all},V{all})
73.1 % ( 73 %) ParsSPR(Tau{all},V{all})
31.3 % ( 23 %) Multiplier(V{all})
93.5 % ( 82 %) Nodeslider(V{all})
38.7 % ( 20 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.59 0.41 0.29
2 | 167243 0.75 0.57
3 | 166801 167063 0.79
4 | 166160 165656 167077
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.64 0.45 0.31
2 | 166392 0.75 0.57
3 | 166540 166620 0.79
4 | 165992 166917 167539
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1211.31
| 2 1 |
| |
| |
| 2 1 |
| |
| 1 |
| 2 2|
| 2 |
|1 2 |
| 2 2 1 2 1 1 21 1 |
| 1 22 1 1 1 1 1121 2 2 12*2* 1 2 2 |
|2 *1 1 11 2*1 2 111 1 22 2 12 2 * 12 1 *1 2 12 1|
| 2 2 22 1 *21 22 2 2 2 *2 2 22 2 1 2 1 2212 11 |
| 1 1 1 2 1 1 1 * 1 |
| * 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1215.25
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1212.96 -1216.46
2 -1213.02 -1216.22
--------------------------------------
TOTAL -1212.99 -1216.35
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 8.849370 97.622881 0.000129 27.599810 5.595759 699.23 954.01 1.000
r(A<->C){all} 0.160190 0.020517 0.000004 0.454632 0.120791 127.45 136.19 1.001
r(A<->G){all} 0.159567 0.019465 0.000083 0.440057 0.119509 127.83 160.90 1.004
r(A<->T){all} 0.168631 0.020554 0.000029 0.452773 0.130811 106.78 132.14 1.002
r(C<->G){all} 0.169223 0.019668 0.000009 0.449467 0.130295 301.27 305.31 1.002
r(C<->T){all} 0.170351 0.020877 0.000040 0.457661 0.128277 129.77 165.90 1.000
r(G<->T){all} 0.172039 0.019698 0.000078 0.457710 0.134530 125.69 131.52 1.007
pi(A){all} 0.291686 0.000225 0.263840 0.321652 0.291552 881.79 1144.54 1.000
pi(C){all} 0.146505 0.000138 0.124050 0.169418 0.146457 1198.02 1244.73 1.000
pi(G){all} 0.206592 0.000173 0.182790 0.234185 0.206355 1115.95 1163.84 1.000
pi(T){all} 0.355217 0.000244 0.325855 0.386568 0.355102 1093.31 1201.62 1.000
alpha{1,2} 0.899831 0.992900 0.000273 2.888165 0.561719 1016.90 1049.45 1.000
alpha{3} 0.905067 0.881731 0.000307 2.827627 0.611997 1061.46 1169.12 1.000
pinvar{all} 0.986784 0.002303 0.930254 0.999970 0.997618 42.28 52.49 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .*.*
6 -- .**.
7 -- ..**
----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 1018 0.339107 0.015075 0.328448 0.349767 2
6 998 0.332445 0.008480 0.326449 0.338441 2
7 986 0.328448 0.006595 0.323784 0.333111 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 1.889859 9.507310 0.000016 7.492031 0.728481 1.000 2
length{all}[2] 1.730514 8.812963 0.000001 7.157879 0.689611 1.001 2
length{all}[3] 1.747112 9.327736 0.000001 7.059225 0.651401 1.000 2
length{all}[4] 1.769237 8.321336 0.000000 7.019990 0.681487 1.000 2
length{all}[5] 1.804812 11.681897 0.000000 6.915880 0.646539 1.005 2
length{all}[6] 1.730783 6.662076 0.000000 6.805545 0.733349 1.001 2
length{all}[7] 1.599137 6.091124 0.000001 6.402296 0.631396 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.010050
Maximum standard deviation of split frequencies = 0.015075
Average PSRF for parameter values (excluding NA and >10.0) = 1.001
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\------------------------------------------------------------------------ C4 (4)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
+
|---------------------------------------------------------------- C3 (3)
|
\------------------------------------------------------------------- C4 (4)
|--------| 0.100 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
Running FUBAR...
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\
***************** TYPES OF STANDARD ANALYSES *****************
(1) Selection Analyses
(2) Evolutionary Hypothesis Testing
(3) Relative evolutionary rate inference
(4) Coevolutionary analysis
(5) Basic Analyses
(6) Codon Selection Analyses
(7) Compartmentalization
(8) Data File Tools
(9) Miscellaneous
(10) Model Comparison
(11) Kernel Analysis Tools
(12) Molecular Clock
(13) Phylogeny Reconstruction
(14) Positive Selection
(15) Recombination
(16) Selection/Recombination
(17) Relative Rate
(18) Relative Ratio
(19) Substitution Rates
Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' *****************
(1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution).
(2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood).
(3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting).
(4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection).
(5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification).
(6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood).
(7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation).
Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types):
Analysis Description
--------------------
Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a
coding sequence alignment to determine whether some sites have been
subject to pervasive purifying or diversifying selection. v2.1
introduces two more methods for estimating the posterior distribution of
grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation
Bayes approximation (fastest). Please note that a FUBAR analysis
generates a cache and a results JSON file in the same directory as
directory as the original alignment. HyPhy needs to have write
privileges to this directory. For example if the original file is in
/home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there
will also exist FUBAR-generated files
/home/sergei/FUBAR/data/pol.nex.FUBAR.json,
/home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide
checkpointing so that a partially completed analysis can be restarted.
- __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree
(one per partition)
- __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring
selection (2013), Mol Biol Evol. 30(5):1196-205
- __Written by__: Sergei L Kosakovsky Pond
- __Contact Information__: spond@temple.edu
- __Analysis Version__: 2.1
####Choose Genetic Code
1. [**Universal**] Universal code. (Genebank transl_table=1).
2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2).
3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3).
4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4).
5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5).
6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6).
7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9).
8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10).
9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12).
10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13).
11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14).
12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15).
13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16).
14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21).
15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22).
16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23).
17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24).
18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25).
19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26).
>Please choose an option (or press q to cancel selection):
>Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`)
>A tree was found in the data file: `(C1,C2,C3,C4)`
>Would you like to use it (y/n)?
>Loaded a multiple sequence alignment with **4** sequences, **300** codons, and **1** partitions from `/data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/fubar/results/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1.fna`
> FUBAR will write cache and result files to _/data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/fubar/results/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/fubar/results/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1.fna.FUBAR.json_, respectively
> Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer):
####Posterior estimation method
1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation)
2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed)
3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default)
>Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5):
### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model
* Log(L) = -1207.45, AIC-c = 2438.99 (12 estimated parameters)
* Tree length (expected substitutions/site) for partition 1 : 0.001
### Computing the phylogenetic likelihood function on the grid
* Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid
* Best scaling achieved for
* synonymous rate = 0.000
* non-synonymous rate = 1.227
* Computing conditional site likelihoods on a 20 x 20 rate grid
### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights
* Using the following settings
* Dirichlet alpha : 0.5
### Tabulating site-level results
----
## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=4, Len=300
HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
**************************************************
HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
**************************************************
HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 DYVSDADFSITGDCTHVYVEDKFDLLISYMYDGKIKSIDGDNVSKDGFFT
HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
**************************** *********************
HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
**************************************************
HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
**************************************************
HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
**************************************************
>HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 TCTGCTGAGTGGAAGTGTGGTTACAGCATGCCGAGCCTTTATAAAATACAGAATATGTGTATGGATGCATGTAATTTGTATAATTATGGTGCTAGTATTAAGTTGCCAGATGGTATTATGTTTAACGTTGTTAAATATACCCAGCTGTGTCAGTTTCTTAATACTACTACCATGTGTGTTCCTCATAATATGCGTGTTTTACACCTTGGTGCTGGCTCTGATAAGGGTGTAGCACCGGGTACAGCTGTTCTACGTAGATGGCTCCCTGACGATGCAATAATTGTTGACAATGATGTTAATGATTATGTCAGTGATGCTGATTTTAGTATAACAGGTGATTGTACACATGTTTATGTCGAAGACAAATTTGACCTACTTATATCATATATGTATGATGGAAAAATTAAGAGCATTGATGGTGACAATGTGTCTAAAGATGGATTTTTCACTTATATTAATGGATTTATACGTGAAAAACTTGCGCTTGGTGGCGCTATGGCTGTTAAGATTACCGAGTATAGTTGGAACAAACAGCTTTATGAGATTGCACAGAAGTTTGAATATTGGACCCTGTTTTGTACCAGTGTCAACACGTCATCTTCTGAGGCTTTCCTTATTGGTATTAACTATCTTGGTGACTTTTCTAGTGCTAGTGTTATAGATGGTAATGTTATGCATGCTAACTATATATTTTGGCGCAACTCCACTATTATGACTATGTCATATAATTCAGTTCTTGATTTGTCAAAATTTAGGTGTAAACATAAAGCAACTGTTATTATTACACTTAAAGATAAAGACATTACTGATATGGTGCTTGGTCTAATTAAAAATGGCAAGTTGTTAATTCGCAACTCGCAGAAATTATTGAATTTTAGCAACCATCTTGTTACAACTAAA >HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 TCTGCTGAGTGGAAGTGTGGTTACAGCATGCCGAGCCTTTATAAAATACAGAATATGTGTATGGATGCATGTAATTTGTATAATTATGGTGCTAGTATTAAGTTGCCAGATGGTATTATGTTTAACGTTGTTAAATATACCCAGCTGTGTCAGTTTCTTAATACTACTACCATGTGTGTTCCTCATAATATGCGTGTTTTACACCTTGGTGCTGGCTCTGATAAGGGTGTAGCACCGGGTACAGCTGTTCTACGTAGATGGCTCCCTGACGATGCAATAATTGTTGACAATGATGTTAATGATTATGTCAGTGATGCTGATTTTAGTATAACAGGTGATTGTACACATGTTTATGTCGAAGACAAATTTGACCTACTTATATCAGATATGTATGATGGAAAAATTAAGAGCATTGATGGTGACAATGTGTCTAAAGATGGATTTTTCACTTATATTAATGGATTTATACGTGAAAAACTTGCGCTTGGTGGCGCTATGGCTGTTAAGATTACCGAGTATAGTTGGAACAAACAGCTTTATGAGATTGCACAGAAGTTTGAATATTGGACCCTGTTTTGTACCAGTGTCAACACGTCATCTTCTGAGGCTTTCCTTATTGGTATTAACTATCTTGGTGACTTTTCTAGTGCTAGTGTTATAGATGGTAATGTTATGCATGCTAACTATATATTTTGGCGCAACTCCACTATTATGACTATGTCATATAATTCAGTTCTTGATTTGTCAAAATTTAGGTGTAAACATAAAGCAACTGTTATTATTACACTTAAAGATAAAGACATTACTGATATGGTGCTTGGTCTAATTAAAAATGGCAAGTTGTTAATTCGCAACTCGCAGAAATTATTGAATTTTAGCAACCATCTTGTTACAACTAAA >HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 TCTGCTGAGTGGAAGTGTGGTTACAGCATGCCGAGCCTTTATAAAATACAGAATATGTGTATGGATGCATGTAATTTGTATAATTATGGTGCTAGTATTAAGTTGCCAGATGGTATTATGTTTAACGTTGTTAAATATACCCAGCTGTGTCAGTTTCTTAATACTACTACCATGTGTGTTCCTCATAATATGCGTGTTTTACACCTTGGTGCTGGCTCTGATAAGGGTGTAGCACCGGGTACAGCTGTTCTACGTAGATGGCTCCCTGACGATGCAATAATTGTTGACAATGATGTTAATGATTATGTCAGTGATGCTGATTTTAGTATAACAGGTGATTGTACACATGTTTATGTCGAAGACAAATTTGACCTACTTATATCAGATATGTATGATGGAAAAATTAAGAGCATTGATGGTGACAATGTGTCTAAAGATGGATTTTTCACTTATATTAATGGATTTATACGTGAAAAACTTGCGCTTGGTGGCGCTATGGCTGTTAAGATTACCGAGTATAGTTGGAACAAACAGCTTTATGAGATTGCACAGAAGTTTGAATATTGGACCCTGTTTTGTACCAGTGTCAACACGTCATCTTCTGAGGCTTTCCTTATTGGTATTAACTATCTTGGTGACTTTTCTAGTGCTAGTGTTATAGATGGTAATGTTATGCATGCTAACTATATATTTTGGCGCAACTCCACTATTATGACTATGTCATATAATTCAGTTCTTGATTTGTCAAAATTTAGGTGTAAACATAAAGCAACTGTTATTATTACACTTAAAGATAAAGACATTACTGATATGGTGCTTGGTCTAATTAAAAATGGCAAGTTGTTAATTCGCAACTCGCAGAAATTATTGAATTTTAGCAACCATCTTGTTACAACTAAA >HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 TCTGCTGAGTGGAAGTGTGGTTACAGCATGCCGAGCCTTTATAAAATACAGAATATGTGTATGGATGCATGTAATTTGTATAATTATGGTGCTAGTATTAAGTTGCCAGATGGTATTATGTTTAACGTTGTTAAATATACCCAGCTGTGTCAGTTTCTTAATACTACTACCATGTGTGTTCCTCATAATATGCGTGTTTTACACCTTGGTGCTGGCTCTGATAAGGGTGTAGCACCGGGTACAGCTGTTCTACGTAGATGGCTCCCTGACGATGCAATAATTGTTGACAATGATGTTAATGATTATGTCAGTGATGCTGATTTTAGTATAACAGGTGATTGTACACATGTTTATGTCGAAGACAAATTTGACCTACTTATATCAGATATGTATGATGGAAAAATTAAGAGCATTGATGGTGACAATGTGTCTAAAGATGGATTTTTCACTTATATTAATGGATTTATACGTGAAAAACTTGCGCTTGGTGGCGCTATGGCTGTTAAGATTACCGAGTATAGTTGGAACAAACAGCTTTATGAGATTGCACAGAAGTTTGAATATTGGACCCTGTTTTGTACCAGTGTCAACACGTCATCTTCTGAGGCTTTCCTTATTGGTATTAACTATCTTGGTGACTTTTCTAGTGCTAGTGTTATAGATGGTAATGTTATGCATGCTAACTATATATTTTGGCGCAACTCCACTATTATGACTATGTCATATAATTCAGTTCTTGATTTGTCAAAATTTAGGTGTAAACATAAAGCAACTGTTATTATTACACTTAAAGATAAAGACATTACTGATATGGTGCTTGGTCTAATTAAAAATGGCAAGTTGTTAATTCGCAACTCGCAGAAATTATTGAATTTTAGCAACCATCTTGTTACAACTAAA
>HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN DYVSDADFSITGDCTHVYVEDKFDLLISYMYDGKIKSIDGDNVSKDGFFT YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK >HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK >HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK >HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
Reading sequence file /data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/fubar/fasta/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1 Found 4 sequences of length 900 Alignment looks like a valid DNA alignment. Estimated diversity is (pairwise deletion - ignoring missing/ambig): 0.1% Found 0 informative sites. Writing alignment of informative sites to: Phi.inf.sites Writing list of informative sites to: Phi.inf.list Calculating all pairwise incompatibilities... 100.0% Using a window size of 80 with k as 1 Too few informative sites to use normal approximation. Try doing a permutation test or increasing alignment length Can also try decreasing windowsize.
#NEXUS
[ID: 8466325032]
begin taxa;
dimensions ntax=4;
taxlabels
HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
;
end;
begin trees;
translate
1 HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2,
2 HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2,
3 HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2,
4 HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:7.284809e-01,2:6.896114e-01,3:6.514007e-01,4:6.814870e-01);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:7.284809e-01,2:6.896114e-01,3:6.514007e-01,4:6.814870e-01);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1212.27 -1218.77
2 -1212.12 -1216.37
--------------------------------------
TOTAL -1212.20 -1218.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 6.475232 78.548632 0.000010 25.627120 2.927722 40.88 66.29 1.002
r(A<->C){all} 0.164363 0.018219 0.000174 0.427855 0.131176 101.22 127.53 1.002
r(A<->G){all} 0.146867 0.016004 0.000045 0.404462 0.114653 69.08 133.82 1.000
r(A<->T){all} 0.147184 0.015947 0.000057 0.397870 0.112353 161.78 164.79 1.001
r(C<->G){all} 0.165770 0.019431 0.000034 0.450929 0.129907 132.72 155.82 1.000
r(C<->T){all} 0.166034 0.019519 0.000076 0.436496 0.129687 35.25 106.76 1.009
r(G<->T){all} 0.209783 0.025295 0.000048 0.520336 0.172740 76.55 79.56 1.004
pi(A){all} 0.291395 0.000230 0.260810 0.319845 0.291325 663.93 916.33 1.000
pi(C){all} 0.146830 0.000141 0.124085 0.170177 0.146535 1033.01 1056.76 1.000
pi(G){all} 0.206520 0.000175 0.179966 0.230575 0.206547 1089.49 1150.86 1.001
pi(T){all} 0.355255 0.000244 0.323334 0.384207 0.355431 1071.27 1156.70 1.000
alpha{1,2} 0.902051 0.920939 0.000659 2.780874 0.588855 699.35 917.23 1.001
alpha{3} 0.913965 0.973764 0.000068 2.900909 0.586969 926.56 1074.92 1.002
pinvar{all} 0.871093 0.055449 0.319857 0.999893 0.996366 10.58 14.43 1.011
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C2,C3,C4)` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **4** sequences, **300** codons, and **1** partitions from `/data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/fubar/results/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/fubar/results/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/fubar/results/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -1207.45, AIC-c = 2438.99 (12 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.001 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 0.000 * non-synonymous rate = 1.227 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results ---- ## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
