--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -522.96 -531.20
2 -522.93 -529.51
--------------------------------------
TOTAL -522.95 -530.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.067129 0.005479 0.020404 0.156036 0.052374 803.10 930.81 1.000
r(A<->C){all} 0.077425 0.005248 0.000116 0.213177 0.057067 333.77 478.53 1.009
r(A<->G){all} 0.237039 0.012814 0.027209 0.454012 0.226231 298.20 425.25 1.001
r(A<->T){all} 0.137357 0.007187 0.002153 0.300616 0.121676 325.09 377.46 1.005
r(C<->G){all} 0.070768 0.004301 0.000009 0.194659 0.054487 537.33 539.33 1.000
r(C<->T){all} 0.312634 0.013815 0.094085 0.535790 0.301517 459.99 461.76 1.000
r(G<->T){all} 0.164777 0.007820 0.011285 0.332747 0.154379 227.99 339.48 1.000
pi(A){all} 0.214226 0.000470 0.172139 0.256951 0.213774 1356.39 1377.09 1.000
pi(C){all} 0.203237 0.000456 0.161211 0.244329 0.202569 1336.73 1370.13 1.000
pi(G){all} 0.241667 0.000532 0.199794 0.289365 0.241808 1282.90 1315.82 1.000
pi(T){all} 0.340870 0.000629 0.290643 0.386766 0.340811 1360.98 1396.75 1.000
alpha{1,2} 0.677870 0.736841 0.000397 2.434321 0.350909 1126.88 1188.02 1.000
alpha{3} 1.378713 1.270098 0.000417 3.607951 1.079052 1038.91 1057.73 1.000
pinvar{all} 0.501948 0.072726 0.029839 0.903398 0.531543 267.26 505.28 1.004
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
-- Starting log on Fri Oct 21 22:38:34 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=110
C1 MSINQLTLAVASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVASGLQ
C2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
C3 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
C4 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
*********:************************************ ***
C1 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLEE
C2 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
C3 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
C4 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
************************************************:*
C1 FHVIFGKRGG
C2 FQVIFGKRGG
C3 FQVIFGKRGG
C4 FQVIFGKRGG
*:********
-- Starting log on Fri Oct 21 22:39:15 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=110
C1 MSINQLTLAVASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVASGLQ
C2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
C3 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
C4 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
*********:************************************ ***
C1 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLEE
C2 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
C3 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
C4 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
************************************************:*
C1 FHVIFGKRGG
C2 FQVIFGKRGG
C3 FQVIFGKRGG
C4 FQVIFGKRGG
*:********
-- Starting log on Fri Oct 21 22:38:34 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=110
C1 MSINQLTLAVASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVASGLQ
C2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
C3 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
C4 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
*********:************************************ ***
C1 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLEE
C2 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
C3 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
C4 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
************************************************:*
C1 FHVIFGKRGG
C2 FQVIFGKRGG
C3 FQVIFGKRGG
C4 FQVIFGKRGG
*:********
-- Starting log on Fri Oct 21 22:52:50 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/gapped_alignment/fubar,HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 330 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666392772
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 762771537
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8437544378
Seed = 353117984
Swapseed = 1666392772
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.00 % Dirichlet(Revmat{all})
1.00 % Slider(Revmat{all})
1.00 % Dirichlet(Pi{all})
1.00 % Slider(Pi{all})
2.00 % Multiplier(Alpha{1,2})
2.00 % Multiplier(Alpha{3})
2.00 % Slider(Pinvar{all})
10.00 % ExtSPR(Tau{all},V{all})
10.00 % NNI(Tau{all},V{all})
10.00 % ParsSPR(Tau{all},V{all})
40.00 % Multiplier(V{all})
14.00 % Nodeslider(V{all})
6.00 % TLMultiplier(V{all})
Division 1 has 6 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 10 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -554.909649 -- 13.556448
Chain 2 -- -554.909649 -- 13.556448
Chain 3 -- -554.909649 -- 13.556448
Chain 4 -- -554.909649 -- 13.556448
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -554.909649 -- 13.556448
Chain 2 -- -554.909649 -- 13.556448
Chain 3 -- -554.909649 -- 13.556448
Chain 4 -- -554.909649 -- 13.556448
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-554.910] (-554.910) (-554.910) (-554.910) * [-554.910] (-554.910) (-554.910) (-554.910)
1000 -- (-526.018) [-524.068] (-525.628) (-532.938) * (-526.758) [-525.544] (-535.320) (-529.039) -- 0:00:00
2000 -- (-529.127) (-525.048) [-525.094] (-525.945) * [-528.833] (-525.874) (-526.331) (-523.558) -- 0:00:00
3000 -- (-524.558) (-530.333) (-530.593) [-525.678] * (-529.201) (-526.783) [-527.541] (-525.351) -- 0:05:32
4000 -- (-526.762) [-532.249] (-536.510) (-528.146) * (-536.096) [-526.487] (-528.821) (-530.619) -- 0:04:09
5000 -- [-522.838] (-528.314) (-528.244) (-524.642) * (-530.346) (-531.167) (-527.791) [-523.612] -- 0:03:19
Average standard deviation of split frequencies: 0.209513
6000 -- (-524.284) [-529.172] (-531.222) (-528.543) * (-527.842) [-526.464] (-525.490) (-523.536) -- 0:02:45
7000 -- [-527.267] (-525.739) (-529.626) (-527.923) * (-530.448) (-522.509) [-524.436] (-524.305) -- 0:02:21
8000 -- [-522.587] (-524.027) (-526.807) (-527.566) * (-530.256) (-524.250) [-527.587] (-524.171) -- 0:02:04
9000 -- (-524.470) (-521.333) [-528.435] (-525.560) * (-535.838) [-522.744] (-523.693) (-525.139) -- 0:01:50
10000 -- (-521.456) (-526.203) [-527.279] (-530.004) * (-532.813) (-529.324) (-523.552) [-526.792] -- 0:01:39
Average standard deviation of split frequencies: 0.058926
11000 -- (-525.774) [-522.489] (-523.609) (-525.178) * (-527.077) (-529.472) [-522.474] (-527.303) -- 0:01:29
12000 -- (-523.486) (-524.741) (-519.553) [-527.937] * (-532.100) (-527.992) (-523.132) [-523.905] -- 0:01:22
13000 -- (-522.517) [-525.890] (-522.764) (-522.851) * (-529.597) (-525.867) [-529.979] (-526.220) -- 0:02:31
14000 -- [-524.337] (-530.099) (-524.629) (-526.724) * (-529.144) (-523.623) [-525.541] (-526.777) -- 0:02:20
15000 -- [-524.609] (-525.424) (-522.557) (-527.990) * (-529.437) [-526.165] (-526.276) (-524.249) -- 0:02:11
Average standard deviation of split frequencies: 0.039284
16000 -- [-521.370] (-526.511) (-523.868) (-523.203) * [-531.871] (-528.138) (-522.617) (-527.156) -- 0:02:03
17000 -- (-524.077) [-525.993] (-528.841) (-522.108) * (-527.433) (-523.387) (-524.567) [-523.281] -- 0:01:55
18000 -- (-525.263) (-522.908) [-528.638] (-523.163) * (-530.421) (-523.265) [-525.259] (-522.306) -- 0:01:49
19000 -- [-523.636] (-523.384) (-531.288) (-524.541) * (-533.266) (-528.643) (-520.834) [-519.450] -- 0:01:43
20000 -- [-520.300] (-527.422) (-525.441) (-527.898) * (-537.232) [-522.153] (-523.081) (-522.953) -- 0:01:38
Average standard deviation of split frequencies: 0.045620
21000 -- (-521.751) (-529.027) [-523.493] (-528.326) * (-533.496) (-520.131) [-522.023] (-522.790) -- 0:01:33
22000 -- (-522.165) (-529.495) (-526.518) [-525.100] * (-532.631) (-521.928) (-527.572) [-526.218] -- 0:02:13
23000 -- [-523.348] (-527.191) (-529.431) (-528.168) * [-527.319] (-521.287) (-529.515) (-529.917) -- 0:02:07
24000 -- (-520.754) (-528.419) (-527.760) [-522.314] * (-531.916) (-521.759) [-523.347] (-527.959) -- 0:02:02
25000 -- (-523.556) (-529.812) (-525.682) [-525.889] * (-525.464) (-528.201) [-524.165] (-525.472) -- 0:01:57
Average standard deviation of split frequencies: 0.048349
26000 -- (-525.309) [-521.005] (-532.173) (-529.731) * (-532.254) (-525.759) [-525.896] (-520.729) -- 0:01:52
27000 -- (-525.410) (-522.827) (-522.516) [-526.541] * (-525.604) [-524.647] (-524.152) (-524.030) -- 0:01:48
28000 -- (-522.382) [-521.022] (-529.915) (-527.969) * (-525.370) (-520.452) (-522.959) [-521.184] -- 0:01:44
29000 -- (-525.678) [-526.249] (-534.422) (-521.242) * (-523.128) (-523.260) (-523.428) [-523.570] -- 0:01:40
30000 -- (-525.103) (-528.873) [-522.491] (-523.728) * (-525.166) [-523.905] (-523.725) (-523.999) -- 0:01:37
Average standard deviation of split frequencies: 0.051240
31000 -- (-527.851) [-523.539] (-527.845) (-528.865) * (-530.398) [-525.549] (-529.649) (-522.087) -- 0:01:33
32000 -- (-533.546) (-526.472) [-522.286] (-526.920) * [-532.434] (-526.008) (-527.253) (-525.216) -- 0:02:01
33000 -- [-527.939] (-521.781) (-531.761) (-527.575) * (-528.158) (-525.399) (-523.443) [-519.978] -- 0:01:57
34000 -- (-526.151) [-529.047] (-524.773) (-523.531) * (-527.483) [-524.376] (-534.025) (-522.800) -- 0:01:53
35000 -- (-524.975) (-525.763) [-522.554] (-530.899) * (-524.216) (-532.622) (-518.723) [-520.784] -- 0:01:50
Average standard deviation of split frequencies: 0.017459
36000 -- [-526.197] (-526.036) (-527.843) (-525.649) * (-527.914) (-531.071) (-528.861) [-522.813] -- 0:01:47
37000 -- (-525.553) (-529.546) [-525.165] (-526.071) * [-529.539] (-524.050) (-527.817) (-526.267) -- 0:01:44
38000 -- (-525.893) [-524.384] (-525.188) (-522.314) * (-526.087) (-525.739) (-523.087) [-524.225] -- 0:01:41
39000 -- (-528.471) (-526.625) (-533.986) [-522.707] * (-524.534) (-527.081) [-523.944] (-531.553) -- 0:01:38
40000 -- (-523.857) (-530.540) (-531.019) [-525.576] * (-527.866) (-530.090) (-521.327) [-523.404] -- 0:01:36
Average standard deviation of split frequencies: 0.023184
41000 -- (-523.182) [-522.931] (-528.596) (-527.556) * (-530.801) (-524.276) (-527.694) [-524.228] -- 0:01:33
42000 -- (-526.301) [-524.040] (-525.034) (-526.674) * (-527.799) (-522.883) [-525.957] (-525.578) -- 0:01:54
43000 -- (-525.125) [-523.559] (-527.694) (-529.682) * (-528.915) (-526.420) [-528.341] (-521.413) -- 0:01:51
44000 -- (-523.255) [-522.479] (-526.068) (-523.416) * (-526.637) (-525.843) (-523.206) [-524.770] -- 0:01:48
45000 -- (-523.403) [-526.591] (-524.810) (-524.619) * (-526.707) (-526.520) [-525.586] (-526.067) -- 0:01:46
Average standard deviation of split frequencies: 0.047824
46000 -- (-525.522) (-532.168) [-524.215] (-524.836) * (-537.270) (-524.609) (-525.449) [-524.043] -- 0:01:43
47000 -- (-523.064) (-529.633) (-522.315) [-527.623] * (-528.198) (-528.119) (-529.262) [-523.944] -- 0:01:41
48000 -- (-521.751) (-523.812) [-523.524] (-526.381) * (-532.155) [-526.313] (-526.537) (-523.824) -- 0:01:39
49000 -- (-524.274) (-528.173) (-523.469) [-528.017] * (-525.965) (-523.767) [-525.369] (-528.055) -- 0:01:37
50000 -- (-532.662) (-523.902) [-528.226] (-522.588) * [-527.261] (-530.172) (-527.401) (-523.262) -- 0:01:35
Average standard deviation of split frequencies: 0.062027
51000 -- (-524.416) (-525.623) (-523.438) [-525.373] * (-526.814) (-526.653) (-532.616) [-523.073] -- 0:01:33
52000 -- (-522.575) (-524.761) [-524.180] (-524.131) * (-521.677) (-526.616) (-526.097) [-524.988] -- 0:01:49
53000 -- (-526.413) (-524.676) [-523.570] (-534.455) * [-524.008] (-531.423) (-522.636) (-520.096) -- 0:01:47
54000 -- [-522.586] (-524.866) (-521.459) (-528.281) * (-520.949) (-524.536) [-524.000] (-526.431) -- 0:01:45
55000 -- [-522.295] (-522.809) (-526.775) (-527.066) * (-531.547) (-525.655) (-525.943) [-522.944] -- 0:01:43
Average standard deviation of split frequencies: 0.072955
56000 -- [-522.512] (-526.991) (-532.068) (-524.972) * (-527.649) (-523.559) (-528.112) [-525.291] -- 0:01:41
57000 -- [-527.650] (-528.741) (-527.845) (-523.871) * [-525.875] (-526.637) (-523.357) (-523.803) -- 0:01:39
58000 -- (-525.317) (-526.815) (-529.451) [-522.036] * (-525.239) (-525.450) (-522.534) [-522.394] -- 0:01:37
59000 -- [-525.447] (-524.218) (-524.497) (-522.618) * (-521.502) (-529.133) [-522.917] (-530.898) -- 0:01:35
60000 -- (-525.635) [-526.721] (-527.862) (-530.187) * (-523.016) (-526.469) [-521.924] (-523.739) -- 0:01:34
Average standard deviation of split frequencies: 0.062163
61000 -- (-525.274) [-524.859] (-527.059) (-524.278) * (-524.739) (-531.637) [-523.526] (-522.140) -- 0:01:32
62000 -- [-525.423] (-527.404) (-525.392) (-525.173) * (-523.390) (-526.190) (-524.280) [-528.215] -- 0:01:45
63000 -- (-524.253) (-524.113) [-525.108] (-528.386) * (-530.610) (-522.024) (-526.359) [-525.660] -- 0:01:44
64000 -- (-527.061) (-524.235) [-524.006] (-532.650) * (-524.459) (-524.113) (-521.987) [-525.563] -- 0:01:42
65000 -- (-521.824) (-526.863) (-525.137) [-527.561] * [-527.713] (-528.920) (-521.966) (-528.783) -- 0:01:40
Average standard deviation of split frequencies: 0.066663
66000 -- (-522.021) [-523.109] (-527.349) (-527.273) * (-523.010) (-524.992) [-524.741] (-526.935) -- 0:01:39
67000 -- (-527.345) [-523.784] (-527.142) (-524.572) * [-529.374] (-528.920) (-523.545) (-526.364) -- 0:01:37
68000 -- (-523.599) (-525.729) [-525.018] (-527.404) * (-524.617) (-525.485) [-522.060] (-528.574) -- 0:01:35
69000 -- (-526.683) (-525.491) [-522.431] (-526.777) * (-522.922) (-528.870) [-524.044] (-525.554) -- 0:01:34
70000 -- [-530.804] (-521.433) (-529.887) (-528.073) * (-529.838) [-529.447] (-527.128) (-523.160) -- 0:01:33
Average standard deviation of split frequencies: 0.071155
71000 -- (-529.584) [-524.137] (-535.181) (-527.533) * [-525.963] (-523.078) (-524.490) (-527.184) -- 0:01:31
72000 -- (-528.526) (-525.086) [-525.723] (-528.790) * (-526.237) (-527.823) (-532.620) [-521.750] -- 0:01:43
73000 -- [-524.477] (-526.865) (-527.804) (-525.981) * (-529.331) (-524.082) (-531.018) [-525.212] -- 0:01:41
74000 -- (-533.105) (-531.328) [-524.020] (-524.251) * [-528.958] (-524.853) (-530.135) (-521.627) -- 0:01:40
75000 -- (-526.598) (-522.180) [-526.591] (-523.797) * (-525.919) (-525.547) (-523.333) [-525.680] -- 0:01:38
Average standard deviation of split frequencies: 0.074432
76000 -- (-528.043) (-518.704) (-526.924) [-524.636] * (-536.193) (-529.876) [-522.195] (-524.582) -- 0:01:37
77000 -- [-522.783] (-526.364) (-525.859) (-524.528) * (-527.568) [-525.700] (-526.098) (-533.480) -- 0:01:35
78000 -- [-523.521] (-520.419) (-526.992) (-526.157) * (-526.985) (-525.441) [-528.835] (-521.718) -- 0:01:34
79000 -- (-524.838) (-520.380) (-527.842) [-524.211] * (-523.441) (-528.975) [-526.713] (-522.523) -- 0:01:33
80000 -- (-524.063) [-523.626] (-532.758) (-524.698) * (-528.395) (-524.281) [-524.047] (-534.538) -- 0:01:32
Average standard deviation of split frequencies: 0.062334
81000 -- (-524.780) [-525.835] (-525.256) (-527.838) * (-532.452) [-529.714] (-525.609) (-530.099) -- 0:01:42
82000 -- (-526.876) (-524.516) [-528.277] (-532.688) * (-524.335) (-527.034) (-527.822) [-525.880] -- 0:01:40
83000 -- [-525.466] (-523.894) (-528.930) (-528.168) * (-526.407) (-526.288) (-525.845) [-522.990] -- 0:01:39
84000 -- (-535.253) (-520.076) [-525.750] (-522.249) * (-523.570) (-525.695) [-524.754] (-531.999) -- 0:01:38
85000 -- [-529.713] (-526.961) (-524.604) (-527.987) * (-520.305) [-530.159] (-525.637) (-521.981) -- 0:01:36
Average standard deviation of split frequencies: 0.062123
86000 -- (-525.556) (-520.733) (-523.957) [-525.555] * (-526.580) (-525.659) (-532.816) [-523.546] -- 0:01:35
87000 -- [-525.597] (-528.015) (-528.116) (-525.047) * [-522.405] (-524.543) (-521.877) (-521.200) -- 0:01:34
88000 -- [-529.773] (-527.331) (-530.846) (-527.355) * (-524.499) (-529.828) (-521.615) [-526.156] -- 0:01:33
89000 -- (-524.361) (-541.745) [-528.277] (-525.243) * (-529.020) (-525.973) (-523.218) [-526.877] -- 0:01:32
90000 -- (-527.507) (-530.637) (-521.784) [-522.643] * (-524.099) (-526.870) [-526.588] (-529.708) -- 0:01:41
Average standard deviation of split frequencies: 0.062392
91000 -- [-522.021] (-529.576) (-527.803) (-523.261) * (-524.273) [-523.026] (-527.985) (-526.658) -- 0:01:39
92000 -- [-529.715] (-534.170) (-523.579) (-527.295) * [-524.711] (-528.921) (-530.987) (-527.156) -- 0:01:38
93000 -- (-526.212) (-528.600) (-524.209) [-523.826] * (-521.980) [-524.739] (-524.439) (-530.403) -- 0:01:37
94000 -- (-528.937) (-521.697) (-525.674) [-522.580] * [-530.583] (-524.874) (-524.829) (-527.972) -- 0:01:36
95000 -- (-531.223) (-525.589) [-521.218] (-521.406) * (-529.319) (-524.908) [-524.410] (-532.619) -- 0:01:35
Average standard deviation of split frequencies: 0.052378
96000 -- (-528.544) [-521.541] (-521.705) (-528.919) * (-528.350) (-529.904) [-521.757] (-529.222) -- 0:01:34
97000 -- (-528.697) (-526.347) (-530.676) [-524.966] * (-522.142) (-523.805) (-522.871) [-527.007] -- 0:01:33
98000 -- (-529.871) [-524.368] (-528.102) (-534.400) * (-523.864) (-529.286) [-528.475] (-527.993) -- 0:01:32
99000 -- [-524.519] (-525.541) (-529.702) (-524.352) * [-524.383] (-532.350) (-523.521) (-534.064) -- 0:01:31
100000 -- (-520.902) [-524.048] (-525.076) (-522.726) * (-524.047) (-524.991) (-525.407) [-528.923] -- 0:01:39
Average standard deviation of split frequencies: 0.062438
101000 -- [-528.615] (-531.481) (-528.621) (-525.743) * [-522.945] (-531.846) (-531.071) (-531.627) -- 0:01:37
102000 -- (-525.734) (-528.934) (-524.717) [-521.798] * [-521.891] (-525.291) (-530.793) (-530.043) -- 0:01:36
103000 -- [-524.563] (-521.683) (-523.387) (-522.599) * (-532.998) (-523.003) [-526.972] (-532.581) -- 0:01:35
104000 -- [-526.539] (-526.922) (-521.630) (-526.579) * (-520.837) (-528.712) (-526.849) [-523.551] -- 0:01:34
105000 -- (-531.806) (-525.603) (-523.627) [-523.778] * [-522.962] (-526.484) (-523.314) (-527.078) -- 0:01:33
Average standard deviation of split frequencies: 0.053367
106000 -- (-526.615) [-527.256] (-522.673) (-529.886) * (-523.543) (-524.497) (-523.053) [-527.539] -- 0:01:32
107000 -- (-526.976) [-522.078] (-528.075) (-523.078) * (-524.090) (-524.402) [-524.029] (-524.668) -- 0:01:31
108000 -- [-523.536] (-522.934) (-525.471) (-522.816) * (-524.847) [-524.023] (-526.562) (-531.424) -- 0:01:30
109000 -- (-525.021) (-521.882) (-527.414) [-519.666] * (-525.582) (-525.436) (-526.604) [-524.577] -- 0:01:29
110000 -- (-525.010) (-525.340) (-524.956) [-523.198] * (-525.577) (-525.896) [-526.104] (-526.868) -- 0:01:37
Average standard deviation of split frequencies: 0.048276
111000 -- [-528.314] (-521.929) (-527.647) (-521.249) * (-522.257) [-525.074] (-530.802) (-527.476) -- 0:01:36
112000 -- (-526.916) (-520.517) (-526.210) [-521.934] * (-523.719) (-528.622) [-526.670] (-529.045) -- 0:01:35
113000 -- (-531.751) (-523.415) [-526.139] (-524.934) * (-523.551) (-527.625) [-524.790] (-527.135) -- 0:01:34
114000 -- (-525.023) (-526.600) (-523.893) [-524.088] * (-522.680) [-526.544] (-526.934) (-530.628) -- 0:01:33
115000 -- (-527.341) [-523.707] (-524.474) (-524.845) * [-524.272] (-531.297) (-523.561) (-526.815) -- 0:01:32
Average standard deviation of split frequencies: 0.037929
116000 -- (-531.486) (-528.986) (-529.140) [-521.810] * (-526.398) [-528.424] (-536.415) (-528.841) -- 0:01:31
117000 -- (-530.008) (-524.155) [-525.124] (-526.625) * [-525.244] (-524.091) (-534.048) (-528.098) -- 0:01:30
118000 -- (-523.077) (-525.870) [-526.858] (-526.393) * (-529.421) (-528.103) [-523.095] (-525.060) -- 0:01:29
119000 -- (-528.980) (-527.622) (-527.500) [-523.722] * (-522.133) (-532.689) (-526.889) [-528.723] -- 0:01:36
120000 -- (-523.825) [-524.655] (-527.937) (-527.198) * (-525.048) (-527.241) [-520.892] (-528.793) -- 0:01:35
Average standard deviation of split frequencies: 0.031253
121000 -- [-525.518] (-527.100) (-522.668) (-523.784) * (-523.255) (-527.544) [-523.487] (-532.439) -- 0:01:34
122000 -- [-525.105] (-524.200) (-524.575) (-524.537) * (-527.756) (-528.704) (-524.309) [-528.380] -- 0:01:33
123000 -- [-531.394] (-527.592) (-525.237) (-523.530) * (-522.487) (-530.672) [-525.394] (-530.244) -- 0:01:32
124000 -- (-531.234) (-530.521) [-526.284] (-523.618) * (-521.352) (-520.437) (-525.696) [-525.505] -- 0:01:31
125000 -- (-524.877) [-525.301] (-526.018) (-526.730) * (-523.855) [-527.137] (-525.951) (-531.413) -- 0:01:31
Average standard deviation of split frequencies: 0.042401
126000 -- (-525.749) (-527.460) [-532.638] (-524.823) * (-529.301) (-527.969) (-527.070) [-527.324] -- 0:01:30
127000 -- [-523.792] (-527.473) (-530.133) (-525.839) * (-528.482) (-522.849) [-525.994] (-530.779) -- 0:01:29
128000 -- (-524.899) (-533.989) (-526.629) [-521.941] * (-529.365) (-526.019) [-528.792] (-527.629) -- 0:01:28
129000 -- (-524.426) (-526.302) (-524.240) [-523.035] * (-524.028) [-521.375] (-525.318) (-523.528) -- 0:01:34
130000 -- (-521.384) (-529.680) [-521.820] (-525.222) * (-521.699) [-525.885] (-523.976) (-522.942) -- 0:01:33
Average standard deviation of split frequencies: 0.036077
131000 -- (-526.740) (-523.966) (-522.033) [-521.538] * (-529.683) (-526.387) [-527.934] (-522.603) -- 0:01:32
132000 -- (-523.173) (-523.414) [-524.163] (-522.102) * (-529.617) [-523.762] (-525.763) (-524.008) -- 0:01:32
133000 -- (-525.627) [-525.028] (-527.448) (-529.284) * (-525.950) (-528.226) [-523.106] (-527.502) -- 0:01:31
134000 -- (-522.297) (-524.159) (-527.582) [-525.316] * (-527.304) (-527.483) [-526.398] (-522.919) -- 0:01:30
135000 -- [-523.032] (-527.298) (-530.894) (-524.292) * [-522.763] (-528.826) (-526.510) (-527.848) -- 0:01:29
Average standard deviation of split frequencies: 0.036973
136000 -- [-531.930] (-531.142) (-528.485) (-525.582) * (-527.645) (-523.140) [-523.181] (-525.891) -- 0:01:28
137000 -- (-525.645) (-530.786) (-525.030) [-524.200] * (-529.719) (-521.891) [-526.196] (-527.329) -- 0:01:28
138000 -- (-529.553) (-530.134) [-522.523] (-521.018) * (-524.437) (-522.734) [-529.419] (-525.056) -- 0:01:27
139000 -- (-529.305) (-523.253) (-523.748) [-524.636] * (-523.371) [-524.707] (-537.196) (-525.479) -- 0:01:32
140000 -- (-528.005) (-524.810) [-522.677] (-528.394) * (-538.782) (-529.272) [-525.194] (-527.569) -- 0:01:32
Average standard deviation of split frequencies: 0.037980
141000 -- (-529.651) (-529.711) (-525.471) [-527.842] * (-529.270) (-534.522) [-526.014] (-528.596) -- 0:01:31
142000 -- (-531.171) (-522.793) (-524.416) [-526.356] * (-522.383) [-526.760] (-524.193) (-527.529) -- 0:01:30
143000 -- (-531.531) (-524.741) [-526.602] (-524.077) * [-524.904] (-523.040) (-522.551) (-526.590) -- 0:01:29
144000 -- (-527.671) [-526.855] (-525.761) (-526.930) * (-533.100) (-525.748) (-524.284) [-523.878] -- 0:01:29
145000 -- (-528.857) [-527.092] (-531.354) (-525.967) * (-522.895) (-533.029) [-526.334] (-525.052) -- 0:01:28
Average standard deviation of split frequencies: 0.040898
146000 -- (-533.375) (-525.067) [-525.487] (-523.134) * (-535.857) (-523.517) (-527.818) [-522.366] -- 0:01:27
147000 -- (-528.241) [-523.528] (-526.312) (-528.534) * [-525.671] (-524.144) (-526.672) (-522.527) -- 0:01:27
148000 -- [-527.315] (-525.712) (-525.105) (-529.640) * (-529.512) (-524.985) [-529.255] (-522.267) -- 0:01:26
149000 -- (-525.978) (-522.844) [-530.340] (-529.169) * (-525.346) (-526.892) (-526.203) [-523.340] -- 0:01:31
150000 -- (-528.742) (-523.769) [-523.422] (-534.144) * (-526.914) (-527.961) (-524.622) [-525.010] -- 0:01:30
Average standard deviation of split frequencies: 0.039631
151000 -- (-522.692) [-525.307] (-526.283) (-531.657) * (-521.240) (-523.048) (-524.816) [-525.569] -- 0:01:29
152000 -- [-524.328] (-524.358) (-524.309) (-524.382) * (-522.282) (-527.847) (-523.333) [-525.382] -- 0:01:29
153000 -- (-524.657) (-535.604) (-522.027) [-522.684] * (-525.075) (-529.125) [-522.343] (-526.880) -- 0:01:28
154000 -- (-522.565) (-523.682) (-522.524) [-523.702] * (-523.839) (-527.863) (-524.003) [-524.867] -- 0:01:27
155000 -- (-522.762) [-530.548] (-526.095) (-526.467) * (-522.283) (-523.168) (-521.788) [-527.098] -- 0:01:27
Average standard deviation of split frequencies: 0.032233
156000 -- [-525.182] (-531.464) (-526.913) (-525.300) * (-528.114) (-523.152) (-522.670) [-523.170] -- 0:01:26
157000 -- (-522.340) (-529.360) [-523.802] (-526.025) * (-521.915) (-529.676) [-526.121] (-528.901) -- 0:01:25
158000 -- (-524.218) (-526.179) [-520.258] (-526.157) * (-522.079) (-527.520) (-530.553) [-525.967] -- 0:01:30
159000 -- [-529.219] (-526.374) (-522.177) (-522.365) * (-524.751) [-526.724] (-528.378) (-526.354) -- 0:01:29
160000 -- (-523.637) (-530.279) (-526.553) [-523.632] * (-528.746) [-524.259] (-526.490) (-529.927) -- 0:01:29
Average standard deviation of split frequencies: 0.027384
161000 -- (-521.835) [-525.326] (-522.100) (-526.015) * (-531.103) (-524.479) (-530.405) [-525.250] -- 0:01:28
162000 -- [-522.981] (-526.092) (-522.504) (-526.496) * (-523.088) (-533.248) (-524.705) [-529.634] -- 0:01:27
163000 -- (-523.935) (-526.775) [-527.076] (-526.810) * (-525.417) [-523.772] (-530.652) (-530.194) -- 0:01:27
164000 -- [-523.952] (-528.000) (-528.333) (-527.113) * (-526.116) [-525.899] (-530.203) (-525.209) -- 0:01:26
165000 -- [-528.198] (-524.489) (-524.240) (-530.957) * (-526.623) [-526.033] (-523.583) (-533.454) -- 0:01:26
Average standard deviation of split frequencies: 0.030291
166000 -- (-529.052) (-528.054) (-530.802) [-525.017] * (-524.671) (-521.905) (-522.801) [-527.417] -- 0:01:25
167000 -- (-523.949) (-525.245) [-529.881] (-534.967) * [-523.816] (-525.409) (-523.642) (-525.379) -- 0:01:24
168000 -- (-530.694) (-523.165) [-528.193] (-527.064) * (-523.188) (-524.006) (-524.650) [-527.281] -- 0:01:29
169000 -- (-522.154) [-523.684] (-534.033) (-527.734) * (-528.293) (-526.268) [-524.246] (-525.724) -- 0:01:28
170000 -- (-527.088) [-523.475] (-524.486) (-523.954) * (-529.325) (-527.014) (-519.920) [-527.334] -- 0:01:27
Average standard deviation of split frequencies: 0.027621
171000 -- (-525.503) [-522.679] (-530.626) (-529.205) * [-523.730] (-530.102) (-524.248) (-529.160) -- 0:01:27
172000 -- (-523.710) [-524.627] (-527.010) (-530.099) * [-522.725] (-522.900) (-525.426) (-524.206) -- 0:01:26
173000 -- (-543.494) (-535.079) [-521.936] (-526.985) * (-524.061) [-524.529] (-521.939) (-527.483) -- 0:01:26
174000 -- (-527.002) (-526.426) [-526.119] (-529.158) * (-522.772) (-528.651) (-524.254) [-527.216] -- 0:01:25
175000 -- (-527.192) (-522.654) (-526.986) [-529.779] * (-529.512) (-529.567) (-527.030) [-526.363] -- 0:01:24
Average standard deviation of split frequencies: 0.030356
176000 -- (-533.879) (-524.793) [-524.670] (-527.471) * (-525.907) [-533.382] (-527.082) (-527.212) -- 0:01:24
177000 -- (-522.294) (-527.007) [-525.200] (-530.378) * (-531.310) (-523.777) [-522.162] (-527.937) -- 0:01:23
178000 -- (-533.457) [-522.937] (-529.071) (-528.832) * (-527.795) [-527.588] (-524.164) (-528.046) -- 0:01:27
179000 -- (-529.514) [-524.952] (-530.645) (-524.920) * (-534.840) [-526.612] (-522.329) (-525.276) -- 0:01:27
180000 -- (-529.264) (-525.605) [-523.854] (-526.898) * (-529.453) [-528.926] (-531.621) (-524.170) -- 0:01:26
Average standard deviation of split frequencies: 0.034790
181000 -- (-526.446) (-525.627) [-529.586] (-527.505) * (-525.206) [-524.624] (-523.842) (-525.510) -- 0:01:25
182000 -- (-532.846) (-523.942) [-523.541] (-528.091) * (-524.899) [-525.356] (-521.738) (-527.411) -- 0:01:25
183000 -- (-522.360) (-525.414) [-525.573] (-521.719) * (-526.359) (-529.970) (-523.720) [-527.371] -- 0:01:24
184000 -- (-527.005) [-522.502] (-526.944) (-526.397) * (-528.053) (-529.030) [-525.437] (-531.013) -- 0:01:24
185000 -- (-526.152) (-529.336) (-526.124) [-524.493] * (-527.020) (-530.954) (-524.914) [-526.171] -- 0:01:23
Average standard deviation of split frequencies: 0.035482
186000 -- (-533.485) (-522.569) [-523.380] (-524.609) * (-527.388) (-531.648) [-524.262] (-526.057) -- 0:01:23
187000 -- (-531.424) (-526.514) (-524.061) [-524.727] * (-527.002) (-529.799) [-524.061] (-524.414) -- 0:01:22
188000 -- (-533.056) (-528.820) [-525.199] (-526.238) * (-530.170) [-528.395] (-537.472) (-521.683) -- 0:01:26
189000 -- [-531.871] (-525.250) (-525.708) (-526.386) * (-527.153) (-527.483) [-524.205] (-524.601) -- 0:01:25
190000 -- (-528.429) [-525.335] (-524.661) (-528.210) * (-525.947) (-529.121) [-524.314] (-530.076) -- 0:01:25
Average standard deviation of split frequencies: 0.031317
191000 -- (-528.919) (-526.036) (-523.821) [-528.971] * [-526.593] (-528.636) (-523.453) (-526.677) -- 0:01:24
192000 -- (-529.841) [-523.970] (-527.022) (-524.753) * (-524.759) (-526.056) (-530.036) [-526.571] -- 0:01:24
193000 -- (-526.422) (-523.676) [-524.990] (-524.647) * [-522.996] (-525.121) (-526.723) (-526.073) -- 0:01:23
194000 -- (-526.199) [-527.386] (-524.728) (-528.086) * (-524.256) [-521.897] (-525.402) (-538.909) -- 0:01:23
195000 -- (-527.939) (-525.769) [-532.004] (-527.120) * [-521.601] (-531.165) (-526.576) (-525.711) -- 0:01:22
Average standard deviation of split frequencies: 0.027258
196000 -- (-529.290) [-527.795] (-525.558) (-524.873) * (-523.672) (-521.199) (-527.860) [-526.397] -- 0:01:22
197000 -- (-531.094) (-525.155) (-521.795) [-525.181] * [-523.254] (-524.863) (-528.610) (-522.664) -- 0:01:21
198000 -- (-537.806) (-524.233) [-521.642] (-528.784) * (-522.673) (-528.031) (-527.061) [-521.618] -- 0:01:25
199000 -- (-536.780) (-527.926) (-525.632) [-525.042] * (-525.294) (-524.450) (-528.530) [-524.185] -- 0:01:24
200000 -- (-531.173) (-528.568) [-523.305] (-521.720) * (-526.366) (-527.313) (-523.823) [-521.842] -- 0:01:24
Average standard deviation of split frequencies: 0.025058
201000 -- (-529.453) (-524.763) [-524.463] (-524.259) * (-531.233) (-525.359) [-527.927] (-524.684) -- 0:01:23
202000 -- [-524.110] (-526.107) (-524.522) (-534.429) * (-532.568) (-525.371) [-528.102] (-530.640) -- 0:01:22
203000 -- (-528.496) [-528.425] (-524.951) (-530.635) * (-531.364) (-523.940) [-530.193] (-525.870) -- 0:01:22
204000 -- (-532.598) (-528.111) [-520.673] (-527.286) * (-530.200) (-525.720) (-528.236) [-527.184] -- 0:01:21
205000 -- (-528.643) [-521.207] (-526.537) (-529.078) * (-525.936) (-528.648) (-528.527) [-524.863] -- 0:01:21
Average standard deviation of split frequencies: 0.024409
206000 -- (-529.828) [-529.610] (-524.049) (-526.264) * (-525.192) [-522.212] (-527.798) (-526.659) -- 0:01:20
207000 -- (-532.966) (-525.013) (-524.871) [-525.903] * (-526.250) [-523.336] (-525.680) (-531.579) -- 0:01:20
208000 -- (-527.868) [-524.872] (-523.362) (-525.646) * (-522.702) (-523.677) [-521.668] (-527.310) -- 0:01:23
209000 -- [-525.310] (-524.454) (-527.946) (-524.985) * [-523.305] (-528.812) (-528.168) (-529.487) -- 0:01:23
210000 -- [-530.534] (-525.703) (-521.966) (-526.673) * (-527.384) [-524.966] (-525.691) (-528.912) -- 0:01:22
Average standard deviation of split frequencies: 0.025360
211000 -- (-533.408) [-528.181] (-527.370) (-521.644) * (-523.889) (-532.261) [-525.815] (-525.098) -- 0:01:22
212000 -- (-527.843) [-525.866] (-521.229) (-526.092) * (-523.026) (-524.609) [-523.629] (-521.953) -- 0:01:21
213000 -- (-534.992) [-522.422] (-526.294) (-525.797) * [-523.216] (-539.963) (-526.986) (-523.978) -- 0:01:21
214000 -- (-529.976) (-523.125) (-527.715) [-525.040] * (-523.190) (-523.310) (-526.832) [-520.244] -- 0:01:20
215000 -- (-528.011) [-523.568] (-524.192) (-524.479) * (-525.907) (-525.697) (-523.202) [-519.510] -- 0:01:20
Average standard deviation of split frequencies: 0.024734
216000 -- (-528.417) [-525.907] (-531.425) (-524.465) * [-528.362] (-526.577) (-527.490) (-525.681) -- 0:01:19
217000 -- (-526.354) (-524.386) [-525.783] (-528.829) * (-525.943) (-529.688) [-526.512] (-531.148) -- 0:01:19
218000 -- (-530.028) [-528.889] (-525.901) (-526.574) * (-523.164) [-527.613] (-522.852) (-522.360) -- 0:01:22
219000 -- (-526.223) (-526.185) [-523.880] (-526.436) * [-529.388] (-528.011) (-525.941) (-526.896) -- 0:01:22
220000 -- (-523.604) (-523.268) [-527.506] (-531.791) * (-523.543) (-525.049) (-530.601) [-523.143] -- 0:01:21
Average standard deviation of split frequencies: 0.019939
221000 -- (-525.612) (-523.460) [-523.659] (-529.841) * (-524.136) [-523.473] (-530.467) (-524.338) -- 0:01:21
222000 -- (-523.808) (-525.923) (-528.245) [-527.133] * [-521.429] (-526.530) (-522.021) (-522.034) -- 0:01:20
223000 -- (-524.614) [-523.639] (-525.672) (-527.863) * (-525.036) [-525.752] (-521.452) (-525.849) -- 0:01:20
224000 -- (-523.526) [-521.734] (-530.288) (-522.677) * (-527.324) (-522.262) [-524.471] (-523.430) -- 0:01:19
225000 -- [-526.949] (-523.349) (-528.968) (-525.546) * (-533.573) (-527.084) (-524.995) [-523.985] -- 0:01:19
Average standard deviation of split frequencies: 0.016687
226000 -- (-529.993) (-524.371) (-526.137) [-520.482] * (-539.452) (-522.793) (-523.219) [-523.213] -- 0:01:18
227000 -- [-525.650] (-523.390) (-523.846) (-526.894) * (-527.396) (-528.118) [-524.505] (-523.771) -- 0:01:21
228000 -- [-528.790] (-525.610) (-527.213) (-520.254) * (-523.816) (-523.996) (-526.657) [-529.094] -- 0:01:21
229000 -- (-529.455) [-526.279] (-526.352) (-523.261) * (-525.265) (-525.083) [-522.602] (-530.119) -- 0:01:20
230000 -- (-524.566) (-526.434) (-525.173) [-524.535] * [-524.401] (-525.499) (-525.066) (-527.637) -- 0:01:20
Average standard deviation of split frequencies: 0.017712
231000 -- [-525.750] (-526.190) (-526.406) (-524.404) * (-525.425) (-525.979) (-524.539) [-523.013] -- 0:01:19
232000 -- (-525.148) [-525.123] (-527.268) (-533.051) * (-523.617) [-525.017] (-528.628) (-522.598) -- 0:01:19
233000 -- (-522.276) (-521.474) (-525.772) [-526.052] * (-523.389) (-523.461) (-526.490) [-524.509] -- 0:01:19
234000 -- (-522.932) [-523.453] (-525.645) (-528.728) * (-522.160) (-524.375) [-528.617] (-525.728) -- 0:01:18
235000 -- (-525.260) [-522.020] (-527.412) (-529.485) * [-526.279] (-527.626) (-524.456) (-526.441) -- 0:01:18
Average standard deviation of split frequencies: 0.018643
236000 -- (-524.111) (-526.566) (-535.262) [-525.512] * (-530.264) (-525.440) [-523.506] (-524.046) -- 0:01:20
237000 -- (-526.534) (-532.776) [-528.496] (-529.767) * [-526.127] (-525.264) (-522.228) (-533.253) -- 0:01:20
238000 -- [-526.410] (-526.651) (-527.660) (-524.146) * (-526.928) [-522.061] (-523.133) (-523.370) -- 0:01:20
239000 -- [-520.817] (-526.916) (-531.757) (-522.321) * [-523.204] (-528.151) (-532.132) (-521.850) -- 0:01:19
240000 -- (-527.877) (-526.061) (-531.070) [-523.065] * (-523.745) (-527.551) (-529.379) [-527.709] -- 0:01:19
Average standard deviation of split frequencies: 0.024811
241000 -- (-526.261) [-523.402] (-520.330) (-520.558) * [-526.770] (-529.728) (-524.711) (-523.785) -- 0:01:18
242000 -- (-524.995) (-530.807) (-528.274) [-522.517] * (-525.121) (-522.426) [-524.032] (-524.290) -- 0:01:18
243000 -- (-524.151) (-526.056) (-531.684) [-523.891] * (-530.189) [-526.549] (-529.613) (-523.675) -- 0:01:17
244000 -- [-525.624] (-526.473) (-523.812) (-526.883) * (-527.288) (-524.710) (-533.428) [-527.072] -- 0:01:17
245000 -- (-528.979) [-520.555] (-525.858) (-524.142) * (-523.019) [-525.800] (-526.509) (-524.026) -- 0:01:17
Average standard deviation of split frequencies: 0.025550
246000 -- (-526.402) [-526.140] (-525.169) (-525.115) * [-528.237] (-527.577) (-526.047) (-526.873) -- 0:01:19
247000 -- (-523.051) (-534.594) (-521.451) [-526.310] * (-531.838) (-526.171) (-526.591) [-526.481] -- 0:01:19
248000 -- [-522.899] (-525.762) (-527.178) (-521.852) * (-523.512) (-524.659) (-519.374) [-528.291] -- 0:01:18
249000 -- [-521.970] (-526.723) (-522.289) (-523.948) * (-527.996) [-525.844] (-523.904) (-527.072) -- 0:01:18
250000 -- (-520.964) (-524.620) (-521.553) [-524.234] * [-522.631] (-528.762) (-526.810) (-526.697) -- 0:01:18
Average standard deviation of split frequencies: 0.026328
251000 -- (-530.887) (-527.165) (-528.000) [-527.420] * [-526.426] (-527.496) (-530.162) (-524.367) -- 0:01:17
252000 -- (-528.144) (-525.964) [-523.179] (-526.421) * (-527.608) (-525.472) [-522.107] (-528.118) -- 0:01:17
253000 -- (-529.036) [-519.448] (-524.613) (-527.958) * (-528.262) [-523.148] (-525.135) (-527.044) -- 0:01:16
254000 -- (-528.122) [-524.972] (-524.780) (-525.972) * (-523.242) (-523.820) [-523.633] (-525.004) -- 0:01:16
255000 -- (-522.652) [-529.162] (-522.996) (-525.675) * (-525.805) (-524.635) [-524.478] (-522.674) -- 0:01:15
Average standard deviation of split frequencies: 0.028235
256000 -- (-527.901) (-531.661) (-524.588) [-526.772] * (-524.975) (-529.863) [-522.044] (-524.048) -- 0:01:18
257000 -- (-527.486) [-526.947] (-527.392) (-527.305) * (-529.790) (-526.013) (-523.963) [-524.498] -- 0:01:18
258000 -- (-524.340) [-524.868] (-530.087) (-527.122) * (-527.877) [-527.795] (-524.632) (-526.918) -- 0:01:17
259000 -- (-527.123) (-527.864) [-527.568] (-528.888) * (-526.463) (-527.099) [-526.813] (-527.734) -- 0:01:17
260000 -- [-526.179] (-527.712) (-529.012) (-527.654) * (-525.622) (-526.832) [-526.647] (-524.623) -- 0:01:16
Average standard deviation of split frequencies: 0.024113
261000 -- [-521.407] (-526.076) (-529.133) (-529.189) * (-530.058) [-523.199] (-531.991) (-523.845) -- 0:01:16
262000 -- (-528.745) (-528.431) (-529.606) [-526.618] * [-528.025] (-527.975) (-525.040) (-527.594) -- 0:01:16
263000 -- [-521.824] (-525.681) (-524.741) (-526.840) * [-525.059] (-524.319) (-524.475) (-523.467) -- 0:01:15
264000 -- (-522.085) (-524.162) [-523.481] (-523.969) * (-532.730) [-525.181] (-531.134) (-525.893) -- 0:01:15
265000 -- (-524.668) [-528.584] (-526.581) (-522.465) * [-524.366] (-526.557) (-521.845) (-525.652) -- 0:01:14
Average standard deviation of split frequencies: 0.021266
266000 -- [-523.038] (-529.061) (-525.534) (-525.000) * [-521.494] (-527.184) (-525.452) (-529.696) -- 0:01:17
267000 -- [-524.932] (-522.853) (-521.510) (-525.568) * (-524.360) (-525.722) [-523.472] (-526.091) -- 0:01:16
268000 -- (-525.693) (-525.834) (-526.614) [-520.673] * (-523.335) [-529.117] (-522.100) (-527.934) -- 0:01:16
269000 -- (-526.078) [-526.392] (-525.440) (-523.104) * [-522.604] (-526.275) (-521.539) (-524.456) -- 0:01:16
270000 -- [-524.329] (-524.171) (-525.660) (-527.556) * (-525.288) (-529.617) [-524.197] (-529.205) -- 0:01:15
Average standard deviation of split frequencies: 0.018578
271000 -- (-524.335) (-531.325) (-527.388) [-522.990] * [-525.021] (-524.848) (-525.569) (-524.133) -- 0:01:15
272000 -- (-528.804) (-524.995) [-523.242] (-530.208) * (-527.204) (-529.258) (-524.826) [-520.713] -- 0:01:14
273000 -- (-523.040) (-530.443) [-526.846] (-527.475) * (-531.155) (-522.098) [-531.701] (-521.091) -- 0:01:14
274000 -- [-522.004] (-525.401) (-524.189) (-531.783) * (-523.975) (-532.377) (-532.041) [-521.145] -- 0:01:14
275000 -- [-527.122] (-526.866) (-526.902) (-528.692) * (-527.636) (-529.300) (-527.844) [-526.729] -- 0:01:13
Average standard deviation of split frequencies: 0.018219
276000 -- [-522.607] (-524.895) (-523.528) (-526.707) * (-526.814) [-524.797] (-521.156) (-524.316) -- 0:01:16
277000 -- (-523.089) [-524.054] (-524.435) (-523.415) * (-524.176) (-531.982) (-527.857) [-530.282] -- 0:01:15
278000 -- [-525.082] (-525.522) (-528.507) (-524.150) * (-526.119) (-525.450) [-525.294] (-527.317) -- 0:01:15
279000 -- (-525.360) [-522.966] (-526.021) (-532.241) * (-528.262) (-523.686) [-527.530] (-526.084) -- 0:01:14
280000 -- (-523.911) (-525.680) (-528.592) [-528.000] * [-525.634] (-529.825) (-525.623) (-523.570) -- 0:01:14
Average standard deviation of split frequencies: 0.019035
281000 -- (-527.319) (-525.619) [-529.641] (-538.409) * (-528.407) (-527.396) (-524.875) [-526.429] -- 0:01:14
282000 -- [-526.832] (-524.929) (-520.870) (-529.077) * (-529.492) (-529.189) [-523.723] (-526.346) -- 0:01:13
283000 -- (-531.030) (-521.610) (-520.902) [-526.244] * (-530.177) (-528.078) [-526.221] (-519.347) -- 0:01:13
284000 -- (-526.156) (-525.000) [-523.074] (-532.347) * (-528.284) (-523.945) (-522.100) [-524.914] -- 0:01:13
285000 -- (-526.905) (-525.583) [-523.583] (-524.744) * (-529.222) (-524.051) [-523.793] (-523.360) -- 0:01:12
Average standard deviation of split frequencies: 0.018680
286000 -- [-528.856] (-522.518) (-526.535) (-523.905) * (-533.730) [-522.086] (-524.247) (-524.048) -- 0:01:14
287000 -- [-528.004] (-522.087) (-523.071) (-528.575) * [-522.018] (-525.042) (-529.504) (-529.851) -- 0:01:14
288000 -- (-526.060) [-523.655] (-521.360) (-524.346) * [-523.708] (-532.089) (-527.182) (-524.971) -- 0:01:14
289000 -- (-524.854) (-522.452) (-532.368) [-525.601] * (-527.938) (-523.826) [-531.005] (-522.304) -- 0:01:13
290000 -- [-522.331] (-522.880) (-531.408) (-525.031) * (-522.573) (-530.707) [-527.653] (-521.477) -- 0:01:13
Average standard deviation of split frequencies: 0.019462
291000 -- (-529.370) [-522.986] (-523.355) (-523.403) * (-526.334) [-521.954] (-536.103) (-530.255) -- 0:01:13
292000 -- (-528.947) (-525.163) (-529.615) [-523.737] * (-521.134) [-525.577] (-539.452) (-529.957) -- 0:01:12
293000 -- (-522.244) [-521.876] (-525.507) (-524.027) * (-522.030) (-534.254) (-530.754) [-524.649] -- 0:01:12
294000 -- (-521.473) (-525.338) (-528.141) [-525.531] * [-525.706] (-526.147) (-527.608) (-524.760) -- 0:01:12
295000 -- (-523.825) (-527.086) [-525.568] (-521.769) * (-522.586) (-525.346) [-530.326] (-524.365) -- 0:01:11
Average standard deviation of split frequencies: 0.014864
296000 -- [-529.117] (-527.990) (-522.782) (-525.066) * (-525.552) (-525.306) [-522.644] (-523.792) -- 0:01:13
297000 -- [-528.066] (-524.550) (-529.807) (-527.048) * [-526.108] (-524.118) (-527.211) (-526.917) -- 0:01:13
298000 -- (-528.186) [-526.101] (-536.942) (-528.208) * [-523.072] (-521.857) (-525.623) (-522.589) -- 0:01:13
299000 -- (-533.265) [-529.348] (-530.096) (-529.705) * (-523.037) [-527.837] (-528.952) (-526.283) -- 0:01:12
300000 -- (-523.770) (-521.258) [-523.370] (-527.489) * (-522.702) (-524.342) (-526.241) [-522.963] -- 0:01:12
Average standard deviation of split frequencies: 0.014633
301000 -- [-525.712] (-526.013) (-524.438) (-527.840) * (-527.773) [-526.566] (-528.981) (-524.065) -- 0:01:11
302000 -- (-534.310) (-528.513) [-523.941] (-523.095) * [-531.741] (-529.497) (-520.817) (-525.475) -- 0:01:11
303000 -- (-523.476) [-524.939] (-523.452) (-522.872) * (-525.332) (-522.763) (-524.177) [-523.772] -- 0:01:11
304000 -- (-525.850) (-524.654) (-531.572) [-530.913] * (-524.253) [-521.490] (-525.059) (-526.300) -- 0:01:10
305000 -- [-523.000] (-524.220) (-527.945) (-530.909) * (-529.211) [-522.905] (-526.170) (-526.955) -- 0:01:10
Average standard deviation of split frequencies: 0.014378
306000 -- [-527.236] (-523.996) (-525.117) (-522.771) * (-527.456) (-525.097) (-527.196) [-521.240] -- 0:01:10
307000 -- (-527.071) (-527.794) [-525.365] (-526.286) * [-523.998] (-525.383) (-525.474) (-531.530) -- 0:01:12
308000 -- (-527.404) [-527.567] (-528.111) (-521.709) * (-525.415) [-524.081] (-530.252) (-521.878) -- 0:01:11
309000 -- (-533.445) (-525.457) [-526.044] (-524.873) * (-527.735) [-522.118] (-526.442) (-524.979) -- 0:01:11
310000 -- (-525.248) (-521.400) (-525.496) [-520.896] * (-524.474) (-524.596) [-526.495] (-525.395) -- 0:01:11
Average standard deviation of split frequencies: 0.011128
311000 -- (-524.231) (-527.295) (-527.247) [-521.687] * (-520.811) [-523.413] (-526.506) (-523.259) -- 0:01:10
312000 -- (-523.694) [-526.710] (-527.108) (-527.774) * (-524.593) [-522.419] (-525.999) (-533.007) -- 0:01:10
313000 -- (-525.732) [-524.869] (-525.762) (-524.054) * (-522.943) (-523.122) (-524.502) [-527.737] -- 0:01:10
314000 -- [-524.297] (-522.832) (-531.929) (-527.146) * [-526.670] (-522.262) (-527.172) (-531.418) -- 0:01:09
315000 -- (-525.195) (-524.327) (-521.954) [-526.290] * (-524.351) (-521.616) [-523.348] (-523.527) -- 0:01:09
Average standard deviation of split frequencies: 0.007956
316000 -- (-528.551) [-522.280] (-527.647) (-520.732) * (-523.108) (-522.165) (-522.863) [-521.367] -- 0:01:09
317000 -- (-528.547) [-526.248] (-522.392) (-525.499) * [-522.095] (-528.482) (-528.209) (-522.300) -- 0:01:11
318000 -- [-527.950] (-532.756) (-527.460) (-524.623) * (-530.877) [-526.083] (-522.956) (-523.558) -- 0:01:10
319000 -- (-528.695) (-529.490) [-523.916] (-526.893) * [-523.940] (-527.319) (-524.928) (-526.299) -- 0:01:10
320000 -- (-528.218) (-525.295) [-528.762] (-533.216) * (-525.576) [-525.397] (-526.112) (-524.496) -- 0:01:10
Average standard deviation of split frequencies: 0.008820
321000 -- (-530.453) (-525.360) [-523.693] (-528.942) * (-521.682) [-523.158] (-526.018) (-530.466) -- 0:01:09
322000 -- (-529.813) (-524.215) (-524.807) [-526.213] * [-524.112] (-522.550) (-530.167) (-531.040) -- 0:01:09
323000 -- (-525.778) (-530.497) [-525.343] (-527.753) * (-525.127) (-527.070) (-524.184) [-530.103] -- 0:01:09
324000 -- (-524.368) [-525.935] (-524.797) (-529.057) * (-524.922) (-527.625) [-530.069] (-521.200) -- 0:01:08
325000 -- (-526.237) (-525.469) (-523.313) [-527.630] * (-528.225) [-526.208] (-525.439) (-529.040) -- 0:01:08
Average standard deviation of split frequencies: 0.012532
326000 -- [-523.345] (-526.381) (-527.528) (-533.842) * [-524.092] (-527.251) (-527.914) (-523.966) -- 0:01:08
327000 -- (-523.288) (-525.896) (-525.643) [-524.729] * (-523.180) (-524.412) (-525.334) [-525.358] -- 0:01:07
328000 -- [-525.764] (-525.598) (-526.218) (-525.400) * (-524.112) [-524.261] (-528.475) (-522.493) -- 0:01:09
329000 -- (-526.144) [-524.508] (-524.376) (-533.083) * (-532.965) (-525.980) [-527.607] (-527.597) -- 0:01:09
330000 -- (-532.235) [-528.106] (-524.629) (-533.708) * [-528.785] (-523.412) (-525.703) (-523.040) -- 0:01:09
Average standard deviation of split frequencies: 0.011405
331000 -- (-530.443) [-527.712] (-523.802) (-529.929) * [-524.750] (-525.282) (-520.875) (-527.596) -- 0:01:08
332000 -- (-525.934) [-523.260] (-520.096) (-537.547) * (-524.101) [-529.364] (-527.358) (-528.178) -- 0:01:08
333000 -- [-526.709] (-525.230) (-524.804) (-522.852) * (-526.468) (-527.118) [-525.999] (-534.556) -- 0:01:08
334000 -- (-525.224) (-526.085) [-521.669] (-524.864) * (-523.196) (-524.750) [-526.393] (-525.581) -- 0:01:07
335000 -- (-523.213) [-522.478] (-524.310) (-526.398) * [-523.454] (-524.152) (-532.317) (-526.510) -- 0:01:07
Average standard deviation of split frequencies: 0.013095
336000 -- (-528.789) (-528.432) [-524.538] (-523.890) * [-521.327] (-523.491) (-529.279) (-529.090) -- 0:01:07
337000 -- (-523.155) (-530.808) (-522.305) [-526.545] * (-527.879) (-525.373) (-538.468) [-527.397] -- 0:01:06
338000 -- [-520.684] (-521.698) (-527.522) (-525.243) * [-525.744] (-524.133) (-528.591) (-521.915) -- 0:01:08
339000 -- (-523.170) (-520.936) [-526.191] (-528.681) * (-530.381) (-530.284) [-526.084] (-530.007) -- 0:01:08
340000 -- (-523.780) [-521.206] (-524.537) (-524.061) * (-528.131) (-522.688) (-529.957) [-528.393] -- 0:01:07
Average standard deviation of split frequencies: 0.012915
341000 -- (-525.052) [-522.708] (-527.546) (-524.940) * [-527.573] (-529.350) (-527.228) (-520.885) -- 0:01:07
342000 -- (-530.454) (-521.761) [-527.465] (-521.417) * (-528.002) (-525.261) (-525.663) [-524.393] -- 0:01:07
343000 -- [-522.411] (-523.534) (-532.131) (-524.359) * (-528.267) (-523.583) [-522.248] (-530.608) -- 0:01:07
344000 -- (-522.920) [-524.312] (-525.032) (-523.962) * (-532.158) (-532.059) [-526.608] (-526.872) -- 0:01:06
345000 -- (-526.334) (-522.296) [-527.560] (-523.047) * [-525.154] (-537.575) (-530.710) (-526.437) -- 0:01:06
Average standard deviation of split frequencies: 0.012716
346000 -- (-532.778) (-520.906) (-525.176) [-523.285] * (-524.729) [-523.963] (-535.143) (-526.562) -- 0:01:06
347000 -- (-528.267) (-524.753) [-528.279] (-524.659) * (-526.773) [-521.780] (-528.115) (-520.470) -- 0:01:05
348000 -- (-523.946) (-524.222) (-532.958) [-524.418] * (-525.119) (-522.467) [-527.138] (-530.094) -- 0:01:07
349000 -- [-524.981] (-522.301) (-524.908) (-524.459) * (-527.740) [-524.259] (-532.710) (-529.511) -- 0:01:07
350000 -- (-530.885) (-522.943) (-526.119) [-526.551] * (-525.387) (-525.491) [-525.026] (-529.098) -- 0:01:06
Average standard deviation of split frequencies: 0.012547
351000 -- (-529.778) (-523.360) [-521.291] (-526.395) * (-523.393) (-522.550) (-531.031) [-528.984] -- 0:01:06
352000 -- (-528.023) (-523.382) (-526.867) [-524.679] * [-523.972] (-533.256) (-532.387) (-527.087) -- 0:01:06
353000 -- (-527.692) [-526.972] (-526.676) (-525.935) * (-522.371) (-525.277) [-527.134] (-523.611) -- 0:01:05
354000 -- [-528.408] (-526.094) (-530.158) (-523.229) * (-523.311) [-530.781] (-529.851) (-522.666) -- 0:01:05
355000 -- (-524.683) [-521.919] (-526.638) (-524.250) * (-520.876) [-524.019] (-526.981) (-521.208) -- 0:01:05
Average standard deviation of split frequencies: 0.008828
356000 -- (-524.603) (-528.662) [-525.722] (-526.762) * (-520.841) (-526.018) (-523.443) [-523.388] -- 0:01:05
357000 -- (-531.803) (-528.805) [-522.364] (-525.761) * (-524.447) (-527.016) [-522.374] (-523.067) -- 0:01:04
358000 -- (-526.039) (-524.239) (-529.968) [-526.411] * [-524.656] (-528.585) (-526.008) (-525.756) -- 0:01:06
359000 -- [-524.561] (-529.935) (-529.362) (-528.011) * [-526.629] (-527.904) (-524.807) (-526.914) -- 0:01:06
360000 -- (-524.576) [-522.854] (-527.216) (-530.087) * [-527.179] (-526.135) (-527.158) (-527.048) -- 0:01:05
Average standard deviation of split frequencies: 0.008714
361000 -- (-531.696) (-523.427) (-528.164) [-527.405] * (-523.393) (-522.661) (-525.028) [-524.811] -- 0:01:05
362000 -- [-527.355] (-529.820) (-526.829) (-530.836) * (-527.717) (-534.031) (-524.443) [-527.413] -- 0:01:05
363000 -- (-524.525) (-526.528) (-524.031) [-524.528] * (-522.271) (-527.787) [-525.115] (-534.912) -- 0:01:04
364000 -- [-521.822] (-528.353) (-529.815) (-523.456) * [-522.983] (-527.994) (-524.258) (-523.736) -- 0:01:04
365000 -- [-524.590] (-523.371) (-527.938) (-539.756) * (-524.788) [-525.786] (-525.126) (-522.803) -- 0:01:04
Average standard deviation of split frequencies: 0.009445
366000 -- (-526.913) (-524.573) [-525.818] (-531.222) * (-526.145) [-526.203] (-525.438) (-524.396) -- 0:01:04
367000 -- [-522.287] (-525.124) (-527.099) (-524.516) * [-525.965] (-523.382) (-530.029) (-528.842) -- 0:01:03
368000 -- (-520.220) (-530.256) (-527.644) [-524.474] * [-527.044] (-526.254) (-526.746) (-522.957) -- 0:01:03
369000 -- (-521.093) (-529.966) (-528.418) [-524.428] * [-526.387] (-523.509) (-528.486) (-524.213) -- 0:01:04
370000 -- (-525.287) (-528.242) [-523.332] (-522.043) * (-531.488) (-525.809) [-527.041] (-525.985) -- 0:01:04
Average standard deviation of split frequencies: 0.006783
371000 -- (-524.747) (-528.559) [-523.419] (-521.795) * (-529.250) (-527.012) (-529.928) [-524.041] -- 0:01:04
372000 -- (-527.993) (-525.505) [-523.430] (-523.677) * (-528.335) (-528.425) (-527.575) [-527.000] -- 0:01:04
373000 -- (-528.834) (-534.225) (-524.277) [-523.597] * [-524.282] (-519.240) (-525.122) (-523.790) -- 0:01:03
374000 -- (-525.537) [-523.649] (-524.696) (-521.157) * (-522.819) [-522.858] (-527.845) (-534.345) -- 0:01:03
375000 -- (-527.033) (-530.231) [-525.181] (-527.811) * (-521.580) (-524.888) (-526.948) [-525.400] -- 0:01:03
Average standard deviation of split frequencies: 0.005851
376000 -- (-529.412) [-519.761] (-525.699) (-520.609) * (-521.996) [-525.441] (-528.541) (-529.436) -- 0:01:03
377000 -- (-529.993) (-522.613) (-523.982) [-520.799] * (-523.910) [-530.303] (-529.401) (-528.059) -- 0:01:02
378000 -- [-520.521] (-532.012) (-524.446) (-523.955) * [-521.218] (-530.073) (-524.890) (-528.141) -- 0:01:02
379000 -- (-522.994) (-533.698) [-528.936] (-525.606) * [-525.511] (-526.257) (-524.865) (-527.181) -- 0:01:03
380000 -- [-526.551] (-527.383) (-525.280) (-526.279) * (-523.808) [-521.725] (-522.764) (-527.125) -- 0:01:03
Average standard deviation of split frequencies: 0.005779
381000 -- [-523.665] (-528.437) (-525.679) (-526.651) * (-529.081) [-521.154] (-526.911) (-522.014) -- 0:01:03
382000 -- (-526.651) (-523.273) (-526.320) [-522.448] * (-523.495) (-528.176) (-526.027) [-521.778] -- 0:01:03
383000 -- [-523.981] (-522.669) (-526.826) (-530.392) * (-527.518) (-530.255) (-524.380) [-524.817] -- 0:01:02
384000 -- (-526.892) (-522.157) (-531.355) [-522.404] * (-524.966) [-522.558] (-522.477) (-523.891) -- 0:01:02
385000 -- (-525.957) (-525.936) [-526.732] (-527.845) * (-526.140) (-523.137) (-522.998) [-528.468] -- 0:01:02
Average standard deviation of split frequencies: 0.007328
386000 -- (-528.553) (-522.968) (-524.971) [-525.028] * (-528.249) (-521.235) (-523.509) [-522.381] -- 0:01:02
387000 -- (-528.014) (-521.917) [-523.457] (-534.007) * (-530.959) (-523.143) [-521.121] (-524.997) -- 0:01:01
388000 -- (-526.135) (-521.687) (-522.246) [-525.564] * (-523.080) (-521.217) [-522.236] (-531.600) -- 0:01:01
389000 -- (-524.501) [-528.687] (-522.056) (-525.120) * [-530.492] (-522.707) (-525.123) (-527.111) -- 0:01:01
390000 -- [-525.130] (-520.289) (-525.500) (-523.877) * (-527.849) (-527.768) [-523.741] (-523.568) -- 0:01:02
Average standard deviation of split frequencies: 0.010458
391000 -- (-526.330) (-524.343) [-520.220] (-524.665) * (-524.736) (-533.625) (-530.666) [-524.395] -- 0:01:02
392000 -- (-525.121) (-523.239) [-525.025] (-529.140) * (-531.265) (-525.427) (-526.771) [-524.484] -- 0:01:02
393000 -- (-524.083) (-524.103) (-521.574) [-527.220] * (-523.639) (-523.236) [-522.670] (-526.453) -- 0:01:01
394000 -- (-526.576) [-520.564] (-523.449) (-524.544) * [-530.133] (-528.220) (-530.924) (-531.739) -- 0:01:01
395000 -- (-522.971) [-522.884] (-530.867) (-527.753) * (-523.842) [-527.599] (-528.832) (-528.582) -- 0:01:01
Average standard deviation of split frequencies: 0.010317
396000 -- (-525.427) [-524.137] (-526.758) (-530.118) * (-532.457) [-524.566] (-526.002) (-524.081) -- 0:01:01
397000 -- (-528.504) [-527.439] (-527.918) (-527.708) * (-523.446) (-526.692) (-530.514) [-525.743] -- 0:01:00
398000 -- (-526.251) [-525.321] (-525.836) (-524.794) * (-524.008) (-536.707) [-525.222] (-527.853) -- 0:01:00
399000 -- (-528.677) (-521.602) [-529.358] (-525.273) * [-534.185] (-528.525) (-524.425) (-525.716) -- 0:01:00
400000 -- (-536.373) (-524.875) [-527.071] (-527.650) * (-525.132) [-526.493] (-531.092) (-529.198) -- 0:01:01
Average standard deviation of split frequencies: 0.010981
401000 -- (-534.125) (-526.922) [-527.841] (-524.132) * (-524.208) [-524.180] (-530.014) (-522.649) -- 0:01:01
402000 -- (-524.690) (-530.362) (-524.247) [-522.449] * [-524.592] (-525.668) (-524.374) (-521.714) -- 0:01:00
403000 -- (-529.428) (-533.063) [-529.052] (-524.694) * (-530.026) (-523.531) [-523.288] (-526.887) -- 0:01:00
404000 -- (-523.833) [-523.554] (-528.312) (-524.475) * (-528.313) (-523.916) [-524.529] (-525.176) -- 0:01:00
405000 -- (-526.656) (-524.534) [-530.621] (-523.985) * (-525.318) [-523.390] (-528.041) (-532.305) -- 0:01:00
Average standard deviation of split frequencies: 0.010837
406000 -- (-522.635) [-524.489] (-527.511) (-526.155) * [-524.225] (-523.598) (-526.809) (-526.796) -- 0:00:59
407000 -- [-522.722] (-526.362) (-534.278) (-531.237) * (-527.791) (-527.183) [-523.096] (-529.626) -- 0:00:59
408000 -- (-526.644) [-524.588] (-522.543) (-526.860) * (-524.463) [-520.904] (-523.098) (-527.234) -- 0:00:59
409000 -- (-528.361) [-524.424] (-531.464) (-522.483) * (-533.202) (-523.395) (-526.891) [-528.794] -- 0:00:59
410000 -- (-524.734) (-525.750) (-527.378) [-522.521] * (-527.606) [-523.201] (-529.006) (-529.908) -- 0:01:00
Average standard deviation of split frequencies: 0.012244
411000 -- (-528.591) (-522.535) (-531.446) [-525.118] * (-522.965) (-525.518) (-527.693) [-528.163] -- 0:01:00
412000 -- (-525.955) (-521.773) [-523.355] (-527.430) * (-527.436) [-524.682] (-525.642) (-527.455) -- 0:00:59
413000 -- (-531.242) [-529.851] (-533.590) (-520.494) * (-525.021) (-526.712) [-531.267] (-523.832) -- 0:00:59
414000 -- (-525.506) (-523.184) [-520.687] (-524.345) * (-523.588) [-524.445] (-525.158) (-528.972) -- 0:00:59
415000 -- (-527.732) (-520.672) (-528.220) [-525.261] * (-523.528) (-527.131) (-522.269) [-523.898] -- 0:00:59
Average standard deviation of split frequencies: 0.010576
416000 -- (-521.146) [-524.123] (-527.307) (-525.901) * (-529.463) [-526.147] (-521.312) (-521.261) -- 0:00:58
417000 -- (-522.789) [-523.373] (-527.252) (-527.091) * (-524.744) (-521.853) [-522.514] (-529.251) -- 0:00:58
418000 -- (-527.628) [-523.893] (-524.105) (-524.145) * [-528.330] (-524.815) (-522.832) (-529.040) -- 0:00:58
419000 -- [-530.526] (-538.742) (-528.814) (-526.369) * (-536.337) [-523.318] (-525.004) (-525.797) -- 0:00:58
420000 -- (-523.595) [-523.986] (-525.480) (-528.873) * (-526.033) (-526.495) [-522.401] (-527.663) -- 0:00:58
Average standard deviation of split frequencies: 0.013447
421000 -- (-522.157) (-535.538) (-527.950) [-523.478] * (-526.871) [-522.274] (-525.276) (-528.203) -- 0:00:59
422000 -- (-522.961) (-524.097) [-526.404] (-526.809) * (-527.216) [-521.943] (-526.742) (-530.136) -- 0:00:58
423000 -- (-525.238) [-527.797] (-525.197) (-525.417) * [-528.561] (-527.104) (-520.945) (-527.146) -- 0:00:58
424000 -- [-523.304] (-527.912) (-521.829) (-527.573) * (-525.934) (-532.113) (-521.841) [-530.456] -- 0:00:58
425000 -- (-525.932) (-527.141) (-526.307) [-525.275] * [-523.318] (-528.474) (-528.785) (-526.575) -- 0:00:58
Average standard deviation of split frequencies: 0.012541
426000 -- (-529.762) (-521.044) [-522.769] (-526.172) * (-527.496) [-529.284] (-528.230) (-528.263) -- 0:00:57
427000 -- (-527.900) [-523.886] (-522.921) (-525.973) * (-525.803) [-525.103] (-530.255) (-523.380) -- 0:00:57
428000 -- (-523.068) (-522.567) (-525.523) [-524.182] * (-526.984) (-528.081) (-522.120) [-528.562] -- 0:00:57
429000 -- (-525.620) (-522.074) [-524.253] (-523.917) * (-525.892) [-520.088] (-526.156) (-524.713) -- 0:00:57
430000 -- (-526.968) [-524.095] (-533.030) (-531.977) * (-526.089) (-521.791) (-526.552) [-520.899] -- 0:00:57
Average standard deviation of split frequencies: 0.012405
431000 -- (-524.035) (-526.788) [-525.705] (-524.927) * [-527.709] (-527.338) (-531.172) (-522.442) -- 0:00:58
432000 -- (-528.899) [-526.829] (-522.500) (-523.420) * (-523.496) [-525.133] (-533.233) (-522.997) -- 0:00:57
433000 -- (-528.549) (-527.963) (-521.040) [-523.361] * (-528.480) (-525.175) (-532.175) [-524.386] -- 0:00:57
434000 -- (-525.746) [-524.842] (-526.795) (-522.378) * (-525.239) (-525.637) (-526.424) [-522.287] -- 0:00:57
435000 -- (-528.952) (-529.515) [-524.220] (-531.656) * [-528.146] (-525.211) (-530.206) (-529.588) -- 0:00:57
Average standard deviation of split frequencies: 0.014416
436000 -- [-523.869] (-523.946) (-524.770) (-524.663) * (-531.628) [-525.876] (-529.730) (-527.833) -- 0:00:56
437000 -- (-524.949) (-525.289) [-526.356] (-520.585) * (-529.493) (-526.437) [-521.116] (-534.274) -- 0:00:56
438000 -- (-527.189) (-528.781) (-523.136) [-526.660] * (-526.350) (-524.892) (-530.143) [-521.500] -- 0:00:56
439000 -- (-525.010) [-522.250] (-521.883) (-526.328) * (-527.099) [-522.972] (-526.555) (-524.971) -- 0:00:56
440000 -- (-524.060) (-530.155) [-520.113] (-529.052) * (-526.959) (-532.727) (-529.244) [-528.289] -- 0:00:56
Average standard deviation of split frequencies: 0.011411
441000 -- (-522.951) (-531.866) [-523.751] (-526.133) * (-532.636) [-526.529] (-531.380) (-529.234) -- 0:00:55
442000 -- (-525.467) (-525.965) [-520.709] (-531.403) * (-526.037) [-526.406] (-526.716) (-529.479) -- 0:00:56
443000 -- (-526.381) (-527.570) [-523.184] (-524.928) * [-522.686] (-525.093) (-522.626) (-521.403) -- 0:00:56
444000 -- (-528.196) (-528.615) [-526.743] (-528.769) * (-528.719) (-525.019) (-523.950) [-521.341] -- 0:00:56
445000 -- (-529.017) [-523.277] (-523.569) (-530.848) * (-526.931) (-526.414) (-524.696) [-526.351] -- 0:00:56
Average standard deviation of split frequencies: 0.014093
446000 -- (-530.828) (-526.534) [-521.866] (-530.071) * [-526.320] (-525.637) (-526.444) (-535.494) -- 0:00:55
447000 -- (-526.621) (-529.610) (-522.767) [-526.796] * [-523.450] (-521.758) (-529.251) (-522.630) -- 0:00:55
448000 -- (-525.013) (-527.701) [-524.880] (-526.739) * [-526.251] (-522.023) (-529.078) (-527.793) -- 0:00:55
449000 -- [-525.948] (-526.628) (-524.711) (-531.964) * (-525.068) [-523.689] (-529.927) (-524.759) -- 0:00:55
450000 -- (-525.084) (-527.026) [-527.189] (-529.043) * (-527.310) (-524.988) (-520.850) [-526.470] -- 0:00:55
Average standard deviation of split frequencies: 0.017434
451000 -- (-523.131) [-525.189] (-521.626) (-526.534) * [-524.339] (-526.506) (-524.068) (-524.580) -- 0:00:54
452000 -- (-528.478) [-521.451] (-523.046) (-523.593) * (-523.851) (-525.632) (-527.152) [-526.542] -- 0:00:55
453000 -- (-527.145) (-528.493) [-524.196] (-533.393) * (-522.897) [-524.781] (-524.424) (-527.106) -- 0:00:55
454000 -- (-526.167) (-524.546) (-527.746) [-527.551] * (-522.537) [-524.412] (-522.427) (-526.168) -- 0:00:55
455000 -- (-528.527) (-526.632) [-519.574] (-527.060) * (-525.259) [-525.386] (-525.446) (-523.786) -- 0:00:55
Average standard deviation of split frequencies: 0.018608
456000 -- (-521.391) (-524.352) (-526.330) [-525.709] * [-520.655] (-525.651) (-524.402) (-524.468) -- 0:00:54
457000 -- (-523.569) (-521.930) (-524.288) [-526.329] * [-530.145] (-524.009) (-529.922) (-526.975) -- 0:00:54
458000 -- (-520.314) [-524.228] (-524.096) (-524.461) * (-527.751) [-526.105] (-531.946) (-523.806) -- 0:00:54
459000 -- [-524.684] (-527.497) (-522.619) (-525.704) * (-523.620) [-520.234] (-523.037) (-527.302) -- 0:00:54
460000 -- (-523.076) [-525.886] (-529.644) (-525.666) * (-522.703) (-524.526) (-520.188) [-523.091] -- 0:00:54
Average standard deviation of split frequencies: 0.019102
461000 -- (-530.923) (-523.747) [-527.676] (-525.049) * (-525.580) [-525.439] (-524.975) (-532.199) -- 0:00:53
462000 -- (-525.819) (-522.891) [-526.515] (-528.711) * (-525.202) (-522.871) [-522.100] (-524.929) -- 0:00:54
463000 -- (-529.227) [-527.305] (-525.471) (-527.979) * (-530.144) [-524.811] (-527.531) (-525.778) -- 0:00:54
464000 -- [-524.401] (-527.883) (-524.479) (-524.717) * (-527.193) (-526.846) (-522.215) [-528.424] -- 0:00:54
465000 -- (-526.851) (-531.651) [-523.987] (-526.222) * (-527.877) (-525.152) [-524.069] (-528.996) -- 0:00:54
Average standard deviation of split frequencies: 0.020232
466000 -- (-525.572) [-529.577] (-524.099) (-526.824) * (-528.038) (-525.321) [-524.178] (-525.046) -- 0:00:53
467000 -- (-521.312) (-524.224) [-522.757] (-530.276) * (-531.758) (-525.678) (-527.833) [-523.908] -- 0:00:53
468000 -- (-532.086) (-524.572) [-522.771] (-526.241) * (-524.189) (-527.319) [-522.498] (-532.276) -- 0:00:53
469000 -- (-528.378) (-525.232) [-523.674] (-526.741) * (-526.564) (-524.223) [-528.389] (-521.532) -- 0:00:53
470000 -- [-524.692] (-526.112) (-526.219) (-527.089) * [-524.340] (-525.531) (-524.037) (-527.369) -- 0:00:53
Average standard deviation of split frequencies: 0.020031
471000 -- [-524.151] (-523.345) (-529.238) (-524.597) * (-523.104) (-523.030) (-530.145) [-527.578] -- 0:00:52
472000 -- (-527.568) (-531.060) [-525.868] (-528.966) * (-525.506) (-528.421) (-531.416) [-524.196] -- 0:00:52
473000 -- (-524.984) (-526.441) (-525.447) [-522.526] * [-526.066] (-524.444) (-525.718) (-527.918) -- 0:00:53
474000 -- [-523.749] (-521.875) (-524.110) (-525.598) * [-526.219] (-525.900) (-530.555) (-525.719) -- 0:00:53
475000 -- (-532.897) [-528.866] (-525.874) (-524.008) * (-530.861) [-525.055] (-525.435) (-529.091) -- 0:00:53
Average standard deviation of split frequencies: 0.022448
476000 -- (-522.477) (-523.847) (-524.240) [-524.776] * (-528.230) (-526.560) (-525.130) [-523.874] -- 0:00:52
477000 -- (-524.058) (-524.079) [-523.158] (-526.810) * (-533.116) (-524.056) [-526.109] (-525.625) -- 0:00:52
478000 -- (-519.883) (-527.634) [-521.260] (-526.432) * (-526.788) (-533.304) (-529.286) [-522.304] -- 0:00:52
479000 -- (-522.812) (-533.538) [-526.345] (-524.937) * (-523.848) (-522.737) [-524.749] (-525.608) -- 0:00:52
480000 -- (-522.112) [-525.113] (-525.504) (-524.197) * (-528.596) (-523.903) [-522.168] (-526.786) -- 0:00:52
Average standard deviation of split frequencies: 0.023538
481000 -- (-522.560) (-531.068) [-524.462] (-524.614) * (-532.622) (-525.849) [-522.960] (-529.295) -- 0:00:51
482000 -- (-529.250) [-526.072] (-531.318) (-523.799) * (-532.671) [-527.011] (-529.237) (-527.034) -- 0:00:51
483000 -- (-529.496) [-526.384] (-526.980) (-527.851) * (-527.652) (-530.935) [-522.375] (-524.364) -- 0:00:52
484000 -- (-523.442) (-523.907) (-522.992) [-524.163] * (-527.139) (-525.863) (-524.328) [-525.976] -- 0:00:52
485000 -- [-528.569] (-526.504) (-525.783) (-525.547) * [-524.710] (-523.376) (-525.402) (-524.454) -- 0:00:52
Average standard deviation of split frequencies: 0.020693
486000 -- (-529.711) (-526.322) [-524.617] (-524.053) * [-529.078] (-525.890) (-525.742) (-523.395) -- 0:00:51
487000 -- (-522.130) (-527.301) (-527.458) [-521.086] * (-528.310) [-522.735] (-532.401) (-524.572) -- 0:00:51
488000 -- (-528.972) [-525.317] (-524.249) (-523.653) * [-522.746] (-522.081) (-529.142) (-534.395) -- 0:00:51
489000 -- (-532.096) (-525.573) (-529.833) [-521.534] * [-524.502] (-531.809) (-525.845) (-530.285) -- 0:00:51
490000 -- (-527.216) [-524.814] (-522.669) (-526.372) * (-523.100) (-528.212) [-526.771] (-527.951) -- 0:00:51
Average standard deviation of split frequencies: 0.019215
491000 -- (-522.251) (-526.782) (-524.477) [-522.685] * (-531.875) (-529.211) (-527.067) [-521.317] -- 0:00:50
492000 -- (-528.471) (-524.652) (-523.520) [-523.129] * [-523.491] (-520.614) (-533.097) (-527.625) -- 0:00:50
493000 -- (-528.429) (-525.311) [-526.690] (-523.905) * (-526.205) [-525.640] (-529.094) (-527.435) -- 0:00:51
494000 -- (-530.189) [-525.448] (-522.793) (-525.763) * (-530.675) [-524.933] (-526.165) (-527.429) -- 0:00:51
495000 -- (-525.620) (-523.087) (-525.109) [-526.312] * [-523.769] (-524.078) (-526.302) (-530.648) -- 0:00:51
Average standard deviation of split frequencies: 0.020909
496000 -- (-529.211) [-525.335] (-523.450) (-522.695) * [-525.353] (-523.351) (-526.958) (-527.022) -- 0:00:50
497000 -- [-524.700] (-528.672) (-521.825) (-524.091) * (-528.215) [-522.342] (-525.634) (-524.248) -- 0:00:50
498000 -- (-527.604) (-526.696) [-523.495] (-524.444) * [-524.283] (-522.842) (-522.900) (-526.547) -- 0:00:50
499000 -- [-525.385] (-527.392) (-525.835) (-525.807) * (-533.505) (-528.271) [-523.996] (-526.112) -- 0:00:50
500000 -- (-525.453) [-524.186] (-524.520) (-527.335) * (-535.316) (-523.930) (-523.855) [-527.144] -- 0:00:50
Average standard deviation of split frequencies: 0.020714
501000 -- (-526.283) (-527.813) (-527.990) [-525.443] * (-529.994) (-524.654) [-522.945] (-526.372) -- 0:00:49
502000 -- (-524.725) [-523.741] (-533.222) (-527.178) * [-525.989] (-529.524) (-523.058) (-522.166) -- 0:00:49
503000 -- (-524.689) [-524.178] (-538.056) (-523.978) * (-529.736) (-524.107) (-524.831) [-527.917] -- 0:00:50
504000 -- (-524.898) [-524.756] (-525.658) (-523.607) * (-525.048) (-523.556) [-523.753] (-534.303) -- 0:00:50
505000 -- (-520.978) (-523.209) (-524.340) [-525.285] * (-528.546) (-529.662) [-523.065] (-522.547) -- 0:00:49
Average standard deviation of split frequencies: 0.018012
506000 -- [-523.500] (-520.892) (-531.624) (-524.055) * (-529.190) [-523.458] (-526.201) (-527.148) -- 0:00:49
507000 -- (-522.951) [-526.847] (-534.638) (-529.733) * (-527.750) [-532.162] (-525.816) (-528.348) -- 0:00:49
508000 -- (-520.799) [-524.037] (-525.149) (-530.501) * [-525.230] (-520.796) (-526.376) (-526.162) -- 0:00:49
509000 -- [-523.219] (-524.836) (-522.860) (-531.579) * (-529.480) [-524.308] (-526.974) (-527.573) -- 0:00:49
510000 -- (-528.553) (-524.586) [-524.491] (-524.159) * (-525.240) [-524.836] (-533.104) (-531.204) -- 0:00:49
Average standard deviation of split frequencies: 0.018462
511000 -- (-523.220) (-524.145) [-525.042] (-525.857) * (-525.635) (-523.792) (-528.495) [-526.805] -- 0:00:48
512000 -- [-526.782] (-527.661) (-535.626) (-526.246) * [-523.906] (-527.286) (-528.284) (-530.745) -- 0:00:48
513000 -- (-526.290) (-521.381) [-531.247] (-528.603) * (-522.430) (-522.720) [-529.978] (-527.286) -- 0:00:49
514000 -- (-530.064) [-523.697] (-530.115) (-526.674) * (-527.160) (-527.721) [-526.946] (-529.606) -- 0:00:49
515000 -- (-524.085) [-521.580] (-535.504) (-523.652) * [-523.791] (-527.073) (-524.294) (-525.547) -- 0:00:48
Average standard deviation of split frequencies: 0.020099
516000 -- [-523.482] (-526.374) (-525.286) (-534.895) * (-525.910) (-523.482) [-528.793] (-527.256) -- 0:00:48
517000 -- (-528.763) [-522.825] (-532.447) (-528.343) * (-527.083) (-523.675) [-528.550] (-529.146) -- 0:00:48
518000 -- (-528.463) (-525.016) [-533.688] (-527.419) * [-529.257] (-521.877) (-526.575) (-526.137) -- 0:00:48
519000 -- (-526.942) [-526.376] (-520.412) (-524.382) * [-522.293] (-527.001) (-523.634) (-525.495) -- 0:00:48
520000 -- (-523.623) (-526.765) [-521.511] (-526.564) * (-522.422) (-524.640) [-524.974] (-525.926) -- 0:00:48
Average standard deviation of split frequencies: 0.019315
521000 -- (-522.584) (-526.325) [-531.385] (-522.696) * (-524.148) [-525.253] (-524.704) (-524.368) -- 0:00:47
522000 -- (-521.684) [-524.701] (-526.553) (-531.038) * (-523.357) [-522.825] (-522.185) (-529.446) -- 0:00:47
523000 -- [-521.688] (-528.583) (-531.075) (-523.480) * [-524.783] (-527.033) (-526.300) (-527.384) -- 0:00:47
524000 -- (-526.076) (-525.695) [-531.355] (-524.906) * [-524.489] (-524.949) (-522.384) (-531.002) -- 0:00:48
525000 -- [-521.602] (-529.115) (-537.690) (-525.797) * (-525.549) (-526.292) [-527.572] (-521.460) -- 0:00:47
Average standard deviation of split frequencies: 0.020314
526000 -- [-528.235] (-528.340) (-533.979) (-523.541) * (-530.776) (-527.578) [-524.492] (-525.236) -- 0:00:47
527000 -- (-525.421) [-524.984] (-528.539) (-524.888) * (-524.715) (-525.690) [-523.444] (-528.496) -- 0:00:47
528000 -- (-536.725) (-527.059) (-528.542) [-526.473] * [-527.182] (-527.558) (-529.091) (-523.209) -- 0:00:47
529000 -- (-527.912) (-527.397) (-531.134) [-522.221] * (-525.607) (-525.012) (-525.874) [-521.627] -- 0:00:47
530000 -- (-523.003) (-523.796) (-524.812) [-524.316] * (-522.676) (-528.741) [-526.051] (-524.464) -- 0:00:47
Average standard deviation of split frequencies: 0.020135
531000 -- (-525.027) (-526.036) [-526.658] (-527.659) * (-522.784) (-526.451) (-527.671) [-521.608] -- 0:00:46
532000 -- (-527.203) [-530.371] (-528.634) (-525.565) * (-521.371) [-526.675] (-525.351) (-520.661) -- 0:00:46
533000 -- (-525.586) (-530.380) (-532.223) [-523.525] * (-525.442) (-530.900) [-521.767] (-529.194) -- 0:00:46
534000 -- [-525.933] (-527.035) (-531.218) (-524.842) * (-524.446) (-526.796) (-520.271) [-525.435] -- 0:00:47
535000 -- (-528.428) (-530.851) (-527.309) [-529.443] * (-524.130) (-529.521) [-523.858] (-524.931) -- 0:00:46
Average standard deviation of split frequencies: 0.017590
536000 -- [-523.050] (-527.849) (-532.399) (-528.247) * (-521.098) (-522.270) (-522.200) [-524.912] -- 0:00:46
537000 -- (-526.232) (-529.078) (-522.543) [-527.262] * [-520.824] (-525.223) (-523.728) (-527.348) -- 0:00:46
538000 -- (-522.129) (-525.940) [-530.140] (-526.658) * (-526.273) (-526.424) (-525.938) [-528.079] -- 0:00:46
539000 -- [-522.853] (-524.307) (-531.002) (-522.869) * (-524.016) (-526.963) [-526.847] (-527.229) -- 0:00:46
540000 -- (-523.030) (-530.739) [-525.222] (-523.387) * [-523.540] (-525.835) (-524.516) (-528.028) -- 0:00:46
Average standard deviation of split frequencies: 0.018019
541000 -- (-523.668) [-524.935] (-525.033) (-523.948) * [-524.578] (-527.089) (-526.178) (-525.010) -- 0:00:45
542000 -- (-531.125) [-525.609] (-530.162) (-523.826) * [-525.803] (-520.738) (-526.637) (-534.041) -- 0:00:45
543000 -- (-528.523) (-528.076) (-523.752) [-526.413] * (-526.871) [-522.663] (-524.792) (-526.984) -- 0:00:45
544000 -- (-526.292) [-529.078] (-534.132) (-527.574) * (-524.993) (-527.093) [-522.919] (-526.103) -- 0:00:46
545000 -- (-531.613) (-524.589) (-527.553) [-527.641] * (-532.599) (-531.821) [-526.031] (-524.133) -- 0:00:45
Average standard deviation of split frequencies: 0.018419
546000 -- (-529.483) (-523.744) (-532.325) [-526.490] * (-526.324) (-532.392) [-525.153] (-523.083) -- 0:00:45
547000 -- [-527.517] (-523.216) (-530.401) (-523.300) * [-525.277] (-527.989) (-527.637) (-527.426) -- 0:00:45
548000 -- (-526.576) (-524.910) [-523.622] (-528.784) * (-525.129) (-521.376) [-527.350] (-528.502) -- 0:00:45
549000 -- (-529.173) [-522.811] (-527.420) (-525.077) * (-524.860) (-524.906) [-528.713] (-527.899) -- 0:00:45
550000 -- (-525.968) (-525.527) [-524.681] (-527.232) * (-527.445) (-532.283) (-525.513) [-522.346] -- 0:00:45
Average standard deviation of split frequencies: 0.017692
551000 -- (-529.096) (-524.824) (-525.354) [-523.391] * (-525.634) (-525.084) [-530.390] (-530.429) -- 0:00:44
552000 -- [-523.522] (-530.267) (-526.507) (-523.883) * [-524.252] (-525.603) (-526.643) (-523.553) -- 0:00:44
553000 -- (-526.974) (-531.114) [-525.457] (-523.641) * (-530.144) [-522.964] (-519.735) (-523.904) -- 0:00:44
554000 -- [-521.917] (-522.485) (-524.394) (-523.135) * [-525.848] (-527.653) (-527.018) (-527.358) -- 0:00:44
555000 -- (-528.648) [-527.344] (-525.196) (-519.495) * (-522.759) (-532.494) [-526.796] (-525.937) -- 0:00:44
Average standard deviation of split frequencies: 0.018087
556000 -- (-533.180) (-525.496) [-525.902] (-529.265) * (-523.443) (-535.978) [-525.793] (-537.740) -- 0:00:44
557000 -- (-533.907) [-522.973] (-527.149) (-524.036) * (-521.990) [-523.359] (-519.262) (-528.493) -- 0:00:44
558000 -- (-524.655) (-521.300) (-521.655) [-523.693] * (-529.371) (-523.715) [-527.622] (-529.025) -- 0:00:44
559000 -- (-526.346) (-528.937) [-521.261] (-526.398) * (-529.007) [-530.867] (-520.940) (-535.213) -- 0:00:44
560000 -- (-528.950) (-523.007) [-523.370] (-523.642) * (-531.477) (-527.642) [-522.628] (-525.004) -- 0:00:44
Average standard deviation of split frequencies: 0.017937
561000 -- (-528.462) (-522.156) (-529.381) [-526.277] * [-521.845] (-527.939) (-535.952) (-520.395) -- 0:00:43
562000 -- (-529.021) (-526.963) [-523.812] (-527.267) * (-529.274) (-530.619) (-523.713) [-520.565] -- 0:00:43
563000 -- [-525.452] (-523.730) (-523.314) (-531.183) * (-528.863) (-528.829) (-524.302) [-522.878] -- 0:00:43
564000 -- (-522.296) [-524.106] (-526.864) (-525.221) * (-527.914) (-530.306) [-524.608] (-526.637) -- 0:00:43
565000 -- (-525.421) (-525.448) (-523.631) [-526.483] * (-530.616) (-529.356) (-526.022) [-521.368] -- 0:00:43
Average standard deviation of split frequencies: 0.017768
566000 -- (-524.989) (-525.915) (-524.917) [-520.943] * (-528.311) [-525.216] (-525.349) (-524.903) -- 0:00:43
567000 -- (-525.159) (-528.096) [-527.383] (-523.306) * [-530.707] (-535.933) (-525.080) (-526.691) -- 0:00:43
568000 -- [-523.045] (-523.959) (-526.337) (-525.920) * (-523.483) [-526.352] (-528.838) (-523.882) -- 0:00:43
569000 -- (-525.351) [-525.229] (-523.076) (-525.385) * (-527.164) [-525.592] (-527.256) (-530.726) -- 0:00:43
570000 -- [-532.125] (-525.041) (-524.675) (-524.765) * [-524.498] (-526.923) (-521.319) (-529.429) -- 0:00:43
Average standard deviation of split frequencies: 0.017072
571000 -- (-523.903) (-525.107) [-524.037] (-527.644) * (-524.247) (-523.670) (-531.479) [-524.216] -- 0:00:42
572000 -- (-525.326) [-527.358] (-527.258) (-531.122) * [-524.624] (-528.767) (-527.203) (-527.691) -- 0:00:42
573000 -- (-531.648) (-525.025) (-530.520) [-526.262] * (-528.342) (-527.219) [-527.151] (-519.931) -- 0:00:42
574000 -- (-524.954) (-523.723) (-524.308) [-529.204] * (-528.201) (-526.257) (-526.111) [-519.641] -- 0:00:42
575000 -- (-526.502) (-527.080) [-524.365] (-528.173) * [-524.611] (-526.967) (-526.142) (-529.345) -- 0:00:42
Average standard deviation of split frequencies: 0.016368
576000 -- (-523.949) (-527.932) [-522.952] (-524.711) * (-530.544) (-527.300) [-525.344] (-521.318) -- 0:00:42
577000 -- (-528.893) (-523.405) (-530.929) [-527.423] * [-524.456] (-521.427) (-523.910) (-521.802) -- 0:00:42
578000 -- (-527.881) (-522.605) (-528.058) [-525.057] * (-523.133) (-522.731) [-523.873] (-525.074) -- 0:00:42
579000 -- (-526.806) (-526.322) [-520.805] (-527.106) * [-523.465] (-524.230) (-521.861) (-530.084) -- 0:00:42
580000 -- (-527.278) [-522.492] (-522.007) (-528.483) * [-529.805] (-522.610) (-528.369) (-524.829) -- 0:00:42
Average standard deviation of split frequencies: 0.016237
581000 -- (-525.324) [-526.452] (-528.069) (-527.826) * (-528.139) (-527.668) (-525.958) [-522.537] -- 0:00:41
582000 -- (-524.199) (-524.489) (-529.239) [-526.543] * (-527.163) [-527.407] (-523.401) (-526.390) -- 0:00:41
583000 -- (-529.461) (-523.607) (-523.112) [-524.761] * (-527.352) (-526.024) [-523.132] (-526.795) -- 0:00:41
584000 -- [-530.594] (-532.666) (-526.653) (-522.778) * (-531.337) (-524.351) [-524.830] (-527.528) -- 0:00:41
585000 -- (-526.798) (-524.130) (-528.054) [-522.111] * (-529.537) (-526.149) [-528.197] (-524.478) -- 0:00:41
Average standard deviation of split frequencies: 0.015016
586000 -- (-527.646) (-525.211) [-526.346] (-525.640) * (-529.996) (-520.823) (-529.580) [-527.369] -- 0:00:41
587000 -- (-528.241) [-522.961] (-524.613) (-530.907) * (-531.342) (-525.956) (-527.566) [-525.850] -- 0:00:41
588000 -- (-526.087) (-535.049) (-530.144) [-526.517] * (-529.802) (-526.161) (-530.208) [-524.525] -- 0:00:41
589000 -- [-521.866] (-535.145) (-537.628) (-528.521) * (-527.056) (-526.099) [-529.077] (-521.685) -- 0:00:41
590000 -- [-525.153] (-527.138) (-532.983) (-529.171) * (-523.717) (-523.265) (-527.000) [-524.960] -- 0:00:41
Average standard deviation of split frequencies: 0.015430
591000 -- [-523.795] (-521.416) (-527.205) (-527.634) * (-523.325) (-524.370) [-526.543] (-523.137) -- 0:00:40
592000 -- (-527.319) (-527.528) [-530.704] (-529.861) * (-531.060) [-529.200] (-522.394) (-521.175) -- 0:00:40
593000 -- [-527.545] (-522.673) (-538.626) (-525.577) * (-527.509) [-524.673] (-526.383) (-528.213) -- 0:00:40
594000 -- (-531.827) [-526.253] (-525.320) (-525.997) * (-524.321) [-524.179] (-528.711) (-523.594) -- 0:00:40
595000 -- [-521.615] (-524.492) (-531.188) (-525.953) * (-526.023) [-522.242] (-524.998) (-521.434) -- 0:00:40
Average standard deviation of split frequencies: 0.016346
596000 -- (-524.268) [-524.018] (-529.342) (-526.224) * [-525.325] (-526.185) (-526.842) (-523.361) -- 0:00:40
597000 -- (-532.753) [-523.063] (-525.463) (-523.186) * (-525.518) [-523.833] (-530.841) (-523.859) -- 0:00:40
598000 -- (-525.774) (-524.456) (-525.087) [-526.089] * (-522.239) [-519.801] (-527.557) (-523.927) -- 0:00:40
599000 -- (-534.355) [-528.257] (-523.101) (-522.983) * (-525.243) [-523.279] (-524.608) (-523.520) -- 0:00:40
600000 -- (-524.491) (-530.158) [-525.596] (-524.600) * (-524.689) (-521.051) (-535.492) [-522.611] -- 0:00:40
Average standard deviation of split frequencies: 0.012034
601000 -- (-531.946) (-529.645) (-526.506) [-525.013] * (-526.608) [-521.984] (-531.294) (-521.564) -- 0:00:39
602000 -- [-526.904] (-523.211) (-533.696) (-528.903) * (-522.624) [-520.392] (-533.824) (-528.391) -- 0:00:39
603000 -- (-526.529) (-522.998) (-525.716) [-522.535] * (-525.031) (-520.124) (-533.556) [-526.424] -- 0:00:39
604000 -- (-534.009) [-523.768] (-526.481) (-522.916) * [-525.775] (-524.004) (-527.140) (-522.685) -- 0:00:39
605000 -- (-527.192) (-527.300) (-527.057) [-528.029] * (-524.761) [-525.641] (-523.475) (-526.295) -- 0:00:39
Average standard deviation of split frequencies: 0.012446
606000 -- [-524.873] (-522.961) (-525.887) (-523.455) * (-527.814) [-521.767] (-529.150) (-523.441) -- 0:00:39
607000 -- (-531.326) (-526.299) [-528.771] (-523.936) * (-522.962) [-528.440] (-524.921) (-528.580) -- 0:00:39
608000 -- (-524.542) [-523.850] (-526.698) (-528.591) * (-517.951) (-524.736) [-523.750] (-524.437) -- 0:00:39
609000 -- (-535.303) [-524.213] (-528.486) (-528.971) * (-522.837) (-527.929) [-524.467] (-528.488) -- 0:00:39
610000 -- [-528.728] (-523.355) (-528.352) (-528.131) * [-523.288] (-523.948) (-525.049) (-526.765) -- 0:00:39
Average standard deviation of split frequencies: 0.011322
611000 -- (-529.468) (-528.909) [-528.877] (-524.456) * (-532.679) (-523.677) (-524.689) [-526.410] -- 0:00:38
612000 -- (-527.552) [-524.453] (-523.512) (-520.267) * (-525.726) (-523.666) [-523.068] (-523.328) -- 0:00:38
613000 -- [-522.604] (-522.076) (-523.507) (-523.642) * [-525.259] (-526.144) (-523.265) (-522.993) -- 0:00:38
614000 -- (-525.547) [-523.064] (-519.184) (-522.319) * (-529.904) (-522.651) [-528.696] (-531.736) -- 0:00:38
615000 -- (-521.730) (-528.910) (-525.990) [-522.454] * (-526.079) [-528.140] (-530.572) (-526.304) -- 0:00:38
Average standard deviation of split frequencies: 0.009693
616000 -- (-524.565) (-526.619) [-523.134] (-527.374) * (-527.958) [-520.939] (-528.297) (-525.998) -- 0:00:38
617000 -- [-521.996] (-523.516) (-525.104) (-525.378) * (-529.382) (-525.610) [-524.856] (-524.825) -- 0:00:38
618000 -- (-523.979) (-526.424) (-532.796) [-525.577] * (-530.561) [-526.187] (-527.407) (-530.447) -- 0:00:38
619000 -- (-524.485) (-525.727) (-522.196) [-522.920] * (-525.962) (-522.716) [-519.133] (-520.632) -- 0:00:38
620000 -- (-521.816) (-529.318) [-527.187] (-522.657) * (-533.132) (-521.511) (-525.870) [-522.902] -- 0:00:38
Average standard deviation of split frequencies: 0.008101
621000 -- (-524.079) [-525.354] (-528.708) (-525.965) * [-521.748] (-523.583) (-524.963) (-523.954) -- 0:00:37
622000 -- (-526.033) (-525.435) (-525.006) [-523.615] * (-525.899) (-525.038) [-525.323] (-526.122) -- 0:00:37
623000 -- [-523.531] (-522.781) (-521.671) (-523.278) * (-530.389) [-526.366] (-521.512) (-533.888) -- 0:00:37
624000 -- (-521.089) [-522.758] (-529.214) (-526.342) * (-526.480) (-524.521) (-520.799) [-521.080] -- 0:00:37
625000 -- (-528.122) [-523.489] (-521.931) (-525.539) * [-525.967] (-528.243) (-524.170) (-522.818) -- 0:00:37
Average standard deviation of split frequencies: 0.007530
626000 -- [-522.120] (-527.944) (-527.793) (-530.950) * (-527.112) (-529.324) (-526.337) [-525.068] -- 0:00:37
627000 -- (-521.637) (-529.369) (-523.503) [-523.748] * (-526.186) (-525.533) [-521.982] (-528.896) -- 0:00:37
628000 -- (-528.695) (-530.186) (-524.749) [-524.224] * (-525.100) (-524.005) [-520.969] (-528.454) -- 0:00:37
629000 -- (-526.639) (-527.496) [-526.166] (-528.618) * (-527.756) (-524.171) (-523.980) [-523.377] -- 0:00:37
630000 -- [-524.307] (-527.141) (-530.522) (-527.637) * (-530.040) (-530.510) (-527.058) [-521.691] -- 0:00:37
Average standard deviation of split frequencies: 0.006976
631000 -- (-527.558) (-527.147) [-532.595] (-523.890) * (-525.926) (-524.972) (-527.173) [-523.398] -- 0:00:36
632000 -- (-527.765) (-520.462) (-530.303) [-523.258] * (-525.879) (-524.632) [-522.960] (-524.444) -- 0:00:36
633000 -- [-526.614] (-525.240) (-533.064) (-530.428) * [-526.286] (-525.631) (-519.298) (-521.797) -- 0:00:36
634000 -- [-526.690] (-519.348) (-528.497) (-524.971) * (-523.023) [-524.920] (-522.489) (-524.016) -- 0:00:36
635000 -- (-530.324) (-525.063) (-527.285) [-523.432] * (-523.912) [-527.039] (-521.451) (-530.688) -- 0:00:36
Average standard deviation of split frequencies: 0.007906
636000 -- [-526.321] (-528.728) (-526.167) (-524.083) * (-527.279) [-526.691] (-522.699) (-525.286) -- 0:00:36
637000 -- [-523.094] (-526.905) (-528.716) (-526.494) * (-529.648) (-527.808) [-520.372] (-526.008) -- 0:00:36
638000 -- (-522.589) (-530.082) (-535.032) [-524.868] * (-524.329) [-521.814] (-524.176) (-523.044) -- 0:00:36
639000 -- [-530.988] (-521.792) (-527.749) (-529.518) * (-523.882) [-524.348] (-525.556) (-523.523) -- 0:00:36
640000 -- (-525.960) (-530.619) (-530.015) [-526.720] * (-522.999) [-526.926] (-522.315) (-522.356) -- 0:00:36
Average standard deviation of split frequencies: 0.007849
641000 -- (-522.822) (-526.362) (-531.701) [-523.078] * (-526.567) (-528.299) [-523.575] (-526.970) -- 0:00:35
642000 -- (-523.259) (-524.118) [-524.873] (-527.387) * [-522.120] (-532.262) (-522.733) (-524.813) -- 0:00:35
643000 -- [-522.364] (-521.086) (-524.108) (-525.075) * (-524.980) [-528.284] (-524.951) (-526.359) -- 0:00:35
644000 -- (-528.394) (-525.434) (-525.474) [-527.030] * (-523.225) (-525.905) (-523.001) [-528.467] -- 0:00:35
645000 -- [-520.796] (-524.898) (-522.909) (-525.602) * (-521.468) (-527.904) (-527.206) [-524.880] -- 0:00:35
Average standard deviation of split frequencies: 0.007784
646000 -- (-522.961) (-522.526) (-522.506) [-526.044] * (-521.955) (-528.536) (-529.964) [-528.649] -- 0:00:35
647000 -- (-523.979) (-523.059) (-530.416) [-522.037] * (-526.772) (-526.239) (-524.014) [-523.948] -- 0:00:35
648000 -- (-529.124) (-522.809) [-526.121] (-531.128) * (-525.312) (-530.580) [-522.441] (-525.730) -- 0:00:35
649000 -- (-523.598) (-525.847) [-524.988] (-525.427) * (-523.746) [-528.397] (-525.470) (-528.040) -- 0:00:35
650000 -- [-522.588] (-523.632) (-525.874) (-524.957) * [-524.123] (-534.605) (-522.074) (-528.372) -- 0:00:35
Average standard deviation of split frequencies: 0.007245
651000 -- (-527.078) (-523.880) (-526.698) [-522.592] * (-526.587) (-525.273) (-526.707) [-527.010] -- 0:00:34
652000 -- (-525.752) (-526.053) [-522.658] (-531.120) * (-527.388) [-525.255] (-530.453) (-531.580) -- 0:00:34
653000 -- (-526.635) (-532.622) (-523.277) [-526.365] * [-525.463] (-528.202) (-524.835) (-526.536) -- 0:00:34
654000 -- (-531.304) (-525.571) [-532.454] (-525.668) * (-528.333) [-527.390] (-520.457) (-527.009) -- 0:00:34
655000 -- (-522.822) [-529.907] (-526.399) (-524.634) * (-528.528) (-522.431) (-526.305) [-525.891] -- 0:00:34
Average standard deviation of split frequencies: 0.007665
656000 -- [-527.124] (-530.645) (-530.846) (-525.197) * (-530.622) [-525.871] (-525.092) (-522.983) -- 0:00:34
657000 -- (-527.443) [-522.142] (-526.859) (-524.229) * [-522.612] (-534.581) (-527.125) (-526.393) -- 0:00:34
658000 -- (-528.027) [-524.193] (-522.570) (-522.990) * (-525.140) [-524.366] (-525.653) (-527.928) -- 0:00:34
659000 -- (-526.972) (-529.892) [-523.679] (-526.559) * (-527.472) [-527.570] (-526.826) (-526.447) -- 0:00:34
660000 -- (-524.800) (-526.128) [-525.703] (-525.768) * [-528.506] (-529.226) (-527.478) (-526.612) -- 0:00:34
Average standard deviation of split frequencies: 0.005708
661000 -- [-523.429] (-530.402) (-523.113) (-522.662) * (-522.887) [-523.665] (-528.533) (-530.990) -- 0:00:33
662000 -- (-528.318) (-522.033) [-522.448] (-526.507) * (-526.527) (-528.070) [-522.041] (-526.428) -- 0:00:33
663000 -- (-525.937) (-521.888) [-521.521] (-526.391) * (-528.921) (-521.847) [-522.983] (-530.653) -- 0:00:33
664000 -- (-522.081) [-527.033] (-531.267) (-530.410) * (-529.977) (-526.041) (-523.827) [-524.384] -- 0:00:33
665000 -- [-522.904] (-521.442) (-524.015) (-525.247) * (-525.452) [-524.672] (-530.229) (-526.315) -- 0:00:33
Average standard deviation of split frequencies: 0.007078
666000 -- (-522.727) [-523.570] (-524.221) (-528.275) * [-527.776] (-522.999) (-525.779) (-526.364) -- 0:00:33
667000 -- (-529.681) (-526.250) (-530.909) [-527.589] * (-521.562) [-526.829] (-525.183) (-538.061) -- 0:00:33
668000 -- (-532.949) [-531.416] (-533.036) (-527.864) * (-526.277) (-521.139) [-523.590] (-524.577) -- 0:00:33
669000 -- [-528.313] (-522.883) (-527.580) (-525.643) * (-530.716) (-525.381) [-525.495] (-534.523) -- 0:00:33
670000 -- [-524.336] (-526.451) (-528.906) (-529.521) * (-531.050) [-523.223] (-521.510) (-526.211) -- 0:00:33
Average standard deviation of split frequencies: 0.009372
671000 -- (-525.888) (-531.021) [-522.514] (-529.751) * (-530.762) (-526.348) (-525.841) [-526.978] -- 0:00:32
672000 -- (-529.479) (-528.044) (-529.335) [-523.388] * (-527.313) (-523.170) [-522.394] (-536.556) -- 0:00:32
673000 -- (-530.320) (-528.385) (-526.865) [-525.501] * (-527.116) (-526.038) [-526.443] (-523.085) -- 0:00:32
674000 -- (-523.535) (-530.593) (-527.297) [-525.653] * (-528.118) (-527.446) [-524.094] (-525.241) -- 0:00:32
675000 -- [-519.821] (-524.512) (-528.172) (-524.868) * (-526.807) (-534.593) [-521.271] (-528.909) -- 0:00:32
Average standard deviation of split frequencies: 0.006973
676000 -- (-525.372) (-527.747) [-521.891] (-525.783) * (-527.567) (-527.754) [-526.227] (-524.704) -- 0:00:32
677000 -- (-527.206) (-525.260) [-524.788] (-522.358) * (-524.637) (-527.582) [-522.639] (-531.160) -- 0:00:32
678000 -- [-523.091] (-528.876) (-526.600) (-522.188) * (-523.374) (-523.109) [-525.736] (-526.353) -- 0:00:32
679000 -- [-524.931] (-525.784) (-528.210) (-524.109) * (-526.529) (-532.353) [-521.592] (-532.793) -- 0:00:32
680000 -- [-523.694] (-526.250) (-526.780) (-531.091) * (-528.786) (-530.645) [-529.110] (-528.880) -- 0:00:32
Average standard deviation of split frequencies: 0.005541
681000 -- (-529.954) [-524.207] (-524.243) (-535.635) * (-521.907) (-528.757) (-524.576) [-534.113] -- 0:00:31
682000 -- (-524.170) [-522.202] (-519.413) (-527.093) * [-525.990] (-524.727) (-525.699) (-527.029) -- 0:00:31
683000 -- [-526.982] (-523.989) (-526.041) (-523.837) * [-522.240] (-525.882) (-528.806) (-528.146) -- 0:00:31
684000 -- (-521.653) [-531.755] (-533.082) (-520.433) * (-523.338) (-527.060) [-525.051] (-526.151) -- 0:00:31
685000 -- (-525.349) [-531.990] (-527.364) (-529.198) * (-526.940) (-528.226) (-520.262) [-524.606] -- 0:00:31
Average standard deviation of split frequencies: 0.005956
686000 -- (-528.429) (-530.135) (-526.092) [-526.646] * (-525.387) (-524.006) [-525.357] (-529.596) -- 0:00:31
687000 -- (-525.096) (-524.224) (-527.165) [-522.730] * (-526.658) (-526.525) [-523.961] (-528.039) -- 0:00:30
688000 -- (-527.607) [-524.810] (-524.016) (-523.973) * (-528.562) [-525.153] (-520.294) (-523.706) -- 0:00:31
689000 -- (-527.151) (-526.021) (-524.380) [-523.106] * (-523.368) (-522.143) (-528.838) [-526.983] -- 0:00:31
690000 -- (-525.971) [-522.327] (-524.516) (-521.551) * (-523.470) (-527.229) [-527.895] (-527.391) -- 0:00:31
Average standard deviation of split frequencies: 0.004550
691000 -- [-523.587] (-527.342) (-529.894) (-524.728) * (-525.158) (-530.270) (-528.874) [-519.806] -- 0:00:30
692000 -- (-530.746) [-524.621] (-527.118) (-524.119) * [-527.208] (-526.312) (-524.855) (-520.380) -- 0:00:30
693000 -- (-526.021) (-528.586) [-525.324] (-533.000) * (-527.738) (-526.191) [-526.770] (-527.022) -- 0:00:30
694000 -- (-527.793) (-522.761) (-522.656) [-525.156] * (-526.361) [-525.792] (-525.505) (-521.301) -- 0:00:30
695000 -- (-523.502) (-532.211) (-527.737) [-529.973] * (-525.251) (-532.653) (-528.968) [-523.232] -- 0:00:30
Average standard deviation of split frequencies: 0.004515
696000 -- (-524.824) (-526.652) (-531.832) [-521.822] * (-529.488) [-525.527] (-526.265) (-527.638) -- 0:00:30
697000 -- (-528.436) (-523.544) [-525.679] (-529.961) * (-526.317) [-523.029] (-525.547) (-523.025) -- 0:00:29
698000 -- [-523.159] (-526.084) (-525.276) (-522.284) * (-523.382) (-526.756) [-527.549] (-525.944) -- 0:00:30
699000 -- [-522.140] (-523.726) (-526.033) (-523.745) * [-527.127] (-523.709) (-521.378) (-525.699) -- 0:00:30
700000 -- (-524.428) [-523.113] (-522.951) (-522.699) * (-524.686) (-522.565) [-524.403] (-526.121) -- 0:00:30
Average standard deviation of split frequencies: 0.004037
701000 -- (-523.427) [-523.414] (-537.357) (-522.257) * (-522.994) (-525.394) (-523.259) [-530.208] -- 0:00:29
702000 -- (-528.582) (-525.738) (-525.585) [-523.301] * [-520.594] (-520.058) (-525.567) (-527.366) -- 0:00:29
703000 -- (-531.346) (-524.290) (-526.861) [-523.687] * (-522.453) (-526.279) (-528.719) [-523.023] -- 0:00:29
704000 -- [-525.834] (-527.157) (-529.535) (-524.492) * (-521.767) (-522.562) (-524.228) [-524.009] -- 0:00:29
705000 -- (-527.932) [-523.174] (-525.804) (-523.378) * (-525.950) (-526.143) (-528.177) [-526.576] -- 0:00:29
Average standard deviation of split frequencies: 0.003116
706000 -- (-528.975) [-525.561] (-528.295) (-526.447) * (-533.577) (-531.540) (-523.558) [-522.877] -- 0:00:29
707000 -- (-526.995) (-523.804) (-526.413) [-524.247] * (-537.447) (-535.212) [-520.672] (-527.887) -- 0:00:29
708000 -- (-525.408) [-523.797] (-523.796) (-527.338) * (-532.010) (-527.591) [-526.645] (-528.396) -- 0:00:28
709000 -- [-532.950] (-524.647) (-521.574) (-523.591) * (-527.666) (-529.587) (-525.960) [-525.993] -- 0:00:29
710000 -- (-525.841) (-529.203) [-528.531] (-525.499) * (-525.811) (-526.763) (-525.316) [-525.623] -- 0:00:29
Average standard deviation of split frequencies: 0.005307
711000 -- (-529.047) (-522.400) (-527.036) [-522.246] * (-525.222) [-524.624] (-528.641) (-524.549) -- 0:00:28
712000 -- [-527.180] (-524.970) (-527.690) (-527.787) * (-528.634) [-526.827] (-526.092) (-524.992) -- 0:00:28
713000 -- (-523.428) (-530.916) [-523.172] (-523.666) * (-528.533) (-531.415) [-522.822] (-523.678) -- 0:00:28
714000 -- (-525.156) (-529.435) [-529.386] (-528.701) * (-532.321) [-523.190] (-529.381) (-525.464) -- 0:00:28
715000 -- (-526.292) (-527.903) [-526.787] (-524.345) * (-523.964) [-529.333] (-529.704) (-531.414) -- 0:00:28
Average standard deviation of split frequencies: 0.004828
716000 -- [-531.605] (-531.522) (-524.469) (-529.801) * [-528.867] (-524.294) (-524.434) (-524.987) -- 0:00:28
717000 -- (-527.447) (-529.652) (-525.570) [-525.777] * (-531.954) (-526.102) (-525.293) [-523.633] -- 0:00:28
718000 -- [-520.248] (-522.914) (-520.452) (-526.233) * (-525.551) (-522.774) (-523.296) [-522.991] -- 0:00:27
719000 -- [-522.742] (-526.038) (-521.176) (-530.221) * (-529.194) [-522.316] (-528.224) (-525.647) -- 0:00:28
720000 -- (-526.051) [-528.256] (-524.325) (-531.560) * (-530.191) [-520.295] (-524.793) (-528.549) -- 0:00:28
Average standard deviation of split frequencies: 0.004797
721000 -- (-527.306) (-525.860) [-525.622] (-524.932) * [-524.089] (-527.324) (-525.379) (-531.147) -- 0:00:27
722000 -- (-529.542) [-522.064] (-528.191) (-530.344) * [-526.807] (-533.634) (-525.054) (-527.090) -- 0:00:27
723000 -- (-524.589) [-526.728] (-524.009) (-528.127) * (-525.986) (-532.710) (-526.524) [-523.505] -- 0:00:27
724000 -- (-526.301) (-524.466) (-522.482) [-525.910] * (-524.940) [-533.167] (-520.704) (-525.138) -- 0:00:27
725000 -- (-527.787) (-520.871) [-522.208] (-526.189) * (-523.547) (-523.786) (-521.154) [-527.967] -- 0:00:27
Average standard deviation of split frequencies: 0.004329
726000 -- [-523.956] (-520.658) (-524.957) (-523.615) * [-522.870] (-522.108) (-522.099) (-528.559) -- 0:00:27
727000 -- (-527.559) (-528.040) [-527.010] (-524.235) * (-532.551) (-523.871) (-528.732) [-519.583] -- 0:00:27
728000 -- [-529.509] (-521.258) (-523.878) (-522.040) * [-523.388] (-520.479) (-524.087) (-530.439) -- 0:00:26
729000 -- (-526.581) (-521.730) [-526.035] (-535.236) * (-522.699) [-526.115] (-522.782) (-529.167) -- 0:00:26
730000 -- (-522.574) (-525.706) (-525.506) [-523.454] * (-524.028) [-525.532] (-531.614) (-525.474) -- 0:00:27
Average standard deviation of split frequencies: 0.004731
731000 -- (-527.295) [-524.231] (-524.897) (-524.893) * (-526.395) [-523.535] (-529.053) (-522.375) -- 0:00:26
732000 -- (-528.146) (-530.138) (-528.188) [-522.435] * (-524.904) (-524.724) (-527.789) [-521.281] -- 0:00:26
733000 -- (-523.976) [-521.200] (-524.979) (-522.185) * (-526.569) [-529.909] (-525.414) (-525.347) -- 0:00:26
734000 -- (-524.226) (-524.180) [-526.419] (-521.337) * (-521.305) (-529.762) [-528.759] (-522.402) -- 0:00:26
735000 -- (-527.108) [-523.468] (-521.946) (-523.326) * [-528.218] (-530.460) (-526.091) (-525.411) -- 0:00:26
Average standard deviation of split frequencies: 0.005551
736000 -- (-530.396) [-522.083] (-527.242) (-522.129) * (-528.365) [-525.962] (-524.646) (-521.978) -- 0:00:26
737000 -- (-529.009) (-531.408) [-521.444] (-526.147) * (-529.613) [-528.335] (-528.937) (-528.758) -- 0:00:26
738000 -- [-526.097] (-522.712) (-527.118) (-525.163) * (-524.956) (-525.278) [-532.407] (-525.775) -- 0:00:25
739000 -- (-526.330) [-522.533] (-525.536) (-526.812) * (-530.835) (-527.048) (-527.735) [-524.146] -- 0:00:25
740000 -- (-523.035) (-527.997) [-525.211] (-532.333) * (-527.963) (-529.456) [-525.309] (-521.854) -- 0:00:26
Average standard deviation of split frequencies: 0.005940
741000 -- (-531.835) [-524.218] (-525.820) (-524.652) * (-521.419) (-527.621) (-528.219) [-524.470] -- 0:00:25
742000 -- [-528.393] (-523.960) (-526.292) (-529.324) * (-530.156) (-535.964) (-526.922) [-525.839] -- 0:00:25
743000 -- (-526.039) [-521.008] (-525.266) (-525.371) * (-525.847) [-532.339] (-530.243) (-529.229) -- 0:00:25
744000 -- (-524.765) (-522.919) [-521.632] (-522.631) * (-518.644) (-527.764) (-530.903) [-522.677] -- 0:00:25
745000 -- [-533.778] (-525.031) (-526.277) (-529.896) * (-526.145) (-530.080) [-526.157] (-521.319) -- 0:00:25
Average standard deviation of split frequencies: 0.007583
746000 -- (-527.035) (-527.434) [-521.898] (-526.734) * (-521.298) (-535.822) [-531.185] (-523.373) -- 0:00:25
747000 -- (-524.119) (-525.009) [-521.979] (-526.250) * (-529.164) (-528.388) (-527.371) [-523.344] -- 0:00:25
748000 -- [-526.135] (-530.480) (-523.604) (-534.853) * (-529.614) (-523.699) [-523.135] (-524.358) -- 0:00:24
749000 -- (-525.817) [-523.080] (-523.014) (-526.833) * (-524.326) (-526.537) [-527.158] (-525.388) -- 0:00:24
750000 -- [-522.379] (-526.211) (-529.493) (-528.742) * (-523.550) (-526.607) (-526.396) [-525.690] -- 0:00:25
Average standard deviation of split frequencies: 0.008792
751000 -- (-524.490) (-526.987) [-522.480] (-527.498) * (-529.200) (-525.213) (-520.235) [-523.907] -- 0:00:24
752000 -- (-527.839) [-523.876] (-526.701) (-532.303) * (-525.056) (-522.949) [-522.920] (-524.392) -- 0:00:24
753000 -- (-524.285) (-533.063) (-526.933) [-522.764] * (-531.189) (-523.948) (-527.717) [-522.723] -- 0:00:24
754000 -- (-531.879) (-524.525) [-524.619] (-526.436) * (-533.102) [-526.946] (-522.624) (-526.833) -- 0:00:24
755000 -- [-524.898] (-528.337) (-529.168) (-532.891) * (-529.390) (-528.556) [-520.596] (-526.538) -- 0:00:24
Average standard deviation of split frequencies: 0.009145
756000 -- (-530.175) [-527.868] (-527.960) (-528.221) * (-527.430) (-532.792) (-528.079) [-525.231] -- 0:00:24
757000 -- (-526.485) [-524.752] (-527.403) (-524.654) * (-526.428) [-526.329] (-527.530) (-525.664) -- 0:00:24
758000 -- (-523.161) (-525.340) (-532.165) [-523.970] * [-524.455] (-524.968) (-529.594) (-525.470) -- 0:00:23
759000 -- [-525.848] (-525.957) (-530.860) (-531.046) * (-529.420) (-524.498) [-528.614] (-527.827) -- 0:00:23
760000 -- [-525.122] (-523.858) (-526.151) (-524.505) * (-525.294) [-524.950] (-526.934) (-527.545) -- 0:00:23
Average standard deviation of split frequencies: 0.008263
761000 -- (-520.113) [-524.564] (-525.434) (-529.649) * (-523.776) [-525.479] (-523.524) (-523.338) -- 0:00:23
762000 -- [-523.324] (-527.383) (-522.364) (-529.660) * (-541.855) (-530.077) (-529.063) [-522.172] -- 0:00:23
763000 -- (-529.723) [-522.917] (-526.952) (-526.081) * (-522.242) [-521.746] (-526.758) (-533.743) -- 0:00:23
764000 -- (-526.006) (-526.773) (-528.872) [-525.599] * [-522.955] (-526.640) (-526.814) (-525.990) -- 0:00:23
765000 -- (-524.285) (-525.105) [-519.342] (-523.986) * [-528.039] (-522.429) (-523.801) (-524.058) -- 0:00:23
Average standard deviation of split frequencies: 0.008205
766000 -- [-522.366] (-524.995) (-524.884) (-527.953) * (-525.002) (-529.750) [-525.140] (-521.747) -- 0:00:23
767000 -- (-525.518) (-524.328) (-526.556) [-525.320] * (-524.873) (-534.535) [-525.207] (-525.350) -- 0:00:23
768000 -- (-534.196) [-526.187] (-524.688) (-525.351) * (-527.453) (-539.745) (-532.385) [-528.275] -- 0:00:22
769000 -- [-521.245] (-526.479) (-520.850) (-528.137) * (-527.934) (-528.810) (-522.799) [-524.867] -- 0:00:22
770000 -- (-529.473) (-524.588) [-520.598] (-522.212) * (-530.701) (-526.010) [-523.453] (-523.704) -- 0:00:22
Average standard deviation of split frequencies: 0.008156
771000 -- (-531.521) (-523.451) (-522.882) [-526.688] * [-524.872] (-528.806) (-522.056) (-528.513) -- 0:00:22
772000 -- (-525.201) [-522.498] (-529.508) (-531.874) * (-521.384) (-524.754) [-521.773] (-524.957) -- 0:00:22
773000 -- [-527.640] (-529.936) (-520.599) (-523.326) * (-530.738) (-525.412) [-523.538] (-522.810) -- 0:00:22
774000 -- (-527.926) (-522.743) [-523.421] (-524.778) * [-525.365] (-528.543) (-525.919) (-523.380) -- 0:00:22
775000 -- (-527.867) (-522.120) (-526.475) [-524.356] * (-522.756) (-525.755) (-527.386) [-524.820] -- 0:00:22
Average standard deviation of split frequencies: 0.008910
776000 -- [-529.300] (-525.225) (-525.825) (-528.539) * (-535.856) [-522.865] (-531.274) (-525.262) -- 0:00:22
777000 -- (-525.428) (-528.897) [-527.969] (-532.341) * (-525.782) [-526.442] (-529.036) (-522.808) -- 0:00:22
778000 -- (-525.938) [-521.774] (-526.459) (-526.210) * [-525.372] (-525.609) (-527.194) (-528.205) -- 0:00:21
779000 -- [-525.238] (-525.493) (-527.076) (-534.509) * (-527.770) [-525.252] (-525.510) (-530.287) -- 0:00:21
780000 -- (-529.512) (-529.346) [-522.940] (-531.432) * (-524.513) [-525.789] (-525.202) (-523.463) -- 0:00:21
Average standard deviation of split frequencies: 0.008856
781000 -- (-524.924) (-527.593) [-522.867] (-525.318) * (-532.862) (-521.567) [-523.017] (-526.005) -- 0:00:21
782000 -- [-529.378] (-532.121) (-522.424) (-528.325) * (-524.526) [-523.783] (-529.455) (-526.086) -- 0:00:21
783000 -- (-525.380) (-530.585) (-524.640) [-526.173] * (-525.589) (-524.278) [-522.870] (-524.984) -- 0:00:21
784000 -- (-524.067) (-525.473) [-524.247] (-526.027) * (-523.578) (-525.009) (-526.632) [-524.217] -- 0:00:21
785000 -- (-526.976) [-522.185] (-527.988) (-532.263) * (-525.964) [-524.153] (-525.330) (-528.069) -- 0:00:21
Average standard deviation of split frequencies: 0.009196
786000 -- (-529.942) [-523.440] (-532.695) (-527.764) * (-527.373) (-529.099) (-521.692) [-531.776] -- 0:00:21
787000 -- [-525.480] (-522.669) (-524.386) (-526.086) * [-522.078] (-535.285) (-531.544) (-527.357) -- 0:00:21
788000 -- [-525.135] (-522.104) (-523.813) (-529.739) * (-526.503) [-538.211] (-526.488) (-531.085) -- 0:00:20
789000 -- (-525.849) (-533.678) [-524.849] (-527.698) * [-523.182] (-522.941) (-527.301) (-526.294) -- 0:00:20
790000 -- (-526.690) (-522.775) [-524.349] (-527.205) * (-522.192) (-530.470) (-532.674) [-523.690] -- 0:00:20
Average standard deviation of split frequencies: 0.009539
791000 -- (-528.940) (-530.336) [-523.396] (-524.175) * (-533.909) [-527.341] (-530.005) (-523.881) -- 0:00:20
792000 -- (-526.862) (-524.639) [-523.307] (-523.638) * (-532.265) (-525.283) (-537.318) [-526.162] -- 0:00:20
793000 -- (-534.074) (-525.370) (-528.891) [-524.174] * (-524.879) (-528.346) [-521.254] (-527.756) -- 0:00:20
794000 -- (-528.086) (-528.166) (-522.023) [-527.653] * [-522.399] (-526.359) (-530.719) (-524.383) -- 0:00:20
795000 -- (-527.227) (-533.828) (-525.845) [-528.753] * (-526.887) (-530.452) [-524.354] (-527.722) -- 0:00:20
Average standard deviation of split frequencies: 0.010265
796000 -- [-526.067] (-527.913) (-523.194) (-528.059) * (-529.707) [-524.689] (-528.191) (-527.432) -- 0:00:20
797000 -- (-524.035) (-531.010) [-528.510] (-531.537) * (-528.899) (-528.941) (-526.623) [-522.562] -- 0:00:20
798000 -- (-524.826) (-523.877) [-520.272] (-522.867) * (-527.034) (-525.712) (-523.102) [-527.314] -- 0:00:19
799000 -- [-526.394] (-526.188) (-523.572) (-523.263) * (-523.716) (-529.690) [-523.416] (-526.475) -- 0:00:19
800000 -- (-529.933) (-524.380) (-524.956) [-526.892] * (-524.988) (-528.985) (-523.501) [-527.355] -- 0:00:19
Average standard deviation of split frequencies: 0.010990
801000 -- (-526.956) (-527.862) [-528.231] (-534.100) * [-527.811] (-531.878) (-526.986) (-523.256) -- 0:00:19
802000 -- [-532.071] (-524.466) (-531.455) (-527.680) * (-521.326) (-528.277) [-524.753] (-524.843) -- 0:00:19
803000 -- (-529.689) [-530.369] (-522.712) (-525.777) * (-523.962) (-528.078) [-526.177] (-522.690) -- 0:00:19
804000 -- (-529.767) (-526.639) [-523.214] (-532.025) * [-524.077] (-526.022) (-524.639) (-530.026) -- 0:00:19
805000 -- (-526.561) (-521.809) (-524.783) [-526.718] * [-530.062] (-531.096) (-524.920) (-527.367) -- 0:00:19
Average standard deviation of split frequencies: 0.010528
806000 -- (-525.396) [-531.726] (-524.384) (-529.784) * [-529.852] (-528.859) (-527.554) (-522.525) -- 0:00:19
807000 -- [-524.160] (-531.434) (-526.749) (-526.689) * (-524.220) [-525.082] (-528.725) (-520.881) -- 0:00:19
808000 -- (-524.921) (-524.097) (-526.622) [-526.964] * (-528.580) [-530.444] (-524.669) (-521.318) -- 0:00:19
809000 -- (-527.129) [-524.613] (-527.234) (-523.647) * [-527.504] (-535.061) (-529.701) (-525.230) -- 0:00:18
810000 -- [-527.721] (-524.281) (-525.422) (-523.955) * (-526.126) [-527.954] (-528.806) (-526.095) -- 0:00:18
Average standard deviation of split frequencies: 0.011242
811000 -- (-525.872) (-531.663) [-527.603] (-522.968) * (-530.511) (-535.585) [-523.177] (-525.173) -- 0:00:18
812000 -- (-523.223) (-523.255) [-520.211] (-524.001) * [-528.170] (-522.553) (-527.841) (-532.883) -- 0:00:18
813000 -- [-527.172] (-526.740) (-528.627) (-526.277) * [-526.935] (-526.616) (-524.960) (-523.204) -- 0:00:18
814000 -- [-522.952] (-523.640) (-535.565) (-526.749) * [-529.047] (-525.201) (-525.958) (-524.282) -- 0:00:18
815000 -- (-523.634) (-527.128) [-523.388] (-532.078) * [-528.464] (-528.613) (-527.199) (-526.183) -- 0:00:18
Average standard deviation of split frequencies: 0.011939
816000 -- (-527.148) [-520.743] (-534.245) (-526.579) * (-527.022) [-529.082] (-522.374) (-527.557) -- 0:00:18
817000 -- (-524.223) [-527.684] (-528.410) (-524.754) * (-527.997) [-522.710] (-524.129) (-542.043) -- 0:00:18
818000 -- (-523.880) (-531.002) [-525.727] (-530.522) * [-522.374] (-521.788) (-530.324) (-525.317) -- 0:00:18
819000 -- [-520.377] (-525.098) (-526.957) (-523.211) * (-525.514) [-528.345] (-526.363) (-527.678) -- 0:00:17
820000 -- (-522.636) [-525.789] (-527.234) (-522.058) * (-522.732) [-523.162] (-526.517) (-524.284) -- 0:00:17
Average standard deviation of split frequencies: 0.010722
821000 -- (-524.275) [-525.744] (-529.344) (-527.646) * (-523.567) (-522.990) (-529.504) [-534.106] -- 0:00:17
822000 -- (-525.336) (-526.075) (-526.008) [-525.525] * (-531.029) [-524.910] (-527.697) (-526.275) -- 0:00:17
823000 -- (-525.026) (-525.891) (-522.828) [-522.064] * (-526.061) (-523.892) [-521.704] (-529.975) -- 0:00:17
824000 -- (-521.804) (-525.268) [-521.275] (-527.403) * (-527.731) [-526.731] (-529.919) (-531.929) -- 0:00:17
825000 -- (-529.436) (-524.966) [-521.703] (-524.603) * [-525.549] (-526.168) (-521.699) (-526.304) -- 0:00:17
Average standard deviation of split frequencies: 0.010653
826000 -- (-525.300) (-530.617) [-522.836] (-522.577) * (-523.922) (-529.619) (-526.354) [-524.149] -- 0:00:17
827000 -- (-520.719) (-526.675) (-533.285) [-521.564] * (-527.844) (-530.985) [-523.421] (-526.588) -- 0:00:17
828000 -- (-527.647) [-523.357] (-526.294) (-531.739) * (-527.985) (-529.480) [-526.951] (-520.709) -- 0:00:17
829000 -- (-523.995) (-527.790) (-524.300) [-526.526] * [-524.873] (-529.535) (-529.998) (-521.796) -- 0:00:16
830000 -- (-525.633) [-523.686] (-523.501) (-522.700) * [-526.209] (-534.811) (-524.849) (-533.422) -- 0:00:16
Average standard deviation of split frequencies: 0.009080
831000 -- (-524.522) (-527.104) [-531.891] (-521.620) * (-526.535) [-528.131] (-528.657) (-530.837) -- 0:00:16
832000 -- (-527.358) (-528.185) (-526.390) [-524.129] * (-523.515) [-527.985] (-523.385) (-527.552) -- 0:00:16
833000 -- [-524.187] (-525.886) (-534.829) (-527.027) * [-526.344] (-531.493) (-520.573) (-523.736) -- 0:00:16
834000 -- (-529.826) (-522.863) (-521.172) [-519.810] * [-523.782] (-526.361) (-523.679) (-533.884) -- 0:00:16
835000 -- [-521.332] (-524.865) (-522.650) (-522.099) * [-535.435] (-528.924) (-531.071) (-525.566) -- 0:00:16
Average standard deviation of split frequencies: 0.010150
836000 -- (-528.153) (-523.802) (-525.336) [-522.888] * (-530.290) (-527.586) (-530.207) [-524.171] -- 0:00:16
837000 -- [-524.146] (-529.971) (-533.176) (-525.022) * (-526.628) [-522.365] (-534.079) (-524.448) -- 0:00:16
838000 -- (-526.871) (-526.881) (-527.812) [-522.633] * (-522.601) (-526.200) (-528.269) [-523.094] -- 0:00:16
839000 -- (-521.869) (-531.277) (-531.962) [-524.132] * (-527.861) [-525.051] (-523.270) (-528.273) -- 0:00:15
840000 -- [-524.576] (-530.329) (-525.233) (-523.383) * (-523.855) [-525.806] (-525.101) (-531.917) -- 0:00:15
Average standard deviation of split frequencies: 0.008972
841000 -- (-522.756) (-523.539) (-529.146) [-525.117] * [-520.629] (-524.501) (-537.260) (-527.062) -- 0:00:15
842000 -- [-523.988] (-532.268) (-525.335) (-525.446) * (-525.673) (-524.659) (-529.497) [-526.123] -- 0:00:15
843000 -- (-526.459) (-532.232) (-530.417) [-526.000] * (-533.906) (-523.551) [-525.348] (-525.524) -- 0:00:15
844000 -- (-526.592) (-528.807) (-527.242) [-522.974] * [-524.162] (-524.470) (-523.624) (-523.782) -- 0:00:15
845000 -- (-521.730) (-523.321) (-523.189) [-523.315] * (-525.701) (-525.232) [-527.923] (-521.927) -- 0:00:15
Average standard deviation of split frequencies: 0.008915
846000 -- [-521.283] (-527.435) (-528.426) (-519.737) * (-524.765) (-530.822) (-529.636) [-524.618] -- 0:00:15
847000 -- (-524.904) (-529.937) [-527.758] (-528.047) * (-528.487) (-532.203) (-528.585) [-526.509] -- 0:00:15
848000 -- (-524.355) (-524.485) [-523.471] (-529.058) * (-531.252) (-524.959) [-528.763] (-520.630) -- 0:00:15
849000 -- (-524.463) (-522.465) (-525.024) [-534.659] * (-528.550) (-524.647) [-522.113] (-524.115) -- 0:00:14
850000 -- (-528.838) [-521.020] (-525.608) (-523.199) * (-528.947) [-524.642] (-531.709) (-522.754) -- 0:00:14
Average standard deviation of split frequencies: 0.008128
851000 -- [-524.021] (-521.949) (-526.456) (-528.464) * (-530.472) [-523.127] (-524.225) (-527.182) -- 0:00:14
852000 -- (-527.454) [-521.645] (-522.487) (-527.574) * (-528.443) [-525.045] (-531.057) (-524.175) -- 0:00:14
853000 -- (-529.434) [-522.670] (-525.360) (-523.595) * (-527.109) [-523.740] (-524.158) (-521.760) -- 0:00:14
854000 -- [-524.037] (-521.200) (-522.520) (-524.632) * (-525.757) [-524.696] (-527.275) (-525.688) -- 0:00:14
855000 -- (-533.233) (-528.028) [-523.576] (-525.043) * (-533.273) (-522.815) [-526.257] (-519.713) -- 0:00:14
Average standard deviation of split frequencies: 0.007710
856000 -- [-530.635] (-527.452) (-523.354) (-531.865) * [-526.499] (-531.157) (-534.612) (-522.645) -- 0:00:14
857000 -- (-522.747) (-530.345) [-528.153] (-528.875) * (-520.718) (-525.641) (-523.597) [-523.892] -- 0:00:14
858000 -- [-523.005] (-531.259) (-523.862) (-521.358) * (-522.381) (-526.716) (-528.916) [-522.693] -- 0:00:14
859000 -- (-522.077) (-525.488) (-526.644) [-521.651] * (-523.502) [-532.621] (-525.448) (-523.119) -- 0:00:13
860000 -- (-525.580) [-522.103] (-533.819) (-526.129) * [-523.211] (-523.803) (-528.224) (-523.544) -- 0:00:13
Average standard deviation of split frequencies: 0.006207
861000 -- (-530.947) (-521.587) (-523.254) [-527.828] * (-523.835) [-524.625] (-523.246) (-525.396) -- 0:00:13
862000 -- [-522.359] (-529.158) (-531.021) (-526.887) * (-523.111) (-523.290) (-528.000) [-524.581] -- 0:00:13
863000 -- [-528.465] (-526.756) (-532.878) (-523.742) * [-528.664] (-524.157) (-523.994) (-527.255) -- 0:00:13
864000 -- (-525.905) (-526.013) (-530.428) [-524.337] * (-526.658) (-526.886) (-525.429) [-525.350] -- 0:00:13
865000 -- (-525.889) [-523.454] (-526.918) (-525.468) * (-532.037) [-529.283] (-529.008) (-525.701) -- 0:00:13
Average standard deviation of split frequencies: 0.006169
866000 -- (-523.954) [-526.124] (-533.610) (-530.028) * (-524.345) (-530.726) (-527.630) [-523.672] -- 0:00:13
867000 -- [-524.554] (-527.793) (-526.359) (-533.152) * (-521.589) (-520.518) [-521.995] (-527.023) -- 0:00:13
868000 -- (-524.563) (-526.770) [-532.681] (-526.676) * (-522.758) [-528.344] (-524.979) (-528.590) -- 0:00:13
869000 -- (-530.053) (-527.763) (-530.597) [-520.803] * (-529.024) (-527.386) (-525.679) [-526.946] -- 0:00:12
870000 -- (-530.677) [-521.091] (-527.386) (-527.562) * [-527.941] (-521.603) (-522.788) (-524.895) -- 0:00:12
Average standard deviation of split frequencies: 0.007580
871000 -- (-534.346) (-526.999) (-527.370) [-522.931] * [-525.204] (-525.586) (-531.671) (-522.846) -- 0:00:12
872000 -- (-534.786) (-528.709) (-521.627) [-527.458] * (-530.359) [-522.270] (-530.103) (-528.683) -- 0:00:12
873000 -- (-527.862) [-524.222] (-524.781) (-525.721) * (-522.731) (-525.525) [-526.518] (-532.330) -- 0:00:12
874000 -- (-525.325) (-529.804) [-521.206] (-526.138) * (-527.412) (-526.432) (-527.633) [-529.113] -- 0:00:12
875000 -- (-528.843) [-526.649] (-520.652) (-526.143) * (-524.574) (-522.930) (-524.308) [-520.889] -- 0:00:12
Average standard deviation of split frequencies: 0.007534
876000 -- (-528.346) (-523.920) (-521.800) [-529.094] * [-525.521] (-527.908) (-522.994) (-522.468) -- 0:00:12
877000 -- [-527.220] (-527.705) (-526.079) (-524.146) * [-523.857] (-522.758) (-527.235) (-526.068) -- 0:00:12
878000 -- [-523.753] (-524.624) (-521.236) (-524.478) * (-524.902) (-526.148) (-528.490) [-522.224] -- 0:00:12
879000 -- (-522.500) [-523.179] (-521.846) (-529.356) * [-522.511] (-527.297) (-522.362) (-526.192) -- 0:00:11
880000 -- [-523.964] (-526.247) (-525.027) (-525.356) * (-524.605) [-525.476] (-523.175) (-525.362) -- 0:00:11
Average standard deviation of split frequencies: 0.006423
881000 -- (-530.911) [-523.897] (-523.761) (-525.993) * (-530.000) (-528.640) [-524.424] (-526.562) -- 0:00:11
882000 -- (-522.965) [-525.651] (-529.162) (-525.200) * (-527.968) (-526.687) [-524.106] (-525.998) -- 0:00:11
883000 -- (-524.663) (-529.462) (-528.301) [-524.364] * (-526.719) (-529.613) [-525.013] (-525.057) -- 0:00:11
884000 -- (-527.613) [-531.576] (-526.485) (-524.950) * (-520.006) (-530.210) [-520.687] (-532.966) -- 0:00:11
885000 -- [-525.239] (-528.856) (-524.784) (-527.187) * [-523.260] (-525.851) (-525.376) (-527.578) -- 0:00:11
Average standard deviation of split frequencies: 0.006739
886000 -- (-521.974) (-526.196) [-528.966] (-530.548) * (-530.425) [-523.625] (-523.476) (-525.401) -- 0:00:11
887000 -- [-525.875] (-529.213) (-527.727) (-527.783) * (-530.325) (-520.131) [-522.536] (-524.528) -- 0:00:11
888000 -- (-528.676) (-525.712) (-527.962) [-527.563] * (-528.606) (-530.129) (-526.920) [-525.164] -- 0:00:11
889000 -- (-524.259) [-525.520] (-525.301) (-526.321) * (-522.958) (-524.257) (-523.675) [-524.527] -- 0:00:10
890000 -- (-524.090) [-524.497] (-524.897) (-524.340) * [-525.369] (-526.654) (-522.472) (-527.811) -- 0:00:10
Average standard deviation of split frequencies: 0.007763
891000 -- (-524.122) (-525.153) [-524.243] (-524.099) * (-527.111) (-527.450) [-526.071] (-524.384) -- 0:00:10
892000 -- (-527.588) (-526.007) (-520.541) [-526.451] * (-525.213) (-522.622) (-525.545) [-524.617] -- 0:00:10
893000 -- (-524.682) (-529.192) [-522.615] (-523.014) * (-527.042) (-525.454) [-524.774] (-527.128) -- 0:00:10
894000 -- (-527.029) (-525.643) (-526.604) [-528.810] * (-523.973) (-533.232) (-523.784) [-532.667] -- 0:00:10
895000 -- [-527.447] (-527.760) (-529.857) (-522.351) * (-528.198) (-526.287) (-531.205) [-521.262] -- 0:00:10
Average standard deviation of split frequencies: 0.008769
896000 -- [-522.504] (-520.608) (-528.842) (-527.125) * (-529.733) [-530.103] (-525.601) (-525.585) -- 0:00:10
897000 -- (-532.790) (-524.969) [-525.017] (-527.852) * (-527.104) (-528.833) [-528.638] (-524.869) -- 0:00:10
898000 -- (-527.793) (-529.042) (-527.871) [-523.011] * (-526.186) [-525.330] (-531.105) (-528.224) -- 0:00:10
899000 -- [-524.148] (-525.452) (-535.653) (-524.045) * (-519.548) [-527.174] (-535.029) (-526.309) -- 0:00:09
900000 -- (-528.999) [-526.958] (-523.270) (-523.498) * (-526.791) (-522.426) (-526.557) [-527.159] -- 0:00:09
Average standard deviation of split frequencies: 0.008374
901000 -- [-525.845] (-523.270) (-524.618) (-523.067) * (-522.635) (-521.326) (-529.797) [-523.391] -- 0:00:09
902000 -- (-525.919) [-524.338] (-525.319) (-530.220) * (-528.922) (-523.964) (-532.530) [-523.916] -- 0:00:09
903000 -- (-527.165) [-520.138] (-526.043) (-523.300) * (-520.280) (-528.104) [-527.738] (-528.234) -- 0:00:09
904000 -- [-526.227] (-527.048) (-527.552) (-527.037) * (-523.811) (-529.139) [-529.151] (-521.954) -- 0:00:09
905000 -- (-526.465) (-523.821) [-534.360] (-532.090) * (-524.716) (-536.756) [-526.450] (-525.618) -- 0:00:09
Average standard deviation of split frequencies: 0.009019
906000 -- (-532.652) [-520.412] (-522.944) (-527.318) * [-520.868] (-531.872) (-524.766) (-525.724) -- 0:00:09
907000 -- (-524.416) (-521.346) [-528.683] (-528.948) * [-524.632] (-533.206) (-527.879) (-525.309) -- 0:00:09
908000 -- (-523.245) (-524.605) (-525.513) [-527.615] * [-526.731] (-544.070) (-526.490) (-535.688) -- 0:00:09
909000 -- (-526.464) (-529.656) [-528.768] (-529.094) * (-523.455) (-525.285) (-528.618) [-525.008] -- 0:00:09
910000 -- (-520.070) [-526.533] (-524.899) (-531.218) * (-526.738) (-523.550) (-532.383) [-524.250] -- 0:00:08
Average standard deviation of split frequencies: 0.011043
911000 -- (-525.508) [-527.891] (-527.916) (-526.389) * (-525.342) (-525.548) [-523.506] (-527.681) -- 0:00:08
912000 -- (-522.447) (-527.903) (-528.963) [-524.306] * (-528.017) [-522.143] (-530.558) (-528.368) -- 0:00:08
913000 -- (-523.757) (-524.475) [-532.828] (-528.049) * [-525.385] (-531.345) (-533.147) (-527.153) -- 0:00:08
914000 -- (-522.628) (-532.081) [-524.691] (-524.851) * (-526.286) [-527.977] (-525.057) (-522.808) -- 0:00:08
915000 -- (-524.897) (-525.329) [-524.440] (-526.227) * [-530.010] (-530.718) (-521.895) (-528.705) -- 0:00:08
Average standard deviation of split frequencies: 0.011322
916000 -- (-526.910) [-522.225] (-526.271) (-524.340) * (-525.510) (-527.312) [-524.198] (-527.197) -- 0:00:08
917000 -- [-525.695] (-526.659) (-523.507) (-533.523) * (-528.067) (-527.734) [-527.858] (-526.158) -- 0:00:08
918000 -- [-530.900] (-530.740) (-525.789) (-521.697) * (-522.909) (-527.964) [-525.468] (-522.590) -- 0:00:08
919000 -- (-534.399) (-522.381) (-523.981) [-521.301] * (-524.956) (-529.500) [-523.717] (-521.398) -- 0:00:08
920000 -- [-528.135] (-527.948) (-522.730) (-525.341) * [-526.730] (-525.036) (-524.950) (-526.337) -- 0:00:07
Average standard deviation of split frequencies: 0.009899
921000 -- (-525.830) [-527.407] (-529.664) (-527.230) * (-526.519) (-528.574) (-523.315) [-527.221] -- 0:00:07
922000 -- (-525.627) (-526.128) [-527.175] (-527.569) * (-525.935) [-523.289] (-527.909) (-526.246) -- 0:00:07
923000 -- (-524.699) (-526.062) [-527.080] (-529.516) * (-529.057) [-524.561] (-524.556) (-522.643) -- 0:00:07
924000 -- (-528.586) (-525.297) [-527.296] (-527.247) * (-533.603) (-522.955) [-527.076] (-525.242) -- 0:00:07
925000 -- (-526.972) [-525.235] (-527.036) (-525.144) * (-526.237) [-523.643] (-527.774) (-524.283) -- 0:00:07
Average standard deviation of split frequencies: 0.009163
926000 -- (-524.333) (-525.251) (-526.177) [-523.982] * (-523.908) (-523.325) [-527.782] (-525.204) -- 0:00:07
927000 -- (-522.334) (-528.022) (-525.016) [-525.276] * (-523.020) [-525.882] (-530.359) (-526.355) -- 0:00:07
928000 -- (-526.233) (-523.019) [-522.098] (-521.213) * (-525.141) (-530.703) [-526.530] (-524.838) -- 0:00:07
929000 -- (-529.738) (-526.302) [-520.510] (-522.320) * (-535.133) [-525.372] (-524.787) (-522.435) -- 0:00:07
930000 -- (-524.072) [-525.833] (-523.029) (-524.979) * (-532.146) (-527.017) (-523.805) [-521.745] -- 0:00:06
Average standard deviation of split frequencies: 0.009793
931000 -- (-530.141) (-524.110) [-523.094] (-522.456) * (-528.783) (-525.266) [-520.499] (-528.647) -- 0:00:06
932000 -- (-530.193) (-522.097) [-528.813] (-525.499) * (-524.910) (-529.292) (-523.592) [-523.968] -- 0:00:06
933000 -- (-530.394) (-525.700) (-526.736) [-521.954] * (-522.747) [-523.296] (-528.858) (-521.593) -- 0:00:06
934000 -- (-529.615) [-524.403] (-528.194) (-523.285) * (-522.381) (-521.655) (-527.377) [-525.728] -- 0:00:06
935000 -- (-525.444) [-526.037] (-524.342) (-526.284) * (-523.920) (-523.367) (-524.594) [-522.917] -- 0:00:06
Average standard deviation of split frequencies: 0.008730
936000 -- [-529.128] (-523.650) (-528.102) (-525.040) * [-525.950] (-528.212) (-528.403) (-525.177) -- 0:00:06
937000 -- (-525.005) [-521.328] (-530.396) (-524.744) * [-526.274] (-529.571) (-524.666) (-527.609) -- 0:00:06
938000 -- (-527.169) [-525.028] (-528.922) (-525.053) * (-526.471) [-523.382] (-528.353) (-527.583) -- 0:00:06
939000 -- (-533.154) (-525.529) [-522.957] (-527.581) * [-533.448] (-523.752) (-529.447) (-527.471) -- 0:00:06
940000 -- [-527.838] (-527.161) (-525.232) (-532.544) * (-524.218) (-529.953) (-525.474) [-525.334] -- 0:00:05
Average standard deviation of split frequencies: 0.008018
941000 -- (-532.205) (-525.821) (-526.381) [-525.595] * (-529.072) (-540.644) [-523.782] (-526.984) -- 0:00:05
942000 -- (-534.205) [-527.805] (-521.789) (-526.205) * [-525.731] (-530.825) (-526.495) (-528.754) -- 0:00:05
943000 -- (-529.181) (-522.392) [-523.608] (-521.846) * [-524.174] (-535.522) (-533.288) (-529.448) -- 0:00:05
944000 -- (-540.074) [-527.577] (-525.172) (-523.138) * [-521.362] (-531.749) (-522.358) (-532.579) -- 0:00:05
945000 -- (-531.168) [-530.084] (-528.319) (-527.797) * (-524.330) (-524.179) [-525.278] (-532.131) -- 0:00:05
Average standard deviation of split frequencies: 0.007309
946000 -- (-527.278) [-520.825] (-527.444) (-525.631) * [-522.506] (-529.360) (-526.397) (-525.435) -- 0:00:05
947000 -- (-534.336) (-523.089) [-521.704] (-528.776) * (-523.405) (-532.790) [-524.878] (-531.504) -- 0:00:05
948000 -- (-530.472) (-523.125) (-525.664) [-521.868] * (-527.869) (-522.868) [-522.375] (-523.817) -- 0:00:05
949000 -- (-527.828) [-523.378] (-521.181) (-527.441) * (-527.462) (-521.419) [-524.352] (-528.860) -- 0:00:05
950000 -- [-525.663] (-524.386) (-525.129) (-525.030) * (-526.619) (-524.136) [-528.147] (-528.140) -- 0:00:04
Average standard deviation of split frequencies: 0.007934
951000 -- (-525.104) (-535.586) [-527.730] (-526.573) * (-529.272) (-532.828) (-525.805) [-526.619] -- 0:00:04
952000 -- (-529.262) (-527.433) [-526.228] (-522.079) * (-528.575) [-522.426] (-524.739) (-528.198) -- 0:00:04
953000 -- (-527.513) (-522.926) [-522.747] (-529.606) * (-524.928) (-524.171) [-523.718] (-533.553) -- 0:00:04
954000 -- (-523.569) (-522.554) [-520.758] (-526.872) * (-524.478) (-529.744) (-530.622) [-525.989] -- 0:00:04
955000 -- (-524.299) [-521.712] (-522.138) (-525.847) * (-522.816) (-526.904) (-524.782) [-523.782] -- 0:00:04
Average standard deviation of split frequencies: 0.008876
956000 -- (-524.797) (-528.808) [-523.462] (-528.564) * (-529.004) (-527.053) (-530.261) [-525.377] -- 0:00:04
957000 -- (-522.630) (-523.425) (-529.561) [-531.599] * [-525.897] (-531.012) (-523.230) (-529.944) -- 0:00:04
958000 -- (-523.866) (-523.738) (-524.206) [-520.985] * [-527.673] (-525.669) (-523.524) (-526.464) -- 0:00:04
959000 -- (-524.931) (-531.084) (-532.573) [-521.455] * [-522.488] (-530.497) (-526.317) (-524.642) -- 0:00:04
960000 -- (-524.731) (-521.640) [-523.855] (-526.567) * (-526.059) (-525.003) (-528.433) [-522.825] -- 0:00:03
Average standard deviation of split frequencies: 0.009487
961000 -- (-527.885) [-523.844] (-528.752) (-526.787) * (-528.065) (-528.143) [-529.581] (-523.135) -- 0:00:03
962000 -- [-524.025] (-530.489) (-526.352) (-525.005) * [-526.795] (-529.517) (-527.166) (-524.362) -- 0:00:03
963000 -- (-519.937) (-523.887) [-526.311] (-527.388) * (-528.823) (-530.229) (-526.121) [-527.327] -- 0:00:03
964000 -- (-522.684) (-523.271) [-525.501] (-532.257) * [-525.987] (-523.032) (-526.751) (-522.713) -- 0:00:03
965000 -- (-529.143) [-523.939] (-531.558) (-522.795) * (-523.577) (-530.045) (-525.782) [-522.097] -- 0:00:03
Average standard deviation of split frequencies: 0.008459
966000 -- (-523.006) (-531.117) (-529.490) [-521.523] * (-527.839) [-525.979] (-539.374) (-527.740) -- 0:00:03
967000 -- [-523.853] (-526.184) (-527.260) (-527.983) * (-526.650) (-532.244) (-529.413) [-523.931] -- 0:00:03
968000 -- (-525.737) (-534.577) (-525.758) [-529.314] * [-527.250] (-528.045) (-526.188) (-528.326) -- 0:00:03
969000 -- (-524.988) (-528.423) [-525.457] (-527.871) * (-525.795) (-525.224) [-528.195] (-526.293) -- 0:00:03
970000 -- (-524.680) (-526.560) [-524.936] (-527.303) * (-526.324) (-523.763) (-528.410) [-528.604] -- 0:00:02
Average standard deviation of split frequencies: 0.008418
971000 -- (-527.503) [-526.608] (-537.046) (-522.233) * (-528.926) (-523.246) [-523.271] (-525.974) -- 0:00:02
972000 -- (-526.903) (-527.761) [-528.806] (-528.920) * [-525.594] (-523.144) (-524.644) (-529.834) -- 0:00:02
973000 -- [-526.004] (-531.917) (-527.818) (-524.495) * (-521.949) (-521.124) [-526.813] (-523.137) -- 0:00:02
974000 -- [-529.153] (-532.163) (-529.916) (-526.116) * (-523.246) (-522.810) (-528.132) [-528.758] -- 0:00:02
975000 -- (-528.249) [-527.362] (-526.751) (-525.985) * (-525.956) (-521.375) (-528.565) [-525.069] -- 0:00:02
Average standard deviation of split frequencies: 0.007084
976000 -- (-527.733) (-525.989) (-530.176) [-522.428] * [-525.384] (-524.235) (-531.326) (-525.175) -- 0:00:02
977000 -- (-524.895) [-524.937] (-528.682) (-526.632) * [-522.242] (-523.491) (-530.989) (-536.274) -- 0:00:02
978000 -- (-531.358) [-521.759] (-532.922) (-529.341) * (-520.859) [-527.647] (-524.224) (-526.926) -- 0:00:02
979000 -- [-520.963] (-525.612) (-525.685) (-528.412) * (-527.246) [-521.176] (-524.303) (-526.676) -- 0:00:02
980000 -- (-531.811) (-527.079) (-542.859) [-530.711] * (-530.500) (-523.200) (-528.340) [-527.877] -- 0:00:01
Average standard deviation of split frequencies: 0.007691
981000 -- [-526.062] (-526.124) (-528.922) (-527.325) * (-524.425) (-521.128) (-524.295) [-524.066] -- 0:00:01
982000 -- (-529.627) [-528.992] (-525.894) (-526.839) * (-522.746) (-521.889) (-528.313) [-523.344] -- 0:00:01
983000 -- (-528.239) (-524.267) [-523.546] (-524.418) * (-526.713) [-522.913] (-533.260) (-524.833) -- 0:00:01
984000 -- (-528.879) (-526.886) [-525.486] (-524.519) * (-524.028) (-526.446) [-532.476] (-531.367) -- 0:00:01
985000 -- (-526.991) (-529.381) (-532.912) [-523.015] * [-521.455] (-525.686) (-526.575) (-524.141) -- 0:00:01
Average standard deviation of split frequencies: 0.007331
986000 -- (-526.044) [-525.406] (-527.302) (-527.615) * (-529.905) (-521.779) [-529.705] (-525.266) -- 0:00:01
987000 -- (-527.048) [-532.109] (-535.045) (-526.149) * (-533.778) [-523.084] (-527.029) (-526.432) -- 0:00:01
988000 -- (-528.814) (-531.480) (-527.138) [-526.331] * (-522.719) (-525.821) (-522.994) [-523.632] -- 0:00:01
989000 -- (-524.676) [-526.086] (-523.473) (-529.021) * (-527.548) (-524.034) [-532.074] (-528.916) -- 0:00:01
990000 -- (-539.610) [-525.364] (-524.125) (-526.573) * (-530.461) [-527.670] (-526.636) (-527.895) -- 0:00:00
Average standard deviation of split frequencies: 0.007296
991000 -- [-525.248] (-523.682) (-525.651) (-528.996) * (-522.079) (-529.016) [-523.335] (-522.177) -- 0:00:00
992000 -- (-527.404) (-530.434) (-523.403) [-523.966] * (-534.751) (-523.070) (-527.720) [-526.587] -- 0:00:00
993000 -- [-530.289] (-526.455) (-528.030) (-527.125) * (-530.266) [-521.791] (-526.643) (-522.136) -- 0:00:00
994000 -- (-523.398) (-524.254) (-529.565) [-523.509] * (-528.021) (-528.500) (-528.539) [-524.408] -- 0:00:00
995000 -- (-528.895) [-526.011] (-528.899) (-521.630) * (-526.646) (-522.908) [-524.317] (-521.866) -- 0:00:00
Average standard deviation of split frequencies: 0.007257
996000 -- (-528.607) (-522.887) (-533.017) [-525.618] * (-528.384) [-522.211] (-523.573) (-524.618) -- 0:00:00
997000 -- (-521.898) (-527.439) (-529.155) [-524.907] * (-528.158) (-525.292) (-527.389) [-522.374] -- 0:00:00
998000 -- (-531.809) (-525.302) (-525.216) [-522.779] * (-529.395) (-528.862) (-522.641) [-522.608] -- 0:00:00
999000 -- (-532.869) (-527.468) (-526.436) [-521.781] * (-525.728) [-526.817] (-519.487) (-522.275) -- 0:00:00
1000000 -- (-523.609) [-524.322] (-526.481) (-528.420) * (-524.039) [-526.274] (-533.235) (-524.032) -- 0:00:00
Average standard deviation of split frequencies: 0.007852
Analysis completed in 1 mins 39 seconds
Analysis used 98.17 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -517.33
Likelihood of best state for "cold" chain of run 2 was -517.21
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
72.1 % ( 63 %) Dirichlet(Revmat{all})
90.2 % ( 85 %) Slider(Revmat{all})
38.0 % ( 35 %) Dirichlet(Pi{all})
37.4 % ( 22 %) Slider(Pi{all})
79.7 % ( 71 %) Multiplier(Alpha{1,2})
72.9 % ( 47 %) Multiplier(Alpha{3})
86.4 % ( 75 %) Slider(Pinvar{all})
93.4 % ( 93 %) ExtSPR(Tau{all},V{all})
94.1 % ( 96 %) NNI(Tau{all},V{all})
69.5 % ( 75 %) ParsSPR(Tau{all},V{all})
27.2 % ( 30 %) Multiplier(V{all})
49.9 % ( 47 %) Nodeslider(V{all})
29.1 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
72.1 % ( 62 %) Dirichlet(Revmat{all})
90.3 % ( 80 %) Slider(Revmat{all})
38.1 % ( 29 %) Dirichlet(Pi{all})
37.6 % ( 29 %) Slider(Pi{all})
79.5 % ( 64 %) Multiplier(Alpha{1,2})
72.3 % ( 40 %) Multiplier(Alpha{3})
86.4 % ( 78 %) Slider(Pinvar{all})
93.1 % ( 96 %) ExtSPR(Tau{all},V{all})
94.1 % ( 90 %) NNI(Tau{all},V{all})
69.5 % ( 76 %) ParsSPR(Tau{all},V{all})
27.2 % ( 30 %) Multiplier(V{all})
50.1 % ( 60 %) Nodeslider(V{all})
29.2 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.65 0.50
2 | 166022 0.82 0.66
3 | 166729 167555 0.83
4 | 166273 166794 166627
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.65 0.50
2 | 166358 0.82 0.66
3 | 166694 167334 0.83
4 | 166390 166675 166549
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -523.68
| 2 1 |
| 1 |
| 1 1 2 1 2 |
| 2 2 2 11 1 |
| 2 1 *1 2 1 * * *1 |
| 2 2 11* 2 2 2 1* 2 2|
|*2 1 1 11 * * 2 1 2 2 1 1 2 |
| 1 2 2 2 1 122 112 1 2 2 1|
| 2 1 1 2 2 1 1 2 |
| 2 1 2 2 1 |
| 2 2 2 2 2* 1 1 1 2 2 2 2 12 1 |
| 1 1 1 1 2 1 |
| 1 1 1 1 2 |
| 2 |
| 1 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -526.51
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -522.85 -529.23
2 -522.80 -531.12
--------------------------------------
TOTAL -522.82 -530.57
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.065787 0.003434 0.018289 0.147056 0.051867 803.84 833.05 1.000
r(A<->C){all} 0.076109 0.005438 0.000030 0.230309 0.053963 241.91 292.54 1.000
r(A<->G){all} 0.246536 0.012679 0.031245 0.457790 0.235493 259.30 350.62 1.000
r(A<->T){all} 0.137320 0.007093 0.000343 0.297523 0.122838 461.96 496.28 1.002
r(C<->G){all} 0.068533 0.004617 0.000027 0.197194 0.049449 501.67 552.87 1.000
r(C<->T){all} 0.312614 0.014428 0.091281 0.545388 0.301724 182.75 274.33 1.003
r(G<->T){all} 0.158888 0.007504 0.013582 0.327028 0.149711 326.92 400.10 1.000
pi(A){all} 0.212492 0.000476 0.171654 0.256506 0.212315 1090.33 1156.87 1.000
pi(C){all} 0.204548 0.000503 0.160004 0.247798 0.203313 1160.33 1204.59 1.000
pi(G){all} 0.242199 0.000534 0.198055 0.288276 0.241365 937.21 1079.17 1.000
pi(T){all} 0.340762 0.000639 0.293952 0.391900 0.340716 1221.48 1276.57 1.000
alpha{1,2} 0.672600 0.731865 0.000377 2.416219 0.337235 811.14 1049.26 1.000
alpha{3} 1.346768 1.264563 0.000509 3.532154 1.048168 1258.80 1329.56 1.000
pinvar{all} 0.493169 0.074512 0.018459 0.887729 0.511065 461.78 491.57 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .**.
6 -- ..**
7 -- .*.*
----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 1168 0.389074 0.009422 0.382412 0.395736 2
6 919 0.306129 0.011777 0.297801 0.314457 2
7 915 0.304797 0.002355 0.303131 0.306462 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.051118 0.002945 0.011646 0.123249 0.038309 1.000 2
length{all}[2] 0.003035 0.000012 0.000002 0.009215 0.001980 1.000 2
length{all}[3] 0.002935 0.000012 0.000003 0.009115 0.001888 1.000 2
length{all}[4] 0.005524 0.000024 0.000011 0.014055 0.004391 1.000 2
length{all}[5] 0.003585 0.000021 0.000003 0.011025 0.002193 1.000 2
length{all}[6] 0.002892 0.000011 0.000004 0.009055 0.001872 1.003 2
length{all}[7] 0.002935 0.000010 0.000010 0.009398 0.001922 0.999 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007852
Maximum standard deviation of split frequencies = 0.011777
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\------------------------------------------------------------------------ C4 (4)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|---- C2 (2)
+
|---- C3 (3)
|
\-------- C4 (4)
|--------| 0.005 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
Running FUBAR...
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\
***************** TYPES OF STANDARD ANALYSES *****************
(1) Selection Analyses
(2) Evolutionary Hypothesis Testing
(3) Relative evolutionary rate inference
(4) Coevolutionary analysis
(5) Basic Analyses
(6) Codon Selection Analyses
(7) Compartmentalization
(8) Data File Tools
(9) Miscellaneous
(10) Model Comparison
(11) Kernel Analysis Tools
(12) Molecular Clock
(13) Phylogeny Reconstruction
(14) Positive Selection
(15) Recombination
(16) Selection/Recombination
(17) Relative Rate
(18) Relative Ratio
(19) Substitution Rates
Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' *****************
(1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution).
(2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood).
(3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting).
(4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection).
(5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification).
(6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood).
(7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation).
Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types):
Analysis Description
--------------------
Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a
coding sequence alignment to determine whether some sites have been
subject to pervasive purifying or diversifying selection. v2.1
introduces two more methods for estimating the posterior distribution of
grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation
Bayes approximation (fastest). Please note that a FUBAR analysis
generates a cache and a results JSON file in the same directory as
directory as the original alignment. HyPhy needs to have write
privileges to this directory. For example if the original file is in
/home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there
will also exist FUBAR-generated files
/home/sergei/FUBAR/data/pol.nex.FUBAR.json,
/home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide
checkpointing so that a partially completed analysis can be restarted.
- __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree
(one per partition)
- __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring
selection (2013), Mol Biol Evol. 30(5):1196-205
- __Written by__: Sergei L Kosakovsky Pond
- __Contact Information__: spond@temple.edu
- __Analysis Version__: 2.1
####Choose Genetic Code
1. [**Universal**] Universal code. (Genebank transl_table=1).
2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2).
3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3).
4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4).
5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5).
6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6).
7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9).
8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10).
9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12).
10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13).
11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14).
12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15).
13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16).
14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21).
15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22).
16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23).
17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24).
18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25).
19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26).
>Please choose an option (or press q to cancel selection):
>Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`)
>A tree was found in the data file: `(C1,C2,C3,C4)`
>Would you like to use it (y/n)?
>Loaded a multiple sequence alignment with **4** sequences, **110** codons, and **1** partitions from `/data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/fubar/results/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1.fna`
> FUBAR will write cache and result files to _/data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/fubar/results/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/fubar/results/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1.fna.FUBAR.json_, respectively
> Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer):
####Posterior estimation method
1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation)
2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed)
3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default)
>Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5):
### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model
* Log(L) = -517.59, AIC-c = 1059.41 (12 estimated parameters)
* Tree length (expected substitutions/site) for partition 1 : 0.040
### Computing the phylogenetic likelihood function on the grid
* Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid
* Best scaling achieved for
* synonymous rate = 2.815
* non-synonymous rate = 0.571
* Computing conditional site likelihoods on a 20 x 20 rate grid
### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights
* Using the following settings
* Dirichlet alpha : 0.5
### Tabulating site-level results
----
## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=110
HKU2_GD_430_2006_nsp1_VIPR_P_148283140_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 MSINQLTLAVASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVASGLQ
HKU2_HK_33_2006_NA_VIPR_P_148283167_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
HKU2_HK_298_2006_NA_VIPR_P_148283158_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
*********:************************************ ***
HKU2_GD_430_2006_nsp1_VIPR_P_148283140_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLEE
HKU2_HK_33_2006_NA_VIPR_P_148283167_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
HKU2_HK_298_2006_NA_VIPR_P_148283158_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
************************************************:*
HKU2_GD_430_2006_nsp1_VIPR_P_148283140_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 FHVIFGKRGG
HKU2_HK_33_2006_NA_VIPR_P_148283167_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 FQVIFGKRGG
HKU2_HK_298_2006_NA_VIPR_P_148283158_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 FQVIFGKRGG
HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 FQVIFGKRGG
*:********
>HKU2_GD_430_2006_nsp1_VIPR_P_148283140_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 ATGTCTATCAACCAATTGACACTTGCAGTTGCAAGTGACCAGGAAATTTCAGCTCATGGCTATCCTACTATGTCTGATGCCGTTGAACATTTTAGTTCCTCCGCATCACACGGTTTTAAGGATTGCCGTTTTGTAGCCTCTGGGCTGCAGGACATCGTTATTGGAGTTGAACCCAGTGACTTTGTCGTGGCTTTGGAGGGTGATGAAATTCTCACTGCCTATATAGCCACTTTTGGAGCTAGACCTCGTTGTTTGCGCGGCTGGCTTATACCTTCTAATTCTAATTATGTTTTGGAGGAATTTCATGTAATTTTTGGCAAGCGCGGCGGT >HKU2_HK_33_2006_NA_VIPR_P_148283167_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 ATGTCTATCAACCAATTGACACTTGCAATTGCAAGTGATCAGGAAATTTCAGCTCATGGCTATCCTACTATGTCTGATGCCGTTGAACATTTTAGTTCCTCCGCATCACACGGTTTTAAGGATTGCCGTTTTGTAGCCGTGGGGCTGCAGGACATTGTTATTGGAGTTGAACCCAGTGACTTTGTCGTGGCTTTGGAGGGTGATGAAATTCTCACTGCCTATATAGCCACATTTGGAGCTAGACCTCGTTGTTTGCGCGGTTGGCTTATACCTTCTAATTCTAATTATGTTTTGGATGAGTTTCAAGTGATTTTTGGCAAGCGCGGCGGT >HKU2_HK_298_2006_NA_VIPR_P_148283158_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 ATGTCTATCAACCAATTGACACTTGCAATTGCAAGTGATCAGGAAATTTCAGCTCATGGCTATCCTACTATGTCTGATGCCGTTGAACATTTTAGTTCCTCCGCATCACACGGTTTTAAGGATTGCCGTTTTGTAGCCGTGGGGCTGCAGGACATTGTTATTGGAGTTGAACCCAGTGACTTTGTCGTGGCTTTGGAGGGTGATGAAATTCTCACTGCCTATATAGCCACATTTGGAGCTAGACCTCGTTGTTTGCGCGGTTGGCTTATACCTTCTAATTCTAATTATGTTTTGGATGAGTTTCAAGTGATTTTTGGCAAGCGCGGCGGT >HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 ATGTCTATCAACCAATTGACACTTGCAATTGCAAGTGATCAGGAAATTTCAGCTCATGGCTATCCTACTATGTCTGATGCCGTTGAACATTTTAGTTCCTCCGCATCACACGGTTTTAAGGATTGCCGTTTTGTAGCCGTGGGGCTGCAGGACATTGTTATTGGAGTTGAACCCAGTGACTTTGTCGTGGCTTTGGAGGGTGATGAAATTCTCACTGCCTATATAGCCACATTTGGAGCTAGACCTCGTTGTTTGCGCGGTTGGCTTATACCTTCTAATTCTAATTATGTCTTGGATGAGTTTCAAGTGATTTTTGGCAAGCGCGGCGGT
>HKU2_GD_430_2006_nsp1_VIPR_P_148283140_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 MSINQLTLAVASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVASGLQ DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLEE FHVIFGKRGG >HKU2_HK_33_2006_NA_VIPR_P_148283167_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE FQVIFGKRGG >HKU2_HK_298_2006_NA_VIPR_P_148283158_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE FQVIFGKRGG >HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE FQVIFGKRGG
Reading sequence file /data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/fubar/fasta/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1 Found 4 sequences of length 330 Alignment looks like a valid DNA alignment. Estimated diversity is (pairwise deletion - ignoring missing/ambig): 2.0% Found 0 informative sites. Writing alignment of informative sites to: Phi.inf.sites Writing list of informative sites to: Phi.inf.list Calculating all pairwise incompatibilities... 100.0% Using a window size of 80 with k as 1 Too few informative sites to use normal approximation. Try doing a permutation test or increasing alignment length Can also try decreasing windowsize.
#NEXUS
[ID: 8437544378]
begin taxa;
dimensions ntax=4;
taxlabels
HKU2_GD_430_2006_nsp1_VIPR_P_148283140_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
HKU2_HK_33_2006_NA_VIPR_P_148283167_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
HKU2_HK_298_2006_NA_VIPR_P_148283158_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
;
end;
begin trees;
translate
1 HKU2_GD_430_2006_nsp1_VIPR_P_148283140_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2,
2 HKU2_HK_33_2006_NA_VIPR_P_148283167_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2,
3 HKU2_HK_298_2006_NA_VIPR_P_148283158_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2,
4 HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:3.830857e-02,2:1.980179e-03,3:1.887514e-03,4:4.391445e-03);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:3.830857e-02,2:1.980179e-03,3:1.887514e-03,4:4.391445e-03);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -522.96 -531.20
2 -522.93 -529.51
--------------------------------------
TOTAL -522.95 -530.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.067129 0.005479 0.020404 0.156036 0.052374 803.10 930.81 1.000
r(A<->C){all} 0.077425 0.005248 0.000116 0.213177 0.057067 333.77 478.53 1.009
r(A<->G){all} 0.237039 0.012814 0.027209 0.454012 0.226231 298.20 425.25 1.001
r(A<->T){all} 0.137357 0.007187 0.002153 0.300616 0.121676 325.09 377.46 1.005
r(C<->G){all} 0.070768 0.004301 0.000009 0.194659 0.054487 537.33 539.33 1.000
r(C<->T){all} 0.312634 0.013815 0.094085 0.535790 0.301517 459.99 461.76 1.000
r(G<->T){all} 0.164777 0.007820 0.011285 0.332747 0.154379 227.99 339.48 1.000
pi(A){all} 0.214226 0.000470 0.172139 0.256951 0.213774 1356.39 1377.09 1.000
pi(C){all} 0.203237 0.000456 0.161211 0.244329 0.202569 1336.73 1370.13 1.000
pi(G){all} 0.241667 0.000532 0.199794 0.289365 0.241808 1282.90 1315.82 1.000
pi(T){all} 0.340870 0.000629 0.290643 0.386766 0.340811 1360.98 1396.75 1.000
alpha{1,2} 0.677870 0.736841 0.000397 2.434321 0.350909 1126.88 1188.02 1.000
alpha{3} 1.378713 1.270098 0.000417 3.607951 1.079052 1038.91 1057.73 1.000
pinvar{all} 0.501948 0.072726 0.029839 0.903398 0.531543 267.26 505.28 1.004
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C2,C3,C4)` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **4** sequences, **110** codons, and **1** partitions from `/data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/fubar/results/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/fubar/results/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/fubar/results/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -517.59, AIC-c = 1059.41 (12 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.040 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 2.815 * non-synonymous rate = 0.571 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results ---- ## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
