--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1332.57 -1348.71
2 -1332.32 -1346.39
--------------------------------------
TOTAL -1332.44 -1348.11
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.181332 0.001707 0.110885 0.259924 0.175716 1114.36 1165.77 1.000
r(A<->C){all} 0.095638 0.001785 0.018928 0.178157 0.090109 658.96 773.07 1.000
r(A<->G){all} 0.192400 0.003841 0.089070 0.326833 0.186267 444.00 597.65 1.000
r(A<->T){all} 0.128453 0.001593 0.060550 0.215161 0.124740 446.47 617.86 1.000
r(C<->G){all} 0.083122 0.001853 0.000001 0.161692 0.078363 511.94 536.09 1.005
r(C<->T){all} 0.447278 0.005710 0.308139 0.600852 0.445352 501.88 589.86 1.001
r(G<->T){all} 0.053109 0.000949 0.002127 0.112029 0.047844 609.15 645.84 1.000
pi(A){all} 0.235339 0.000258 0.204184 0.266228 0.234684 987.97 1056.70 1.001
pi(C){all} 0.237689 0.000240 0.206521 0.266617 0.237732 1283.38 1330.44 1.000
pi(G){all} 0.185011 0.000200 0.157070 0.212770 0.184837 1200.38 1238.87 1.000
pi(T){all} 0.341961 0.000317 0.305524 0.375553 0.341827 1239.97 1250.83 1.000
alpha{1,2} 0.212505 0.035763 0.000023 0.520230 0.173766 1164.20 1228.42 1.000
alpha{3} 2.066277 1.612726 0.224464 4.509700 1.804892 1232.73 1241.94 1.000
pinvar{all} 0.706063 0.007049 0.529868 0.836086 0.721558 705.91 746.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
-- Starting log on Tue Oct 25 21:14:49 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=9, Len=223
C1 MAFSPSLFQPVVIQKETHGGEPSSLNHVITCIPLTGYVAALVVNACFYPL
C2 MAFSPSLFQPVVIQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
C3 MAFSPSLFQPVVIQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
C4 MAFSPSLFQPLVIQKETHGGEPSSPNHVIACIPLTGYVAALVVNACFYPL
C5 MAFSPSLFQPLVIQKETHGGEPSSPNHVIACIPLTGYVAALVVNACFYPL
C6 MAFSPSLFQPVVFQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
C7 MAFSPSLFQPVVFQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
C8 MAFSPSLFQPVVFQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
C9 MAFSPSLFQPVVIQKETHGGEPSSLNDVITCIPLTGYVASLVVNACFYPL
**********:*:*********** *.**:*********:**********
C1 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQGTQQPVGICLMVYCI
C2 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI
C3 LLCLPYSSCRASVCKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI
C4 LFCLPYSSCRASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI
C5 LFCLPYSSCRASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI
C6 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI
C7 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI
C8 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI
C9 LLCLPYSSCRASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI
*:**********:*********************:.**************
C1 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C2 ILIAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C3 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C4 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C5 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C6 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C7 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C8 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C9 ILMAIWTFDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
**:****:******************************************
C1 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
C2 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
C3 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
C4 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
C5 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
C6 FVKNFNQRCRCTNCFFAHSATYLECIFISRFAKTTLVSISDFQLNGSHST
C7 FVKNFNQRCRCTNCFFAHSATYLECIFISRFAKTTLVSISDFQLNGSHST
C8 FVKNFNQRCRCTNCFFAHSATYLECIFISRFAKTTLVSISDFQLNGSHST
C9 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
************************* *****:******************
C1 VFVPFNSRDSVPLHIIAPSVLTV
C2 VFVPFNSRDSVPLHIIAPSVLTV
C3 VFVPFNSRDSVPLHIIAPSVLTV
C4 VFVPFNSRDSVPLHIIAPSVLTV
C5 VFVPFNSRDSVPLHIIAPSVLTV
C6 VFVPFNSRDSVPLHIIAPSVLTV
C7 VFVPFNSRDSVPLHIIAPSVLTV
C8 VFVPFNSRDSVPLHIIAPSVLTV
C9 VFVPFNSRDSVPLHIIAPSVLTV
***********************
-- Starting log on Tue Oct 25 21:15:18 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=9, Len=223
C1 MAFSPSLFQPVVIQKETHGGEPSSLNHVITCIPLTGYVAALVVNACFYPL
C2 MAFSPSLFQPVVIQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
C3 MAFSPSLFQPVVIQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
C4 MAFSPSLFQPLVIQKETHGGEPSSPNHVIACIPLTGYVAALVVNACFYPL
C5 MAFSPSLFQPLVIQKETHGGEPSSPNHVIACIPLTGYVAALVVNACFYPL
C6 MAFSPSLFQPVVFQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
C7 MAFSPSLFQPVVFQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
C8 MAFSPSLFQPVVFQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
C9 MAFSPSLFQPVVIQKETHGGEPSSLNDVITCIPLTGYVASLVVNACFYPL
**********:*:*********** *.**:*********:**********
C1 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQGTQQPVGICLMVYCI
C2 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI
C3 LLCLPYSSCRASVCKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI
C4 LFCLPYSSCRASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI
C5 LFCLPYSSCRASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI
C6 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI
C7 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI
C8 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI
C9 LLCLPYSSCRASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI
*:**********:*********************:.**************
C1 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C2 ILIAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C3 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C4 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C5 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C6 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C7 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C8 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C9 ILMAIWTFDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
**:****:******************************************
C1 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
C2 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
C3 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
C4 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
C5 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
C6 FVKNFNQRCRCTNCFFAHSATYLECIFISRFAKTTLVSISDFQLNGSHST
C7 FVKNFNQRCRCTNCFFAHSATYLECIFISRFAKTTLVSISDFQLNGSHST
C8 FVKNFNQRCRCTNCFFAHSATYLECIFISRFAKTTLVSISDFQLNGSHST
C9 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
************************* *****:******************
C1 VFVPFNSRDSVPLHIIAPSVLTV
C2 VFVPFNSRDSVPLHIIAPSVLTV
C3 VFVPFNSRDSVPLHIIAPSVLTV
C4 VFVPFNSRDSVPLHIIAPSVLTV
C5 VFVPFNSRDSVPLHIIAPSVLTV
C6 VFVPFNSRDSVPLHIIAPSVLTV
C7 VFVPFNSRDSVPLHIIAPSVLTV
C8 VFVPFNSRDSVPLHIIAPSVLTV
C9 VFVPFNSRDSVPLHIIAPSVLTV
***********************
-- Starting log on Tue Oct 25 21:14:49 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=9, Len=223
C1 MAFSPSLFQPVVIQKETHGGEPSSLNHVITCIPLTGYVAALVVNACFYPL
C2 MAFSPSLFQPVVIQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
C3 MAFSPSLFQPVVIQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
C4 MAFSPSLFQPLVIQKETHGGEPSSPNHVIACIPLTGYVAALVVNACFYPL
C5 MAFSPSLFQPLVIQKETHGGEPSSPNHVIACIPLTGYVAALVVNACFYPL
C6 MAFSPSLFQPVVFQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
C7 MAFSPSLFQPVVFQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
C8 MAFSPSLFQPVVFQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
C9 MAFSPSLFQPVVIQKETHGGEPSSLNDVITCIPLTGYVASLVVNACFYPL
**********:*:*********** *.**:*********:**********
C1 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQGTQQPVGICLMVYCI
C2 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI
C3 LLCLPYSSCRASVCKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI
C4 LFCLPYSSCRASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI
C5 LFCLPYSSCRASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI
C6 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI
C7 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI
C8 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI
C9 LLCLPYSSCRASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI
*:**********:*********************:.**************
C1 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C2 ILIAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C3 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C4 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C5 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C6 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C7 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C8 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
C9 ILMAIWTFDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
**:****:******************************************
C1 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
C2 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
C3 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
C4 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
C5 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
C6 FVKNFNQRCRCTNCFFAHSATYLECIFISRFAKTTLVSISDFQLNGSHST
C7 FVKNFNQRCRCTNCFFAHSATYLECIFISRFAKTTLVSISDFQLNGSHST
C8 FVKNFNQRCRCTNCFFAHSATYLECIFISRFAKTTLVSISDFQLNGSHST
C9 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
************************* *****:******************
C1 VFVPFNSRDSVPLHIIAPSVLTV
C2 VFVPFNSRDSVPLHIIAPSVLTV
C3 VFVPFNSRDSVPLHIIAPSVLTV
C4 VFVPFNSRDSVPLHIIAPSVLTV
C5 VFVPFNSRDSVPLHIIAPSVLTV
C6 VFVPFNSRDSVPLHIIAPSVLTV
C7 VFVPFNSRDSVPLHIIAPSVLTV
C8 VFVPFNSRDSVPLHIIAPSVLTV
C9 VFVPFNSRDSVPLHIIAPSVLTV
***********************
-- Starting log on Tue Oct 25 21:32:17 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/gapped_alignment/fubar,TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 9 taxa and 669 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666733540
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 587794672
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4250677722
Seed = 1893472698
Swapseed = 1666733540
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 18 unique site patterns
Division 2 has 7 unique site patterns
Division 3 has 38 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1641.844907 -- 32.479477
Chain 2 -- -1673.960074 -- 32.479477
Chain 3 -- -1676.827468 -- 32.479477
Chain 4 -- -1661.343818 -- 32.479477
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1633.001159 -- 32.479477
Chain 2 -- -1669.390323 -- 32.479477
Chain 3 -- -1656.024672 -- 32.479477
Chain 4 -- -1565.259776 -- 32.479477
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1641.845] (-1673.960) (-1676.827) (-1661.344) * [-1633.001] (-1669.390) (-1656.025) (-1565.260)
1000 -- (-1357.175) [-1349.620] (-1357.409) (-1368.538) * (-1356.103) (-1379.227) (-1366.666) [-1359.276] -- 0:00:00
2000 -- (-1336.684) (-1343.977) [-1341.579] (-1348.712) * (-1353.556) (-1351.734) [-1346.867] (-1346.277) -- 0:00:00
3000 -- (-1340.225) [-1338.780] (-1349.505) (-1342.317) * (-1339.791) [-1342.316] (-1349.117) (-1341.387) -- 0:05:32
4000 -- (-1341.676) (-1344.011) (-1342.923) [-1339.012] * (-1343.033) [-1337.653] (-1346.815) (-1341.361) -- 0:04:09
5000 -- (-1344.262) [-1341.306] (-1353.278) (-1339.537) * [-1339.004] (-1339.234) (-1338.775) (-1341.690) -- 0:03:19
Average standard deviation of split frequencies: 0.036262
6000 -- [-1338.226] (-1340.084) (-1341.923) (-1339.097) * (-1346.653) (-1347.038) (-1353.023) [-1334.154] -- 0:02:45
7000 -- (-1343.974) [-1342.899] (-1343.719) (-1339.196) * (-1332.559) [-1337.849] (-1343.240) (-1344.225) -- 0:04:43
8000 -- (-1338.520) (-1345.458) [-1346.040] (-1335.093) * [-1333.311] (-1345.319) (-1335.514) (-1344.384) -- 0:04:08
9000 -- [-1333.794] (-1337.528) (-1346.961) (-1341.704) * (-1341.264) [-1339.756] (-1347.501) (-1343.267) -- 0:03:40
10000 -- [-1331.669] (-1339.084) (-1341.537) (-1349.419) * [-1337.659] (-1343.492) (-1337.662) (-1353.658) -- 0:03:18
Average standard deviation of split frequencies: 0.044194
11000 -- (-1344.147) (-1342.918) [-1345.424] (-1332.749) * (-1349.961) (-1333.537) [-1338.285] (-1351.966) -- 0:02:59
12000 -- (-1341.358) (-1333.754) (-1341.928) [-1333.915] * (-1350.188) (-1335.154) (-1345.963) [-1339.990] -- 0:04:07
13000 -- (-1342.828) (-1348.701) [-1333.221] (-1337.959) * (-1338.243) (-1346.191) (-1339.403) [-1352.387] -- 0:03:47
14000 -- (-1335.237) (-1343.519) (-1341.296) [-1334.942] * (-1337.662) [-1335.598] (-1339.871) (-1344.660) -- 0:03:31
15000 -- (-1339.206) (-1346.002) (-1348.132) [-1331.777] * (-1346.114) (-1340.266) (-1343.830) [-1338.723] -- 0:03:17
Average standard deviation of split frequencies: 0.082075
16000 -- [-1335.797] (-1333.901) (-1340.131) (-1339.714) * (-1336.437) [-1335.160] (-1346.352) (-1344.668) -- 0:04:06
17000 -- (-1338.262) (-1343.863) [-1341.830] (-1345.761) * (-1334.961) (-1335.654) (-1343.673) [-1339.056] -- 0:03:51
18000 -- (-1332.794) [-1336.331] (-1345.863) (-1345.672) * [-1329.953] (-1335.201) (-1340.871) (-1338.700) -- 0:03:38
19000 -- (-1341.286) (-1345.045) [-1344.690] (-1341.879) * [-1334.209] (-1338.707) (-1352.162) (-1348.191) -- 0:03:26
20000 -- (-1335.842) (-1341.358) [-1341.130] (-1337.670) * [-1337.608] (-1334.788) (-1342.066) (-1346.095) -- 0:04:05
Average standard deviation of split frequencies: 0.051702
21000 -- [-1333.870] (-1353.132) (-1347.337) (-1338.404) * [-1331.931] (-1332.324) (-1341.760) (-1340.120) -- 0:03:53
22000 -- (-1343.223) (-1338.428) [-1341.441] (-1340.702) * (-1333.168) [-1340.433] (-1339.122) (-1344.048) -- 0:03:42
23000 -- (-1339.183) (-1339.364) [-1338.925] (-1347.253) * [-1340.748] (-1337.592) (-1335.400) (-1340.583) -- 0:03:32
24000 -- (-1341.545) [-1334.324] (-1336.471) (-1336.820) * (-1338.397) (-1332.063) (-1336.312) [-1340.577] -- 0:04:04
25000 -- (-1331.594) [-1334.707] (-1342.861) (-1351.989) * (-1339.927) (-1339.553) [-1335.360] (-1349.597) -- 0:03:54
Average standard deviation of split frequencies: 0.051975
26000 -- (-1341.569) (-1351.559) [-1336.122] (-1352.922) * [-1338.321] (-1348.762) (-1336.698) (-1346.316) -- 0:03:44
27000 -- (-1346.467) (-1338.616) [-1336.628] (-1347.998) * [-1328.510] (-1338.790) (-1338.278) (-1343.874) -- 0:03:36
28000 -- [-1344.068] (-1340.640) (-1341.744) (-1349.400) * (-1338.463) (-1343.278) [-1338.407] (-1339.323) -- 0:04:03
29000 -- [-1343.985] (-1339.087) (-1337.763) (-1338.369) * (-1336.283) [-1332.141] (-1337.466) (-1338.864) -- 0:03:54
30000 -- (-1336.631) [-1337.259] (-1346.027) (-1349.647) * (-1339.259) (-1337.920) (-1340.640) [-1336.856] -- 0:03:46
Average standard deviation of split frequencies: 0.040992
31000 -- [-1338.552] (-1347.350) (-1341.409) (-1336.147) * [-1336.033] (-1337.082) (-1341.509) (-1339.554) -- 0:03:38
32000 -- (-1348.214) [-1342.139] (-1339.914) (-1341.000) * [-1335.996] (-1336.876) (-1353.266) (-1342.555) -- 0:04:02
33000 -- (-1342.177) (-1344.199) [-1336.426] (-1343.425) * (-1336.921) (-1340.047) (-1343.063) [-1334.680] -- 0:03:54
34000 -- (-1336.955) (-1345.702) (-1343.083) [-1346.676] * (-1343.598) (-1336.678) [-1333.943] (-1334.824) -- 0:03:47
35000 -- [-1333.458] (-1343.935) (-1344.779) (-1334.013) * (-1339.505) (-1341.917) [-1332.770] (-1337.043) -- 0:03:40
Average standard deviation of split frequencies: 0.032300
36000 -- (-1336.477) (-1339.446) (-1343.818) [-1332.198] * (-1341.179) (-1341.287) (-1337.047) [-1338.949] -- 0:04:01
37000 -- (-1341.763) (-1343.905) (-1333.251) [-1332.942] * (-1339.447) (-1332.627) (-1343.749) [-1340.935] -- 0:03:54
38000 -- (-1344.647) [-1329.251] (-1335.134) (-1345.629) * (-1338.008) (-1338.356) (-1348.573) [-1337.326] -- 0:03:47
39000 -- (-1347.367) [-1335.220] (-1343.857) (-1337.391) * [-1340.591] (-1334.254) (-1340.579) (-1330.670) -- 0:03:41
40000 -- (-1341.569) (-1335.513) (-1341.386) [-1333.116] * (-1335.950) [-1342.557] (-1328.393) (-1344.456) -- 0:04:00
Average standard deviation of split frequencies: 0.043056
41000 -- [-1337.660] (-1330.217) (-1335.982) (-1344.539) * (-1339.072) [-1335.619] (-1338.736) (-1348.515) -- 0:03:53
42000 -- (-1349.753) (-1349.154) (-1345.711) [-1335.972] * (-1339.726) [-1341.557] (-1337.923) (-1339.996) -- 0:03:48
43000 -- (-1340.050) [-1332.740] (-1341.314) (-1339.182) * (-1349.875) (-1340.627) (-1345.904) [-1333.176] -- 0:03:42
44000 -- [-1342.869] (-1336.920) (-1337.748) (-1335.888) * [-1332.594] (-1341.227) (-1336.494) (-1340.124) -- 0:03:59
45000 -- (-1336.167) (-1339.068) (-1334.675) [-1335.999] * [-1336.528] (-1346.720) (-1334.457) (-1344.521) -- 0:03:53
Average standard deviation of split frequencies: 0.039625
46000 -- (-1337.020) [-1335.234] (-1336.351) (-1337.502) * (-1336.429) (-1341.034) [-1338.737] (-1330.934) -- 0:03:48
47000 -- (-1333.236) [-1338.436] (-1338.663) (-1347.097) * (-1341.344) (-1344.198) (-1336.002) [-1332.145] -- 0:03:43
48000 -- [-1334.871] (-1338.886) (-1339.950) (-1339.411) * (-1335.545) (-1339.098) [-1337.528] (-1336.883) -- 0:03:58
49000 -- (-1335.341) (-1340.892) [-1344.950] (-1335.552) * (-1337.818) (-1349.852) (-1340.789) [-1340.443] -- 0:03:52
50000 -- (-1337.180) [-1341.134] (-1343.651) (-1335.273) * [-1342.411] (-1343.470) (-1340.641) (-1345.591) -- 0:03:48
Average standard deviation of split frequencies: 0.037881
51000 -- [-1338.686] (-1343.530) (-1339.941) (-1336.858) * [-1333.169] (-1340.602) (-1337.495) (-1340.690) -- 0:03:43
52000 -- (-1345.939) (-1333.342) [-1333.690] (-1351.340) * (-1335.925) (-1338.205) (-1338.920) [-1331.527] -- 0:03:57
53000 -- (-1337.503) [-1335.441] (-1343.320) (-1338.196) * (-1335.225) (-1348.754) (-1340.070) [-1334.600] -- 0:03:52
54000 -- (-1350.675) (-1335.746) (-1335.237) [-1335.661] * (-1333.786) (-1338.632) (-1341.462) [-1331.218] -- 0:03:47
55000 -- (-1343.160) (-1348.769) (-1338.669) [-1337.608] * [-1340.796] (-1338.422) (-1340.179) (-1347.584) -- 0:03:43
Average standard deviation of split frequencies: 0.036077
56000 -- (-1338.543) (-1347.341) (-1340.557) [-1340.508] * [-1335.136] (-1336.475) (-1348.832) (-1333.874) -- 0:03:56
57000 -- (-1334.935) [-1342.081] (-1342.419) (-1339.040) * (-1344.486) [-1340.039] (-1338.353) (-1337.214) -- 0:03:51
58000 -- (-1337.143) (-1339.339) (-1340.213) [-1335.249] * (-1352.556) (-1339.836) (-1339.420) [-1337.175] -- 0:03:47
59000 -- [-1336.598] (-1337.637) (-1341.223) (-1340.542) * (-1343.671) (-1331.953) (-1344.004) [-1334.708] -- 0:03:43
60000 -- [-1347.054] (-1335.986) (-1336.543) (-1347.712) * (-1340.130) (-1340.570) [-1332.646] (-1336.692) -- 0:03:55
Average standard deviation of split frequencies: 0.033857
61000 -- (-1341.911) (-1338.478) (-1343.146) [-1341.096] * (-1338.722) [-1339.878] (-1337.077) (-1342.205) -- 0:03:50
62000 -- (-1338.505) (-1338.428) [-1331.852] (-1337.062) * (-1334.149) (-1338.034) [-1332.795] (-1345.359) -- 0:03:46
63000 -- (-1338.674) (-1339.307) (-1336.347) [-1339.889] * [-1335.028] (-1346.571) (-1335.677) (-1344.972) -- 0:03:43
64000 -- (-1340.509) (-1338.377) (-1340.402) [-1334.662] * (-1336.027) (-1336.942) (-1342.375) [-1340.943] -- 0:03:54
65000 -- [-1336.849] (-1336.268) (-1341.329) (-1340.950) * [-1335.990] (-1343.119) (-1348.224) (-1341.996) -- 0:03:50
Average standard deviation of split frequencies: 0.031121
66000 -- (-1340.302) (-1339.030) [-1333.564] (-1332.196) * (-1339.021) [-1342.176] (-1340.017) (-1348.173) -- 0:03:46
67000 -- [-1335.585] (-1334.640) (-1336.161) (-1335.076) * (-1349.917) [-1341.937] (-1341.999) (-1341.594) -- 0:03:42
68000 -- (-1337.801) (-1357.485) (-1339.036) [-1336.484] * (-1341.365) (-1336.025) [-1349.839] (-1342.569) -- 0:03:53
69000 -- (-1344.721) [-1336.933] (-1347.550) (-1334.698) * [-1331.624] (-1333.970) (-1349.149) (-1337.582) -- 0:03:49
70000 -- (-1338.090) (-1336.321) (-1340.637) [-1334.375] * (-1334.956) [-1339.939] (-1347.726) (-1336.985) -- 0:03:45
Average standard deviation of split frequencies: 0.031448
71000 -- (-1343.335) (-1347.860) (-1342.481) [-1340.685] * [-1337.302] (-1340.788) (-1333.913) (-1331.488) -- 0:03:42
72000 -- [-1329.182] (-1334.403) (-1342.371) (-1343.275) * (-1334.766) (-1334.546) [-1337.190] (-1339.889) -- 0:03:52
73000 -- (-1340.312) [-1334.888] (-1337.551) (-1337.682) * [-1338.699] (-1341.262) (-1336.693) (-1333.173) -- 0:03:48
74000 -- (-1341.335) (-1335.474) (-1337.151) [-1335.824] * (-1345.112) (-1349.515) [-1343.280] (-1341.921) -- 0:03:45
75000 -- (-1342.179) (-1339.243) [-1336.171] (-1342.650) * [-1339.779] (-1333.477) (-1340.812) (-1341.869) -- 0:03:54
Average standard deviation of split frequencies: 0.032786
76000 -- (-1341.538) [-1338.634] (-1341.321) (-1338.083) * (-1350.827) (-1338.038) [-1330.808] (-1344.229) -- 0:03:51
77000 -- (-1340.850) (-1337.529) (-1339.713) [-1346.233] * (-1338.140) (-1340.271) (-1339.349) [-1333.317] -- 0:03:47
78000 -- [-1339.010] (-1340.482) (-1339.113) (-1344.031) * (-1343.851) [-1333.883] (-1339.535) (-1340.019) -- 0:03:56
79000 -- (-1337.365) (-1342.499) [-1335.276] (-1341.630) * (-1352.693) (-1335.946) (-1338.564) [-1332.901] -- 0:03:53
80000 -- (-1342.764) [-1333.302] (-1338.906) (-1341.760) * (-1339.942) [-1332.998] (-1343.670) (-1338.270) -- 0:03:50
Average standard deviation of split frequencies: 0.028802
81000 -- (-1338.264) (-1339.849) (-1335.979) [-1334.283] * [-1331.047] (-1343.773) (-1330.980) (-1343.542) -- 0:03:46
82000 -- [-1335.736] (-1340.675) (-1341.795) (-1340.394) * (-1339.839) (-1340.191) [-1337.902] (-1340.010) -- 0:03:55
83000 -- (-1336.887) (-1336.561) [-1339.958] (-1338.676) * (-1343.314) (-1338.481) [-1338.950] (-1333.545) -- 0:03:52
84000 -- (-1336.203) [-1336.482] (-1340.069) (-1337.881) * [-1335.188] (-1336.967) (-1343.281) (-1339.592) -- 0:03:49
85000 -- (-1338.121) (-1337.241) (-1348.079) [-1343.193] * (-1343.519) (-1333.171) [-1338.814] (-1347.338) -- 0:03:46
Average standard deviation of split frequencies: 0.031714
86000 -- (-1337.466) (-1338.553) [-1346.116] (-1337.555) * (-1334.573) (-1339.543) [-1334.379] (-1348.493) -- 0:03:53
87000 -- (-1341.433) (-1342.552) [-1330.599] (-1334.496) * (-1341.274) (-1337.602) [-1336.321] (-1336.614) -- 0:03:50
88000 -- [-1335.289] (-1340.289) (-1335.899) (-1335.597) * (-1337.039) (-1340.238) [-1336.843] (-1339.348) -- 0:03:48
89000 -- [-1339.028] (-1330.518) (-1344.591) (-1342.552) * (-1340.137) (-1346.049) (-1337.517) [-1342.242] -- 0:03:45
90000 -- (-1340.868) (-1337.876) (-1337.626) [-1339.805] * (-1350.322) (-1349.960) (-1339.153) [-1333.718] -- 0:03:52
Average standard deviation of split frequencies: 0.031196
91000 -- [-1338.667] (-1341.671) (-1340.312) (-1335.160) * (-1336.433) (-1341.063) (-1334.504) [-1333.830] -- 0:03:49
92000 -- [-1341.289] (-1342.430) (-1343.484) (-1339.776) * [-1338.888] (-1339.346) (-1346.107) (-1344.327) -- 0:03:47
93000 -- (-1340.594) (-1350.177) [-1340.868] (-1342.279) * [-1340.963] (-1338.267) (-1341.320) (-1342.453) -- 0:03:44
94000 -- (-1336.849) (-1332.328) [-1341.505] (-1352.189) * (-1331.782) (-1333.373) [-1339.017] (-1332.668) -- 0:03:51
95000 -- (-1344.412) (-1340.544) [-1328.982] (-1341.719) * (-1334.593) (-1336.072) (-1341.203) [-1335.872] -- 0:03:48
Average standard deviation of split frequencies: 0.030866
96000 -- (-1342.649) [-1330.382] (-1338.297) (-1334.666) * (-1344.457) (-1346.968) (-1331.809) [-1341.207] -- 0:03:46
97000 -- (-1334.874) (-1344.113) [-1331.757] (-1333.170) * (-1342.770) (-1335.178) [-1336.610] (-1337.591) -- 0:03:43
98000 -- (-1347.614) (-1337.300) [-1333.059] (-1342.734) * (-1344.278) (-1335.997) [-1340.135] (-1338.118) -- 0:03:50
99000 -- [-1333.167] (-1337.501) (-1335.307) (-1344.037) * (-1340.191) (-1336.967) [-1342.303] (-1341.544) -- 0:03:47
100000 -- [-1334.808] (-1337.686) (-1334.921) (-1332.918) * (-1335.662) [-1334.507] (-1329.199) (-1351.101) -- 0:03:45
Average standard deviation of split frequencies: 0.040344
101000 -- (-1341.110) [-1342.809] (-1343.480) (-1331.550) * (-1339.576) (-1349.873) [-1331.055] (-1349.855) -- 0:03:42
102000 -- (-1355.579) [-1336.711] (-1333.369) (-1339.834) * (-1340.298) (-1336.484) [-1337.548] (-1337.871) -- 0:03:40
103000 -- (-1343.525) (-1336.571) [-1340.047] (-1340.582) * (-1334.915) (-1337.305) (-1343.283) [-1337.095] -- 0:03:46
104000 -- [-1339.233] (-1343.223) (-1345.220) (-1340.380) * (-1341.308) (-1334.443) [-1344.594] (-1343.779) -- 0:03:44
105000 -- (-1344.819) [-1340.275] (-1346.512) (-1341.105) * (-1338.616) (-1335.117) [-1331.660] (-1336.872) -- 0:03:41
Average standard deviation of split frequencies: 0.035578
106000 -- (-1344.818) (-1335.262) (-1337.881) [-1337.991] * [-1333.569] (-1336.618) (-1338.013) (-1341.007) -- 0:03:39
107000 -- (-1343.488) [-1334.793] (-1334.642) (-1331.171) * (-1331.745) (-1334.092) (-1338.072) [-1337.867] -- 0:03:45
108000 -- (-1335.874) [-1335.519] (-1341.970) (-1335.003) * (-1346.198) (-1337.281) (-1338.482) [-1336.605] -- 0:03:43
109000 -- [-1339.409] (-1342.043) (-1342.367) (-1338.152) * (-1338.180) (-1341.222) (-1336.740) [-1339.015] -- 0:03:40
110000 -- (-1344.018) (-1345.579) [-1338.680] (-1345.280) * (-1338.336) [-1342.233] (-1332.095) (-1342.125) -- 0:03:38
Average standard deviation of split frequencies: 0.038992
111000 -- (-1337.947) (-1344.858) [-1343.395] (-1343.759) * (-1336.025) [-1344.690] (-1350.273) (-1335.424) -- 0:03:44
112000 -- (-1337.302) (-1338.135) [-1335.064] (-1343.435) * (-1337.633) (-1342.444) [-1335.972] (-1336.153) -- 0:03:42
113000 -- (-1332.959) (-1343.944) [-1331.770] (-1335.651) * (-1331.824) (-1335.059) (-1349.870) [-1339.231] -- 0:03:39
114000 -- [-1335.145] (-1344.911) (-1338.988) (-1336.765) * [-1339.095] (-1341.904) (-1338.325) (-1336.599) -- 0:03:37
115000 -- (-1341.802) [-1338.915] (-1339.169) (-1342.733) * (-1337.168) [-1339.652] (-1343.230) (-1342.394) -- 0:03:43
Average standard deviation of split frequencies: 0.037825
116000 -- (-1333.981) (-1343.409) (-1335.922) [-1336.486] * [-1335.851] (-1332.025) (-1335.434) (-1341.958) -- 0:03:41
117000 -- (-1335.876) (-1346.161) (-1336.879) [-1334.752] * (-1338.144) (-1337.860) [-1337.595] (-1335.011) -- 0:03:38
118000 -- (-1339.497) (-1336.082) [-1336.526] (-1340.653) * [-1334.633] (-1340.302) (-1345.710) (-1335.487) -- 0:03:36
119000 -- [-1332.553] (-1334.671) (-1333.622) (-1338.264) * (-1334.645) (-1341.863) (-1339.886) [-1333.899] -- 0:03:42
120000 -- (-1339.812) (-1335.855) (-1333.818) [-1345.007] * [-1335.388] (-1337.208) (-1343.121) (-1334.461) -- 0:03:40
Average standard deviation of split frequencies: 0.034258
121000 -- (-1337.429) (-1340.406) [-1341.821] (-1336.766) * (-1339.935) (-1335.803) (-1336.970) [-1332.685] -- 0:03:37
122000 -- [-1340.187] (-1332.410) (-1338.293) (-1331.884) * (-1341.346) (-1339.420) (-1336.678) [-1336.314] -- 0:03:35
123000 -- (-1338.017) (-1339.633) [-1337.448] (-1347.105) * [-1335.267] (-1337.092) (-1352.313) (-1342.369) -- 0:03:41
124000 -- (-1341.404) (-1347.073) [-1339.522] (-1336.107) * [-1331.730] (-1333.463) (-1350.075) (-1341.577) -- 0:03:39
125000 -- [-1338.047] (-1342.871) (-1354.601) (-1333.899) * (-1335.338) (-1340.878) [-1342.519] (-1351.432) -- 0:03:37
Average standard deviation of split frequencies: 0.031369
126000 -- (-1350.356) [-1335.286] (-1339.086) (-1334.222) * (-1349.600) (-1340.827) (-1333.175) [-1334.391] -- 0:03:35
127000 -- (-1341.806) [-1342.353] (-1336.053) (-1355.929) * [-1338.460] (-1339.377) (-1332.032) (-1339.041) -- 0:03:39
128000 -- [-1334.175] (-1334.208) (-1341.882) (-1341.554) * [-1335.423] (-1346.224) (-1332.940) (-1348.247) -- 0:03:38
129000 -- [-1334.302] (-1338.683) (-1340.321) (-1335.137) * (-1337.384) [-1342.563] (-1339.093) (-1334.219) -- 0:03:36
130000 -- (-1339.528) [-1341.212] (-1331.298) (-1338.057) * [-1338.832] (-1341.650) (-1331.093) (-1346.632) -- 0:03:34
Average standard deviation of split frequencies: 0.023311
131000 -- (-1340.752) (-1338.029) (-1338.420) [-1340.189] * [-1336.088] (-1335.883) (-1340.646) (-1338.401) -- 0:03:38
132000 -- (-1335.751) [-1334.840] (-1341.347) (-1338.589) * [-1335.839] (-1343.167) (-1338.930) (-1346.018) -- 0:03:37
133000 -- (-1342.871) (-1351.322) [-1337.121] (-1341.971) * (-1345.870) (-1349.285) [-1336.246] (-1345.937) -- 0:03:35
134000 -- [-1334.685] (-1344.851) (-1334.367) (-1345.460) * [-1332.833] (-1346.325) (-1341.265) (-1342.015) -- 0:03:33
135000 -- (-1341.314) [-1341.117] (-1335.496) (-1335.729) * (-1336.591) (-1354.883) [-1339.957] (-1354.567) -- 0:03:37
Average standard deviation of split frequencies: 0.021331
136000 -- (-1335.847) (-1350.849) (-1337.419) [-1339.983] * [-1343.858] (-1349.556) (-1340.250) (-1345.362) -- 0:03:36
137000 -- [-1337.773] (-1339.085) (-1344.248) (-1335.384) * (-1334.110) (-1337.156) [-1333.368] (-1340.596) -- 0:03:34
138000 -- [-1339.463] (-1340.485) (-1331.726) (-1335.962) * (-1336.973) (-1336.897) (-1338.354) [-1333.231] -- 0:03:32
139000 -- (-1337.719) (-1335.354) [-1337.835] (-1345.660) * (-1342.609) [-1334.833] (-1335.971) (-1341.849) -- 0:03:36
140000 -- (-1340.385) (-1341.398) [-1337.952] (-1339.397) * (-1334.048) (-1334.882) (-1346.613) [-1342.590] -- 0:03:35
Average standard deviation of split frequencies: 0.019076
141000 -- (-1343.773) (-1340.186) (-1340.329) [-1342.382] * (-1338.072) (-1340.586) [-1343.879] (-1343.490) -- 0:03:33
142000 -- (-1340.554) (-1331.181) [-1337.267] (-1342.046) * (-1331.585) (-1338.781) [-1327.906] (-1344.444) -- 0:03:31
143000 -- (-1338.756) [-1342.880] (-1335.229) (-1342.877) * (-1345.310) (-1334.906) (-1340.627) [-1336.021] -- 0:03:35
144000 -- (-1338.099) [-1339.753] (-1336.475) (-1337.478) * (-1345.979) [-1338.102] (-1342.177) (-1344.901) -- 0:03:34
145000 -- (-1339.367) (-1344.897) [-1337.384] (-1339.688) * (-1345.275) [-1332.616] (-1339.641) (-1338.111) -- 0:03:32
Average standard deviation of split frequencies: 0.020366
146000 -- (-1342.291) (-1335.745) (-1342.946) [-1332.246] * [-1331.844] (-1336.932) (-1339.879) (-1340.653) -- 0:03:30
147000 -- (-1336.499) (-1349.470) [-1339.774] (-1334.340) * (-1344.884) [-1334.581] (-1340.654) (-1349.853) -- 0:03:34
148000 -- (-1334.398) (-1352.708) (-1338.591) [-1332.909] * [-1330.035] (-1338.130) (-1336.053) (-1339.830) -- 0:03:33
149000 -- (-1340.382) (-1337.495) (-1341.462) [-1341.908] * (-1335.499) [-1337.633] (-1341.024) (-1333.300) -- 0:03:31
150000 -- (-1336.122) (-1335.087) (-1348.944) [-1346.539] * (-1336.777) [-1340.489] (-1347.025) (-1347.562) -- 0:03:29
Average standard deviation of split frequencies: 0.016847
151000 -- (-1340.851) (-1334.743) [-1338.922] (-1347.101) * (-1334.647) (-1337.470) [-1332.074] (-1340.388) -- 0:03:33
152000 -- (-1343.532) (-1336.255) [-1344.358] (-1343.612) * (-1329.130) [-1335.391] (-1337.053) (-1335.345) -- 0:03:32
153000 -- (-1345.692) [-1338.644] (-1339.854) (-1339.294) * (-1341.569) (-1340.207) [-1336.012] (-1343.672) -- 0:03:30
154000 -- (-1347.094) [-1334.357] (-1346.959) (-1340.873) * (-1341.081) [-1343.642] (-1341.611) (-1342.775) -- 0:03:28
155000 -- (-1334.935) [-1333.746] (-1348.163) (-1331.692) * [-1334.206] (-1338.082) (-1338.041) (-1340.629) -- 0:03:32
Average standard deviation of split frequencies: 0.014644
156000 -- (-1343.991) (-1338.441) [-1343.789] (-1335.526) * (-1338.510) (-1340.206) [-1340.639] (-1340.684) -- 0:03:31
157000 -- (-1343.259) (-1344.484) (-1341.257) [-1335.719] * (-1341.849) [-1336.815] (-1342.408) (-1339.724) -- 0:03:29
158000 -- (-1338.686) [-1339.223] (-1339.316) (-1337.136) * (-1340.489) (-1336.529) [-1342.264] (-1339.033) -- 0:03:27
159000 -- [-1333.317] (-1333.952) (-1337.086) (-1342.392) * (-1344.969) (-1342.267) (-1333.942) [-1331.065] -- 0:03:31
160000 -- [-1335.075] (-1333.188) (-1338.586) (-1335.795) * (-1344.034) (-1337.585) (-1340.166) [-1333.249] -- 0:03:30
Average standard deviation of split frequencies: 0.016137
161000 -- [-1336.735] (-1338.240) (-1333.800) (-1338.523) * (-1345.536) (-1343.979) (-1331.049) [-1334.747] -- 0:03:28
162000 -- (-1335.983) [-1346.001] (-1331.595) (-1343.848) * (-1339.091) (-1351.802) [-1338.043] (-1338.878) -- 0:03:26
163000 -- (-1338.979) (-1339.106) [-1336.916] (-1339.399) * [-1336.625] (-1346.107) (-1340.706) (-1350.696) -- 0:03:30
164000 -- (-1349.635) (-1338.080) [-1334.619] (-1336.446) * [-1332.774] (-1338.150) (-1344.031) (-1332.385) -- 0:03:29
165000 -- (-1338.279) (-1338.360) [-1338.160] (-1334.072) * (-1338.427) [-1342.186] (-1341.045) (-1337.590) -- 0:03:27
Average standard deviation of split frequencies: 0.014199
166000 -- [-1332.012] (-1338.270) (-1340.661) (-1340.302) * [-1336.638] (-1336.932) (-1340.165) (-1333.136) -- 0:03:25
167000 -- (-1331.804) (-1355.129) (-1334.431) [-1337.196] * [-1332.910] (-1348.369) (-1337.976) (-1340.726) -- 0:03:29
168000 -- [-1337.465] (-1335.671) (-1341.139) (-1339.199) * (-1336.071) [-1333.155] (-1345.390) (-1335.965) -- 0:03:28
169000 -- [-1338.015] (-1333.446) (-1341.054) (-1332.887) * (-1347.411) [-1331.043] (-1338.566) (-1336.974) -- 0:03:26
170000 -- (-1346.028) [-1329.274] (-1348.381) (-1333.954) * (-1346.730) [-1337.514] (-1345.229) (-1337.609) -- 0:03:25
Average standard deviation of split frequencies: 0.014023
171000 -- (-1336.870) (-1334.781) [-1339.258] (-1337.835) * (-1347.067) (-1333.318) (-1335.968) [-1340.785] -- 0:03:28
172000 -- (-1337.351) (-1338.902) [-1341.995] (-1342.121) * (-1341.127) [-1336.157] (-1345.653) (-1345.579) -- 0:03:27
173000 -- [-1335.693] (-1341.418) (-1335.145) (-1347.814) * (-1332.009) (-1338.976) (-1343.309) [-1337.340] -- 0:03:25
174000 -- [-1339.380] (-1336.936) (-1339.070) (-1340.388) * (-1335.143) [-1334.302] (-1330.684) (-1334.595) -- 0:03:24
175000 -- [-1336.592] (-1333.437) (-1345.149) (-1340.669) * [-1346.660] (-1334.095) (-1338.314) (-1333.330) -- 0:03:27
Average standard deviation of split frequencies: 0.013598
176000 -- (-1338.056) (-1340.928) [-1342.971] (-1347.439) * [-1342.026] (-1337.311) (-1339.320) (-1341.954) -- 0:03:26
177000 -- (-1349.143) [-1334.196] (-1340.242) (-1341.833) * (-1347.032) (-1337.755) (-1334.989) [-1342.180] -- 0:03:24
178000 -- (-1353.919) [-1335.463] (-1343.329) (-1341.948) * (-1346.533) (-1338.640) (-1342.026) [-1340.018] -- 0:03:23
179000 -- (-1342.704) (-1337.008) (-1352.266) [-1343.454] * [-1336.483] (-1340.645) (-1333.691) (-1338.832) -- 0:03:26
180000 -- (-1339.165) [-1340.655] (-1334.503) (-1337.350) * (-1336.789) [-1337.077] (-1342.602) (-1334.128) -- 0:03:25
Average standard deviation of split frequencies: 0.013849
181000 -- (-1334.106) (-1338.704) [-1335.792] (-1335.860) * (-1335.630) (-1329.772) (-1342.306) [-1336.245] -- 0:03:23
182000 -- (-1348.503) (-1335.556) [-1343.180] (-1335.973) * (-1345.063) (-1338.568) (-1331.926) [-1334.446] -- 0:03:22
183000 -- (-1342.771) (-1334.136) [-1341.408] (-1349.053) * (-1343.508) (-1343.403) (-1338.275) [-1339.907] -- 0:03:25
184000 -- (-1355.147) (-1343.357) [-1333.642] (-1335.153) * (-1339.887) (-1333.177) (-1336.846) [-1338.222] -- 0:03:24
185000 -- (-1338.732) (-1343.108) (-1336.806) [-1336.829] * [-1344.806] (-1346.723) (-1333.596) (-1340.353) -- 0:03:22
Average standard deviation of split frequencies: 0.015791
186000 -- [-1334.672] (-1337.459) (-1345.422) (-1339.811) * [-1331.480] (-1339.573) (-1346.753) (-1336.663) -- 0:03:21
187000 -- (-1338.889) (-1335.528) (-1346.768) [-1329.230] * (-1342.607) [-1336.271] (-1347.779) (-1337.636) -- 0:03:24
188000 -- (-1335.706) [-1339.257] (-1338.184) (-1342.937) * (-1340.355) [-1338.266] (-1340.934) (-1331.474) -- 0:03:23
189000 -- (-1338.902) (-1346.243) (-1342.547) [-1339.108] * (-1332.915) (-1342.017) (-1344.410) [-1338.025] -- 0:03:21
190000 -- (-1345.158) (-1343.742) [-1340.550] (-1341.314) * (-1340.432) (-1339.326) [-1337.258] (-1333.050) -- 0:03:20
Average standard deviation of split frequencies: 0.016736
191000 -- [-1333.643] (-1339.046) (-1349.435) (-1339.152) * (-1338.802) [-1344.634] (-1340.953) (-1347.712) -- 0:03:23
192000 -- (-1332.598) [-1339.362] (-1335.833) (-1345.775) * (-1333.628) (-1333.469) [-1334.948] (-1337.257) -- 0:03:22
193000 -- (-1342.180) (-1337.017) [-1345.254] (-1342.633) * (-1346.504) [-1332.462] (-1330.269) (-1334.871) -- 0:03:20
194000 -- (-1334.625) [-1332.151] (-1340.954) (-1340.813) * [-1335.668] (-1333.541) (-1337.431) (-1342.545) -- 0:03:19
195000 -- (-1338.004) [-1343.068] (-1345.809) (-1343.179) * (-1339.725) (-1342.828) (-1336.782) [-1336.478] -- 0:03:22
Average standard deviation of split frequencies: 0.016096
196000 -- (-1333.072) [-1334.029] (-1344.553) (-1337.902) * (-1331.686) (-1338.358) [-1334.317] (-1335.116) -- 0:03:21
197000 -- (-1348.423) (-1338.513) [-1342.034] (-1338.137) * [-1341.670] (-1337.003) (-1336.866) (-1339.416) -- 0:03:19
198000 -- (-1340.249) (-1336.974) [-1341.285] (-1346.411) * (-1332.631) (-1340.947) (-1342.049) [-1336.243] -- 0:03:18
199000 -- (-1342.224) (-1341.641) [-1339.511] (-1342.327) * (-1346.265) (-1340.901) [-1333.955] (-1343.982) -- 0:03:21
200000 -- (-1341.187) [-1340.430] (-1343.132) (-1345.207) * (-1341.596) (-1347.492) (-1339.554) [-1336.406] -- 0:03:20
Average standard deviation of split frequencies: 0.018251
201000 -- (-1340.240) (-1340.202) (-1334.115) [-1335.125] * (-1341.773) [-1341.219] (-1336.720) (-1342.710) -- 0:03:18
202000 -- (-1349.196) (-1335.086) (-1335.226) [-1334.807] * (-1341.569) (-1340.688) [-1334.574] (-1344.760) -- 0:03:17
203000 -- (-1339.295) [-1334.302] (-1346.220) (-1337.933) * (-1343.751) [-1340.351] (-1338.811) (-1343.367) -- 0:03:20
204000 -- [-1336.308] (-1335.788) (-1351.222) (-1350.365) * (-1341.235) (-1340.847) [-1335.834] (-1336.366) -- 0:03:19
205000 -- (-1336.603) [-1334.387] (-1337.498) (-1342.605) * [-1349.500] (-1340.314) (-1336.137) (-1346.524) -- 0:03:17
Average standard deviation of split frequencies: 0.016899
206000 -- (-1338.074) (-1347.924) [-1336.618] (-1340.596) * (-1337.983) [-1345.411] (-1334.250) (-1334.608) -- 0:03:16
207000 -- (-1344.394) (-1347.812) [-1332.764] (-1334.864) * (-1346.918) (-1344.210) [-1346.692] (-1336.562) -- 0:03:19
208000 -- (-1341.509) [-1340.592] (-1336.699) (-1352.177) * (-1333.443) [-1337.317] (-1337.091) (-1343.766) -- 0:03:18
209000 -- (-1341.313) [-1342.776] (-1336.937) (-1333.903) * (-1345.412) [-1335.112] (-1341.184) (-1343.240) -- 0:03:16
210000 -- (-1355.080) (-1341.134) [-1336.624] (-1343.353) * (-1335.643) [-1330.496] (-1341.024) (-1337.349) -- 0:03:15
Average standard deviation of split frequencies: 0.017385
211000 -- [-1335.332] (-1345.205) (-1348.903) (-1343.556) * (-1343.758) (-1332.992) (-1352.720) [-1344.177] -- 0:03:18
212000 -- (-1342.444) (-1339.811) (-1347.718) [-1336.486] * (-1335.095) (-1349.364) [-1338.901] (-1349.143) -- 0:03:17
213000 -- (-1338.419) (-1342.254) [-1338.235] (-1337.884) * (-1340.201) [-1338.507] (-1347.619) (-1336.184) -- 0:03:15
214000 -- (-1334.748) (-1335.978) (-1337.393) [-1344.939] * (-1331.479) [-1331.132] (-1341.387) (-1340.724) -- 0:03:14
215000 -- (-1336.685) [-1338.309] (-1336.899) (-1338.267) * (-1331.788) (-1333.286) (-1339.004) [-1338.146] -- 0:03:17
Average standard deviation of split frequencies: 0.015613
216000 -- (-1343.089) (-1341.316) [-1341.386] (-1343.769) * (-1344.618) [-1333.050] (-1339.822) (-1340.848) -- 0:03:16
217000 -- (-1339.615) [-1336.804] (-1343.424) (-1334.252) * [-1339.382] (-1342.605) (-1336.549) (-1335.182) -- 0:03:14
218000 -- [-1330.234] (-1335.580) (-1346.185) (-1340.205) * (-1341.269) (-1340.182) (-1334.911) [-1340.345] -- 0:03:13
219000 -- (-1341.816) (-1338.356) (-1339.862) [-1337.959] * (-1340.094) (-1339.396) [-1335.484] (-1337.785) -- 0:03:16
220000 -- (-1342.452) (-1344.317) (-1335.918) [-1331.547] * (-1343.770) (-1339.909) [-1335.239] (-1335.125) -- 0:03:15
Average standard deviation of split frequencies: 0.014954
221000 -- (-1334.826) [-1343.034] (-1353.747) (-1341.949) * (-1341.742) [-1337.858] (-1340.027) (-1337.841) -- 0:03:13
222000 -- (-1337.872) (-1339.064) [-1336.137] (-1338.655) * [-1334.903] (-1343.617) (-1348.939) (-1338.438) -- 0:03:12
223000 -- [-1336.880] (-1336.996) (-1332.725) (-1340.994) * [-1337.138] (-1336.267) (-1341.017) (-1336.958) -- 0:03:15
224000 -- [-1334.652] (-1341.404) (-1339.235) (-1338.213) * (-1348.637) [-1332.196] (-1335.089) (-1341.337) -- 0:03:14
225000 -- [-1342.543] (-1341.542) (-1350.681) (-1337.532) * (-1342.227) (-1334.344) (-1334.290) [-1336.751] -- 0:03:12
Average standard deviation of split frequencies: 0.015644
226000 -- (-1335.286) [-1344.601] (-1341.752) (-1345.855) * (-1332.863) [-1336.000] (-1338.636) (-1342.594) -- 0:03:11
227000 -- [-1337.465] (-1344.844) (-1348.040) (-1338.245) * (-1337.874) (-1334.922) [-1342.029] (-1337.178) -- 0:03:14
228000 -- [-1344.909] (-1359.228) (-1344.616) (-1338.766) * (-1334.435) [-1332.096] (-1344.096) (-1338.749) -- 0:03:13
229000 -- (-1350.166) (-1345.443) [-1337.382] (-1339.437) * (-1342.612) [-1333.132] (-1331.676) (-1340.441) -- 0:03:11
230000 -- (-1346.575) [-1339.003] (-1340.384) (-1344.208) * (-1336.066) (-1341.924) (-1331.657) [-1336.417] -- 0:03:10
Average standard deviation of split frequencies: 0.015720
231000 -- (-1345.267) [-1336.565] (-1344.120) (-1336.518) * (-1345.210) [-1333.476] (-1337.041) (-1334.966) -- 0:03:13
232000 -- (-1345.835) (-1340.872) [-1332.717] (-1336.941) * [-1338.608] (-1338.031) (-1336.421) (-1333.271) -- 0:03:12
233000 -- (-1343.215) [-1338.615] (-1338.753) (-1335.819) * [-1334.274] (-1337.749) (-1334.237) (-1338.603) -- 0:03:10
234000 -- (-1340.748) [-1338.056] (-1352.538) (-1339.947) * (-1337.860) (-1334.461) [-1337.432] (-1336.604) -- 0:03:09
235000 -- (-1338.906) [-1339.534] (-1344.762) (-1337.639) * (-1349.101) (-1336.779) (-1343.191) [-1337.140] -- 0:03:12
Average standard deviation of split frequencies: 0.017363
236000 -- (-1333.753) (-1335.757) [-1340.294] (-1338.264) * (-1337.696) (-1336.379) (-1334.077) [-1329.714] -- 0:03:11
237000 -- (-1343.721) [-1337.718] (-1337.289) (-1344.792) * (-1340.236) (-1342.693) (-1342.806) [-1335.721] -- 0:03:09
238000 -- (-1339.530) (-1347.733) [-1337.298] (-1346.162) * [-1345.137] (-1338.266) (-1341.785) (-1339.605) -- 0:03:08
239000 -- [-1338.374] (-1337.006) (-1339.071) (-1345.669) * (-1344.112) (-1350.428) (-1340.727) [-1338.059] -- 0:03:11
240000 -- (-1338.004) (-1339.680) [-1336.597] (-1333.458) * [-1340.911] (-1342.859) (-1344.533) (-1337.748) -- 0:03:10
Average standard deviation of split frequencies: 0.017069
241000 -- [-1334.683] (-1343.979) (-1339.101) (-1338.434) * (-1338.227) [-1337.240] (-1340.975) (-1340.211) -- 0:03:08
242000 -- [-1338.780] (-1341.297) (-1336.271) (-1355.951) * [-1336.919] (-1348.331) (-1341.490) (-1351.241) -- 0:03:07
243000 -- (-1332.567) (-1339.899) [-1330.533] (-1351.980) * (-1340.210) [-1335.386] (-1338.114) (-1341.659) -- 0:03:10
244000 -- (-1337.617) (-1337.178) [-1339.870] (-1342.271) * (-1336.738) [-1343.609] (-1336.176) (-1343.703) -- 0:03:09
245000 -- [-1336.620] (-1341.103) (-1333.747) (-1342.872) * (-1340.668) [-1341.986] (-1333.877) (-1343.794) -- 0:03:07
Average standard deviation of split frequencies: 0.017931
246000 -- (-1346.649) (-1332.308) [-1340.828] (-1339.875) * [-1331.853] (-1350.644) (-1332.601) (-1343.660) -- 0:03:06
247000 -- (-1338.262) (-1338.201) (-1337.844) [-1338.959] * (-1347.269) (-1346.220) (-1334.840) [-1333.318] -- 0:03:09
248000 -- (-1341.654) [-1337.349] (-1345.825) (-1333.907) * (-1341.091) [-1337.546] (-1345.601) (-1342.653) -- 0:03:08
249000 -- [-1329.746] (-1334.086) (-1346.073) (-1334.777) * (-1348.949) (-1342.072) (-1337.518) [-1342.433] -- 0:03:06
250000 -- [-1338.832] (-1335.620) (-1340.897) (-1346.771) * (-1350.802) (-1342.803) [-1331.741] (-1346.025) -- 0:03:06
Average standard deviation of split frequencies: 0.015179
251000 -- (-1342.260) (-1336.449) (-1342.889) [-1335.408] * (-1342.785) [-1344.897] (-1336.531) (-1335.461) -- 0:03:07
252000 -- [-1333.625] (-1331.005) (-1335.188) (-1330.786) * (-1343.826) (-1356.708) (-1342.136) [-1329.072] -- 0:03:07
253000 -- (-1339.748) [-1337.823] (-1352.390) (-1340.928) * (-1340.203) (-1341.728) [-1336.312] (-1331.924) -- 0:03:06
254000 -- [-1337.264] (-1339.958) (-1341.553) (-1342.242) * [-1331.961] (-1339.348) (-1340.507) (-1338.938) -- 0:03:05
255000 -- (-1339.939) [-1333.068] (-1339.707) (-1347.408) * (-1335.887) (-1335.007) [-1335.441] (-1343.293) -- 0:03:06
Average standard deviation of split frequencies: 0.016441
256000 -- (-1334.187) [-1333.073] (-1337.525) (-1343.348) * (-1339.766) [-1340.534] (-1335.420) (-1348.797) -- 0:03:06
257000 -- (-1342.676) (-1342.665) (-1345.007) [-1329.477] * (-1331.214) [-1340.768] (-1341.955) (-1337.094) -- 0:03:05
258000 -- (-1344.711) (-1344.551) (-1338.551) [-1339.504] * (-1336.307) [-1336.267] (-1345.288) (-1347.702) -- 0:03:04
259000 -- [-1342.601] (-1333.348) (-1342.209) (-1339.274) * (-1338.247) (-1335.742) [-1340.522] (-1343.572) -- 0:03:03
260000 -- (-1333.097) [-1336.757] (-1345.233) (-1340.701) * [-1337.147] (-1343.215) (-1343.266) (-1344.170) -- 0:03:05
Average standard deviation of split frequencies: 0.016018
261000 -- (-1334.700) (-1334.876) [-1344.914] (-1340.996) * (-1338.902) (-1334.902) (-1336.381) [-1342.391] -- 0:03:04
262000 -- [-1336.061] (-1336.609) (-1346.527) (-1335.383) * (-1331.900) (-1340.024) [-1332.476] (-1345.309) -- 0:03:03
263000 -- (-1335.103) [-1339.385] (-1338.322) (-1337.707) * (-1339.250) (-1338.972) (-1342.382) [-1334.359] -- 0:03:02
264000 -- (-1342.455) (-1335.544) (-1342.103) [-1339.446] * (-1338.489) [-1333.721] (-1343.326) (-1332.578) -- 0:03:04
265000 -- (-1333.847) [-1336.641] (-1338.688) (-1337.122) * [-1334.786] (-1330.629) (-1345.283) (-1345.580) -- 0:03:03
Average standard deviation of split frequencies: 0.015950
266000 -- (-1345.435) [-1332.216] (-1335.545) (-1331.630) * [-1339.994] (-1342.000) (-1336.713) (-1337.274) -- 0:03:02
267000 -- (-1336.722) (-1344.580) [-1342.534] (-1343.131) * (-1339.002) (-1342.748) (-1340.594) [-1341.001] -- 0:03:01
268000 -- [-1339.361] (-1333.210) (-1344.279) (-1339.978) * (-1345.893) (-1335.730) (-1353.174) [-1332.184] -- 0:03:03
269000 -- [-1341.263] (-1338.516) (-1340.843) (-1337.460) * (-1344.795) [-1337.225] (-1344.833) (-1336.618) -- 0:03:02
270000 -- (-1347.259) (-1333.742) [-1336.287] (-1339.320) * (-1340.153) [-1341.898] (-1340.137) (-1345.254) -- 0:03:01
Average standard deviation of split frequencies: 0.016794
271000 -- (-1336.554) [-1333.560] (-1337.999) (-1338.735) * [-1333.763] (-1338.974) (-1338.562) (-1337.838) -- 0:03:00
272000 -- (-1336.169) (-1340.435) [-1335.321] (-1348.684) * (-1332.534) (-1344.409) (-1341.277) [-1336.049] -- 0:03:02
273000 -- (-1341.491) (-1336.979) (-1336.996) [-1338.278] * (-1344.608) (-1342.361) (-1338.039) [-1336.850] -- 0:03:01
274000 -- (-1330.473) (-1345.975) (-1340.706) [-1335.229] * (-1341.116) (-1342.511) (-1342.360) [-1333.519] -- 0:03:00
275000 -- (-1340.535) [-1341.549] (-1341.657) (-1335.442) * (-1339.168) (-1339.752) [-1336.844] (-1338.843) -- 0:02:59
Average standard deviation of split frequencies: 0.015494
276000 -- (-1340.717) (-1349.145) (-1339.525) [-1333.964] * (-1331.271) (-1348.703) (-1342.408) [-1334.715] -- 0:03:01
277000 -- [-1345.587] (-1347.532) (-1337.769) (-1339.220) * (-1343.646) (-1338.322) [-1335.260] (-1333.393) -- 0:03:00
278000 -- (-1337.471) (-1344.829) (-1343.922) [-1337.650] * (-1346.652) (-1338.721) (-1336.106) [-1342.087] -- 0:02:59
279000 -- (-1345.067) (-1336.337) [-1340.767] (-1339.910) * (-1342.353) (-1341.140) [-1331.920] (-1341.846) -- 0:02:58
280000 -- (-1346.468) [-1335.045] (-1336.792) (-1338.482) * (-1342.139) [-1332.355] (-1336.915) (-1342.439) -- 0:03:00
Average standard deviation of split frequencies: 0.015356
281000 -- [-1335.986] (-1339.597) (-1341.987) (-1345.542) * (-1343.528) [-1339.060] (-1337.316) (-1337.563) -- 0:02:59
282000 -- (-1339.611) (-1341.787) (-1335.012) [-1336.326] * [-1334.041] (-1340.516) (-1333.869) (-1339.931) -- 0:02:58
283000 -- (-1336.277) (-1340.218) (-1345.567) [-1336.401] * (-1335.371) (-1335.502) (-1344.030) [-1341.679] -- 0:02:57
284000 -- (-1343.403) [-1338.069] (-1345.154) (-1342.269) * (-1346.667) (-1346.652) [-1336.442] (-1338.185) -- 0:02:59
285000 -- (-1336.245) (-1335.546) (-1342.418) [-1341.371] * (-1341.988) [-1342.009] (-1344.537) (-1336.341) -- 0:02:58
Average standard deviation of split frequencies: 0.014717
286000 -- (-1336.766) (-1338.804) [-1335.790] (-1340.487) * (-1348.812) [-1335.859] (-1337.956) (-1338.594) -- 0:02:57
287000 -- [-1329.437] (-1342.542) (-1335.633) (-1344.371) * (-1342.598) [-1330.654] (-1342.669) (-1337.341) -- 0:02:56
288000 -- (-1336.685) (-1336.888) [-1331.330] (-1339.316) * [-1335.062] (-1336.434) (-1340.996) (-1339.510) -- 0:02:58
289000 -- (-1333.162) (-1338.376) (-1353.621) [-1344.878] * (-1339.538) (-1340.100) (-1341.268) [-1334.898] -- 0:02:57
290000 -- [-1336.964] (-1337.573) (-1340.258) (-1340.382) * (-1337.245) (-1342.256) (-1337.459) [-1340.547] -- 0:02:56
Average standard deviation of split frequencies: 0.013901
291000 -- [-1338.844] (-1341.334) (-1341.328) (-1343.043) * [-1334.600] (-1339.470) (-1335.340) (-1340.641) -- 0:02:55
292000 -- (-1336.183) [-1338.528] (-1342.573) (-1335.785) * (-1336.054) (-1350.266) (-1343.397) [-1336.280] -- 0:02:57
293000 -- (-1341.476) [-1337.066] (-1334.492) (-1335.202) * (-1337.263) (-1342.806) [-1336.777] (-1344.636) -- 0:02:56
294000 -- (-1342.787) (-1334.816) [-1343.147] (-1335.594) * (-1332.956) (-1332.931) (-1337.151) [-1336.548] -- 0:02:55
295000 -- (-1350.753) (-1343.107) [-1330.979] (-1343.427) * [-1336.361] (-1331.102) (-1336.720) (-1344.330) -- 0:02:54
Average standard deviation of split frequencies: 0.011489
296000 -- [-1345.318] (-1343.354) (-1331.379) (-1336.514) * (-1339.245) (-1330.807) (-1328.386) [-1336.401] -- 0:02:56
297000 -- (-1343.140) (-1340.441) (-1336.929) [-1341.251] * (-1348.820) (-1340.163) [-1335.344] (-1331.641) -- 0:02:55
298000 -- (-1335.824) [-1331.108] (-1338.130) (-1335.334) * (-1342.654) (-1343.614) (-1346.719) [-1337.059] -- 0:02:54
299000 -- [-1343.405] (-1337.541) (-1339.192) (-1339.606) * (-1336.933) (-1335.452) [-1339.849] (-1340.198) -- 0:02:53
300000 -- (-1346.059) (-1335.167) [-1337.240] (-1341.465) * [-1338.921] (-1337.939) (-1346.514) (-1342.577) -- 0:02:55
Average standard deviation of split frequencies: 0.011759
301000 -- (-1333.048) (-1340.208) (-1334.003) [-1342.899] * (-1343.356) (-1337.101) (-1336.959) [-1340.117] -- 0:02:54
302000 -- (-1340.959) [-1334.631] (-1341.595) (-1343.580) * (-1337.713) (-1335.269) (-1341.345) [-1341.957] -- 0:02:53
303000 -- (-1338.141) (-1338.745) (-1329.459) [-1333.241] * (-1334.522) [-1334.623] (-1338.539) (-1340.847) -- 0:02:52
304000 -- (-1339.899) [-1335.562] (-1337.316) (-1339.745) * (-1334.765) (-1339.809) [-1334.405] (-1339.713) -- 0:02:54
305000 -- [-1337.145] (-1345.722) (-1341.657) (-1340.198) * (-1336.906) (-1335.964) [-1339.335] (-1350.570) -- 0:02:53
Average standard deviation of split frequencies: 0.011224
306000 -- (-1338.424) (-1340.247) (-1341.408) [-1332.199] * (-1332.843) [-1327.643] (-1335.501) (-1334.865) -- 0:02:52
307000 -- (-1338.068) [-1336.769] (-1332.975) (-1340.102) * (-1344.682) (-1332.693) (-1335.116) [-1338.275] -- 0:02:51
308000 -- (-1340.587) (-1340.828) [-1341.498] (-1344.347) * (-1343.824) (-1332.827) (-1338.130) [-1334.021] -- 0:02:53
309000 -- (-1334.090) (-1342.710) [-1333.440] (-1350.735) * [-1336.175] (-1345.519) (-1338.648) (-1348.802) -- 0:02:52
310000 -- [-1328.686] (-1342.496) (-1337.757) (-1338.788) * (-1330.189) [-1335.977] (-1346.262) (-1340.838) -- 0:02:51
Average standard deviation of split frequencies: 0.010839
311000 -- (-1335.944) [-1336.850] (-1341.430) (-1340.660) * [-1335.898] (-1334.934) (-1336.453) (-1345.600) -- 0:02:50
312000 -- (-1343.892) (-1336.204) (-1335.860) [-1333.399] * [-1335.021] (-1340.713) (-1346.772) (-1345.125) -- 0:02:52
313000 -- (-1335.776) (-1332.755) (-1345.092) [-1330.980] * (-1332.650) [-1342.247] (-1340.768) (-1346.401) -- 0:02:51
314000 -- (-1338.800) [-1330.922] (-1348.932) (-1336.038) * (-1341.828) [-1333.009] (-1346.149) (-1336.628) -- 0:02:50
315000 -- (-1333.932) (-1339.125) (-1334.524) [-1334.758] * (-1343.962) (-1347.783) (-1345.923) [-1340.315] -- 0:02:49
Average standard deviation of split frequencies: 0.010869
316000 -- [-1339.086] (-1347.627) (-1339.995) (-1343.530) * (-1338.301) [-1337.159] (-1346.450) (-1336.397) -- 0:02:51
317000 -- (-1336.653) [-1344.170] (-1336.821) (-1346.157) * (-1338.670) (-1333.879) [-1339.363] (-1337.505) -- 0:02:50
318000 -- (-1331.337) (-1336.409) (-1347.808) [-1332.418] * (-1340.192) (-1339.550) [-1337.551] (-1340.105) -- 0:02:49
319000 -- (-1339.486) [-1336.977] (-1341.941) (-1341.659) * (-1337.407) [-1347.941] (-1334.910) (-1344.471) -- 0:02:48
320000 -- (-1334.216) [-1344.981] (-1341.784) (-1335.129) * (-1341.348) (-1344.131) [-1332.457] (-1340.511) -- 0:02:50
Average standard deviation of split frequencies: 0.011236
321000 -- [-1344.679] (-1342.832) (-1335.981) (-1340.951) * (-1339.695) (-1337.648) (-1339.387) [-1339.550] -- 0:02:49
322000 -- [-1334.928] (-1336.213) (-1345.425) (-1338.237) * [-1331.313] (-1339.342) (-1333.034) (-1344.786) -- 0:02:48
323000 -- (-1333.510) [-1331.047] (-1345.596) (-1342.044) * (-1340.900) (-1345.583) [-1334.176] (-1332.248) -- 0:02:47
324000 -- (-1344.954) [-1330.812] (-1342.617) (-1339.227) * (-1338.751) [-1341.213] (-1343.091) (-1344.526) -- 0:02:49
325000 -- (-1342.905) (-1344.906) (-1345.923) [-1338.314] * (-1337.521) (-1335.430) [-1340.253] (-1339.587) -- 0:02:48
Average standard deviation of split frequencies: 0.011155
326000 -- (-1336.086) (-1337.208) (-1344.242) [-1337.786] * (-1330.518) (-1337.402) [-1334.090] (-1331.774) -- 0:02:47
327000 -- [-1338.120] (-1334.322) (-1334.281) (-1342.052) * (-1341.150) [-1330.356] (-1347.201) (-1335.426) -- 0:02:46
328000 -- (-1336.581) (-1347.322) (-1340.871) [-1334.651] * [-1341.627] (-1337.009) (-1335.628) (-1339.047) -- 0:02:48
329000 -- (-1343.720) (-1332.948) (-1338.204) [-1339.780] * [-1342.098] (-1331.151) (-1338.083) (-1340.480) -- 0:02:47
330000 -- [-1334.556] (-1336.962) (-1336.429) (-1335.642) * (-1342.152) [-1338.809] (-1340.137) (-1335.708) -- 0:02:46
Average standard deviation of split frequencies: 0.009572
331000 -- (-1338.901) (-1339.257) [-1331.901] (-1341.040) * [-1336.917] (-1343.821) (-1339.517) (-1338.939) -- 0:02:45
332000 -- [-1336.910] (-1340.369) (-1339.722) (-1341.332) * (-1334.609) [-1340.852] (-1337.540) (-1341.600) -- 0:02:47
333000 -- (-1335.259) (-1336.164) [-1339.622] (-1337.979) * (-1334.395) (-1332.340) [-1332.138] (-1333.044) -- 0:02:46
334000 -- (-1338.321) (-1337.491) (-1329.962) [-1340.192] * [-1334.444] (-1339.800) (-1331.335) (-1335.098) -- 0:02:45
335000 -- (-1338.061) (-1339.061) [-1336.716] (-1350.078) * (-1335.117) [-1349.081] (-1330.993) (-1338.922) -- 0:02:44
Average standard deviation of split frequencies: 0.009220
336000 -- (-1351.840) [-1336.962] (-1340.387) (-1343.937) * (-1338.054) (-1337.869) [-1339.192] (-1342.970) -- 0:02:46
337000 -- (-1335.129) (-1342.844) (-1338.979) [-1340.738] * [-1339.600] (-1333.926) (-1335.339) (-1343.817) -- 0:02:45
338000 -- [-1335.767] (-1344.818) (-1337.318) (-1335.615) * (-1345.504) [-1339.386] (-1335.600) (-1338.611) -- 0:02:44
339000 -- [-1337.471] (-1342.592) (-1340.276) (-1339.411) * [-1331.883] (-1345.032) (-1339.391) (-1334.952) -- 0:02:43
340000 -- (-1332.011) (-1336.998) (-1345.391) [-1342.821] * (-1338.076) [-1333.959] (-1345.339) (-1343.877) -- 0:02:45
Average standard deviation of split frequencies: 0.009884
341000 -- (-1333.355) (-1342.950) (-1344.424) [-1334.977] * [-1338.155] (-1339.456) (-1337.367) (-1343.619) -- 0:02:44
342000 -- (-1340.293) (-1336.764) (-1344.072) [-1330.665] * (-1340.559) (-1341.166) (-1337.313) [-1336.018] -- 0:02:43
343000 -- [-1333.659] (-1349.551) (-1341.771) (-1334.386) * (-1339.240) (-1349.012) (-1338.163) [-1343.501] -- 0:02:42
344000 -- (-1339.396) [-1343.511] (-1340.349) (-1343.966) * (-1335.934) (-1338.525) [-1334.892] (-1346.803) -- 0:02:44
345000 -- (-1342.382) (-1346.955) (-1338.240) [-1339.776] * (-1344.716) [-1339.282] (-1337.602) (-1339.146) -- 0:02:43
Average standard deviation of split frequencies: 0.009440
346000 -- (-1333.742) (-1344.601) (-1339.946) [-1340.473] * (-1338.787) [-1341.561] (-1346.394) (-1332.833) -- 0:02:42
347000 -- (-1343.722) (-1339.096) [-1340.273] (-1338.252) * (-1340.586) [-1333.745] (-1341.437) (-1343.479) -- 0:02:41
348000 -- (-1345.489) (-1333.118) [-1336.084] (-1339.564) * (-1340.000) (-1334.385) (-1340.513) [-1333.705] -- 0:02:43
349000 -- (-1345.868) (-1339.331) (-1339.427) [-1339.312] * [-1333.755] (-1337.668) (-1337.879) (-1333.465) -- 0:02:42
350000 -- (-1334.831) (-1340.172) [-1334.514] (-1338.917) * (-1345.542) [-1337.866] (-1345.469) (-1338.881) -- 0:02:41
Average standard deviation of split frequencies: 0.008930
351000 -- [-1338.080] (-1343.735) (-1344.900) (-1341.835) * (-1337.617) [-1335.530] (-1342.148) (-1334.383) -- 0:02:40
352000 -- [-1337.932] (-1348.551) (-1338.761) (-1344.190) * [-1341.120] (-1335.185) (-1339.334) (-1338.345) -- 0:02:42
353000 -- (-1335.951) [-1341.141] (-1341.767) (-1331.908) * [-1341.187] (-1346.601) (-1334.849) (-1339.594) -- 0:02:41
354000 -- (-1333.685) (-1346.250) [-1339.146] (-1334.330) * (-1347.421) (-1343.229) (-1328.712) [-1334.711] -- 0:02:40
355000 -- [-1334.377] (-1339.625) (-1349.034) (-1352.215) * (-1343.220) (-1338.336) (-1336.844) [-1332.812] -- 0:02:39
Average standard deviation of split frequencies: 0.008229
356000 -- (-1336.499) [-1335.633] (-1334.491) (-1334.206) * [-1339.349] (-1345.846) (-1334.934) (-1337.004) -- 0:02:41
357000 -- (-1331.728) (-1335.194) [-1338.048] (-1344.688) * (-1339.922) (-1334.341) (-1339.539) [-1334.124] -- 0:02:40
358000 -- (-1337.595) (-1338.394) (-1339.844) [-1334.654] * [-1328.870] (-1337.651) (-1334.577) (-1339.808) -- 0:02:39
359000 -- [-1336.685] (-1333.488) (-1344.933) (-1338.626) * (-1336.733) (-1340.242) (-1345.411) [-1336.645] -- 0:02:38
360000 -- [-1333.788] (-1336.486) (-1338.713) (-1343.934) * (-1347.875) [-1340.819] (-1333.601) (-1337.659) -- 0:02:40
Average standard deviation of split frequencies: 0.006815
361000 -- (-1338.208) [-1339.536] (-1338.936) (-1336.965) * (-1336.951) (-1343.680) [-1333.506] (-1334.419) -- 0:02:39
362000 -- (-1340.122) (-1333.191) (-1334.133) [-1338.368] * (-1345.423) (-1349.276) [-1334.215] (-1337.126) -- 0:02:38
363000 -- (-1346.917) (-1338.494) (-1337.931) [-1339.961] * (-1336.518) (-1345.742) (-1338.164) [-1341.381] -- 0:02:37
364000 -- (-1343.628) [-1338.349] (-1335.924) (-1335.088) * (-1340.182) (-1341.593) (-1338.497) [-1337.497] -- 0:02:39
365000 -- (-1343.523) (-1332.830) (-1341.503) [-1338.232] * [-1332.389] (-1340.911) (-1334.790) (-1335.204) -- 0:02:38
Average standard deviation of split frequencies: 0.006992
366000 -- (-1345.869) (-1338.225) (-1333.740) [-1333.130] * [-1338.906] (-1332.599) (-1342.914) (-1337.806) -- 0:02:37
367000 -- (-1337.576) (-1338.568) [-1339.103] (-1338.541) * [-1334.598] (-1339.763) (-1334.497) (-1336.556) -- 0:02:36
368000 -- [-1330.043] (-1342.157) (-1334.976) (-1340.138) * (-1345.634) (-1341.874) [-1340.338] (-1333.710) -- 0:02:38
369000 -- (-1343.384) (-1345.520) [-1335.485] (-1338.368) * (-1332.830) (-1334.378) [-1334.314] (-1342.611) -- 0:02:37
370000 -- [-1340.436] (-1339.071) (-1342.558) (-1340.934) * [-1335.978] (-1339.599) (-1341.726) (-1337.750) -- 0:02:36
Average standard deviation of split frequencies: 0.008267
371000 -- (-1339.268) [-1334.997] (-1341.553) (-1336.694) * (-1337.550) (-1347.807) (-1337.179) [-1337.643] -- 0:02:35
372000 -- [-1340.404] (-1337.742) (-1336.283) (-1335.776) * (-1337.522) [-1337.961] (-1346.491) (-1345.481) -- 0:02:37
373000 -- (-1336.162) (-1348.143) [-1338.706] (-1335.961) * (-1340.133) (-1341.535) (-1336.259) [-1334.196] -- 0:02:36
374000 -- (-1340.347) [-1341.695] (-1337.948) (-1342.400) * (-1340.184) (-1348.405) (-1341.921) [-1331.193] -- 0:02:35
375000 -- (-1342.986) (-1341.055) [-1332.377] (-1345.725) * (-1340.268) (-1332.921) [-1343.192] (-1339.851) -- 0:02:36
Average standard deviation of split frequencies: 0.008418
376000 -- (-1343.591) (-1341.134) [-1336.378] (-1336.995) * (-1336.725) (-1339.797) (-1340.001) [-1333.989] -- 0:02:36
377000 -- (-1338.245) [-1335.614] (-1342.383) (-1340.372) * (-1335.254) (-1343.974) [-1342.329] (-1349.807) -- 0:02:35
378000 -- (-1341.229) (-1347.130) (-1345.167) [-1332.330] * (-1338.179) (-1338.417) (-1347.985) [-1337.070] -- 0:02:34
379000 -- (-1340.999) [-1338.652] (-1347.768) (-1334.031) * [-1338.410] (-1342.509) (-1344.901) (-1334.948) -- 0:02:35
380000 -- (-1343.295) [-1336.294] (-1342.063) (-1334.620) * [-1338.103] (-1343.077) (-1346.877) (-1337.093) -- 0:02:35
Average standard deviation of split frequencies: 0.008845
381000 -- [-1334.119] (-1341.381) (-1337.085) (-1338.563) * (-1343.101) (-1346.827) [-1339.530] (-1336.336) -- 0:02:34
382000 -- (-1337.135) (-1344.411) [-1336.318] (-1342.536) * [-1334.217] (-1341.344) (-1340.137) (-1344.075) -- 0:02:33
383000 -- (-1333.303) [-1336.959] (-1344.550) (-1337.749) * (-1343.041) [-1343.339] (-1342.111) (-1341.836) -- 0:02:34
384000 -- (-1339.273) (-1340.116) [-1342.805] (-1331.513) * (-1338.565) (-1337.486) (-1339.961) [-1336.237] -- 0:02:34
385000 -- (-1354.933) [-1347.050] (-1340.342) (-1340.388) * [-1338.789] (-1332.008) (-1341.033) (-1334.656) -- 0:02:33
Average standard deviation of split frequencies: 0.009334
386000 -- [-1334.206] (-1343.803) (-1330.833) (-1334.815) * [-1330.811] (-1340.316) (-1341.676) (-1336.125) -- 0:02:32
387000 -- (-1341.164) (-1333.074) (-1341.500) [-1333.008] * (-1337.019) [-1338.719] (-1345.263) (-1336.974) -- 0:02:33
388000 -- (-1341.491) (-1341.071) [-1331.494] (-1336.957) * (-1339.741) [-1337.983] (-1342.472) (-1341.105) -- 0:02:33
389000 -- (-1331.931) (-1340.534) (-1334.138) [-1332.876] * [-1340.375] (-1345.515) (-1338.689) (-1347.119) -- 0:02:32
390000 -- [-1334.570] (-1339.180) (-1334.967) (-1334.520) * (-1342.985) (-1345.312) (-1354.029) [-1337.354] -- 0:02:31
Average standard deviation of split frequencies: 0.008791
391000 -- (-1340.228) (-1338.211) [-1335.544] (-1339.204) * (-1338.126) [-1336.347] (-1341.760) (-1337.756) -- 0:02:32
392000 -- (-1350.352) (-1335.652) (-1341.237) [-1342.051] * [-1347.541] (-1339.589) (-1336.791) (-1338.628) -- 0:02:32
393000 -- (-1344.487) [-1340.437] (-1338.408) (-1340.921) * (-1341.070) (-1336.080) [-1337.371] (-1339.035) -- 0:02:31
394000 -- (-1341.019) [-1343.659] (-1339.971) (-1335.992) * (-1348.128) (-1341.526) [-1335.755] (-1338.244) -- 0:02:30
395000 -- (-1341.158) [-1337.848] (-1333.728) (-1344.402) * (-1344.664) (-1342.908) (-1333.491) [-1339.716] -- 0:02:31
Average standard deviation of split frequencies: 0.008418
396000 -- (-1349.529) [-1337.397] (-1341.120) (-1339.533) * [-1339.695] (-1345.281) (-1336.126) (-1339.846) -- 0:02:31
397000 -- [-1344.040] (-1335.803) (-1331.589) (-1333.488) * (-1340.271) (-1350.894) (-1342.804) [-1343.677] -- 0:02:30
398000 -- [-1337.318] (-1344.282) (-1340.854) (-1332.887) * (-1335.948) [-1341.636] (-1340.615) (-1333.425) -- 0:02:29
399000 -- (-1339.535) [-1336.414] (-1339.829) (-1339.768) * (-1343.346) (-1334.880) [-1338.960] (-1341.785) -- 0:02:30
400000 -- (-1337.839) (-1337.074) (-1341.579) [-1331.567] * (-1337.981) (-1340.355) [-1333.779] (-1335.474) -- 0:02:30
Average standard deviation of split frequencies: 0.007816
401000 -- [-1338.473] (-1353.932) (-1340.183) (-1332.216) * (-1344.449) (-1339.229) (-1346.883) [-1337.086] -- 0:02:29
402000 -- (-1335.584) (-1338.900) [-1335.839] (-1339.975) * (-1342.532) [-1334.122] (-1332.788) (-1345.715) -- 0:02:28
403000 -- (-1342.888) (-1339.013) [-1334.046] (-1346.140) * (-1332.705) (-1343.921) [-1334.383] (-1350.667) -- 0:02:29
404000 -- (-1342.760) (-1337.071) (-1332.917) [-1338.030] * [-1334.547] (-1341.249) (-1334.937) (-1335.669) -- 0:02:29
405000 -- (-1332.236) (-1341.406) [-1334.448] (-1341.965) * (-1337.910) [-1329.968] (-1341.628) (-1334.375) -- 0:02:28
Average standard deviation of split frequencies: 0.007962
406000 -- (-1334.275) (-1342.862) [-1336.553] (-1341.017) * (-1343.940) (-1337.192) (-1332.867) [-1334.231] -- 0:02:27
407000 -- (-1337.853) (-1338.815) [-1341.128] (-1336.191) * (-1353.023) [-1333.813] (-1344.753) (-1351.921) -- 0:02:28
408000 -- (-1344.763) (-1335.368) [-1338.093] (-1337.600) * (-1340.947) (-1332.170) [-1330.381] (-1336.931) -- 0:02:28
409000 -- (-1355.897) [-1343.783] (-1337.254) (-1346.769) * (-1346.399) [-1339.423] (-1342.482) (-1343.807) -- 0:02:27
410000 -- (-1340.712) [-1338.493] (-1332.257) (-1345.495) * (-1343.667) (-1347.529) [-1336.011] (-1335.231) -- 0:02:26
Average standard deviation of split frequencies: 0.009183
411000 -- (-1336.627) (-1335.747) [-1335.475] (-1341.274) * [-1336.592] (-1341.661) (-1354.134) (-1340.999) -- 0:02:27
412000 -- (-1332.918) (-1331.703) [-1333.107] (-1344.039) * [-1331.272] (-1347.327) (-1342.783) (-1339.333) -- 0:02:27
413000 -- (-1336.687) (-1333.794) (-1340.571) [-1342.465] * [-1335.098] (-1343.811) (-1337.270) (-1346.711) -- 0:02:26
414000 -- (-1331.974) (-1338.404) (-1345.483) [-1334.742] * [-1337.487] (-1340.878) (-1343.359) (-1337.955) -- 0:02:25
415000 -- (-1341.331) [-1339.650] (-1340.136) (-1337.898) * (-1333.986) (-1345.979) (-1343.290) [-1335.627] -- 0:02:26
Average standard deviation of split frequencies: 0.008337
416000 -- (-1343.001) (-1347.475) [-1337.926] (-1342.519) * (-1341.152) (-1339.955) (-1338.570) [-1347.451] -- 0:02:26
417000 -- (-1339.879) [-1335.379] (-1337.194) (-1343.914) * (-1331.703) [-1334.469] (-1330.554) (-1336.965) -- 0:02:25
418000 -- (-1334.011) (-1337.190) (-1336.377) [-1332.403] * (-1336.259) [-1338.534] (-1344.676) (-1337.030) -- 0:02:24
419000 -- [-1340.945] (-1338.262) (-1348.039) (-1338.859) * (-1334.849) (-1334.538) [-1335.661] (-1333.731) -- 0:02:25
420000 -- (-1333.297) (-1338.097) [-1335.017] (-1334.091) * (-1335.906) (-1344.777) [-1330.669] (-1335.593) -- 0:02:25
Average standard deviation of split frequencies: 0.008405
421000 -- [-1332.619] (-1333.997) (-1334.943) (-1348.629) * (-1333.628) (-1335.189) (-1336.170) [-1333.112] -- 0:02:24
422000 -- (-1340.741) (-1338.856) (-1336.887) [-1333.154] * (-1341.750) [-1340.360] (-1337.660) (-1332.378) -- 0:02:23
423000 -- (-1331.393) (-1341.926) [-1338.772] (-1337.817) * [-1341.937] (-1345.560) (-1336.552) (-1330.609) -- 0:02:24
424000 -- [-1335.547] (-1342.123) (-1336.040) (-1341.210) * [-1340.545] (-1331.232) (-1342.996) (-1342.875) -- 0:02:24
425000 -- [-1332.995] (-1342.347) (-1344.428) (-1339.524) * (-1347.796) [-1336.469] (-1338.564) (-1341.567) -- 0:02:23
Average standard deviation of split frequencies: 0.008220
426000 -- [-1336.520] (-1346.294) (-1346.793) (-1351.467) * (-1333.308) [-1334.383] (-1342.747) (-1340.368) -- 0:02:22
427000 -- (-1340.484) (-1339.105) [-1333.416] (-1342.896) * (-1343.321) (-1339.020) [-1334.009] (-1338.328) -- 0:02:23
428000 -- (-1330.910) (-1336.357) [-1341.046] (-1347.319) * [-1332.205] (-1342.549) (-1350.246) (-1337.399) -- 0:02:23
429000 -- (-1329.266) [-1334.111] (-1335.787) (-1341.660) * (-1343.611) (-1347.131) (-1342.383) [-1336.848] -- 0:02:22
430000 -- (-1347.615) (-1342.381) [-1338.290] (-1338.410) * (-1338.263) [-1336.135] (-1343.498) (-1341.328) -- 0:02:21
Average standard deviation of split frequencies: 0.009226
431000 -- (-1335.382) [-1335.565] (-1336.183) (-1342.805) * (-1332.171) [-1341.378] (-1341.159) (-1342.556) -- 0:02:22
432000 -- (-1337.052) (-1351.858) (-1338.942) [-1338.053] * (-1339.515) (-1338.468) (-1338.383) [-1343.984] -- 0:02:22
433000 -- (-1341.263) [-1342.897] (-1337.431) (-1342.518) * (-1344.882) (-1338.944) (-1338.897) [-1335.604] -- 0:02:21
434000 -- (-1338.849) (-1343.069) (-1338.551) [-1341.033] * [-1337.456] (-1345.130) (-1340.349) (-1331.140) -- 0:02:20
435000 -- (-1345.043) (-1336.671) [-1341.962] (-1340.871) * (-1334.165) (-1338.897) (-1336.392) [-1335.796] -- 0:02:21
Average standard deviation of split frequencies: 0.009036
436000 -- (-1335.706) (-1337.199) (-1336.175) [-1337.175] * [-1338.718] (-1337.521) (-1334.291) (-1341.419) -- 0:02:21
437000 -- [-1338.796] (-1336.408) (-1338.005) (-1336.930) * (-1335.339) (-1335.521) (-1346.754) [-1336.458] -- 0:02:20
438000 -- (-1328.678) [-1337.031] (-1345.964) (-1348.316) * [-1332.409] (-1341.441) (-1341.316) (-1337.524) -- 0:02:19
439000 -- (-1336.277) (-1333.860) (-1336.458) [-1334.762] * (-1337.464) [-1338.219] (-1337.846) (-1341.792) -- 0:02:20
440000 -- (-1336.782) [-1334.400] (-1341.541) (-1339.889) * (-1344.498) [-1339.781] (-1337.163) (-1336.057) -- 0:02:20
Average standard deviation of split frequencies: 0.009016
441000 -- (-1333.040) [-1350.199] (-1334.029) (-1340.679) * (-1347.145) (-1345.006) [-1340.280] (-1341.115) -- 0:02:19
442000 -- (-1338.475) [-1342.615] (-1337.498) (-1340.687) * (-1332.396) (-1339.582) (-1337.204) [-1337.761] -- 0:02:18
443000 -- (-1334.503) [-1334.205] (-1351.927) (-1339.325) * (-1335.539) [-1331.312] (-1339.367) (-1337.875) -- 0:02:19
444000 -- (-1351.554) (-1339.290) (-1344.252) [-1335.135] * [-1339.420] (-1340.373) (-1350.983) (-1334.903) -- 0:02:19
445000 -- (-1342.702) (-1343.614) (-1340.955) [-1330.852] * (-1349.486) (-1338.392) [-1336.736] (-1342.804) -- 0:02:18
Average standard deviation of split frequencies: 0.008984
446000 -- (-1345.135) [-1343.322] (-1338.087) (-1336.553) * (-1336.129) (-1349.413) (-1341.187) [-1336.382] -- 0:02:17
447000 -- (-1346.849) (-1347.503) (-1340.701) [-1335.963] * (-1339.301) (-1341.368) [-1337.894] (-1343.320) -- 0:02:18
448000 -- (-1347.018) (-1346.297) [-1336.938] (-1338.742) * (-1343.980) (-1344.237) [-1331.644] (-1330.572) -- 0:02:18
449000 -- [-1337.132] (-1341.103) (-1337.973) (-1337.668) * (-1337.286) (-1344.863) (-1333.265) [-1339.809] -- 0:02:17
450000 -- (-1349.014) (-1352.870) (-1333.995) [-1337.567] * (-1338.459) (-1339.353) (-1345.221) [-1339.747] -- 0:02:16
Average standard deviation of split frequencies: 0.008219
451000 -- (-1342.668) (-1338.181) [-1339.615] (-1341.421) * [-1338.568] (-1344.036) (-1345.326) (-1341.298) -- 0:02:17
452000 -- (-1336.717) (-1336.242) [-1332.311] (-1344.038) * [-1342.041] (-1337.880) (-1337.844) (-1334.439) -- 0:02:17
453000 -- (-1354.708) (-1339.658) (-1339.724) [-1340.148] * [-1339.486] (-1337.483) (-1338.097) (-1339.399) -- 0:02:16
454000 -- (-1344.658) [-1336.135] (-1343.647) (-1344.027) * (-1335.943) (-1348.475) (-1347.291) [-1335.070] -- 0:02:15
455000 -- (-1340.177) [-1339.589] (-1346.646) (-1340.875) * (-1342.517) (-1341.192) [-1339.210] (-1335.536) -- 0:02:16
Average standard deviation of split frequencies: 0.008270
456000 -- (-1346.208) [-1348.014] (-1336.604) (-1338.840) * (-1344.439) (-1334.052) (-1335.467) [-1336.012] -- 0:02:16
457000 -- (-1341.025) [-1336.500] (-1350.126) (-1335.410) * (-1347.539) [-1333.720] (-1328.026) (-1344.024) -- 0:02:15
458000 -- [-1332.654] (-1335.565) (-1336.589) (-1335.218) * (-1341.324) (-1338.964) [-1338.533] (-1343.863) -- 0:02:14
459000 -- (-1340.478) (-1334.121) [-1340.925] (-1342.116) * [-1334.654] (-1345.157) (-1343.309) (-1342.667) -- 0:02:15
460000 -- (-1341.701) (-1335.658) [-1338.351] (-1349.401) * [-1333.328] (-1337.561) (-1340.064) (-1351.417) -- 0:02:15
Average standard deviation of split frequencies: 0.007821
461000 -- (-1333.829) [-1335.517] (-1341.028) (-1342.340) * (-1340.513) (-1340.796) (-1342.649) [-1336.320] -- 0:02:14
462000 -- (-1339.406) [-1333.330] (-1343.529) (-1346.633) * (-1335.453) [-1338.182] (-1337.105) (-1340.559) -- 0:02:13
463000 -- (-1334.965) [-1331.547] (-1335.068) (-1348.154) * [-1333.670] (-1344.597) (-1342.634) (-1335.888) -- 0:02:14
464000 -- (-1340.909) (-1335.485) (-1335.203) [-1337.160] * (-1336.424) (-1339.029) (-1338.858) [-1340.322] -- 0:02:14
465000 -- [-1335.686] (-1334.987) (-1338.653) (-1343.635) * (-1339.836) (-1337.376) (-1346.018) [-1336.689] -- 0:02:13
Average standard deviation of split frequencies: 0.008021
466000 -- (-1348.765) (-1337.649) (-1333.385) [-1341.027] * (-1341.269) [-1331.492] (-1339.469) (-1334.758) -- 0:02:12
467000 -- [-1331.578] (-1336.759) (-1335.859) (-1344.258) * (-1360.194) (-1336.757) [-1336.332] (-1340.473) -- 0:02:13
468000 -- [-1340.069] (-1348.318) (-1335.458) (-1345.982) * (-1339.030) (-1336.050) [-1332.262] (-1337.408) -- 0:02:13
469000 -- [-1341.401] (-1344.106) (-1334.625) (-1335.754) * (-1353.105) (-1340.855) (-1338.778) [-1335.153] -- 0:02:12
470000 -- (-1344.218) (-1340.423) [-1336.986] (-1343.124) * (-1334.900) [-1334.597] (-1335.455) (-1345.647) -- 0:02:11
Average standard deviation of split frequencies: 0.008656
471000 -- [-1335.468] (-1343.914) (-1341.412) (-1334.361) * [-1338.096] (-1341.836) (-1341.737) (-1344.427) -- 0:02:12
472000 -- (-1349.273) (-1340.231) (-1334.751) [-1343.972] * [-1342.320] (-1339.275) (-1348.259) (-1337.598) -- 0:02:12
473000 -- (-1339.067) (-1351.800) [-1338.471] (-1338.376) * (-1354.198) (-1346.076) (-1345.301) [-1330.796] -- 0:02:11
474000 -- [-1348.600] (-1336.916) (-1334.908) (-1334.275) * (-1334.338) (-1339.385) (-1338.713) [-1339.620] -- 0:02:10
475000 -- (-1341.791) (-1339.876) [-1337.926] (-1339.360) * [-1344.119] (-1341.378) (-1336.723) (-1334.017) -- 0:02:11
Average standard deviation of split frequencies: 0.008064
476000 -- [-1347.545] (-1341.696) (-1343.131) (-1338.238) * [-1332.890] (-1336.352) (-1342.689) (-1337.575) -- 0:02:11
477000 -- (-1338.200) (-1339.757) (-1341.948) [-1340.588] * (-1340.980) [-1333.080] (-1339.250) (-1344.075) -- 0:02:10
478000 -- [-1332.539] (-1344.307) (-1342.462) (-1349.191) * (-1341.804) (-1336.913) [-1334.544] (-1345.693) -- 0:02:09
479000 -- [-1333.381] (-1336.897) (-1349.743) (-1340.785) * (-1343.314) (-1341.110) (-1340.788) [-1340.935] -- 0:02:10
480000 -- (-1346.735) [-1336.286] (-1346.043) (-1340.269) * (-1337.694) (-1340.577) (-1345.969) [-1338.138] -- 0:02:10
Average standard deviation of split frequencies: 0.008476
481000 -- (-1343.421) (-1337.504) (-1337.205) [-1336.640] * (-1345.139) (-1334.552) (-1335.566) [-1337.728] -- 0:02:09
482000 -- (-1335.204) (-1344.067) (-1349.899) [-1331.673] * [-1335.861] (-1335.822) (-1329.713) (-1339.195) -- 0:02:08
483000 -- (-1336.510) (-1341.984) [-1336.621] (-1336.030) * (-1338.304) [-1338.611] (-1338.626) (-1341.257) -- 0:02:09
484000 -- (-1336.065) (-1341.620) (-1337.264) [-1338.693] * (-1353.175) [-1334.075] (-1339.244) (-1334.576) -- 0:02:09
485000 -- [-1335.187] (-1328.810) (-1339.672) (-1347.025) * [-1338.278] (-1347.282) (-1340.168) (-1338.766) -- 0:02:08
Average standard deviation of split frequencies: 0.008868
486000 -- (-1334.842) (-1334.967) (-1350.267) [-1339.270] * (-1336.261) [-1333.633] (-1337.077) (-1345.598) -- 0:02:07
487000 -- (-1340.257) (-1333.199) [-1336.792] (-1345.072) * (-1342.791) (-1335.542) [-1343.078] (-1341.775) -- 0:02:08
488000 -- (-1338.347) [-1336.071] (-1345.775) (-1347.538) * [-1342.961] (-1342.129) (-1338.029) (-1345.509) -- 0:02:08
489000 -- [-1333.945] (-1341.355) (-1337.974) (-1338.016) * (-1340.138) (-1336.942) (-1335.324) [-1338.848] -- 0:02:07
490000 -- (-1342.735) (-1340.263) (-1337.371) [-1342.026] * (-1342.971) [-1334.015] (-1349.735) (-1332.288) -- 0:02:06
Average standard deviation of split frequencies: 0.009813
491000 -- (-1342.707) (-1339.133) (-1337.673) [-1333.880] * (-1340.296) (-1339.934) [-1340.271] (-1338.149) -- 0:02:07
492000 -- (-1349.072) (-1338.341) (-1342.783) [-1348.503] * [-1335.371] (-1336.357) (-1335.627) (-1338.906) -- 0:02:07
493000 -- (-1341.656) [-1337.275] (-1343.453) (-1348.389) * (-1339.833) (-1331.917) (-1335.202) [-1337.880] -- 0:02:06
494000 -- (-1340.672) (-1338.879) (-1337.334) [-1343.482] * (-1337.527) [-1333.235] (-1334.336) (-1342.208) -- 0:02:05
495000 -- (-1346.838) (-1341.096) (-1350.616) [-1335.616] * (-1333.232) (-1334.535) (-1336.058) [-1343.221] -- 0:02:06
Average standard deviation of split frequencies: 0.009165
496000 -- (-1331.671) (-1331.744) [-1332.001] (-1337.058) * [-1331.389] (-1342.716) (-1343.011) (-1338.380) -- 0:02:06
497000 -- [-1341.046] (-1338.567) (-1337.448) (-1338.117) * (-1341.598) (-1340.526) (-1341.652) [-1340.849] -- 0:02:05
498000 -- (-1336.994) [-1344.339] (-1332.913) (-1336.998) * (-1341.865) (-1337.830) [-1337.986] (-1347.183) -- 0:02:04
499000 -- (-1334.164) [-1336.472] (-1345.918) (-1338.678) * (-1337.169) (-1341.325) [-1333.514] (-1340.550) -- 0:02:05
500000 -- [-1344.731] (-1338.377) (-1340.061) (-1344.928) * [-1337.699] (-1332.609) (-1344.188) (-1349.446) -- 0:02:05
Average standard deviation of split frequencies: 0.009550
501000 -- (-1337.810) (-1340.957) (-1335.327) [-1332.875] * (-1342.269) (-1337.633) [-1338.233] (-1340.827) -- 0:02:04
502000 -- (-1345.911) (-1338.433) [-1336.846] (-1345.206) * (-1343.257) (-1337.761) [-1336.754] (-1336.766) -- 0:02:04
503000 -- [-1333.499] (-1331.590) (-1346.304) (-1331.194) * (-1339.240) [-1332.853] (-1341.742) (-1347.877) -- 0:02:04
504000 -- [-1340.342] (-1339.441) (-1340.002) (-1342.969) * (-1337.528) (-1338.536) (-1340.577) [-1333.082] -- 0:02:04
505000 -- (-1341.214) [-1334.161] (-1336.931) (-1332.904) * (-1340.434) [-1337.380] (-1346.976) (-1338.640) -- 0:02:03
Average standard deviation of split frequencies: 0.008717
506000 -- (-1338.391) [-1335.300] (-1334.309) (-1339.636) * (-1337.721) (-1337.027) (-1338.521) [-1336.142] -- 0:02:03
507000 -- (-1335.459) [-1342.556] (-1343.017) (-1343.138) * [-1338.460] (-1337.736) (-1339.615) (-1336.497) -- 0:02:03
508000 -- (-1338.584) [-1329.543] (-1340.981) (-1345.883) * [-1335.236] (-1335.912) (-1342.599) (-1334.411) -- 0:02:03
509000 -- [-1333.939] (-1339.661) (-1349.252) (-1340.135) * (-1335.112) (-1336.484) [-1343.115] (-1335.742) -- 0:02:02
510000 -- (-1341.425) (-1343.096) [-1345.880] (-1331.889) * (-1338.689) (-1333.030) (-1349.235) [-1334.582] -- 0:02:02
Average standard deviation of split frequencies: 0.008572
511000 -- (-1336.532) [-1331.135] (-1341.911) (-1335.869) * (-1342.456) (-1343.441) (-1335.861) [-1338.229] -- 0:02:02
512000 -- (-1340.628) (-1337.371) [-1331.296] (-1357.905) * (-1338.128) [-1339.093] (-1332.236) (-1344.294) -- 0:02:02
513000 -- [-1337.453] (-1340.275) (-1338.532) (-1340.096) * (-1340.148) [-1337.043] (-1338.875) (-1345.369) -- 0:02:01
514000 -- (-1331.358) (-1341.452) (-1342.257) [-1337.719] * (-1342.051) [-1335.540] (-1334.973) (-1330.641) -- 0:02:01
515000 -- (-1336.487) (-1350.892) [-1334.028] (-1336.916) * (-1342.893) [-1337.551] (-1343.870) (-1335.236) -- 0:02:01
Average standard deviation of split frequencies: 0.009788
516000 -- [-1334.027] (-1332.271) (-1347.517) (-1337.615) * (-1333.779) [-1341.061] (-1339.267) (-1345.121) -- 0:02:01
517000 -- (-1338.664) [-1343.144] (-1340.982) (-1344.823) * (-1351.971) (-1329.612) [-1335.960] (-1336.192) -- 0:02:00
518000 -- (-1333.724) (-1343.606) (-1336.788) [-1334.830] * (-1333.525) [-1333.117] (-1344.084) (-1345.573) -- 0:02:00
519000 -- (-1343.285) (-1340.519) (-1348.314) [-1336.371] * (-1335.983) (-1338.539) (-1343.551) [-1332.550] -- 0:02:00
520000 -- (-1342.236) [-1338.116] (-1345.322) (-1337.297) * [-1339.971] (-1339.751) (-1344.987) (-1336.628) -- 0:02:00
Average standard deviation of split frequencies: 0.009959
521000 -- (-1333.725) (-1350.618) [-1334.161] (-1337.944) * (-1340.045) [-1339.186] (-1343.117) (-1346.823) -- 0:01:59
522000 -- [-1337.848] (-1338.816) (-1338.387) (-1340.247) * [-1343.913] (-1336.692) (-1348.575) (-1341.891) -- 0:01:59
523000 -- (-1337.062) [-1340.940] (-1337.081) (-1339.397) * (-1346.284) (-1334.249) (-1338.661) [-1337.892] -- 0:01:59
524000 -- (-1342.505) (-1339.378) [-1333.109] (-1340.296) * (-1351.907) (-1335.488) (-1345.262) [-1336.892] -- 0:01:59
525000 -- (-1344.828) (-1342.176) (-1338.569) [-1336.556] * (-1334.263) (-1335.326) [-1336.233] (-1339.957) -- 0:01:58
Average standard deviation of split frequencies: 0.008706
526000 -- (-1342.472) (-1344.590) (-1339.652) [-1334.772] * [-1341.773] (-1340.467) (-1339.183) (-1338.147) -- 0:01:58
527000 -- (-1336.704) (-1338.747) (-1345.618) [-1338.999] * (-1342.147) (-1341.345) [-1342.448] (-1347.502) -- 0:01:58
528000 -- (-1336.443) (-1342.572) [-1337.834] (-1336.159) * (-1342.739) (-1341.514) (-1347.250) [-1335.136] -- 0:01:58
529000 -- [-1334.453] (-1336.675) (-1340.952) (-1335.031) * (-1337.692) (-1337.265) [-1341.212] (-1341.057) -- 0:01:57
530000 -- [-1338.721] (-1336.274) (-1341.367) (-1340.539) * (-1341.711) [-1334.212] (-1337.688) (-1333.875) -- 0:01:57
Average standard deviation of split frequencies: 0.008883
531000 -- (-1337.291) (-1341.214) (-1335.633) [-1336.341] * (-1336.862) [-1339.199] (-1341.453) (-1341.860) -- 0:01:57
532000 -- (-1340.505) (-1344.289) [-1336.784] (-1329.848) * (-1344.882) (-1346.670) (-1333.514) [-1333.823] -- 0:01:57
533000 -- (-1342.910) [-1339.876] (-1340.727) (-1340.049) * [-1332.528] (-1352.622) (-1337.668) (-1335.944) -- 0:01:56
534000 -- (-1338.081) (-1344.590) (-1336.723) [-1337.740] * [-1337.994] (-1345.427) (-1335.443) (-1341.332) -- 0:01:56
535000 -- (-1341.755) (-1345.191) [-1336.888] (-1340.769) * (-1334.262) [-1339.203] (-1341.410) (-1340.761) -- 0:01:56
Average standard deviation of split frequencies: 0.008481
536000 -- (-1341.484) (-1331.960) [-1342.336] (-1335.487) * (-1339.201) (-1338.692) (-1344.050) [-1331.477] -- 0:01:56
537000 -- (-1333.970) (-1339.548) (-1346.340) [-1336.513] * (-1342.232) (-1344.026) [-1333.620] (-1339.698) -- 0:01:55
538000 -- (-1334.436) [-1338.830] (-1337.498) (-1341.170) * (-1343.729) (-1340.202) (-1339.555) [-1342.417] -- 0:01:55
539000 -- (-1341.007) (-1341.906) [-1335.912] (-1341.700) * [-1344.868] (-1345.258) (-1333.423) (-1340.049) -- 0:01:55
540000 -- (-1344.489) [-1337.291] (-1342.308) (-1339.988) * (-1336.462) (-1338.075) [-1335.073] (-1344.460) -- 0:01:55
Average standard deviation of split frequencies: 0.008781
541000 -- (-1337.728) (-1334.098) (-1341.595) [-1333.944] * [-1344.815] (-1335.073) (-1339.664) (-1341.859) -- 0:01:54
542000 -- (-1346.564) (-1339.252) (-1345.961) [-1337.006] * (-1339.290) (-1336.949) [-1336.899] (-1343.927) -- 0:01:54
543000 -- (-1340.146) (-1336.631) (-1335.579) [-1344.202] * (-1339.115) (-1349.019) [-1338.716] (-1346.585) -- 0:01:54
544000 -- (-1339.369) (-1339.389) (-1335.351) [-1339.226] * (-1334.742) [-1336.923] (-1341.016) (-1347.395) -- 0:01:54
545000 -- (-1335.667) (-1345.566) (-1332.419) [-1341.447] * (-1337.648) (-1341.170) (-1349.308) [-1335.831] -- 0:01:53
Average standard deviation of split frequencies: 0.009065
546000 -- [-1336.837] (-1340.967) (-1337.796) (-1334.746) * (-1336.234) [-1336.347] (-1343.891) (-1336.483) -- 0:01:53
547000 -- (-1344.616) (-1332.152) (-1341.208) [-1331.314] * (-1340.017) (-1335.366) (-1346.212) [-1335.332] -- 0:01:53
548000 -- [-1338.126] (-1340.824) (-1339.561) (-1344.419) * (-1345.378) [-1339.043] (-1340.724) (-1338.506) -- 0:01:53
549000 -- [-1339.084] (-1342.636) (-1338.517) (-1344.686) * [-1335.479] (-1333.882) (-1338.743) (-1334.755) -- 0:01:52
550000 -- (-1337.263) [-1330.957] (-1331.979) (-1342.562) * (-1340.995) (-1341.732) [-1332.231] (-1337.543) -- 0:01:52
Average standard deviation of split frequencies: 0.008866
551000 -- (-1339.743) (-1337.615) [-1337.494] (-1338.201) * (-1340.738) [-1342.969] (-1342.004) (-1345.662) -- 0:01:52
552000 -- [-1338.612] (-1336.216) (-1339.281) (-1338.081) * (-1339.306) (-1345.027) (-1335.488) [-1334.459] -- 0:01:52
553000 -- (-1342.401) (-1338.323) [-1338.344] (-1338.582) * (-1347.583) [-1339.862] (-1339.543) (-1333.494) -- 0:01:51
554000 -- (-1343.792) (-1337.782) [-1336.222] (-1335.323) * (-1339.199) [-1335.872] (-1336.706) (-1345.817) -- 0:01:51
555000 -- (-1337.704) [-1334.129] (-1335.131) (-1339.268) * [-1333.512] (-1340.657) (-1338.362) (-1345.828) -- 0:01:51
Average standard deviation of split frequencies: 0.009266
556000 -- (-1344.497) (-1336.373) [-1340.147] (-1346.418) * (-1341.540) (-1337.775) (-1332.731) [-1338.235] -- 0:01:51
557000 -- (-1347.527) (-1338.817) [-1339.721] (-1341.196) * (-1343.412) (-1339.389) [-1331.439] (-1339.858) -- 0:01:50
558000 -- (-1340.914) (-1335.359) (-1349.469) [-1335.300] * [-1339.993] (-1337.813) (-1339.059) (-1345.146) -- 0:01:50
559000 -- (-1349.586) [-1332.693] (-1344.912) (-1332.069) * (-1341.074) [-1334.526] (-1337.673) (-1340.499) -- 0:01:50
560000 -- (-1335.522) [-1336.551] (-1331.750) (-1347.879) * [-1336.268] (-1342.114) (-1342.098) (-1343.278) -- 0:01:50
Average standard deviation of split frequencies: 0.009429
561000 -- (-1337.525) [-1335.085] (-1335.400) (-1348.350) * (-1336.363) [-1339.575] (-1351.674) (-1343.521) -- 0:01:49
562000 -- (-1342.478) (-1341.330) (-1348.244) [-1330.760] * (-1339.914) [-1332.594] (-1341.367) (-1336.024) -- 0:01:49
563000 -- (-1339.608) [-1338.351] (-1341.512) (-1335.838) * [-1333.750] (-1343.414) (-1341.246) (-1347.209) -- 0:01:49
564000 -- (-1334.746) (-1346.772) (-1341.063) [-1332.652] * (-1351.949) (-1337.149) [-1335.371] (-1345.275) -- 0:01:49
565000 -- (-1338.990) (-1334.305) (-1344.490) [-1330.765] * (-1338.405) (-1333.867) [-1338.209] (-1353.720) -- 0:01:48
Average standard deviation of split frequencies: 0.008864
566000 -- (-1338.851) (-1335.109) [-1331.984] (-1338.179) * [-1339.555] (-1339.401) (-1339.772) (-1345.108) -- 0:01:48
567000 -- [-1333.974] (-1337.702) (-1342.159) (-1335.627) * (-1351.527) (-1338.833) [-1335.980] (-1335.558) -- 0:01:48
568000 -- (-1332.126) [-1336.488] (-1342.250) (-1339.353) * (-1350.324) [-1334.783] (-1339.769) (-1335.786) -- 0:01:48
569000 -- [-1338.006] (-1342.911) (-1336.987) (-1344.824) * (-1342.079) (-1338.780) (-1336.344) [-1342.711] -- 0:01:47
570000 -- [-1343.978] (-1339.881) (-1339.231) (-1338.764) * (-1338.595) (-1344.235) (-1342.815) [-1335.038] -- 0:01:47
Average standard deviation of split frequencies: 0.008615
571000 -- (-1347.264) (-1341.172) [-1335.627] (-1342.774) * (-1343.710) (-1340.402) (-1343.980) [-1334.847] -- 0:01:47
572000 -- (-1338.559) [-1336.225] (-1344.175) (-1328.634) * (-1340.732) (-1340.783) (-1342.182) [-1343.200] -- 0:01:47
573000 -- (-1345.078) [-1335.964] (-1334.364) (-1337.697) * (-1336.755) [-1336.961] (-1336.952) (-1335.969) -- 0:01:46
574000 -- (-1337.292) [-1332.588] (-1335.980) (-1339.167) * (-1339.956) (-1330.828) [-1336.164] (-1343.276) -- 0:01:46
575000 -- (-1336.892) (-1337.103) (-1338.803) [-1335.377] * (-1337.267) (-1333.917) (-1337.857) [-1335.834] -- 0:01:46
Average standard deviation of split frequencies: 0.008944
576000 -- (-1337.397) [-1339.618] (-1343.226) (-1331.918) * (-1354.674) (-1341.413) [-1338.311] (-1340.582) -- 0:01:46
577000 -- (-1343.057) [-1336.415] (-1338.723) (-1341.794) * (-1347.320) [-1335.530] (-1341.350) (-1349.170) -- 0:01:45
578000 -- [-1338.036] (-1341.370) (-1348.671) (-1337.646) * [-1331.567] (-1340.952) (-1339.698) (-1333.882) -- 0:01:45
579000 -- (-1342.718) [-1342.628] (-1337.227) (-1339.173) * (-1339.383) (-1343.995) (-1337.315) [-1336.934] -- 0:01:45
580000 -- (-1342.414) (-1338.410) [-1333.607] (-1336.026) * (-1341.606) [-1333.772] (-1345.799) (-1336.638) -- 0:01:45
Average standard deviation of split frequencies: 0.008118
581000 -- [-1332.630] (-1340.223) (-1333.004) (-1348.402) * (-1332.745) (-1330.349) (-1342.779) [-1336.364] -- 0:01:44
582000 -- (-1338.684) (-1341.443) [-1338.451] (-1340.446) * [-1337.937] (-1340.291) (-1343.287) (-1342.094) -- 0:01:44
583000 -- (-1336.989) (-1342.842) [-1343.734] (-1345.391) * [-1332.515] (-1340.379) (-1344.154) (-1344.245) -- 0:01:44
584000 -- (-1335.602) [-1340.880] (-1343.378) (-1342.759) * (-1335.826) (-1343.003) (-1340.924) [-1343.612] -- 0:01:44
585000 -- (-1337.921) (-1338.954) (-1342.744) [-1342.728] * [-1339.672] (-1339.877) (-1341.783) (-1340.923) -- 0:01:43
Average standard deviation of split frequencies: 0.007930
586000 -- (-1335.069) [-1333.148] (-1350.794) (-1333.077) * (-1337.055) [-1332.192] (-1351.818) (-1332.944) -- 0:01:43
587000 -- (-1342.464) [-1342.911] (-1340.516) (-1342.647) * [-1335.748] (-1335.534) (-1348.250) (-1339.212) -- 0:01:43
588000 -- [-1330.803] (-1348.146) (-1337.193) (-1338.443) * (-1339.201) [-1334.704] (-1343.084) (-1338.142) -- 0:01:43
589000 -- (-1329.012) (-1349.184) [-1336.390] (-1331.019) * [-1339.119] (-1335.905) (-1340.998) (-1344.577) -- 0:01:42
590000 -- [-1330.911] (-1341.989) (-1347.598) (-1334.133) * [-1339.010] (-1347.310) (-1349.784) (-1337.116) -- 0:01:42
Average standard deviation of split frequencies: 0.007924
591000 -- (-1336.314) [-1346.203] (-1337.397) (-1352.481) * (-1335.880) (-1336.670) [-1335.014] (-1347.472) -- 0:01:42
592000 -- (-1340.200) (-1338.921) [-1334.372] (-1352.074) * (-1344.184) [-1333.507] (-1334.314) (-1338.954) -- 0:01:42
593000 -- [-1333.345] (-1341.993) (-1341.564) (-1352.641) * (-1351.524) [-1339.385] (-1331.822) (-1341.559) -- 0:01:41
594000 -- (-1340.316) (-1340.089) [-1340.247] (-1339.264) * [-1340.073] (-1348.070) (-1343.255) (-1333.183) -- 0:01:41
595000 -- (-1335.984) [-1332.891] (-1332.802) (-1338.213) * (-1351.386) [-1332.792] (-1332.761) (-1331.662) -- 0:01:41
Average standard deviation of split frequencies: 0.008418
596000 -- (-1339.998) (-1341.070) (-1340.310) [-1337.220] * (-1334.284) [-1336.970] (-1338.980) (-1344.141) -- 0:01:41
597000 -- (-1332.643) (-1343.920) (-1344.747) [-1336.806] * [-1336.056] (-1332.356) (-1337.002) (-1340.490) -- 0:01:40
598000 -- (-1342.605) [-1339.528] (-1339.977) (-1337.719) * (-1342.961) (-1332.025) [-1338.050] (-1353.875) -- 0:01:40
599000 -- (-1342.009) (-1337.557) [-1332.035] (-1333.821) * (-1329.772) [-1339.312] (-1341.475) (-1337.438) -- 0:01:40
600000 -- (-1340.626) (-1335.669) (-1337.346) [-1338.215] * (-1336.587) [-1339.060] (-1332.120) (-1341.389) -- 0:01:40
Average standard deviation of split frequencies: 0.008577
601000 -- (-1339.773) [-1337.243] (-1341.726) (-1337.559) * (-1342.318) (-1334.542) [-1336.959] (-1332.492) -- 0:01:39
602000 -- (-1343.134) (-1331.992) (-1334.777) [-1339.453] * [-1335.076] (-1335.536) (-1337.236) (-1340.767) -- 0:01:39
603000 -- [-1335.220] (-1344.426) (-1344.603) (-1340.192) * (-1332.059) (-1336.248) [-1339.572] (-1342.125) -- 0:01:39
604000 -- [-1332.702] (-1338.624) (-1335.402) (-1347.183) * (-1338.763) (-1332.998) (-1338.217) [-1330.876] -- 0:01:39
605000 -- (-1337.515) (-1344.106) [-1338.550] (-1337.877) * (-1336.101) (-1335.487) [-1338.493] (-1341.824) -- 0:01:38
Average standard deviation of split frequencies: 0.008724
606000 -- [-1333.468] (-1347.077) (-1343.687) (-1337.340) * [-1328.543] (-1333.017) (-1349.407) (-1341.180) -- 0:01:38
607000 -- (-1339.644) (-1340.974) (-1335.467) [-1336.394] * (-1348.247) [-1338.969] (-1331.117) (-1340.102) -- 0:01:38
608000 -- (-1342.882) [-1334.176] (-1342.288) (-1334.300) * (-1339.328) (-1339.697) [-1331.724] (-1333.380) -- 0:01:38
609000 -- (-1333.646) [-1341.285] (-1336.869) (-1338.729) * (-1343.941) (-1335.627) (-1336.656) [-1331.131] -- 0:01:37
610000 -- [-1335.639] (-1333.442) (-1337.926) (-1338.149) * (-1342.940) (-1341.444) (-1337.053) [-1339.493] -- 0:01:37
Average standard deviation of split frequencies: 0.008822
611000 -- [-1335.600] (-1334.237) (-1341.688) (-1332.805) * [-1332.253] (-1340.463) (-1337.969) (-1340.340) -- 0:01:37
612000 -- (-1351.017) (-1335.877) (-1347.863) [-1336.892] * (-1343.561) (-1336.508) [-1334.926] (-1339.028) -- 0:01:37
613000 -- (-1333.987) (-1342.785) (-1340.172) [-1336.267] * (-1342.684) (-1341.896) [-1339.588] (-1340.992) -- 0:01:36
614000 -- [-1338.401] (-1346.183) (-1344.045) (-1345.123) * (-1329.201) (-1340.941) [-1337.835] (-1343.452) -- 0:01:36
615000 -- (-1337.852) (-1347.820) [-1337.869] (-1340.483) * [-1330.344] (-1338.290) (-1342.142) (-1348.556) -- 0:01:36
Average standard deviation of split frequencies: 0.008309
616000 -- [-1344.139] (-1346.753) (-1333.899) (-1335.734) * (-1333.618) [-1334.957] (-1338.767) (-1340.499) -- 0:01:36
617000 -- [-1334.622] (-1342.141) (-1348.299) (-1337.791) * (-1335.698) [-1343.888] (-1332.349) (-1343.933) -- 0:01:35
618000 -- (-1340.191) (-1337.203) (-1338.967) [-1335.350] * (-1337.306) (-1342.525) (-1336.445) [-1332.500] -- 0:01:35
619000 -- [-1335.085] (-1337.328) (-1338.213) (-1347.408) * (-1342.082) [-1331.320] (-1339.992) (-1337.111) -- 0:01:35
620000 -- (-1330.996) [-1331.046] (-1342.275) (-1341.512) * (-1352.919) (-1337.219) [-1340.439] (-1335.536) -- 0:01:35
Average standard deviation of split frequencies: 0.008355
621000 -- [-1336.397] (-1336.454) (-1345.046) (-1348.252) * (-1335.915) (-1335.320) [-1336.889] (-1337.649) -- 0:01:34
622000 -- (-1343.738) (-1336.278) [-1333.812] (-1334.596) * [-1339.415] (-1347.167) (-1332.008) (-1328.730) -- 0:01:34
623000 -- (-1344.090) [-1332.959] (-1340.261) (-1341.231) * (-1351.812) (-1341.913) [-1336.013] (-1344.361) -- 0:01:34
624000 -- (-1337.423) (-1334.659) (-1337.406) [-1335.443] * (-1341.635) [-1335.751] (-1337.677) (-1340.511) -- 0:01:34
625000 -- (-1336.545) [-1335.754] (-1337.254) (-1345.050) * (-1332.380) (-1333.517) (-1341.882) [-1339.619] -- 0:01:33
Average standard deviation of split frequencies: 0.007853
626000 -- (-1339.861) (-1336.221) [-1337.640] (-1335.559) * (-1342.276) [-1336.062] (-1337.606) (-1338.138) -- 0:01:33
627000 -- (-1338.949) (-1335.756) [-1334.211] (-1337.049) * (-1346.748) [-1340.015] (-1342.807) (-1346.968) -- 0:01:33
628000 -- [-1334.232] (-1340.991) (-1335.870) (-1341.064) * (-1341.108) (-1336.027) [-1334.128] (-1344.291) -- 0:01:33
629000 -- (-1339.405) [-1338.131] (-1334.931) (-1335.209) * (-1335.436) (-1349.871) [-1335.949] (-1340.861) -- 0:01:32
630000 -- (-1341.200) (-1338.408) (-1340.139) [-1338.747] * [-1337.137] (-1333.799) (-1344.335) (-1345.976) -- 0:01:32
Average standard deviation of split frequencies: 0.008115
631000 -- [-1331.978] (-1346.998) (-1340.691) (-1338.858) * (-1342.870) (-1337.473) (-1332.882) [-1339.824] -- 0:01:32
632000 -- (-1338.123) [-1337.885] (-1339.818) (-1336.347) * (-1342.126) (-1335.474) [-1331.561] (-1339.031) -- 0:01:32
633000 -- [-1338.227] (-1333.640) (-1339.376) (-1334.540) * (-1335.053) (-1334.678) [-1333.799] (-1337.833) -- 0:01:31
634000 -- [-1332.438] (-1338.802) (-1336.546) (-1348.076) * (-1346.296) (-1346.534) (-1340.531) [-1331.336] -- 0:01:31
635000 -- (-1332.453) (-1335.470) (-1340.076) [-1333.947] * (-1342.979) [-1338.753] (-1341.607) (-1347.432) -- 0:01:31
Average standard deviation of split frequencies: 0.007306
636000 -- (-1334.380) [-1341.293] (-1342.552) (-1346.509) * (-1344.545) (-1339.509) [-1340.049] (-1336.943) -- 0:01:31
637000 -- (-1338.284) (-1340.027) (-1340.193) [-1338.027] * (-1335.733) [-1327.522] (-1346.342) (-1344.127) -- 0:01:30
638000 -- (-1342.050) [-1338.086] (-1347.592) (-1342.863) * (-1339.798) (-1336.222) (-1343.235) [-1336.107] -- 0:01:30
639000 -- (-1341.759) (-1340.540) [-1342.802] (-1337.595) * (-1340.478) (-1342.774) [-1338.390] (-1343.693) -- 0:01:30
640000 -- [-1344.667] (-1338.945) (-1353.394) (-1336.738) * (-1342.132) (-1340.090) [-1332.620] (-1340.884) -- 0:01:30
Average standard deviation of split frequencies: 0.007516
641000 -- (-1342.642) (-1333.193) (-1344.568) [-1337.883] * (-1340.270) (-1343.036) (-1338.112) [-1352.234] -- 0:01:29
642000 -- (-1336.641) [-1331.776] (-1342.365) (-1339.996) * [-1335.781] (-1341.568) (-1341.844) (-1339.892) -- 0:01:29
643000 -- (-1341.849) (-1333.246) (-1336.302) [-1331.989] * (-1329.483) (-1339.118) (-1336.711) [-1335.930] -- 0:01:29
644000 -- [-1342.645] (-1335.811) (-1334.099) (-1330.027) * (-1345.423) (-1342.560) [-1341.185] (-1341.593) -- 0:01:29
645000 -- (-1339.315) (-1344.326) [-1338.043] (-1339.232) * (-1339.694) (-1332.627) (-1333.078) [-1338.315] -- 0:01:28
Average standard deviation of split frequencies: 0.007819
646000 -- [-1333.732] (-1339.041) (-1340.379) (-1335.350) * (-1342.086) (-1336.326) [-1338.111] (-1349.275) -- 0:01:28
647000 -- (-1337.712) [-1341.777] (-1341.169) (-1334.339) * [-1334.153] (-1340.925) (-1343.807) (-1349.809) -- 0:01:28
648000 -- (-1336.202) [-1339.181] (-1345.053) (-1339.755) * (-1333.075) (-1338.823) [-1334.486] (-1343.627) -- 0:01:28
649000 -- [-1336.268] (-1336.579) (-1345.674) (-1338.706) * [-1338.530] (-1337.497) (-1340.052) (-1340.685) -- 0:01:27
650000 -- (-1340.800) [-1335.565] (-1349.504) (-1341.128) * (-1340.100) [-1344.393] (-1345.285) (-1339.549) -- 0:01:27
Average standard deviation of split frequencies: 0.007762
651000 -- (-1340.091) (-1336.543) [-1346.257] (-1338.966) * (-1341.354) (-1346.567) [-1333.572] (-1335.765) -- 0:01:27
652000 -- (-1336.248) (-1334.454) (-1337.576) [-1336.594] * (-1335.835) (-1336.937) [-1334.973] (-1342.742) -- 0:01:27
653000 -- (-1334.456) [-1337.322] (-1349.260) (-1341.209) * (-1335.659) (-1331.117) (-1343.690) [-1336.640] -- 0:01:26
654000 -- (-1337.286) [-1336.347] (-1343.847) (-1344.943) * (-1342.979) (-1339.067) (-1343.668) [-1330.311] -- 0:01:26
655000 -- (-1338.846) [-1330.777] (-1345.567) (-1337.742) * (-1337.598) (-1340.926) [-1338.456] (-1348.703) -- 0:01:26
Average standard deviation of split frequencies: 0.008007
656000 -- (-1342.752) (-1338.992) [-1333.041] (-1339.765) * (-1339.335) (-1339.718) [-1333.095] (-1338.334) -- 0:01:26
657000 -- (-1346.032) [-1337.272] (-1345.963) (-1335.952) * (-1339.930) [-1338.813] (-1339.090) (-1333.094) -- 0:01:25
658000 -- (-1341.255) (-1339.705) (-1338.087) [-1336.443] * (-1343.579) (-1339.749) (-1338.606) [-1329.883] -- 0:01:25
659000 -- (-1336.504) (-1331.197) (-1339.987) [-1333.822] * (-1342.471) [-1336.274] (-1333.732) (-1334.153) -- 0:01:25
660000 -- [-1334.837] (-1337.275) (-1335.804) (-1338.082) * (-1337.163) [-1340.045] (-1340.646) (-1341.351) -- 0:01:25
Average standard deviation of split frequencies: 0.007645
661000 -- [-1348.030] (-1351.754) (-1337.209) (-1334.066) * [-1338.772] (-1338.108) (-1334.499) (-1333.050) -- 0:01:24
662000 -- (-1346.840) (-1341.080) [-1330.958] (-1338.111) * (-1344.774) [-1337.523] (-1339.733) (-1337.791) -- 0:01:24
663000 -- (-1354.451) [-1338.730] (-1338.049) (-1333.505) * [-1340.588] (-1345.458) (-1337.820) (-1346.324) -- 0:01:24
664000 -- (-1335.929) (-1341.061) (-1338.597) [-1331.383] * [-1334.429] (-1341.227) (-1336.594) (-1345.749) -- 0:01:24
665000 -- [-1336.842] (-1343.734) (-1338.055) (-1333.838) * [-1336.348] (-1341.215) (-1334.881) (-1347.937) -- 0:01:24
Average standard deviation of split frequencies: 0.007786
666000 -- [-1330.378] (-1340.027) (-1341.708) (-1338.797) * (-1341.247) (-1346.932) (-1336.331) [-1333.582] -- 0:01:23
667000 -- [-1331.424] (-1340.266) (-1343.696) (-1331.241) * (-1337.688) (-1337.035) (-1340.759) [-1345.210] -- 0:01:23
668000 -- [-1337.349] (-1338.622) (-1342.576) (-1336.534) * (-1340.774) (-1343.500) [-1335.117] (-1342.313) -- 0:01:23
669000 -- (-1332.033) (-1350.793) (-1336.631) [-1335.690] * (-1341.899) [-1343.568] (-1331.203) (-1339.588) -- 0:01:23
670000 -- (-1336.646) (-1334.927) (-1344.127) [-1331.713] * (-1341.789) (-1340.569) (-1343.029) [-1336.691] -- 0:01:22
Average standard deviation of split frequencies: 0.007531
671000 -- [-1337.661] (-1346.401) (-1344.755) (-1345.358) * (-1338.275) (-1345.954) [-1332.794] (-1334.539) -- 0:01:22
672000 -- [-1338.429] (-1333.597) (-1339.786) (-1339.824) * (-1333.333) [-1338.429] (-1352.487) (-1331.441) -- 0:01:22
673000 -- (-1335.105) [-1335.493] (-1342.694) (-1342.226) * (-1334.836) (-1344.255) (-1351.390) [-1338.211] -- 0:01:22
674000 -- [-1338.174] (-1339.170) (-1338.555) (-1341.447) * (-1344.460) (-1335.846) (-1338.668) [-1335.857] -- 0:01:21
675000 -- (-1340.364) [-1330.277] (-1343.427) (-1347.104) * (-1342.373) [-1330.051] (-1340.877) (-1331.006) -- 0:01:21
Average standard deviation of split frequencies: 0.007272
676000 -- (-1341.324) [-1340.710] (-1336.334) (-1349.527) * (-1343.061) [-1336.864] (-1342.349) (-1336.213) -- 0:01:21
677000 -- (-1331.380) (-1336.359) (-1336.937) [-1341.289] * (-1331.671) (-1349.276) (-1350.154) [-1332.814] -- 0:01:21
678000 -- (-1333.463) (-1344.160) [-1340.196] (-1336.621) * (-1337.771) (-1341.217) [-1345.435] (-1336.697) -- 0:01:20
679000 -- (-1334.405) [-1340.354] (-1337.398) (-1331.141) * (-1343.920) [-1336.590] (-1351.151) (-1333.921) -- 0:01:20
680000 -- [-1336.695] (-1343.552) (-1347.226) (-1337.682) * (-1337.418) (-1335.605) (-1343.970) [-1341.148] -- 0:01:20
Average standard deviation of split frequencies: 0.007420
681000 -- [-1338.333] (-1359.423) (-1336.903) (-1340.999) * (-1333.987) [-1343.014] (-1339.923) (-1336.122) -- 0:01:20
682000 -- (-1342.762) (-1335.551) (-1341.472) [-1335.381] * [-1341.809] (-1341.216) (-1349.505) (-1335.962) -- 0:01:19
683000 -- [-1339.278] (-1342.590) (-1332.747) (-1339.663) * (-1344.799) (-1332.592) (-1337.500) [-1331.881] -- 0:01:19
684000 -- [-1333.664] (-1338.212) (-1337.025) (-1340.609) * [-1336.085] (-1334.735) (-1337.265) (-1336.297) -- 0:01:19
685000 -- (-1339.590) (-1342.230) (-1336.591) [-1335.846] * (-1335.539) (-1341.247) [-1337.855] (-1340.213) -- 0:01:19
Average standard deviation of split frequencies: 0.007019
686000 -- (-1334.605) (-1340.635) [-1330.864] (-1338.930) * [-1337.505] (-1337.114) (-1338.565) (-1340.134) -- 0:01:18
687000 -- [-1337.694] (-1349.514) (-1333.844) (-1340.109) * (-1342.680) (-1340.748) (-1342.365) [-1339.353] -- 0:01:18
688000 -- (-1343.305) (-1344.575) [-1339.896] (-1344.360) * [-1335.742] (-1342.859) (-1334.702) (-1333.686) -- 0:01:18
689000 -- (-1336.078) [-1337.821] (-1337.955) (-1347.622) * [-1339.201] (-1331.023) (-1336.840) (-1341.845) -- 0:01:18
690000 -- (-1336.381) (-1336.454) (-1339.458) [-1341.635] * (-1342.989) (-1339.289) (-1334.560) [-1334.625] -- 0:01:17
Average standard deviation of split frequencies: 0.006582
691000 -- (-1335.676) (-1339.674) (-1341.274) [-1330.678] * (-1345.224) (-1350.587) [-1341.322] (-1341.896) -- 0:01:17
692000 -- (-1341.539) (-1340.671) [-1340.215] (-1332.587) * (-1333.338) (-1334.941) [-1336.445] (-1341.812) -- 0:01:17
693000 -- (-1336.918) (-1340.939) (-1333.837) [-1330.249] * (-1335.699) (-1345.967) (-1334.643) [-1337.298] -- 0:01:17
694000 -- [-1335.850] (-1340.025) (-1339.531) (-1338.777) * (-1338.855) (-1337.082) (-1349.803) [-1331.685] -- 0:01:16
695000 -- (-1341.286) [-1330.663] (-1343.430) (-1334.609) * (-1339.366) [-1337.762] (-1353.397) (-1340.096) -- 0:01:16
Average standard deviation of split frequencies: 0.006676
696000 -- (-1328.774) (-1336.929) [-1341.570] (-1351.268) * (-1347.575) (-1334.894) [-1335.518] (-1335.932) -- 0:01:16
697000 -- (-1340.843) [-1331.242] (-1339.553) (-1333.440) * (-1345.999) (-1341.849) (-1331.963) [-1335.871] -- 0:01:16
698000 -- [-1331.622] (-1336.762) (-1336.297) (-1338.208) * (-1340.763) (-1343.537) [-1335.856] (-1337.792) -- 0:01:15
699000 -- (-1333.336) (-1339.226) [-1337.623] (-1338.097) * (-1339.675) (-1340.904) [-1333.560] (-1334.279) -- 0:01:15
700000 -- [-1336.396] (-1346.845) (-1338.363) (-1341.380) * [-1339.552] (-1344.960) (-1340.137) (-1337.630) -- 0:01:15
Average standard deviation of split frequencies: 0.006872
701000 -- (-1342.652) (-1348.570) [-1339.528] (-1336.887) * (-1340.481) (-1340.914) [-1325.654] (-1345.660) -- 0:01:15
702000 -- [-1340.807] (-1335.527) (-1343.836) (-1344.312) * (-1334.370) [-1337.709] (-1336.559) (-1338.181) -- 0:01:14
703000 -- (-1339.863) (-1335.238) [-1334.575] (-1337.362) * [-1341.190] (-1337.922) (-1341.613) (-1334.997) -- 0:01:14
704000 -- (-1344.447) (-1338.519) [-1342.647] (-1338.145) * (-1341.104) (-1336.344) [-1334.761] (-1335.026) -- 0:01:14
705000 -- (-1334.220) (-1342.629) (-1338.381) [-1336.429] * (-1333.605) (-1335.417) [-1339.307] (-1336.216) -- 0:01:14
Average standard deviation of split frequencies: 0.007106
706000 -- [-1333.425] (-1336.749) (-1332.840) (-1344.440) * (-1343.271) (-1350.729) [-1338.801] (-1340.457) -- 0:01:13
707000 -- [-1338.760] (-1342.144) (-1342.167) (-1336.419) * (-1334.068) (-1340.927) (-1337.265) [-1332.937] -- 0:01:13
708000 -- [-1341.904] (-1340.279) (-1339.305) (-1345.995) * (-1346.758) (-1346.248) (-1339.800) [-1335.499] -- 0:01:13
709000 -- (-1344.127) (-1345.497) [-1341.954] (-1339.095) * [-1339.874] (-1338.881) (-1341.136) (-1334.808) -- 0:01:13
710000 -- (-1344.442) (-1342.682) [-1333.436] (-1346.553) * (-1344.281) [-1335.945] (-1341.246) (-1332.568) -- 0:01:12
Average standard deviation of split frequencies: 0.006254
711000 -- (-1336.204) (-1344.955) (-1333.650) [-1344.600] * (-1334.799) [-1341.258] (-1337.949) (-1346.678) -- 0:01:12
712000 -- (-1337.037) [-1341.118] (-1332.811) (-1344.210) * [-1332.392] (-1336.075) (-1336.492) (-1340.416) -- 0:01:12
713000 -- (-1342.003) [-1335.403] (-1348.077) (-1337.470) * [-1333.709] (-1348.183) (-1331.214) (-1342.841) -- 0:01:12
714000 -- [-1334.555] (-1337.138) (-1343.518) (-1338.977) * (-1337.731) (-1337.570) [-1337.323] (-1339.620) -- 0:01:11
715000 -- (-1340.118) [-1342.601] (-1343.583) (-1344.560) * [-1343.432] (-1342.215) (-1341.566) (-1339.986) -- 0:01:11
Average standard deviation of split frequencies: 0.006490
716000 -- (-1339.060) (-1346.565) [-1340.418] (-1342.137) * (-1348.306) (-1328.387) (-1344.677) [-1339.129] -- 0:01:11
717000 -- (-1345.019) [-1334.285] (-1348.231) (-1333.249) * [-1341.630] (-1334.095) (-1351.106) (-1340.930) -- 0:01:11
718000 -- (-1345.123) [-1336.336] (-1342.903) (-1341.580) * (-1337.115) [-1341.053] (-1337.668) (-1343.230) -- 0:01:10
719000 -- (-1337.414) [-1336.082] (-1336.152) (-1338.603) * [-1336.835] (-1347.383) (-1344.455) (-1345.757) -- 0:01:10
720000 -- (-1335.476) (-1337.302) [-1333.862] (-1337.347) * (-1335.785) (-1336.030) (-1341.713) [-1337.799] -- 0:01:10
Average standard deviation of split frequencies: 0.006308
721000 -- (-1331.810) (-1339.975) (-1341.656) [-1337.852] * (-1345.506) (-1338.130) [-1335.438] (-1344.727) -- 0:01:10
722000 -- (-1335.982) [-1338.376] (-1338.965) (-1340.229) * [-1334.915] (-1342.938) (-1345.229) (-1345.035) -- 0:01:09
723000 -- (-1335.685) (-1346.366) (-1337.258) [-1330.658] * [-1339.589] (-1338.548) (-1334.781) (-1339.432) -- 0:01:09
724000 -- [-1342.079] (-1342.493) (-1342.949) (-1340.636) * [-1344.509] (-1341.843) (-1337.616) (-1336.679) -- 0:01:09
725000 -- (-1347.188) (-1347.823) [-1335.220] (-1340.459) * (-1339.691) (-1336.430) (-1342.800) [-1341.426] -- 0:01:09
Average standard deviation of split frequencies: 0.007096
726000 -- (-1347.566) (-1340.144) (-1336.761) [-1334.535] * (-1338.602) (-1336.966) (-1344.279) [-1336.448] -- 0:01:08
727000 -- (-1340.760) (-1341.442) (-1341.044) [-1330.448] * (-1343.632) (-1342.392) [-1330.808] (-1347.688) -- 0:01:08
728000 -- (-1339.089) (-1340.528) [-1333.722] (-1343.509) * (-1338.731) [-1340.388] (-1343.155) (-1334.256) -- 0:01:08
729000 -- (-1333.940) [-1336.658] (-1342.418) (-1340.707) * [-1344.986] (-1337.620) (-1335.127) (-1339.901) -- 0:01:08
730000 -- (-1332.317) (-1342.989) [-1345.112] (-1341.634) * (-1349.822) (-1340.032) (-1351.736) [-1338.403] -- 0:01:07
Average standard deviation of split frequencies: 0.006636
731000 -- (-1346.140) (-1345.784) (-1337.868) [-1336.409] * (-1343.454) (-1342.182) [-1338.230] (-1333.671) -- 0:01:07
732000 -- [-1343.564] (-1338.721) (-1345.099) (-1341.032) * (-1344.161) (-1334.038) (-1338.295) [-1349.758] -- 0:01:07
733000 -- [-1346.639] (-1342.058) (-1343.779) (-1348.796) * (-1333.601) (-1342.831) (-1339.081) [-1335.517] -- 0:01:07
734000 -- (-1334.699) [-1339.617] (-1339.078) (-1339.243) * (-1332.285) (-1340.259) (-1341.208) [-1335.671] -- 0:01:06
735000 -- (-1334.415) (-1335.737) [-1338.177] (-1339.168) * (-1344.665) (-1340.460) [-1337.326] (-1341.428) -- 0:01:06
Average standard deviation of split frequencies: 0.006771
736000 -- (-1342.753) [-1332.909] (-1349.465) (-1335.049) * (-1343.365) (-1340.381) [-1335.753] (-1346.057) -- 0:01:06
737000 -- (-1342.646) (-1353.158) (-1348.651) [-1335.926] * (-1338.500) (-1338.114) [-1333.989] (-1338.641) -- 0:01:06
738000 -- (-1340.541) [-1332.916] (-1341.707) (-1336.982) * (-1338.118) (-1347.164) (-1337.244) [-1337.584] -- 0:01:05
739000 -- (-1334.943) (-1339.701) [-1334.682] (-1343.386) * [-1335.562] (-1338.788) (-1342.918) (-1348.108) -- 0:01:05
740000 -- (-1335.170) (-1344.335) [-1333.982] (-1334.519) * (-1339.219) [-1336.102] (-1345.310) (-1326.874) -- 0:01:05
Average standard deviation of split frequencies: 0.006592
741000 -- (-1337.064) [-1332.523] (-1334.965) (-1344.513) * [-1343.423] (-1335.438) (-1353.291) (-1339.368) -- 0:01:05
742000 -- (-1336.399) (-1335.961) (-1335.174) [-1342.342] * [-1333.870] (-1346.176) (-1335.793) (-1343.596) -- 0:01:04
743000 -- [-1339.257] (-1332.103) (-1335.185) (-1344.801) * [-1336.751] (-1342.308) (-1345.567) (-1337.512) -- 0:01:04
744000 -- (-1344.343) (-1347.147) [-1341.317] (-1346.110) * (-1339.477) [-1332.325] (-1347.294) (-1340.203) -- 0:01:04
745000 -- (-1336.876) (-1348.396) (-1342.958) [-1337.418] * (-1343.785) [-1338.028] (-1350.993) (-1335.942) -- 0:01:04
Average standard deviation of split frequencies: 0.006319
746000 -- [-1342.601] (-1334.369) (-1338.904) (-1344.878) * (-1339.666) (-1339.655) [-1332.192] (-1335.653) -- 0:01:03
747000 -- (-1341.740) (-1340.412) [-1339.737] (-1348.724) * (-1342.770) (-1341.186) (-1336.278) [-1338.512] -- 0:01:03
748000 -- (-1340.156) [-1346.133] (-1332.572) (-1343.436) * [-1335.583] (-1342.039) (-1343.884) (-1341.472) -- 0:01:03
749000 -- (-1338.787) [-1340.237] (-1336.709) (-1349.904) * [-1338.695] (-1341.525) (-1353.780) (-1345.300) -- 0:01:03
750000 -- [-1333.897] (-1334.006) (-1337.657) (-1341.844) * (-1337.535) [-1336.799] (-1342.772) (-1333.077) -- 0:01:02
Average standard deviation of split frequencies: 0.006818
751000 -- (-1346.547) (-1355.047) [-1336.841] (-1340.613) * (-1336.413) [-1335.595] (-1343.552) (-1342.321) -- 0:01:02
752000 -- (-1346.255) [-1339.203] (-1339.923) (-1338.069) * (-1342.941) (-1333.988) [-1335.733] (-1330.039) -- 0:01:02
753000 -- [-1341.094] (-1339.127) (-1342.657) (-1345.514) * (-1341.132) (-1341.536) [-1338.347] (-1336.655) -- 0:01:01
754000 -- (-1338.235) (-1332.571) [-1339.441] (-1335.112) * [-1332.412] (-1334.011) (-1347.848) (-1336.876) -- 0:01:01
755000 -- (-1336.545) [-1334.496] (-1335.252) (-1334.666) * (-1341.220) (-1335.386) (-1343.999) [-1340.468] -- 0:01:01
Average standard deviation of split frequencies: 0.006993
756000 -- (-1338.489) (-1349.446) [-1336.262] (-1331.968) * (-1336.310) (-1344.361) (-1334.093) [-1332.261] -- 0:01:01
757000 -- [-1334.110] (-1333.707) (-1344.826) (-1339.955) * (-1344.928) (-1346.160) [-1339.043] (-1340.211) -- 0:01:00
758000 -- [-1339.600] (-1345.435) (-1337.237) (-1338.618) * [-1342.764] (-1333.624) (-1343.139) (-1339.964) -- 0:01:00
759000 -- (-1336.604) (-1342.900) (-1336.327) [-1339.255] * (-1346.860) [-1340.250] (-1342.849) (-1335.288) -- 0:01:00
760000 -- (-1339.782) (-1339.941) (-1332.545) [-1336.135] * (-1338.226) (-1343.342) [-1340.360] (-1339.873) -- 0:01:00
Average standard deviation of split frequencies: 0.006906
761000 -- (-1346.860) (-1341.837) (-1339.510) [-1336.810] * (-1339.970) (-1341.365) (-1341.596) [-1339.433] -- 0:00:59
762000 -- (-1339.320) (-1337.767) [-1335.818] (-1347.203) * (-1333.889) (-1342.232) (-1345.629) [-1335.792] -- 0:00:59
763000 -- [-1332.414] (-1343.371) (-1335.584) (-1347.004) * (-1335.667) (-1331.932) [-1334.603] (-1339.247) -- 0:00:59
764000 -- [-1339.758] (-1340.947) (-1342.112) (-1342.519) * (-1339.428) (-1339.900) [-1342.409] (-1343.879) -- 0:00:59
765000 -- [-1336.605] (-1345.757) (-1340.427) (-1337.281) * (-1340.143) (-1335.635) (-1336.423) [-1335.085] -- 0:00:58
Average standard deviation of split frequencies: 0.007121
766000 -- [-1333.975] (-1343.203) (-1339.903) (-1338.700) * (-1340.743) (-1341.269) [-1337.630] (-1343.604) -- 0:00:58
767000 -- (-1336.488) (-1338.509) [-1340.955] (-1351.629) * [-1333.169] (-1339.477) (-1336.620) (-1340.889) -- 0:00:58
768000 -- [-1337.309] (-1339.663) (-1348.538) (-1345.020) * (-1337.687) (-1345.681) [-1333.300] (-1343.106) -- 0:00:58
769000 -- (-1340.082) (-1350.691) [-1335.688] (-1344.638) * (-1345.454) (-1337.112) (-1335.662) [-1335.151] -- 0:00:57
770000 -- (-1340.306) [-1337.796] (-1334.200) (-1343.855) * (-1338.502) (-1344.477) (-1332.239) [-1342.087] -- 0:00:57
Average standard deviation of split frequencies: 0.007165
771000 -- (-1340.006) (-1340.342) [-1343.050] (-1337.766) * (-1346.258) (-1331.266) (-1344.489) [-1341.907] -- 0:00:57
772000 -- (-1345.549) [-1335.196] (-1340.238) (-1337.411) * (-1338.018) (-1331.886) (-1336.686) [-1332.386] -- 0:00:57
773000 -- (-1341.136) [-1336.132] (-1341.213) (-1337.930) * (-1345.648) [-1341.386] (-1332.919) (-1342.792) -- 0:00:56
774000 -- [-1341.251] (-1338.021) (-1336.307) (-1341.489) * (-1337.154) [-1338.194] (-1351.378) (-1337.765) -- 0:00:56
775000 -- [-1336.012] (-1339.009) (-1334.041) (-1346.830) * (-1339.173) (-1337.486) (-1332.661) [-1341.779] -- 0:00:56
Average standard deviation of split frequencies: 0.006812
776000 -- (-1334.503) (-1342.632) [-1337.490] (-1335.191) * (-1337.840) (-1341.355) [-1330.559] (-1340.564) -- 0:00:56
777000 -- (-1343.014) (-1340.178) [-1344.356] (-1340.369) * (-1334.379) [-1336.025] (-1347.077) (-1336.303) -- 0:00:55
778000 -- (-1343.331) (-1338.817) [-1333.748] (-1336.134) * (-1342.711) [-1336.625] (-1331.534) (-1333.393) -- 0:00:55
779000 -- (-1340.158) (-1337.332) (-1344.898) [-1339.868] * [-1338.699] (-1334.879) (-1340.747) (-1336.391) -- 0:00:55
780000 -- (-1336.051) (-1342.253) (-1344.097) [-1335.176] * (-1335.141) (-1341.279) (-1333.231) [-1337.561] -- 0:00:55
Average standard deviation of split frequencies: 0.007246
781000 -- (-1345.931) [-1336.377] (-1339.910) (-1347.295) * (-1339.872) (-1341.789) (-1344.203) [-1335.771] -- 0:00:54
782000 -- (-1342.338) [-1336.552] (-1341.346) (-1337.118) * (-1345.817) (-1340.561) (-1334.798) [-1337.308] -- 0:00:54
783000 -- (-1330.945) (-1341.700) [-1335.716] (-1339.883) * (-1340.485) [-1344.914] (-1333.942) (-1345.369) -- 0:00:54
784000 -- (-1337.965) [-1340.104] (-1342.214) (-1332.428) * (-1343.792) (-1339.025) [-1335.046] (-1334.146) -- 0:00:54
785000 -- (-1340.600) (-1337.076) (-1342.203) [-1341.336] * (-1337.996) (-1340.533) (-1342.802) [-1336.122] -- 0:00:53
Average standard deviation of split frequencies: 0.006940
786000 -- (-1346.569) [-1339.419] (-1337.584) (-1335.002) * (-1340.762) (-1332.996) (-1340.039) [-1332.216] -- 0:00:53
787000 -- (-1340.059) (-1344.720) (-1339.900) [-1335.013] * (-1334.595) (-1337.479) [-1340.068] (-1347.549) -- 0:00:53
788000 -- (-1340.887) (-1346.415) [-1331.809] (-1341.895) * [-1332.324] (-1339.587) (-1340.407) (-1340.300) -- 0:00:53
789000 -- (-1332.440) (-1338.534) (-1336.648) [-1334.286] * (-1340.596) (-1336.006) [-1341.626] (-1347.143) -- 0:00:52
790000 -- [-1336.956] (-1338.319) (-1339.942) (-1344.758) * (-1344.898) (-1335.632) [-1341.733] (-1334.672) -- 0:00:52
Average standard deviation of split frequencies: 0.007027
791000 -- (-1346.184) (-1336.643) (-1341.504) [-1341.277] * [-1342.273] (-1339.341) (-1340.371) (-1338.744) -- 0:00:52
792000 -- (-1344.683) [-1336.938] (-1338.006) (-1343.435) * (-1342.074) (-1336.402) [-1337.282] (-1337.345) -- 0:00:52
793000 -- [-1334.581] (-1340.349) (-1337.508) (-1340.384) * (-1335.518) (-1337.902) [-1341.870] (-1343.588) -- 0:00:51
794000 -- (-1338.643) (-1347.789) [-1332.380] (-1334.662) * (-1339.346) (-1345.733) (-1344.472) [-1334.662] -- 0:00:51
795000 -- (-1340.255) (-1338.828) (-1332.876) [-1329.863] * (-1336.944) (-1338.864) [-1338.836] (-1340.691) -- 0:00:51
Average standard deviation of split frequencies: 0.007234
796000 -- (-1332.611) (-1344.226) (-1338.733) [-1339.358] * (-1329.621) [-1333.136] (-1353.647) (-1343.822) -- 0:00:51
797000 -- (-1334.994) (-1337.514) [-1342.341] (-1339.625) * (-1335.428) (-1337.631) [-1334.008] (-1332.583) -- 0:00:50
798000 -- [-1337.876] (-1340.686) (-1336.209) (-1340.383) * (-1337.116) (-1344.750) [-1333.367] (-1339.585) -- 0:00:50
799000 -- (-1341.628) (-1341.267) [-1335.283] (-1336.673) * (-1337.459) [-1336.594] (-1345.295) (-1334.719) -- 0:00:50
800000 -- (-1342.908) (-1335.736) [-1333.608] (-1347.123) * (-1338.366) [-1337.914] (-1335.137) (-1341.159) -- 0:00:50
Average standard deviation of split frequencies: 0.007570
801000 -- (-1347.078) (-1347.778) [-1339.535] (-1333.295) * [-1334.160] (-1341.676) (-1338.802) (-1337.850) -- 0:00:49
802000 -- (-1335.412) [-1335.363] (-1331.790) (-1335.622) * (-1345.844) (-1344.040) [-1340.257] (-1340.892) -- 0:00:49
803000 -- (-1341.759) (-1331.399) (-1343.120) [-1338.654] * (-1336.121) (-1338.428) [-1338.361] (-1340.904) -- 0:00:49
804000 -- (-1331.836) (-1341.362) (-1336.105) [-1334.149] * (-1330.175) (-1342.861) (-1342.088) [-1337.419] -- 0:00:49
805000 -- (-1337.165) (-1337.331) (-1343.407) [-1333.811] * (-1340.078) (-1338.361) (-1341.572) [-1326.630] -- 0:00:48
Average standard deviation of split frequencies: 0.006893
806000 -- (-1345.717) [-1339.545] (-1336.950) (-1334.786) * (-1344.808) (-1329.402) [-1340.672] (-1335.900) -- 0:00:48
807000 -- (-1348.536) (-1342.302) (-1338.807) [-1334.368] * (-1334.954) [-1336.082] (-1330.630) (-1340.951) -- 0:00:48
808000 -- (-1339.389) (-1339.132) (-1338.921) [-1336.628] * (-1342.471) (-1343.616) [-1335.096] (-1338.961) -- 0:00:48
809000 -- (-1339.647) (-1342.854) (-1335.309) [-1331.737] * (-1334.468) [-1331.855] (-1344.386) (-1351.319) -- 0:00:47
810000 -- (-1350.520) (-1344.803) (-1337.131) [-1338.713] * (-1340.048) (-1337.800) (-1347.054) [-1341.167] -- 0:00:47
Average standard deviation of split frequencies: 0.006604
811000 -- (-1354.856) (-1347.987) [-1332.050] (-1331.341) * [-1335.142] (-1337.482) (-1339.837) (-1337.711) -- 0:00:47
812000 -- (-1335.715) [-1337.480] (-1332.745) (-1346.187) * (-1343.410) (-1334.522) [-1342.044] (-1341.458) -- 0:00:47
813000 -- [-1343.103] (-1334.134) (-1338.791) (-1336.312) * (-1341.324) (-1342.958) [-1328.601] (-1333.610) -- 0:00:46
814000 -- [-1345.324] (-1340.647) (-1330.617) (-1340.050) * (-1342.163) (-1339.519) (-1334.073) [-1332.308] -- 0:00:46
815000 -- (-1340.234) (-1337.155) [-1333.860] (-1338.637) * (-1343.016) (-1340.220) (-1337.468) [-1337.803] -- 0:00:46
Average standard deviation of split frequencies: 0.005901
816000 -- (-1339.081) (-1336.288) [-1337.229] (-1336.006) * (-1344.697) [-1333.751] (-1336.183) (-1339.423) -- 0:00:46
817000 -- (-1342.213) (-1338.561) (-1342.069) [-1328.433] * [-1339.145] (-1344.701) (-1341.688) (-1340.149) -- 0:00:45
818000 -- (-1336.271) (-1335.291) [-1340.232] (-1346.711) * (-1339.988) (-1346.346) (-1354.632) [-1337.583] -- 0:00:45
819000 -- (-1336.948) [-1333.902] (-1341.739) (-1340.057) * (-1340.035) [-1331.807] (-1345.805) (-1346.337) -- 0:00:45
820000 -- [-1336.356] (-1339.112) (-1341.769) (-1347.331) * (-1333.850) (-1350.372) [-1334.827] (-1336.542) -- 0:00:45
Average standard deviation of split frequencies: 0.004883
821000 -- (-1339.933) (-1333.949) [-1337.656] (-1337.982) * (-1349.657) (-1336.729) (-1334.364) [-1335.348] -- 0:00:44
822000 -- (-1339.941) (-1349.987) (-1337.909) [-1337.275] * (-1342.556) [-1337.025] (-1339.936) (-1339.262) -- 0:00:44
823000 -- (-1333.618) (-1340.072) [-1331.993] (-1352.009) * (-1337.333) [-1334.371] (-1338.663) (-1336.808) -- 0:00:44
824000 -- [-1331.385] (-1342.104) (-1340.243) (-1340.179) * (-1341.502) [-1336.364] (-1347.564) (-1333.006) -- 0:00:44
825000 -- (-1341.109) (-1349.557) (-1328.788) [-1332.664] * [-1334.205] (-1335.704) (-1342.531) (-1346.708) -- 0:00:43
Average standard deviation of split frequencies: 0.005218
826000 -- (-1339.394) (-1331.282) (-1339.952) [-1335.836] * [-1337.167] (-1338.857) (-1339.868) (-1341.774) -- 0:00:43
827000 -- [-1333.934] (-1341.821) (-1336.978) (-1333.222) * (-1346.493) [-1326.752] (-1339.421) (-1345.129) -- 0:00:43
828000 -- (-1332.106) (-1340.089) (-1337.139) [-1329.255] * (-1347.681) (-1335.407) (-1338.552) [-1343.767] -- 0:00:43
829000 -- (-1345.893) (-1342.430) [-1330.902] (-1337.505) * [-1337.991] (-1335.977) (-1343.593) (-1339.038) -- 0:00:42
830000 -- (-1346.922) [-1338.040] (-1332.528) (-1336.273) * (-1349.066) [-1339.867] (-1351.542) (-1342.131) -- 0:00:42
Average standard deviation of split frequencies: 0.004945
831000 -- [-1336.686] (-1347.438) (-1341.096) (-1335.101) * [-1335.343] (-1339.318) (-1350.115) (-1337.550) -- 0:00:42
832000 -- (-1345.472) [-1339.314] (-1335.718) (-1338.408) * [-1332.702] (-1342.533) (-1333.733) (-1340.842) -- 0:00:42
833000 -- (-1345.581) (-1336.668) [-1331.430] (-1342.633) * [-1339.046] (-1347.296) (-1342.295) (-1337.883) -- 0:00:41
834000 -- [-1334.365] (-1345.222) (-1345.670) (-1345.873) * [-1344.168] (-1329.918) (-1345.779) (-1338.974) -- 0:00:41
835000 -- (-1344.320) (-1344.319) [-1340.702] (-1336.473) * (-1344.491) (-1344.880) (-1330.768) [-1337.492] -- 0:00:41
Average standard deviation of split frequencies: 0.004592
836000 -- (-1334.741) (-1348.380) (-1340.502) [-1333.186] * (-1342.631) (-1340.733) [-1334.951] (-1331.331) -- 0:00:41
837000 -- (-1346.008) [-1336.881] (-1340.121) (-1339.622) * (-1345.387) (-1337.223) (-1341.103) [-1337.771] -- 0:00:40
838000 -- [-1343.539] (-1331.815) (-1345.021) (-1339.231) * (-1350.160) [-1337.149] (-1331.108) (-1338.620) -- 0:00:40
839000 -- (-1339.213) (-1338.339) (-1339.271) [-1333.707] * [-1339.662] (-1339.006) (-1335.237) (-1338.017) -- 0:00:40
840000 -- (-1340.136) (-1346.852) (-1335.884) [-1336.497] * (-1334.299) (-1347.680) (-1342.312) [-1331.402] -- 0:00:40
Average standard deviation of split frequencies: 0.004887
841000 -- [-1337.115] (-1335.126) (-1341.581) (-1334.762) * [-1341.628] (-1350.791) (-1339.953) (-1338.134) -- 0:00:39
842000 -- [-1334.583] (-1334.333) (-1336.849) (-1340.853) * [-1342.210] (-1334.853) (-1340.696) (-1342.153) -- 0:00:39
843000 -- (-1332.795) [-1336.670] (-1342.127) (-1335.809) * (-1336.575) [-1331.586] (-1339.675) (-1342.594) -- 0:00:39
844000 -- (-1340.232) [-1335.638] (-1337.561) (-1343.327) * (-1335.670) [-1337.583] (-1337.764) (-1338.227) -- 0:00:39
845000 -- (-1344.882) (-1341.967) (-1348.377) [-1335.312] * (-1341.910) (-1345.391) [-1343.167] (-1343.771) -- 0:00:38
Average standard deviation of split frequencies: 0.004736
846000 -- (-1348.998) (-1342.968) [-1330.549] (-1339.614) * (-1337.814) (-1338.759) (-1335.308) [-1335.931] -- 0:00:38
847000 -- (-1348.172) [-1329.367] (-1339.108) (-1343.780) * (-1347.658) (-1344.742) (-1334.837) [-1345.284] -- 0:00:38
848000 -- [-1339.406] (-1330.945) (-1333.397) (-1348.249) * (-1338.538) [-1334.684] (-1338.107) (-1339.997) -- 0:00:38
849000 -- (-1336.647) (-1340.873) [-1333.442] (-1338.095) * (-1334.307) (-1338.824) (-1342.585) [-1336.065] -- 0:00:37
850000 -- (-1346.411) [-1333.834] (-1342.004) (-1340.267) * (-1335.489) (-1343.920) [-1337.925] (-1350.496) -- 0:00:37
Average standard deviation of split frequencies: 0.005106
851000 -- [-1334.712] (-1335.566) (-1332.520) (-1339.238) * (-1337.933) (-1336.281) [-1335.989] (-1343.224) -- 0:00:37
852000 -- (-1340.158) (-1334.605) [-1335.797] (-1338.066) * [-1343.522] (-1341.689) (-1344.141) (-1341.402) -- 0:00:37
853000 -- (-1344.276) [-1339.241] (-1330.889) (-1343.468) * (-1340.736) [-1345.113] (-1345.772) (-1332.998) -- 0:00:36
854000 -- [-1329.558] (-1341.007) (-1342.482) (-1343.071) * (-1345.886) (-1343.565) [-1345.204] (-1337.787) -- 0:00:36
855000 -- (-1331.413) (-1330.711) [-1337.200] (-1332.768) * (-1339.329) (-1347.197) (-1337.919) [-1338.788] -- 0:00:36
Average standard deviation of split frequencies: 0.004956
856000 -- (-1336.375) [-1336.476] (-1337.002) (-1344.359) * (-1337.539) (-1338.099) (-1336.925) [-1339.466] -- 0:00:36
857000 -- [-1341.261] (-1338.467) (-1334.660) (-1339.273) * (-1336.228) [-1331.728] (-1334.508) (-1340.785) -- 0:00:35
858000 -- (-1344.650) [-1347.154] (-1347.273) (-1339.256) * (-1339.640) (-1342.854) (-1335.485) [-1338.066] -- 0:00:35
859000 -- [-1338.985] (-1337.356) (-1339.037) (-1338.780) * (-1341.644) (-1333.803) [-1327.224] (-1338.705) -- 0:00:35
860000 -- [-1339.018] (-1340.330) (-1346.748) (-1346.382) * [-1333.266] (-1332.532) (-1339.695) (-1343.912) -- 0:00:35
Average standard deviation of split frequencies: 0.004851
861000 -- (-1350.300) (-1336.281) [-1338.314] (-1334.266) * (-1337.455) [-1331.475] (-1340.064) (-1338.693) -- 0:00:34
862000 -- (-1336.819) [-1331.556] (-1340.774) (-1347.350) * (-1336.916) (-1332.551) (-1331.543) [-1340.290] -- 0:00:34
863000 -- [-1335.978] (-1340.392) (-1337.460) (-1340.113) * [-1330.073] (-1335.629) (-1339.035) (-1336.141) -- 0:00:34
864000 -- (-1346.192) (-1334.189) (-1340.867) [-1337.813] * (-1338.716) (-1339.898) (-1350.491) [-1333.350] -- 0:00:34
865000 -- (-1333.822) [-1338.346] (-1329.478) (-1332.894) * (-1332.924) [-1336.937] (-1339.188) (-1337.086) -- 0:00:33
Average standard deviation of split frequencies: 0.004821
866000 -- (-1342.411) [-1334.708] (-1344.418) (-1340.274) * (-1336.666) (-1337.997) (-1334.892) [-1332.851] -- 0:00:33
867000 -- (-1334.193) (-1341.724) (-1337.607) [-1337.345] * (-1342.623) (-1337.720) [-1334.769] (-1341.729) -- 0:00:33
868000 -- (-1346.141) (-1335.385) [-1344.661] (-1342.077) * (-1339.264) (-1343.781) [-1342.406] (-1336.528) -- 0:00:33
869000 -- (-1342.710) (-1333.140) [-1336.308] (-1344.260) * (-1343.611) (-1337.347) (-1337.262) [-1338.124] -- 0:00:32
870000 -- [-1334.399] (-1339.168) (-1339.725) (-1336.665) * (-1331.384) (-1330.050) [-1343.798] (-1338.537) -- 0:00:32
Average standard deviation of split frequencies: 0.004254
871000 -- (-1331.883) (-1343.370) [-1341.385] (-1341.106) * (-1342.438) [-1342.830] (-1334.683) (-1348.049) -- 0:00:32
872000 -- [-1332.795] (-1344.016) (-1342.381) (-1336.106) * [-1329.163] (-1338.660) (-1335.445) (-1341.502) -- 0:00:32
873000 -- (-1340.269) (-1338.165) [-1341.714] (-1334.753) * (-1337.212) (-1335.771) (-1337.972) [-1337.592] -- 0:00:31
874000 -- [-1344.018] (-1335.427) (-1349.641) (-1334.235) * (-1344.604) (-1336.830) [-1336.526] (-1341.090) -- 0:00:31
875000 -- (-1337.650) [-1343.619] (-1341.583) (-1345.919) * (-1341.077) (-1344.225) (-1345.405) [-1332.363] -- 0:00:31
Average standard deviation of split frequencies: 0.004459
876000 -- (-1336.421) [-1335.880] (-1347.454) (-1343.613) * [-1339.855] (-1333.546) (-1346.811) (-1335.743) -- 0:00:31
877000 -- [-1334.874] (-1347.110) (-1336.272) (-1344.156) * (-1341.721) (-1339.751) (-1337.415) [-1335.707] -- 0:00:30
878000 -- (-1339.789) [-1340.193] (-1337.799) (-1343.966) * [-1341.723] (-1336.576) (-1334.766) (-1340.377) -- 0:00:30
879000 -- (-1337.652) [-1340.033] (-1336.618) (-1342.649) * [-1338.283] (-1337.506) (-1354.444) (-1336.625) -- 0:00:30
880000 -- [-1337.265] (-1338.610) (-1341.929) (-1355.319) * [-1333.080] (-1337.433) (-1345.346) (-1341.261) -- 0:00:30
Average standard deviation of split frequencies: 0.004665
881000 -- (-1341.065) (-1339.455) (-1344.574) [-1340.197] * (-1341.145) [-1341.666] (-1337.210) (-1344.485) -- 0:00:29
882000 -- (-1337.319) (-1344.380) (-1342.496) [-1333.230] * (-1347.817) (-1335.109) (-1337.964) [-1336.875] -- 0:00:29
883000 -- (-1335.333) (-1336.840) [-1340.248] (-1336.051) * [-1337.328] (-1341.030) (-1342.142) (-1335.807) -- 0:00:29
884000 -- (-1341.941) (-1334.649) (-1343.037) [-1345.567] * (-1337.772) [-1336.702] (-1334.065) (-1338.764) -- 0:00:29
885000 -- [-1338.469] (-1340.915) (-1336.808) (-1346.438) * (-1339.836) [-1336.327] (-1335.943) (-1336.862) -- 0:00:28
Average standard deviation of split frequencies: 0.004218
886000 -- (-1338.271) (-1341.560) [-1332.013] (-1339.788) * [-1343.438] (-1341.657) (-1340.342) (-1334.792) -- 0:00:28
887000 -- [-1336.370] (-1335.618) (-1334.272) (-1336.852) * (-1341.290) (-1340.229) [-1328.919] (-1334.839) -- 0:00:28
888000 -- (-1342.018) (-1345.875) [-1335.616] (-1331.247) * (-1332.366) (-1335.875) [-1335.940] (-1336.838) -- 0:00:28
889000 -- (-1336.449) [-1337.694] (-1353.422) (-1341.523) * (-1338.520) (-1335.240) (-1333.446) [-1338.012] -- 0:00:27
890000 -- (-1330.344) (-1341.214) (-1339.045) [-1331.170] * (-1331.661) [-1337.031] (-1341.248) (-1335.580) -- 0:00:27
Average standard deviation of split frequencies: 0.004045
891000 -- (-1339.046) [-1339.680] (-1348.546) (-1337.690) * (-1339.431) (-1338.451) (-1337.670) [-1337.110] -- 0:00:27
892000 -- (-1339.365) (-1347.315) (-1341.882) [-1343.854] * (-1339.313) (-1338.577) (-1344.082) [-1344.401] -- 0:00:27
893000 -- (-1343.957) (-1340.505) (-1340.825) [-1333.660] * (-1328.787) (-1339.657) [-1334.089] (-1340.097) -- 0:00:26
894000 -- (-1343.609) [-1338.006] (-1340.256) (-1337.863) * [-1334.457] (-1341.066) (-1334.572) (-1338.562) -- 0:00:26
895000 -- (-1339.964) (-1336.119) (-1337.299) [-1334.662] * (-1332.446) (-1341.822) [-1333.193] (-1333.963) -- 0:00:26
Average standard deviation of split frequencies: 0.004059
896000 -- (-1336.418) (-1354.180) [-1340.516] (-1332.731) * [-1332.376] (-1343.234) (-1335.164) (-1349.884) -- 0:00:26
897000 -- (-1337.918) (-1336.972) (-1336.797) [-1337.766] * [-1338.167] (-1339.103) (-1339.605) (-1333.952) -- 0:00:25
898000 -- (-1342.815) (-1342.143) (-1340.415) [-1340.547] * (-1337.040) [-1342.803] (-1342.279) (-1342.558) -- 0:00:25
899000 -- [-1331.911] (-1344.954) (-1340.091) (-1334.924) * [-1338.605] (-1336.783) (-1338.349) (-1332.662) -- 0:00:25
900000 -- (-1339.367) [-1343.659] (-1336.016) (-1339.367) * [-1338.544] (-1337.621) (-1345.821) (-1334.034) -- 0:00:25
Average standard deviation of split frequencies: 0.003776
901000 -- (-1339.318) (-1339.685) (-1342.418) [-1331.186] * (-1337.587) (-1342.919) [-1336.971] (-1333.675) -- 0:00:24
902000 -- (-1341.723) (-1341.851) [-1339.693] (-1337.241) * (-1335.509) (-1339.074) [-1337.694] (-1340.570) -- 0:00:24
903000 -- [-1326.605] (-1332.541) (-1352.603) (-1342.796) * (-1340.214) (-1341.155) [-1346.763] (-1348.031) -- 0:00:24
904000 -- (-1340.021) [-1344.596] (-1342.195) (-1347.927) * (-1338.946) [-1330.969] (-1346.730) (-1340.190) -- 0:00:24
905000 -- [-1334.917] (-1341.767) (-1334.525) (-1341.141) * [-1333.924] (-1332.346) (-1335.388) (-1339.085) -- 0:00:23
Average standard deviation of split frequencies: 0.003828
906000 -- (-1333.751) (-1336.983) [-1336.676] (-1350.233) * (-1331.878) (-1334.317) [-1337.098] (-1344.965) -- 0:00:23
907000 -- (-1352.678) (-1336.886) (-1338.736) [-1339.677] * [-1335.127] (-1345.531) (-1348.270) (-1334.074) -- 0:00:23
908000 -- (-1331.908) (-1348.225) (-1334.443) [-1339.494] * (-1339.823) (-1340.970) [-1344.535] (-1334.031) -- 0:00:23
909000 -- (-1344.703) (-1343.267) (-1346.752) [-1340.914] * (-1340.959) (-1338.144) (-1342.509) [-1337.181] -- 0:00:22
910000 -- (-1341.233) (-1345.285) (-1343.994) [-1342.164] * (-1336.859) (-1336.070) (-1340.383) [-1334.795] -- 0:00:22
Average standard deviation of split frequencies: 0.004215
911000 -- (-1337.350) (-1345.623) (-1333.753) [-1332.612] * (-1339.686) (-1340.931) [-1343.665] (-1334.339) -- 0:00:22
912000 -- (-1334.928) [-1333.820] (-1347.771) (-1336.116) * [-1337.973] (-1342.593) (-1347.466) (-1333.142) -- 0:00:22
913000 -- (-1338.284) [-1336.484] (-1338.614) (-1343.113) * (-1340.731) (-1336.365) [-1340.401] (-1332.856) -- 0:00:21
914000 -- [-1344.727] (-1337.058) (-1339.792) (-1337.353) * (-1338.875) [-1332.799] (-1334.509) (-1347.145) -- 0:00:21
915000 -- (-1343.670) [-1334.776] (-1330.819) (-1348.590) * (-1338.160) (-1348.952) (-1338.507) [-1335.181] -- 0:00:21
Average standard deviation of split frequencies: 0.004668
916000 -- (-1335.737) (-1336.512) [-1335.254] (-1336.253) * (-1342.544) [-1348.013] (-1348.188) (-1333.217) -- 0:00:21
917000 -- (-1339.597) (-1335.012) [-1340.824] (-1340.512) * [-1339.273] (-1337.740) (-1343.850) (-1339.368) -- 0:00:20
918000 -- (-1346.476) (-1343.216) (-1342.208) [-1339.821] * (-1343.776) (-1341.118) [-1343.873] (-1340.419) -- 0:00:20
919000 -- (-1339.451) (-1337.374) (-1333.462) [-1341.072] * (-1336.650) [-1335.733] (-1348.354) (-1344.136) -- 0:00:20
920000 -- (-1339.810) (-1349.601) [-1338.390] (-1339.943) * (-1336.038) (-1339.405) [-1333.390] (-1341.028) -- 0:00:20
Average standard deviation of split frequencies: 0.005084
921000 -- (-1339.949) (-1341.471) (-1339.991) [-1336.132] * [-1332.515] (-1334.704) (-1344.094) (-1337.529) -- 0:00:19
922000 -- (-1339.967) (-1344.998) (-1344.674) [-1340.128] * (-1341.511) (-1334.563) (-1338.695) [-1335.399] -- 0:00:19
923000 -- [-1343.774] (-1342.904) (-1344.221) (-1340.735) * [-1336.501] (-1339.088) (-1345.835) (-1341.085) -- 0:00:19
924000 -- [-1337.481] (-1338.645) (-1347.047) (-1336.463) * (-1338.740) (-1334.280) [-1336.396] (-1341.769) -- 0:00:19
925000 -- (-1331.987) (-1342.573) [-1339.870] (-1333.046) * (-1335.633) (-1343.540) (-1335.529) [-1335.295] -- 0:00:18
Average standard deviation of split frequencies: 0.005527
926000 -- (-1337.332) [-1332.985] (-1339.347) (-1345.401) * [-1335.996] (-1338.873) (-1342.344) (-1342.715) -- 0:00:18
927000 -- (-1334.909) (-1345.913) [-1335.317] (-1337.841) * (-1341.231) [-1345.054] (-1336.605) (-1336.191) -- 0:00:18
928000 -- (-1337.106) [-1336.978] (-1342.876) (-1346.894) * (-1338.845) [-1338.928] (-1341.435) (-1344.017) -- 0:00:18
929000 -- (-1342.498) (-1338.839) (-1328.807) [-1343.563] * (-1340.024) (-1334.578) [-1337.269] (-1328.401) -- 0:00:17
930000 -- (-1330.076) [-1340.664] (-1334.761) (-1342.857) * (-1338.465) (-1344.128) (-1336.479) [-1336.114] -- 0:00:17
Average standard deviation of split frequencies: 0.005897
931000 -- (-1342.065) (-1337.152) [-1331.446] (-1340.429) * (-1345.914) (-1343.624) (-1339.835) [-1338.081] -- 0:00:17
932000 -- (-1343.495) (-1338.329) (-1335.499) [-1341.520] * (-1347.985) (-1333.705) [-1334.524] (-1336.888) -- 0:00:17
933000 -- (-1347.679) (-1341.073) [-1337.049] (-1336.330) * [-1342.049] (-1344.518) (-1330.578) (-1350.894) -- 0:00:16
934000 -- (-1347.806) (-1341.997) (-1343.483) [-1336.638] * [-1333.404] (-1352.678) (-1335.702) (-1339.954) -- 0:00:16
935000 -- (-1342.702) [-1338.116] (-1339.393) (-1338.057) * (-1341.082) (-1340.183) [-1330.537] (-1337.000) -- 0:00:16
Average standard deviation of split frequencies: 0.005576
936000 -- (-1345.771) (-1334.592) (-1335.892) [-1340.282] * (-1342.620) [-1333.233] (-1337.951) (-1336.093) -- 0:00:16
937000 -- (-1335.370) (-1337.586) [-1337.289] (-1332.235) * (-1340.254) (-1337.104) [-1334.795] (-1341.106) -- 0:00:15
938000 -- [-1334.296] (-1341.992) (-1334.180) (-1347.818) * (-1330.786) (-1341.679) [-1339.163] (-1334.016) -- 0:00:15
939000 -- [-1330.902] (-1342.937) (-1341.407) (-1340.852) * [-1333.863] (-1332.121) (-1333.651) (-1336.370) -- 0:00:15
940000 -- [-1332.794] (-1346.258) (-1341.838) (-1340.513) * (-1339.945) (-1334.396) [-1332.913] (-1333.246) -- 0:00:15
Average standard deviation of split frequencies: 0.005584
941000 -- [-1342.569] (-1342.387) (-1342.589) (-1337.452) * (-1347.230) (-1350.107) (-1346.428) [-1334.775] -- 0:00:14
942000 -- (-1347.814) [-1333.249] (-1337.960) (-1336.222) * (-1337.167) (-1345.391) [-1333.111] (-1338.717) -- 0:00:14
943000 -- (-1334.113) (-1344.699) (-1340.768) [-1339.736] * (-1340.773) (-1335.078) [-1333.476] (-1337.368) -- 0:00:14
944000 -- [-1337.046] (-1341.016) (-1343.659) (-1346.029) * (-1336.721) [-1333.056] (-1349.680) (-1337.644) -- 0:00:14
945000 -- (-1347.019) (-1345.538) (-1350.026) [-1340.400] * (-1332.441) [-1332.538] (-1338.351) (-1338.701) -- 0:00:13
Average standard deviation of split frequencies: 0.005837
946000 -- [-1334.581] (-1346.931) (-1349.278) (-1332.124) * (-1342.507) [-1338.651] (-1337.408) (-1340.111) -- 0:00:13
947000 -- [-1336.753] (-1335.505) (-1352.579) (-1333.094) * [-1332.590] (-1334.460) (-1335.762) (-1341.732) -- 0:00:13
948000 -- (-1354.571) (-1338.369) [-1340.786] (-1338.009) * (-1341.413) (-1337.968) (-1339.000) [-1335.644] -- 0:00:13
949000 -- [-1337.237] (-1332.335) (-1332.817) (-1345.023) * (-1338.866) (-1345.544) (-1335.583) [-1339.241] -- 0:00:12
950000 -- (-1340.727) [-1329.461] (-1347.750) (-1342.870) * [-1331.819] (-1336.720) (-1337.932) (-1340.304) -- 0:00:12
Average standard deviation of split frequencies: 0.006021
951000 -- (-1347.723) (-1340.757) (-1346.088) [-1339.635] * (-1343.638) (-1342.735) (-1338.092) [-1342.158] -- 0:00:12
952000 -- [-1331.247] (-1349.699) (-1343.275) (-1328.942) * [-1342.446] (-1342.086) (-1335.057) (-1337.732) -- 0:00:12
953000 -- (-1346.173) (-1340.440) (-1341.396) [-1348.099] * (-1335.287) [-1345.503] (-1340.126) (-1335.963) -- 0:00:11
954000 -- (-1342.953) (-1338.371) [-1338.564] (-1349.269) * [-1340.133] (-1340.290) (-1334.210) (-1337.814) -- 0:00:11
955000 -- (-1337.804) (-1344.522) (-1339.789) [-1332.353] * (-1339.510) (-1341.759) [-1337.848] (-1344.267) -- 0:00:11
Average standard deviation of split frequencies: 0.006234
956000 -- (-1342.975) (-1338.363) [-1338.218] (-1338.994) * (-1338.018) [-1333.601] (-1342.817) (-1338.154) -- 0:00:11
957000 -- (-1345.525) (-1334.182) [-1335.658] (-1339.706) * (-1337.628) (-1338.052) [-1335.882] (-1335.854) -- 0:00:10
958000 -- [-1339.213] (-1341.138) (-1335.481) (-1342.002) * (-1341.228) (-1344.080) [-1330.542] (-1343.552) -- 0:00:10
959000 -- [-1336.566] (-1340.540) (-1336.684) (-1336.301) * (-1337.567) (-1344.338) [-1329.114] (-1340.741) -- 0:00:10
960000 -- (-1333.175) (-1345.651) (-1330.328) [-1344.027] * [-1340.315] (-1332.676) (-1336.413) (-1341.370) -- 0:00:10
Average standard deviation of split frequencies: 0.005538
961000 -- (-1342.601) [-1336.287] (-1334.200) (-1335.848) * (-1340.450) (-1338.312) (-1341.984) [-1337.259] -- 0:00:09
962000 -- (-1341.340) [-1332.024] (-1334.986) (-1342.269) * (-1336.978) (-1339.536) (-1335.585) [-1333.008] -- 0:00:09
963000 -- [-1329.750] (-1332.099) (-1337.837) (-1347.275) * (-1330.987) (-1340.374) (-1336.523) [-1335.703] -- 0:00:09
964000 -- [-1331.754] (-1334.611) (-1345.217) (-1344.249) * [-1338.533] (-1343.235) (-1335.672) (-1341.138) -- 0:00:09
965000 -- (-1338.055) (-1334.304) (-1335.949) [-1344.895] * (-1342.936) (-1333.877) [-1335.357] (-1344.929) -- 0:00:08
Average standard deviation of split frequencies: 0.005507
966000 -- [-1333.614] (-1337.176) (-1335.089) (-1334.076) * (-1347.641) [-1342.155] (-1333.833) (-1339.561) -- 0:00:08
967000 -- [-1335.820] (-1346.713) (-1336.051) (-1334.925) * [-1349.718] (-1344.786) (-1347.249) (-1343.357) -- 0:00:08
968000 -- (-1335.497) [-1339.359] (-1333.674) (-1336.237) * (-1335.232) [-1334.552] (-1336.993) (-1340.649) -- 0:00:08
969000 -- (-1335.417) [-1339.305] (-1344.957) (-1339.717) * (-1342.632) (-1337.824) (-1338.142) [-1330.371] -- 0:00:07
970000 -- [-1333.187] (-1339.568) (-1340.059) (-1340.375) * (-1346.557) (-1343.931) (-1341.028) [-1337.968] -- 0:00:07
Average standard deviation of split frequencies: 0.005481
971000 -- (-1331.950) (-1330.534) [-1343.358] (-1341.475) * (-1340.769) (-1340.461) (-1333.289) [-1332.017] -- 0:00:07
972000 -- (-1339.749) [-1335.862] (-1343.481) (-1349.855) * [-1336.369] (-1343.560) (-1338.281) (-1339.682) -- 0:00:07
973000 -- (-1340.447) (-1341.228) [-1334.540] (-1339.819) * (-1332.802) [-1337.054] (-1341.790) (-1334.810) -- 0:00:06
974000 -- [-1337.812] (-1336.689) (-1341.331) (-1336.335) * (-1338.826) (-1337.157) (-1340.470) [-1333.691] -- 0:00:06
975000 -- (-1337.359) (-1354.434) [-1337.469] (-1337.959) * (-1338.560) [-1339.199] (-1337.678) (-1337.724) -- 0:00:06
Average standard deviation of split frequencies: 0.005727
976000 -- (-1336.510) (-1336.319) [-1340.848] (-1340.321) * (-1340.889) (-1337.050) [-1335.506] (-1335.809) -- 0:00:06
977000 -- (-1340.170) (-1338.041) (-1340.310) [-1341.590] * (-1341.305) (-1342.364) (-1338.827) [-1342.212] -- 0:00:05
978000 -- (-1339.838) [-1338.172] (-1342.510) (-1342.901) * [-1341.385] (-1343.101) (-1334.725) (-1333.995) -- 0:00:05
979000 -- (-1340.079) (-1347.969) [-1335.826] (-1334.981) * (-1339.124) (-1336.345) (-1336.522) [-1335.678] -- 0:00:05
980000 -- (-1333.362) [-1341.600] (-1344.078) (-1339.560) * (-1334.120) (-1341.537) [-1342.823] (-1342.264) -- 0:00:05
Average standard deviation of split frequencies: 0.006283
981000 -- (-1334.487) (-1334.404) [-1342.644] (-1340.225) * [-1334.875] (-1348.541) (-1334.751) (-1330.669) -- 0:00:04
982000 -- [-1337.164] (-1344.709) (-1336.325) (-1346.216) * [-1336.084] (-1346.146) (-1342.049) (-1338.172) -- 0:00:04
983000 -- [-1338.193] (-1343.280) (-1337.884) (-1337.421) * (-1352.187) [-1349.488] (-1338.899) (-1337.921) -- 0:00:04
984000 -- (-1336.121) (-1340.372) (-1334.646) [-1339.146] * [-1337.440] (-1338.848) (-1346.017) (-1337.187) -- 0:00:04
985000 -- (-1335.010) [-1334.683] (-1353.715) (-1341.490) * [-1338.347] (-1342.336) (-1348.268) (-1338.527) -- 0:00:03
Average standard deviation of split frequencies: 0.006523
986000 -- (-1341.658) (-1341.279) [-1336.987] (-1337.677) * (-1331.790) [-1330.511] (-1344.188) (-1338.841) -- 0:00:03
987000 -- [-1338.285] (-1332.672) (-1349.823) (-1337.792) * [-1338.043] (-1336.448) (-1342.124) (-1341.296) -- 0:00:03
988000 -- (-1335.651) (-1345.994) [-1335.237] (-1348.198) * (-1344.769) (-1341.847) [-1339.199] (-1341.449) -- 0:00:03
989000 -- (-1346.289) [-1333.453] (-1339.248) (-1346.730) * (-1333.841) [-1335.681] (-1350.412) (-1345.911) -- 0:00:02
990000 -- (-1338.944) (-1334.914) (-1339.006) [-1335.130] * (-1346.780) (-1335.341) (-1344.952) [-1334.520] -- 0:00:02
Average standard deviation of split frequencies: 0.006424
991000 -- (-1330.218) (-1335.462) (-1344.649) [-1334.152] * (-1341.323) (-1337.155) [-1333.924] (-1340.484) -- 0:00:02
992000 -- [-1342.723] (-1336.284) (-1337.556) (-1346.120) * (-1338.043) [-1333.806] (-1335.308) (-1340.587) -- 0:00:02
993000 -- [-1338.117] (-1332.701) (-1336.816) (-1344.479) * (-1337.418) (-1332.892) (-1339.680) [-1344.865] -- 0:00:01
994000 -- (-1341.937) (-1333.070) [-1338.105] (-1343.658) * (-1340.633) (-1332.359) (-1335.732) [-1333.136] -- 0:00:01
995000 -- (-1343.568) (-1334.225) [-1335.069] (-1332.856) * (-1336.258) (-1344.183) (-1333.455) [-1334.299] -- 0:00:01
Average standard deviation of split frequencies: 0.006525
996000 -- (-1334.141) [-1343.856] (-1360.438) (-1332.306) * (-1343.567) (-1341.100) (-1335.991) [-1333.062] -- 0:00:01
997000 -- [-1340.309] (-1336.057) (-1337.278) (-1339.098) * [-1339.760] (-1334.345) (-1333.059) (-1341.459) -- 0:00:00
998000 -- [-1334.451] (-1343.694) (-1339.933) (-1352.497) * (-1339.102) [-1333.276] (-1332.115) (-1334.106) -- 0:00:00
999000 -- (-1331.048) (-1338.870) (-1338.543) [-1335.928] * (-1346.950) (-1334.104) (-1333.991) [-1332.676] -- 0:00:00
1000000 -- [-1337.486] (-1335.794) (-1338.601) (-1346.830) * (-1342.879) (-1340.478) [-1337.869] (-1338.491) -- 0:00:00
Average standard deviation of split frequencies: 0.006898
Analysis completed in 4 mins 11 seconds
Analysis used 250.84 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1323.45
Likelihood of best state for "cold" chain of run 2 was -1324.27
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
65.7 % ( 65 %) Dirichlet(Revmat{all})
78.7 % ( 71 %) Slider(Revmat{all})
27.4 % ( 25 %) Dirichlet(Pi{all})
30.3 % ( 29 %) Slider(Pi{all})
61.9 % ( 31 %) Multiplier(Alpha{1,2})
63.1 % ( 38 %) Multiplier(Alpha{3})
55.7 % ( 29 %) Slider(Pinvar{all})
30.8 % ( 27 %) ExtSPR(Tau{all},V{all})
19.6 % ( 16 %) ExtTBR(Tau{all},V{all})
36.5 % ( 33 %) NNI(Tau{all},V{all})
38.2 % ( 41 %) ParsSPR(Tau{all},V{all})
26.9 % ( 15 %) Multiplier(V{all})
41.3 % ( 37 %) Nodeslider(V{all})
26.4 % ( 31 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
64.8 % ( 59 %) Dirichlet(Revmat{all})
78.7 % ( 63 %) Slider(Revmat{all})
27.9 % ( 26 %) Dirichlet(Pi{all})
29.8 % ( 30 %) Slider(Pi{all})
61.0 % ( 36 %) Multiplier(Alpha{1,2})
61.5 % ( 39 %) Multiplier(Alpha{3})
55.1 % ( 20 %) Slider(Pinvar{all})
30.4 % ( 39 %) ExtSPR(Tau{all},V{all})
19.6 % ( 22 %) ExtTBR(Tau{all},V{all})
36.7 % ( 30 %) NNI(Tau{all},V{all})
38.2 % ( 40 %) ParsSPR(Tau{all},V{all})
27.0 % ( 21 %) Multiplier(V{all})
41.0 % ( 44 %) Nodeslider(V{all})
26.3 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.74 0.52 0.35
2 | 166443 0.76 0.55
3 | 166997 166785 0.77
4 | 166963 166575 166237
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.74 0.52 0.35
2 | 166432 0.76 0.55
3 | 166645 166788 0.77
4 | 166445 166761 166929
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1335.03
| 11 |
| 1 2 1 2|
| 2 2 1 2 2 |
| 1 1 2 1 1 2 |
| 2 21 2 2 1 1 |
| 2 *22 2212 2 221 2 |
|112 22 1 2 1 11 2 1 1 12 12 22 * |
|2 2 11 2 2 2 2 2 1 2 *1* 11 |
| 11 1 1 2 2 2 1 22 111 1 2 2 * * 1|
| 1 2 1 1 2 2 1 1 |
| 1 2 2 |
| 1 2* 1 1 21 1 |
| 1 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1339.62
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1331.89 -1346.38
2 -1331.71 -1345.93
--------------------------------------
TOTAL -1331.79 -1346.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.181796 0.001664 0.109722 0.263033 0.175751 1218.48 1359.74 1.000
r(A<->C){all} 0.095408 0.001745 0.020009 0.179879 0.090827 584.71 639.12 1.000
r(A<->G){all} 0.193150 0.003917 0.081192 0.316460 0.187526 531.87 633.81 1.000
r(A<->T){all} 0.129528 0.001677 0.050569 0.205870 0.125765 641.21 688.82 1.001
r(C<->G){all} 0.082927 0.001948 0.006809 0.170743 0.077436 535.35 538.70 1.002
r(C<->T){all} 0.446711 0.005634 0.302958 0.591715 0.445733 492.05 661.01 1.000
r(G<->T){all} 0.052276 0.000904 0.001399 0.107482 0.046708 666.12 721.95 1.000
pi(A){all} 0.234538 0.000252 0.204329 0.264894 0.234470 1170.97 1247.13 1.000
pi(C){all} 0.238216 0.000250 0.208011 0.269383 0.238124 1170.94 1184.51 1.000
pi(G){all} 0.184880 0.000217 0.154451 0.212161 0.184721 964.82 1083.87 1.001
pi(T){all} 0.342366 0.000323 0.307979 0.377669 0.342225 1167.99 1205.21 1.000
alpha{1,2} 0.212172 0.041576 0.000034 0.497893 0.172808 1192.21 1270.71 1.000
alpha{3} 2.088664 1.719717 0.095375 4.695116 1.806299 1064.92 1193.02 1.000
pinvar{all} 0.707510 0.007495 0.532277 0.839112 0.723256 783.94 893.06 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
---------------
1 -- .********
2 -- .*.......
3 -- ..*......
4 -- ...*.....
5 -- ....*....
6 -- .....*...
7 -- ......*..
8 -- .......*.
9 -- ........*
10 -- ...**....
11 -- .....***.
12 -- .****...*
13 -- ..***...*
14 -- .**.....*
15 -- .....*.*.
16 -- .....**..
17 -- ......**.
18 -- ..*.....*
19 -- .*......*
20 -- ..***....
21 -- ...**...*
22 -- .**..****
23 -- ...*****.
---------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
10 3002 1.000000 0.000000 1.000000 1.000000 2
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 1916 0.638241 0.018844 0.624917 0.651566 2
13 1593 0.530646 0.010835 0.522985 0.538308 2
14 1135 0.378081 0.011777 0.369753 0.386409 2
15 1019 0.339440 0.001413 0.338441 0.340440 2
16 995 0.331446 0.006124 0.327115 0.335776 2
17 988 0.329114 0.004711 0.325783 0.332445 2
18 855 0.284810 0.000471 0.284477 0.285143 2
19 767 0.255496 0.009893 0.248501 0.262492 2
20 674 0.224517 0.009422 0.217855 0.231179 2
21 490 0.163225 0.000942 0.162558 0.163891 2
22 477 0.158894 0.017430 0.146569 0.171219 2
23 326 0.108594 0.004711 0.105263 0.111925 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.029023 0.000127 0.010170 0.050897 0.027263 1.000 2
length{all}[2] 0.015731 0.000051 0.004481 0.030096 0.014566 1.000 2
length{all}[3] 0.022978 0.000080 0.008720 0.041410 0.021373 1.000 2
length{all}[4] 0.001634 0.000003 0.000001 0.004863 0.001143 1.000 2
length{all}[5] 0.001608 0.000003 0.000002 0.004884 0.001114 1.000 2
length{all}[6] 0.001698 0.000003 0.000000 0.005211 0.001174 1.001 2
length{all}[7] 0.001714 0.000003 0.000000 0.005214 0.001174 1.000 2
length{all}[8] 0.001694 0.000003 0.000000 0.005043 0.001160 1.000 2
length{all}[9] 0.016519 0.000053 0.004962 0.031531 0.015367 1.000 2
length{all}[10] 0.046364 0.000235 0.022387 0.077125 0.043836 1.000 2
length{all}[11] 0.020412 0.000079 0.006506 0.039109 0.018845 1.000 2
length{all}[12] 0.009011 0.000036 0.000010 0.021106 0.007750 1.001 2
length{all}[13] 0.008599 0.000025 0.000553 0.018301 0.007776 0.999 2
length{all}[14] 0.008682 0.000035 0.000062 0.019796 0.007435 1.001 2
length{all}[15] 0.001704 0.000003 0.000001 0.005153 0.001167 0.999 2
length{all}[16] 0.001663 0.000003 0.000001 0.004815 0.001121 0.999 2
length{all}[17] 0.001735 0.000003 0.000001 0.005084 0.001193 0.999 2
length{all}[18] 0.004319 0.000016 0.000001 0.011680 0.003078 1.005 2
length{all}[19] 0.006219 0.000021 0.000015 0.014762 0.005294 0.999 2
length{all}[20] 0.003404 0.000012 0.000013 0.009962 0.002481 0.999 2
length{all}[21] 0.002874 0.000008 0.000005 0.009034 0.002028 0.998 2
length{all}[22] 0.007785 0.000034 0.000170 0.019225 0.006158 0.999 2
length{all}[23] 0.006602 0.000025 0.000002 0.017493 0.005264 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006898
Maximum standard deviation of split frequencies = 0.018844
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------ C6 (6)
| |
|-------------------------100-------------------------+------------------ C7 (7)
| |
+ \------------------ C8 (8)
|
| /------------------------------------------------------ C2 (2)
| |
| | /------------------------------------ C3 (3)
\--------64-------+ |
| | /------------------ C4 (4)
\--------53-------+-------100-------+
| \------------------ C5 (5)
|
\------------------------------------ C9 (9)
Phylogram (based on average branch lengths):
/-------------------------------- C1 (1)
|
| /-- C6 (6)
| |
|---------------------+-- C7 (7)
| |
+ \-- C8 (8)
|
| /------------------ C2 (2)
| |
| | /-------------------------- C3 (3)
\--------+ |
| | /- C4 (4)
\--------+----------------------------------------------------+
| \- C5 (5)
|
\------------------- C9 (9)
|----------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (128 trees sampled):
50 % credible set contains 11 trees
90 % credible set contains 46 trees
95 % credible set contains 63 trees
99 % credible set contains 100 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
Running FUBAR...
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\
***************** TYPES OF STANDARD ANALYSES *****************
(1) Selection Analyses
(2) Evolutionary Hypothesis Testing
(3) Relative evolutionary rate inference
(4) Coevolutionary analysis
(5) Basic Analyses
(6) Codon Selection Analyses
(7) Compartmentalization
(8) Data File Tools
(9) Miscellaneous
(10) Model Comparison
(11) Kernel Analysis Tools
(12) Molecular Clock
(13) Phylogeny Reconstruction
(14) Positive Selection
(15) Recombination
(16) Selection/Recombination
(17) Relative Rate
(18) Relative Ratio
(19) Substitution Rates
Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' *****************
(1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution).
(2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood).
(3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting).
(4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection).
(5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification).
(6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood).
(7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation).
Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types):
Analysis Description
--------------------
Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a
coding sequence alignment to determine whether some sites have been
subject to pervasive purifying or diversifying selection. v2.1
introduces two more methods for estimating the posterior distribution of
grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation
Bayes approximation (fastest). Please note that a FUBAR analysis
generates a cache and a results JSON file in the same directory as
directory as the original alignment. HyPhy needs to have write
privileges to this directory. For example if the original file is in
/home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there
will also exist FUBAR-generated files
/home/sergei/FUBAR/data/pol.nex.FUBAR.json,
/home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide
checkpointing so that a partially completed analysis can be restarted.
- __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree
(one per partition)
- __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring
selection (2013), Mol Biol Evol. 30(5):1196-205
- __Written by__: Sergei L Kosakovsky Pond
- __Contact Information__: spond@temple.edu
- __Analysis Version__: 2.1
####Choose Genetic Code
1. [**Universal**] Universal code. (Genebank transl_table=1).
2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2).
3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3).
4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4).
5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5).
6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6).
7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9).
8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10).
9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12).
10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13).
11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14).
12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15).
13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16).
14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21).
15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22).
16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23).
17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24).
18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25).
19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26).
>Please choose an option (or press q to cancel selection):
>Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`)
>A tree was found in the data file: `(C1,(C6,C7,C8),(C2,(C3,(C4,C5),C9)))`
>Would you like to use it (y/n)?
>Loaded a multiple sequence alignment with **9** sequences, **223** codons, and **1** partitions from `/data//pss_subsets/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna`
> FUBAR will write cache and result files to _/data//pss_subsets/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna.FUBAR.json_, respectively
> Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer):
####Posterior estimation method
1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation)
2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed)
3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default)
>Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5):
### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model
* Log(L) = -1348.31, AIC-c = 2738.77 (21 estimated parameters)
* Tree length (expected substitutions/site) for partition 1 : 0.113
### Computing the phylogenetic likelihood function on the grid
* Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid
* Best scaling achieved for
* synonymous rate = 2.815
* non-synonymous rate = 0.286
* Computing conditional site likelihoods on a 20 x 20 rate grid
### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights
* Using the following settings
* Dirichlet alpha : 0.5
### Tabulating site-level results
----
## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=9, Len=223
BY140535_orf5_AWH65914_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPVVIQKETHGGEPSSLNHVITCIPLTGYVAALVVNACFYPL
BY140562_orf5_AWH65925_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPVVIQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
BtPa_GD2013_NA_AIA62347_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPVVIQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
HKU5_1_LMH03f_NS3d_YP_001039966_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPLVIQKETHGGEPSSPNHVIACIPLTGYVAALVVNACFYPL
LMH03f_NS3d_ABN10879_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPLVIQKETHGGEPSSPNHVIACIPLTGYVAALVVNACFYPL
TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPVVFQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
TT06f_NS3d_ABN10897_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPVVFQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
TT07f_NS3d_ABN10906_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPVVFQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL
YD13403_orf5_AWH65936_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPVVIQKETHGGEPSSLNDVITCIPLTGYVASLVVNACFYPL
**********:*:*********** *.**:*********:**********
BY140535_orf5_AWH65914_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQGTQQPVGICLMVYCI
BY140562_orf5_AWH65925_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI
BtPa_GD2013_NA_AIA62347_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 LLCLPYSSCRASVCKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI
HKU5_1_LMH03f_NS3d_YP_001039966_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 LFCLPYSSCRASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI
LMH03f_NS3d_ABN10879_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 LFCLPYSSCRASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI
TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI
TT06f_NS3d_ABN10897_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI
TT07f_NS3d_ABN10906_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI
YD13403_orf5_AWH65936_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 LLCLPYSSCRASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI
*:**********:*********************:.**************
BY140535_orf5_AWH65914_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
BY140562_orf5_AWH65925_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ILIAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
BtPa_GD2013_NA_AIA62347_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
HKU5_1_LMH03f_NS3d_YP_001039966_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
LMH03f_NS3d_ABN10879_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
TT06f_NS3d_ABN10897_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
TT07f_NS3d_ABN10906_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
YD13403_orf5_AWH65936_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ILMAIWTFDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW
**:****:******************************************
BY140535_orf5_AWH65914_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
BY140562_orf5_AWH65925_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
BtPa_GD2013_NA_AIA62347_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
HKU5_1_LMH03f_NS3d_YP_001039966_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
LMH03f_NS3d_ABN10879_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 FVKNFNQRCRCTNCFFAHSATYLECIFISRFAKTTLVSISDFQLNGSHST
TT06f_NS3d_ABN10897_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 FVKNFNQRCRCTNCFFAHSATYLECIFISRFAKTTLVSISDFQLNGSHST
TT07f_NS3d_ABN10906_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 FVKNFNQRCRCTNCFFAHSATYLECIFISRFAKTTLVSISDFQLNGSHST
YD13403_orf5_AWH65936_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST
************************* *****:******************
BY140535_orf5_AWH65914_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 VFVPFNSRDSVPLHIIAPSVLTV
BY140562_orf5_AWH65925_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 VFVPFNSRDSVPLHIIAPSVLTV
BtPa_GD2013_NA_AIA62347_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 VFVPFNSRDSVPLHIIAPSVLTV
HKU5_1_LMH03f_NS3d_YP_001039966_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 VFVPFNSRDSVPLHIIAPSVLTV
LMH03f_NS3d_ABN10879_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 VFVPFNSRDSVPLHIIAPSVLTV
TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 VFVPFNSRDSVPLHIIAPSVLTV
TT06f_NS3d_ABN10897_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 VFVPFNSRDSVPLHIIAPSVLTV
TT07f_NS3d_ABN10906_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 VFVPFNSRDSVPLHIIAPSVLTV
YD13403_orf5_AWH65936_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 VFVPFNSRDSVPLHIIAPSVLTV
***********************
>BY140535_orf5_AWH65914_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ATGGCTTTTTCGCCATCCCTGTTCCAGCCTGTTGTAATCCAAAAGGAGACACACGGCGGTGAACCTAGCAGTCTTAATCATGTTATCACATGCATCCCTCTTACAGGCTATGTTGCCGCTCTTGTGGTTAATGCATGTTTCTACCCTCTACTACTCTGCTTGCCTTATAGCAGTTGTAGGGCTAGTATATGTAAGACCTTGGTACTTTATGTGCTGATGCTTTACAATTTCATATTGTCGTGTATCCTTGTTCAGGGTACACAACAACCCGTTGGCATATGCCTTATGGTATATTGCATAATATTAATGGCGATCTGGACTATCGACAGAGTTCGATTTTGTCTACTGATTAGATCATTACGTCCACTTATTGACATGAGGTCAAATTTCATCCGTGTCAATACAGTTGCAGGCGGGGTTGTTATACCTGTTAACTATAGCAAACCCTGGTTTGTCAAAAATTTCAATCAGCGTTGTCGCTGTACAAATTGTTTCTTTGCGCACTCAGCAACATATCTCGAGTGCACATTCATTAGCCGTTTCTCTAAAACCACTCTTGTTTCCATTAGTGACTTTCAGCTTAACGGTTCTCATTCAACTGTTTTCGTGCCTTTCAATAGCCGCGATTCAGTACCTCTTCACATAATCGCACCCAGCGTGCTTACAGTT >BY140562_orf5_AWH65925_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ATGGCTTTTTCGCCATCTCTGTTCCAGCCAGTTGTAATCCAAAAGGAGACACACGGCGGTGAACCTAGCAGTCTTAATGATGTTATCACATGCATTCCTCTTACAGGCTATGTTGCCGCTCTTGTGGTTAATGCATGTTTCTACCCGCTACTACTCTGCTTGCCTTATAGCAGTTGTAGGGCTAGTATATGTAAAACCTTGGTACTCTATGTGCTGATGCTTTACAATTTCATTTTGTCATGTATCCTTGTTGAGGACACACAACAACCTGTTGGCATATGCCTTATGGTATATTGCATAATATTAATAGCGATCTGGACTATCGACCGAGTTCGATTTTGTCTACTGATTAGATCATTACGTCCACTTATTGACATGAGGTCAAATTTCATTCGTGTCAATACAGTTGCAGGCGGGGTTGTTATACCTGTTAACTATAGCAAACCCTGGTTTGTCAAAAATTTTAATCAGCGTTGTCGCTGTACAAATTGTTTCTTTGCGCACTCAGCTACATATCTCGAGTGCACATTCATAAGCCGTTTCTCTAAAACCACTCTTGTCTCCATTAGTGACTTTCAGCTTAACGGTTCTCATTCAACTGTTTTCGTGCCTTTCAATAGCCGCGATTCAGTACCTCTTCACATAATCGCACCCAGCGTGCTTACAGTT >BtPa_GD2013_NA_AIA62347_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGCTTTTTCGCCATCTCTGTTCCAGCCAGTCGTAATCCAAAAGGAGACACACGGCGGTGAACCTAGCAGTCTTAATGATGTTATCACATGCATTCCTCTTACAGGCTATGTTGCCGCTCTTGTGGTTAATGCATGTTTTTACCCGTTACTACTCTGCTTGCCTTATAGCAGTTGTAGGGCTAGTGTATGTAAGACATTGGTACTCTATGTGCTGATGCTTTACAATTTCATCTTGTCATGTATCCTTGTACAGGACACACAACAACCTGTTGGCATATGCCTCATGGTATATTGCATTATACTAATGGCGATCTGGACTATCGACCGAGTTCGATTTTGTCTGCTGATCAGATCATTACGTCCACTTATTGACATGAGGTCAAATTTCATCCGTGTCAATACAGTTGCAGGCGGGGTTGTTATACCTGTTAACTATAGCAAACCCTGGTTTGTCAAAAATTTTAACCAGCGTTGTCGCTGTACAAATTGTTTCTTTGCGCACTCAGCAACATATCTCGAGTGCACATTCATAAGCCGTTTCTCTAAAACCACTCTTGTTTCCATTAGTGACTTTCAGCTTAACGGTTCTCATTCAACTGTTTTCGTGCCTTTCAATAGCCGCGATTCAGTACCTCTTCACATAATCGCACCCAGCGTGCTTACAGTT >HKU5_1_LMH03f_NS3d_YP_001039966_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGCTTTTTCGCCATCCCTGTTTCAGCCACTTGTCATCCAAAAGGAGACACACGGTGGTGAACCTAGCAGCCCTAATCATGTCATCGCATGCATACCTCTTACAGGCTATGTTGCCGCTCTTGTGGTTAATGCATGCTTTTACCCTCTACTATTCTGCTTACCTTATAGCAGTTGTAGGGCTAGTGTATGTAAGACCTTGGTACTCTATGTGCTGATGCTTTACAATTTCATTTTGTCGTGTATCCTAGTTGAGGACACACAACAACCTGTTGGCATATGCCTTATGGTATATTGCATAATATTAATGGCGATCTGGACTATCGACAGAGTTCGATTTTGTCTGCTGATCAGATCATTACGTCCACTTATTGACATGAGGTCAAATTTCATCCGTGTCAATACTGTTGCAGGCGGGGTTGTTATACCTGTTAACTATAGCAAACCCTGGTTTGTCAAAAATTTTAACCAGCGTTGTCGCTGTACAAATTGTTTCTTTGCGCACTCAGCAACCTATCTCGAGTGCACATTTATAAGCCGTTTCTCTAAAACCACTCTTGTTTCCATTAGTGACTTTCAGCTTAACGGTTCTCATTCAACTGTTTTCGTGCCTTTCAATAGCCGCGATTCAGTACCTCTTCACATAATCGCACCCAGCGTGCTTACAGTT >LMH03f_NS3d_ABN10879_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGCTTTTTCGCCATCCCTGTTTCAGCCACTTGTCATCCAAAAGGAGACACACGGTGGTGAACCTAGCAGCCCTAATCATGTCATCGCATGCATACCTCTTACAGGCTATGTTGCCGCTCTTGTGGTTAATGCATGCTTTTACCCTCTACTATTCTGCTTACCTTATAGCAGTTGTAGGGCTAGTGTATGTAAGACCTTGGTACTCTATGTGCTGATGCTTTACAATTTCATTTTGTCGTGTATCCTAGTTGAGGACACACAACAACCTGTTGGCATATGCCTTATGGTATATTGCATAATATTAATGGCGATCTGGACTATCGACAGAGTTCGATTTTGTCTGCTGATCAGATCATTACGTCCACTTATTGACATGAGGTCAAATTTCATCCGTGTCAATACTGTTGCAGGCGGGGTTGTTATACCTGTTAACTATAGCAAACCCTGGTTTGTCAAAAATTTTAACCAGCGTTGTCGCTGTACAAATTGTTTCTTTGCGCACTCAGCAACCTATCTCGAGTGCACATTTATAAGCCGTTTCTCTAAAACCACTCTTGTTTCCATTAGTGACTTTCAGCTTAACGGTTCTCATTCAACTGTTTTCGTGCCTTTCAATAGCCGCGATTCAGTACCTCTTCACATAATCGCACCCAGCGTGCTTACAGTT >TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGCTTTTTCGCCATCCCTGTTCCAGCCAGTTGTATTCCAAAAGGAGACACACGGCGGTGAACCTAGCAGTCTTAATGATGTCATCACATGCATTCCTCTTACAGGCTATGTTGCCGCTCTTGTGGTTAATGCATGTTTCTACCCGCTACTACTCTGCTTGCCTTATAGCAGTTGTAGGGCTAGTATATGTAAGACCTTGGTACTCTATGTGCTGATGCTTTACAATTTCATTTTGTCGTGTATCCTTGTTCAGGATACACAACAACCTGTTGGCATATGCCTTATGGTATATTGCATAATATTAATGGCGATCTGGACTATCGACAGAGTTCGATTTTGTCTATTGATCAGATCATTACGTCCACTTATTGACATGAGGTCAAATTTCATTCGTGTCAATACAGTTGCAGGCGGGGTTGTTATACCTGTTAATTATAGCAAACCCTGGTTTGTCAAAAATTTTAACCAGCGTTGTCGCTGTACAAATTGTTTCTTTGCGCACTCAGCAACCTATCTTGAGTGCATATTCATAAGCCGTTTCGCTAAAACCACTCTTGTTTCCATTAGTGACTTTCAGCTTAACGGTTCTCATTCAACTGTTTTCGTGCCTTTCAATAGCCGCGATTCAGTACCTCTTCACATAATCGCACCCAGCGTGCTTACAGTT >TT06f_NS3d_ABN10897_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGCTTTTTCGCCATCCCTGTTCCAGCCAGTTGTATTCCAAAAGGAGACACACGGCGGTGAACCTAGCAGTCTTAATGATGTCATCACATGCATTCCTCTTACAGGCTATGTTGCCGCTCTTGTGGTTAATGCATGTTTCTACCCGCTACTACTCTGCTTGCCTTATAGCAGTTGTAGGGCTAGTATATGTAAGACCTTGGTACTCTATGTGCTGATGCTTTACAATTTCATTTTGTCGTGTATCCTTGTTCAGGATACACAACAACCTGTTGGCATATGCCTTATGGTATATTGCATAATATTAATGGCGATCTGGACTATCGACAGAGTTCGATTTTGTCTATTGATCAGATCATTACGTCCACTTATTGACATGAGGTCAAATTTCATTCGTGTCAATACAGTTGCAGGCGGGGTTGTTATACCTGTTAATTATAGCAAACCCTGGTTTGTCAAAAATTTTAACCAGCGTTGTCGCTGTACAAATTGTTTCTTTGCGCACTCAGCAACCTATCTTGAGTGCATATTCATAAGCCGTTTCGCTAAAACCACTCTTGTTTCCATTAGTGACTTTCAGCTTAACGGTTCTCATTCAACTGTTTTCGTGCCTTTCAATAGCCGCGATTCAGTACCTCTTCACATAATCGCACCCAGCGTGCTTACAGTT >TT07f_NS3d_ABN10906_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGCTTTTTCGCCATCCCTGTTCCAGCCAGTTGTATTCCAAAAGGAGACACACGGCGGTGAACCTAGCAGTCTTAATGATGTCATCACATGCATTCCTCTTACAGGCTATGTTGCCGCTCTTGTGGTTAATGCATGTTTCTACCCGCTACTACTCTGCTTGCCTTATAGCAGTTGTAGGGCTAGTATATGTAAGACCTTGGTACTCTATGTGCTGATGCTTTACAATTTCATTTTGTCGTGTATCCTTGTTCAGGATACACAACAACCTGTTGGCATATGCCTTATGGTATATTGCATAATATTAATGGCGATCTGGACTATCGACAGAGTTCGATTTTGTCTATTGATCAGATCATTACGTCCACTTATTGACATGAGGTCAAATTTCATTCGTGTCAATACAGTTGCAGGCGGGGTTGTTATACCTGTTAATTATAGCAAACCCTGGTTTGTCAAAAATTTTAACCAGCGTTGTCGCTGTACAAATTGTTTCTTTGCGCACTCAGCAACCTATCTTGAGTGCATATTCATAAGCCGTTTCGCTAAAACCACTCTTGTTTCCATTAGTGACTTTCAGCTTAACGGTTCTCATTCAACTGTTTTCGTGCCTTTCAATAGCCGCGATTCAGTACCTCTTCACATAATCGCACCCAGCGTGCTTACAGTT >YD13403_orf5_AWH65936_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ATGGCTTTTTCGCCATCTCTGTTCCAGCCTGTTGTAATCCAAAAGGAGACACACGGCGGTGAACCTAGCAGTCTTAATGATGTTATCACATGCATTCCTCTTACAGGCTATGTTGCCTCTCTTGTGGTTAATGCATGTTTTTACCCGCTACTACTCTGCTTGCCTTATAGCAGTTGTAGGGCTAGTGTATGTAAAACCTTGGTACTCTATGTGCTGATGCTTTACAATTTCATTTTGTCGTGTATCCTTGTTGAGGACACACAACAACCTGTTGGCATATGCCTTATGGTATATTGCATAATATTAATGGCGATCTGGACTTTCGACCGAGTTCGATTTTGTCTGCTGATCAGATCATTACGTCCACTTATTGACATGAGGTCAAATTTCATTCGTGTCAATACAGTTGCAGGCGGGGTTGTTATACCTGTCAACTATAGCAAACCCTGGTTTGTCAAAAATTTCAACCAGCGTTGTCGCTGTACAAATTGTTTCTTTGCGCACTCAGCAACATATCTAGAGTGCACATTCATAAGCCGTTTCTCTAAAACCACTCTTGTTTCCATTAGTGACTTTCAGCTTAACGGTTCTCATTCAACTGTTTTCGTGCCTTTCAATAGCCGCGATTCAGTACCTCTTCACATAATCGCACCCAGCGTGCTTACAGTT
>BY140535_orf5_AWH65914_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPVVIQKETHGGEPSSLNHVITCIPLTGYVAALVVNACFYPL LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQGTQQPVGICLMVYCI ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST VFVPFNSRDSVPLHIIAPSVLTV >BY140562_orf5_AWH65925_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPVVIQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI ILIAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST VFVPFNSRDSVPLHIIAPSVLTV >BtPa_GD2013_NA_AIA62347_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPVVIQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL LLCLPYSSCRASVCKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST VFVPFNSRDSVPLHIIAPSVLTV >HKU5_1_LMH03f_NS3d_YP_001039966_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPLVIQKETHGGEPSSPNHVIACIPLTGYVAALVVNACFYPL LFCLPYSSCRASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST VFVPFNSRDSVPLHIIAPSVLTV >LMH03f_NS3d_ABN10879_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPLVIQKETHGGEPSSPNHVIACIPLTGYVAALVVNACFYPL LFCLPYSSCRASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST VFVPFNSRDSVPLHIIAPSVLTV >TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPVVFQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW FVKNFNQRCRCTNCFFAHSATYLECIFISRFAKTTLVSISDFQLNGSHST VFVPFNSRDSVPLHIIAPSVLTV >TT06f_NS3d_ABN10897_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPVVFQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW FVKNFNQRCRCTNCFFAHSATYLECIFISRFAKTTLVSISDFQLNGSHST VFVPFNSRDSVPLHIIAPSVLTV >TT07f_NS3d_ABN10906_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPVVFQKETHGGEPSSLNDVITCIPLTGYVAALVVNACFYPL LLCLPYSSCRASICKTLVLYVLMLYNFILSCILVQDTQQPVGICLMVYCI ILMAIWTIDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW FVKNFNQRCRCTNCFFAHSATYLECIFISRFAKTTLVSISDFQLNGSHST VFVPFNSRDSVPLHIIAPSVLTV >YD13403_orf5_AWH65936_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MAFSPSLFQPVVIQKETHGGEPSSLNDVITCIPLTGYVASLVVNACFYPL LLCLPYSSCRASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCI ILMAIWTFDRVRFCLLIRSLRPLIDMRSNFIRVNTVAGGVVIPVNYSKPW FVKNFNQRCRCTNCFFAHSATYLECTFISRFSKTTLVSISDFQLNGSHST VFVPFNSRDSVPLHIIAPSVLTV
Reading sequence file /data//pss_subsets/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/fasta/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1
Found 9 sequences of length 669
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 3.2%
Found 38 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 5
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 37 polymorphic sites
**p-Value(s)**
----------
NSS: 4.09e-01 (1000 permutations)
Max Chi^2: 2.20e-02 (1000 permutations)
PHI (Permutation): 9.34e-01 (1000 permutations)
PHI (Normal): 9.20e-01
#NEXUS
[ID: 4250677722]
begin taxa;
dimensions ntax=9;
taxlabels
BY140535_orf5_AWH65914_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
BY140562_orf5_AWH65925_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
BtPa_GD2013_NA_AIA62347_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5
HKU5_1_LMH03f_NS3d_YP_001039966_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
LMH03f_NS3d_ABN10879_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
TT06f_NS3d_ABN10897_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
TT07f_NS3d_ABN10906_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
YD13403_orf5_AWH65936_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
;
end;
begin trees;
translate
1 BY140535_orf5_AWH65914_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5,
2 BY140562_orf5_AWH65925_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5,
3 BtPa_GD2013_NA_AIA62347_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
4 HKU5_1_LMH03f_NS3d_YP_001039966_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
5 LMH03f_NS3d_ABN10879_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
6 TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
7 TT06f_NS3d_ABN10897_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
8 TT07f_NS3d_ABN10906_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
9 YD13403_orf5_AWH65936_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:2.726314e-02,(6:1.173607e-03,7:1.174415e-03,8:1.159853e-03)1.000:1.884538e-02,(2:1.456569e-02,(3:2.137346e-02,(4:1.142996e-03,5:1.114230e-03)1.000:4.383562e-02,9:1.536681e-02)0.531:7.775590e-03)0.638:7.749505e-03);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:2.726314e-02,(6:1.173607e-03,7:1.174415e-03,8:1.159853e-03):1.884538e-02,(2:1.456569e-02,(3:2.137346e-02,(4:1.142996e-03,5:1.114230e-03):4.383562e-02,9:1.536681e-02):7.775590e-03):7.749505e-03);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1332.57 -1348.71
2 -1332.32 -1346.39
--------------------------------------
TOTAL -1332.44 -1348.11
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.181332 0.001707 0.110885 0.259924 0.175716 1114.36 1165.77 1.000
r(A<->C){all} 0.095638 0.001785 0.018928 0.178157 0.090109 658.96 773.07 1.000
r(A<->G){all} 0.192400 0.003841 0.089070 0.326833 0.186267 444.00 597.65 1.000
r(A<->T){all} 0.128453 0.001593 0.060550 0.215161 0.124740 446.47 617.86 1.000
r(C<->G){all} 0.083122 0.001853 0.000001 0.161692 0.078363 511.94 536.09 1.005
r(C<->T){all} 0.447278 0.005710 0.308139 0.600852 0.445352 501.88 589.86 1.001
r(G<->T){all} 0.053109 0.000949 0.002127 0.112029 0.047844 609.15 645.84 1.000
pi(A){all} 0.235339 0.000258 0.204184 0.266228 0.234684 987.97 1056.70 1.001
pi(C){all} 0.237689 0.000240 0.206521 0.266617 0.237732 1283.38 1330.44 1.000
pi(G){all} 0.185011 0.000200 0.157070 0.212770 0.184837 1200.38 1238.87 1.000
pi(T){all} 0.341961 0.000317 0.305524 0.375553 0.341827 1239.97 1250.83 1.000
alpha{1,2} 0.212505 0.035763 0.000023 0.520230 0.173766 1164.20 1228.42 1.000
alpha{3} 2.066277 1.612726 0.224464 4.509700 1.804892 1232.73 1241.94 1.000
pinvar{all} 0.706063 0.007049 0.529868 0.836086 0.721558 705.91 746.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,(C6,C7,C8),(C2,(C3,(C4,C5),C9)))` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **9** sequences, **223** codons, and **1** partitions from `/data//pss_subsets/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3d_ABN10888_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -1348.31, AIC-c = 2738.77 (21 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.113 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 2.815 * non-synonymous rate = 0.286 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results ---- ## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
