--- EXPERIMENT NOTES Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500 --- EXPERIMENT PROPERTIES --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/mrbayes_input.nex.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1865.80 -1879.55 2 -1865.96 -1879.94 -------------------------------------- TOTAL -1865.88 -1879.76 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/mrbayes_input.nex.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.451659 0.005179 0.323877 0.597337 0.445167 1230.19 1275.51 1.000 r(A<->C){all} 0.069541 0.000812 0.020476 0.126434 0.066554 671.91 780.18 1.002 r(A<->G){all} 0.187722 0.001733 0.107723 0.268560 0.184180 760.38 801.50 1.000 r(A<->T){all} 0.117332 0.000831 0.067041 0.178537 0.115295 780.34 796.02 1.000 r(C<->G){all} 0.083463 0.000925 0.028729 0.142312 0.080474 811.69 819.43 1.000 r(C<->T){all} 0.510754 0.003250 0.390813 0.616064 0.510946 723.80 740.97 1.000 r(G<->T){all} 0.031189 0.000316 0.001092 0.065092 0.028921 914.98 929.28 1.000 pi(A){all} 0.267854 0.000231 0.237550 0.297582 0.267691 1091.38 1201.93 1.001 pi(C){all} 0.227746 0.000197 0.200981 0.256092 0.227221 1085.74 1293.37 1.001 pi(G){all} 0.194010 0.000183 0.168189 0.220006 0.193778 1310.99 1355.43 1.000 pi(T){all} 0.310390 0.000249 0.281256 0.343061 0.310388 1177.66 1211.45 1.000 alpha{1,2} 0.167802 0.005098 0.024165 0.303018 0.161687 977.08 1044.71 1.005 alpha{3} 2.116727 1.265798 0.479979 4.366005 1.874239 1005.88 1093.26 1.001 pinvar{all} 0.503875 0.007331 0.332414 0.659123 0.516264 873.67 876.92 1.002 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. --- CODEML SUMMARY
-- Starting log on Tue Oct 25 21:15:09 GMT 2022 -- -- Iteration: /working_dir/input/2_modified/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result-- CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=9, Len=257 C1 MTDDSMDLSLDCVIAQPSSEIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C2 MTDDSMDLNLDCVIAQPSSEIVMMPLSPISTRKRRRHPKNKTRYAKRRFS C3 MTDDSMDLSLDCVIAQPSSEIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C4 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C5 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C6 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C7 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C8 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C9 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT ******.********** ****************** ** *******: C1 PVVPSDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV C2 PLEPRDIIMCEKPTHCIRLVFDQSLRWLHFDGVKNILADYGVTFSSDLHV C3 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV C4 PVEPNDIIMCDKPTHCIRLVFDQSLRWVHFDGIKNILTDYDVIFNPDLHV C5 PVEPNDIIMCDKPTHCIRLVFDQSLRWVHFDGIKNILTDYDVIFNPDLHV C6 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV C7 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV C8 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV C9 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV *: * *****:****************:****:****:**.* *..**** C1 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C2 TVALVCAGNGVTFSDLTPLTFLLADMLLEFNGISTLGQTLVIGVREYPWL C3 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFNLGQTLVIGAREYCWL C4 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C5 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C6 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C7 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C8 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C9 TIALVCAGNGVTFSDLTPLTFILAEMLLEFNGNFTLGQTLVIGAREYHWL *:*******************:**:******* .********.*** ** C1 PQELKTNVGKAIPQSKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C2 PKDLKSNVGQAIPQSKEWLVEHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C3 PQELKANVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDSVQQSY C4 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C5 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C6 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C7 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C8 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C9 PQELKTNVGKAIPQAKEWLVHHGYNVYHTGLPTHMSLAKLHSLDFVQQSY *::**:***:****:*****.*********************** ***** C1 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C2 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C3 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C4 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C5 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C6 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C7 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C8 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C9 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY ************************************************** C1 RACFPGR C2 RACFPGR C3 RACFPGR C4 RACFPGR C5 RACFPGR C6 RACFPGR C7 RACFPGR C8 RACFPGR C9 RACFPGR ******* -- Starting log on Tue Oct 25 21:15:59 GMT 2022 -- -- Iteration: /working_dir/input/2_modified/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result-- CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.08 sec, SCORE=997, Nseq=9, Len=257 C1 MTDDSMDLSLDCVIAQPSSEIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C2 MTDDSMDLNLDCVIAQPSSEIVMMPLSPISTRKRRRHPKNKTRYAKRRFS C3 MTDDSMDLSLDCVIAQPSSEIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C4 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C5 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C6 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C7 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C8 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C9 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT ******.********** ****************** ** *******: C1 PVVPSDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV C2 PLEPRDIIMCEKPTHCIRLVFDQSLRWLHFDGVKNILADYGVTFSSDLHV C3 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV C4 PVEPNDIIMCDKPTHCIRLVFDQSLRWVHFDGIKNILTDYDVIFNPDLHV C5 PVEPNDIIMCDKPTHCIRLVFDQSLRWVHFDGIKNILTDYDVIFNPDLHV C6 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV C7 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV C8 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV C9 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV *: * *****:****************:****:****:**.* *..**** C1 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C2 TVALVCAGNGVTFSDLTPLTFLLADMLLEFNGISTLGQTLVIGVREYPWL C3 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFNLGQTLVIGAREYCWL C4 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C5 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C6 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C7 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C8 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C9 TIALVCAGNGVTFSDLTPLTFILAEMLLEFNGNFTLGQTLVIGAREYHWL *:*******************:**:******* .********.*** ** C1 PQELKTNVGKAIPQSKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C2 PKDLKSNVGQAIPQSKEWLVEHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C3 PQELKANVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDSVQQSY C4 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C5 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C6 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C7 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C8 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C9 PQELKTNVGKAIPQAKEWLVHHGYNVYHTGLPTHMSLAKLHSLDFVQQSY *::**:***:****:*****.*********************** ***** C1 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C2 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C3 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C4 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C5 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C6 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C7 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C8 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C9 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY ************************************************** C1 RACFPGR C2 RACFPGR C3 RACFPGR C4 RACFPGR C5 RACFPGR C6 RACFPGR C7 RACFPGR C8 RACFPGR C9 RACFPGR ******* -- Starting log on Tue Oct 25 21:15:09 GMT 2022 -- -- Iteration: /working_dir/input/2_modified/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result-- CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=9, Len=257 C1 MTDDSMDLSLDCVIAQPSSEIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C2 MTDDSMDLNLDCVIAQPSSEIVMMPLSPISTRKRRRHPKNKTRYAKRRFS C3 MTDDSMDLSLDCVIAQPSSEIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C4 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C5 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C6 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C7 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C8 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT C9 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT ******.********** ****************** ** *******: C1 PVVPSDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV C2 PLEPRDIIMCEKPTHCIRLVFDQSLRWLHFDGVKNILADYGVTFSSDLHV C3 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV C4 PVEPNDIIMCDKPTHCIRLVFDQSLRWVHFDGIKNILTDYDVIFNPDLHV C5 PVEPNDIIMCDKPTHCIRLVFDQSLRWVHFDGIKNILTDYDVIFNPDLHV C6 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV C7 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV C8 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV C9 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV *: * *****:****************:****:****:**.* *..**** C1 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C2 TVALVCAGNGVTFSDLTPLTFLLADMLLEFNGISTLGQTLVIGVREYPWL C3 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFNLGQTLVIGAREYCWL C4 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C5 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C6 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C7 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C8 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL C9 TIALVCAGNGVTFSDLTPLTFILAEMLLEFNGNFTLGQTLVIGAREYHWL *:*******************:**:******* .********.*** ** C1 PQELKTNVGKAIPQSKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C2 PKDLKSNVGQAIPQSKEWLVEHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C3 PQELKANVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDSVQQSY C4 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C5 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C6 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C7 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C8 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY C9 PQELKTNVGKAIPQAKEWLVHHGYNVYHTGLPTHMSLAKLHSLDFVQQSY *::**:***:****:*****.*********************** ***** C1 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C2 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C3 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C4 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C5 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C6 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C7 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C8 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY C9 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY ************************************************** C1 RACFPGR C2 RACFPGR C3 RACFPGR C4 RACFPGR C5 RACFPGR C6 RACFPGR C7 RACFPGR C8 RACFPGR C9 RACFPGR ******* -- Starting log on Tue Oct 25 21:31:21 GMT 2022 -- -- Iteration: /working_dir/pss_subsets/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/gapped_alignment/fubar,TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1-- MrBayes v3.2.6 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/mrbayes_input.nex" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 9 taxa and 771 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Taxon 8 -> C8 Taxon 9 -> C9 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1666733486 Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called 'first_pos' Defining charset called 'second_pos' Defining charset called 'third_pos' Defining partition called 'by_codon' Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1072728814 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 4172891057 Seed = 1202804895 Swapseed = 1666733486 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma The distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Shape parameter is exponentially distributed with parameter (1.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma The distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Shape parameter is exponentially distributed with parameter (1.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma The distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Shape parameter is exponentially distributed with parameter (1.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Active parameters: Partition(s) Parameters 1 2 3 --------------------------- Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 --------------------------- Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(1.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(1.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 0.91 % Dirichlet(Revmat{all}) 0.91 % Slider(Revmat{all}) 0.91 % Dirichlet(Pi{all}) 0.91 % Slider(Pi{all}) 1.82 % Multiplier(Alpha{1,2}) 1.82 % Multiplier(Alpha{3}) 1.82 % Slider(Pinvar{all}) 9.09 % ExtSPR(Tau{all},V{all}) 9.09 % ExtTBR(Tau{all},V{all}) 9.09 % NNI(Tau{all},V{all}) 9.09 % ParsSPR(Tau{all},V{all}) 36.36 % Multiplier(V{all}) 12.73 % Nodeslider(V{all}) 5.45 % TLMultiplier(V{all}) Division 1 has 23 unique site patterns Division 2 has 22 unique site patterns Division 3 has 60 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2329.641565 -- 32.479477 Chain 2 -- -2366.246078 -- 32.479477 Chain 3 -- -2256.296227 -- 32.479477 Chain 4 -- -2345.757216 -- 32.479477 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2352.298174 -- 32.479477 Chain 2 -- -2381.432569 -- 32.479477 Chain 3 -- -2325.469872 -- 32.479477 Chain 4 -- -2346.148626 -- 32.479477 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2329.642] (-2366.246) (-2256.296) (-2345.757) * [-2352.298] (-2381.433) (-2325.470) (-2346.149) 1000 -- (-1898.156) (-1916.677) (-1915.351) [-1898.722] * (-1899.195) [-1907.372] (-1887.962) (-1932.681) -- 0:00:00 2000 -- (-1886.248) (-1884.091) (-1894.354) [-1884.946] * (-1888.386) (-1883.376) [-1876.362] (-1894.350) -- 0:00:00 3000 -- (-1886.806) (-1880.470) (-1884.200) [-1877.530] * (-1875.538) [-1873.192] (-1880.075) (-1889.632) -- 0:05:32 4000 -- (-1884.971) (-1878.283) (-1881.028) [-1874.224] * (-1870.256) [-1870.202] (-1879.978) (-1886.366) -- 0:04:09 5000 -- (-1873.889) (-1870.511) (-1870.527) [-1871.972] * [-1872.861] (-1883.529) (-1879.952) (-1882.119) -- 0:03:19 Average standard deviation of split frequencies: 0.091662 6000 -- [-1864.184] (-1874.175) (-1884.307) (-1876.720) * (-1874.890) [-1873.532] (-1889.706) (-1870.789) -- 0:05:31 7000 -- [-1870.082] (-1872.391) (-1873.497) (-1872.945) * (-1871.183) (-1875.486) (-1874.541) [-1870.470] -- 0:04:43 8000 -- (-1870.808) (-1871.500) (-1879.926) [-1874.758] * (-1879.185) (-1877.492) [-1865.488] (-1877.288) -- 0:04:08 9000 -- [-1866.626] (-1872.869) (-1879.297) (-1871.778) * (-1873.214) (-1873.023) [-1873.761] (-1874.435) -- 0:05:30 10000 -- (-1872.505) (-1874.530) (-1876.762) [-1868.770] * [-1876.364] (-1864.240) (-1876.670) (-1871.800) -- 0:04:57 Average standard deviation of split frequencies: 0.088388 11000 -- (-1870.503) [-1872.371] (-1876.230) (-1866.140) * (-1874.714) (-1873.409) (-1876.124) [-1868.245] -- 0:04:29 12000 -- (-1877.000) [-1870.232] (-1875.831) (-1870.322) * (-1883.649) [-1866.197] (-1869.691) (-1866.226) -- 0:05:29 13000 -- (-1872.014) (-1869.300) (-1870.522) [-1868.432] * (-1875.952) [-1869.537] (-1884.256) (-1876.687) -- 0:05:03 14000 -- (-1871.239) (-1865.467) [-1869.098] (-1871.368) * (-1869.550) [-1863.341] (-1867.987) (-1866.322) -- 0:04:41 15000 -- (-1877.939) (-1871.809) [-1869.465] (-1869.294) * [-1870.112] (-1869.349) (-1870.863) (-1874.467) -- 0:05:28 Average standard deviation of split frequencies: 0.073657 16000 -- (-1875.313) (-1892.106) (-1875.785) [-1876.955] * (-1882.261) (-1870.531) (-1871.180) [-1874.664] -- 0:05:07 17000 -- (-1881.490) (-1871.532) [-1874.615] (-1871.823) * (-1872.595) [-1865.964] (-1877.467) (-1871.752) -- 0:05:46 18000 -- [-1871.887] (-1872.273) (-1878.594) (-1878.821) * (-1869.939) (-1872.242) (-1882.624) [-1872.856] -- 0:05:27 19000 -- [-1875.871] (-1869.205) (-1883.571) (-1877.099) * (-1869.174) (-1877.754) (-1874.256) [-1868.245] -- 0:05:09 20000 -- (-1866.085) [-1872.039] (-1875.593) (-1879.190) * (-1868.776) (-1869.214) (-1869.835) [-1874.333] -- 0:05:43 Average standard deviation of split frequencies: 0.058062 21000 -- (-1870.014) (-1872.089) [-1869.501] (-1873.425) * (-1874.034) [-1872.329] (-1873.331) (-1872.852) -- 0:05:26 22000 -- (-1861.675) (-1874.868) (-1871.028) [-1871.648] * (-1872.249) (-1883.752) (-1873.558) [-1879.462] -- 0:05:11 23000 -- (-1873.576) (-1863.905) [-1868.133] (-1870.497) * [-1876.833] (-1873.104) (-1880.653) (-1865.053) -- 0:05:39 24000 -- [-1877.398] (-1864.818) (-1871.578) (-1870.794) * [-1870.153] (-1869.317) (-1873.173) (-1881.210) -- 0:05:25 25000 -- (-1867.204) (-1871.471) (-1882.518) [-1868.929] * (-1885.233) (-1881.036) (-1868.532) [-1874.106] -- 0:05:12 Average standard deviation of split frequencies: 0.034614 26000 -- (-1865.864) (-1871.548) [-1878.202] (-1876.052) * (-1870.943) [-1865.663] (-1874.053) (-1868.913) -- 0:05:37 27000 -- (-1870.349) [-1863.954] (-1873.511) (-1875.343) * (-1867.222) (-1873.093) [-1870.413] (-1874.513) -- 0:05:24 28000 -- [-1864.972] (-1880.660) (-1878.099) (-1872.171) * (-1869.076) [-1882.909] (-1871.465) (-1877.346) -- 0:05:12 29000 -- [-1874.004] (-1869.818) (-1878.291) (-1877.556) * (-1879.891) [-1872.704] (-1876.361) (-1871.917) -- 0:05:34 30000 -- (-1866.709) (-1875.888) [-1867.402] (-1871.037) * (-1877.236) (-1872.251) (-1869.106) [-1866.050] -- 0:05:23 Average standard deviation of split frequencies: 0.026551 31000 -- (-1865.604) [-1871.745] (-1876.365) (-1872.627) * [-1878.179] (-1874.410) (-1870.863) (-1869.748) -- 0:05:12 32000 -- (-1871.312) [-1869.350] (-1870.949) (-1875.809) * (-1869.708) (-1874.120) (-1868.202) [-1868.194] -- 0:05:32 33000 -- [-1867.746] (-1871.031) (-1880.691) (-1876.448) * [-1870.557] (-1862.177) (-1881.255) (-1867.248) -- 0:05:22 34000 -- (-1868.192) [-1869.624] (-1877.548) (-1880.894) * (-1879.463) [-1869.066] (-1873.273) (-1868.802) -- 0:05:12 35000 -- [-1867.302] (-1868.610) (-1873.275) (-1886.140) * [-1870.222] (-1878.477) (-1871.338) (-1874.884) -- 0:05:30 Average standard deviation of split frequencies: 0.028570 36000 -- [-1866.787] (-1879.164) (-1876.028) (-1878.042) * (-1870.946) (-1881.343) [-1872.689] (-1874.556) -- 0:05:21 37000 -- (-1869.237) (-1880.425) (-1868.780) [-1868.490] * [-1860.263] (-1874.839) (-1868.458) (-1872.874) -- 0:05:12 38000 -- [-1872.675] (-1874.374) (-1866.031) (-1884.354) * (-1871.801) (-1875.629) [-1874.515] (-1878.068) -- 0:05:29 39000 -- [-1870.507] (-1867.112) (-1874.221) (-1869.874) * (-1871.214) (-1864.495) [-1867.474] (-1874.400) -- 0:05:20 40000 -- (-1877.929) (-1867.548) (-1872.796) [-1863.007] * (-1874.586) [-1868.740] (-1873.246) (-1874.540) -- 0:05:12 Average standard deviation of split frequencies: 0.022130 41000 -- (-1872.486) [-1867.239] (-1877.337) (-1876.662) * [-1867.263] (-1866.367) (-1864.507) (-1876.467) -- 0:05:27 42000 -- (-1883.835) [-1876.482] (-1872.999) (-1875.120) * (-1870.724) (-1873.819) [-1870.025] (-1874.368) -- 0:05:19 43000 -- [-1867.518] (-1867.662) (-1869.962) (-1879.393) * (-1879.494) [-1874.101] (-1873.857) (-1873.677) -- 0:05:11 44000 -- (-1874.190) (-1863.800) [-1863.714] (-1876.008) * (-1866.422) (-1868.317) (-1875.650) [-1870.677] -- 0:05:25 45000 -- [-1875.086] (-1875.625) (-1871.211) (-1877.379) * (-1879.009) (-1870.692) [-1869.689] (-1882.364) -- 0:05:18 Average standard deviation of split frequencies: 0.023291 46000 -- (-1876.399) [-1867.339] (-1874.101) (-1883.707) * (-1870.237) (-1868.868) [-1867.432] (-1873.509) -- 0:05:11 47000 -- [-1878.916] (-1866.993) (-1874.734) (-1887.467) * (-1871.696) [-1867.407] (-1870.165) (-1866.285) -- 0:05:24 48000 -- [-1867.587] (-1873.119) (-1871.891) (-1871.049) * (-1865.877) (-1868.811) [-1876.806] (-1875.802) -- 0:05:17 49000 -- (-1869.139) (-1872.644) [-1869.700] (-1869.851) * (-1874.051) [-1872.142] (-1875.090) (-1882.156) -- 0:05:10 50000 -- [-1872.929] (-1881.795) (-1875.637) (-1868.241) * (-1867.982) (-1882.799) (-1870.747) [-1870.988] -- 0:05:23 Average standard deviation of split frequencies: 0.025375 51000 -- (-1870.049) (-1876.371) [-1869.566] (-1868.960) * [-1870.440] (-1870.998) (-1873.712) (-1873.720) -- 0:05:16 52000 -- (-1871.220) (-1872.877) [-1873.486] (-1873.267) * (-1872.168) [-1868.737] (-1870.525) (-1873.871) -- 0:05:28 53000 -- (-1869.425) [-1866.751] (-1872.386) (-1882.761) * (-1870.682) (-1877.611) (-1872.857) [-1868.947] -- 0:05:21 54000 -- (-1865.114) (-1877.066) (-1876.626) [-1869.151] * (-1866.088) [-1872.998] (-1873.244) (-1875.010) -- 0:05:15 55000 -- (-1872.905) [-1865.713] (-1874.088) (-1875.667) * (-1885.288) (-1872.364) [-1865.899] (-1881.433) -- 0:05:26 Average standard deviation of split frequencies: 0.026019 56000 -- (-1872.029) (-1875.319) (-1883.422) [-1875.505] * (-1872.391) (-1887.729) [-1886.053] (-1874.174) -- 0:05:20 57000 -- (-1876.638) (-1876.017) (-1868.779) [-1872.487] * (-1871.060) [-1875.001] (-1870.094) (-1873.513) -- 0:05:14 58000 -- [-1872.384] (-1874.364) (-1873.381) (-1875.805) * (-1867.942) [-1868.654] (-1878.944) (-1867.322) -- 0:05:24 59000 -- (-1880.013) [-1869.864] (-1877.493) (-1877.898) * (-1868.008) [-1878.098] (-1871.772) (-1870.652) -- 0:05:18 60000 -- (-1886.479) [-1868.162] (-1868.698) (-1876.951) * (-1880.301) (-1871.378) [-1874.448] (-1871.828) -- 0:05:13 Average standard deviation of split frequencies: 0.030375 61000 -- (-1873.587) (-1872.105) [-1870.060] (-1873.255) * (-1875.864) [-1874.395] (-1869.915) (-1870.521) -- 0:05:23 62000 -- (-1872.768) (-1880.312) [-1873.051] (-1870.681) * (-1884.874) [-1878.501] (-1875.367) (-1884.436) -- 0:05:17 63000 -- (-1875.102) [-1862.739] (-1870.905) (-1873.542) * (-1873.720) (-1876.619) [-1870.397] (-1871.676) -- 0:05:12 64000 -- [-1868.297] (-1880.907) (-1873.559) (-1887.020) * [-1869.351] (-1871.921) (-1877.928) (-1879.150) -- 0:05:21 65000 -- [-1872.665] (-1879.139) (-1876.975) (-1873.165) * (-1871.762) (-1870.980) [-1873.727] (-1879.726) -- 0:05:16 Average standard deviation of split frequencies: 0.026622 66000 -- (-1867.692) (-1872.684) (-1870.024) [-1874.001] * (-1871.591) (-1878.704) (-1871.194) [-1876.386] -- 0:05:11 67000 -- (-1872.298) (-1877.892) (-1873.339) [-1865.055] * [-1867.881] (-1879.403) (-1873.579) (-1878.427) -- 0:05:20 68000 -- (-1865.602) [-1876.987] (-1878.415) (-1881.759) * (-1872.015) (-1879.690) (-1881.277) [-1870.978] -- 0:05:15 69000 -- (-1870.462) [-1880.597] (-1870.002) (-1866.853) * (-1868.317) [-1871.343] (-1880.579) (-1868.613) -- 0:05:10 70000 -- (-1872.558) (-1875.228) [-1873.370] (-1873.313) * (-1873.777) (-1873.987) (-1875.781) [-1868.779] -- 0:05:18 Average standard deviation of split frequencies: 0.024864 71000 -- (-1879.913) (-1882.041) (-1865.825) [-1875.051] * (-1865.906) (-1869.148) (-1874.229) [-1870.778] -- 0:05:14 72000 -- (-1874.646) [-1872.872] (-1868.680) (-1870.408) * (-1870.676) (-1868.470) (-1871.041) [-1866.024] -- 0:05:09 73000 -- (-1875.751) (-1869.464) [-1867.340] (-1879.230) * (-1876.285) (-1877.759) [-1869.556] (-1875.302) -- 0:05:17 74000 -- (-1878.420) (-1872.217) [-1867.182] (-1866.964) * (-1873.690) (-1866.098) [-1867.940] (-1886.159) -- 0:05:12 75000 -- [-1871.041] (-1879.227) (-1872.346) (-1871.481) * (-1875.891) (-1869.845) [-1868.053] (-1865.122) -- 0:05:08 Average standard deviation of split frequencies: 0.023683 76000 -- (-1874.391) [-1878.141] (-1868.886) (-1872.482) * [-1866.705] (-1867.858) (-1874.299) (-1881.855) -- 0:05:16 77000 -- (-1866.132) (-1870.295) [-1873.797] (-1871.710) * [-1864.253] (-1873.718) (-1868.836) (-1869.012) -- 0:05:11 78000 -- (-1870.762) [-1871.708] (-1872.681) (-1875.808) * (-1869.333) (-1878.817) (-1877.068) [-1870.005] -- 0:05:07 79000 -- [-1869.779] (-1869.518) (-1878.212) (-1870.365) * [-1869.532] (-1874.087) (-1880.168) (-1872.221) -- 0:05:14 80000 -- (-1867.638) (-1874.985) (-1866.996) [-1868.879] * (-1880.146) [-1875.340] (-1869.133) (-1869.289) -- 0:05:10 Average standard deviation of split frequencies: 0.022313 81000 -- (-1868.728) (-1872.095) [-1865.411] (-1872.061) * (-1881.849) (-1877.261) [-1868.970] (-1872.160) -- 0:05:17 82000 -- (-1878.800) (-1872.798) (-1870.775) [-1868.410] * [-1870.045] (-1876.125) (-1869.280) (-1872.981) -- 0:05:13 83000 -- (-1875.943) (-1870.023) (-1868.531) [-1867.126] * (-1877.053) [-1878.199] (-1873.517) (-1872.400) -- 0:05:09 84000 -- (-1864.808) (-1879.658) (-1872.145) [-1867.005] * (-1879.192) (-1877.336) [-1869.038] (-1873.645) -- 0:05:16 85000 -- (-1865.570) (-1864.099) (-1878.193) [-1870.555] * (-1877.662) (-1868.548) [-1866.866] (-1874.096) -- 0:05:12 Average standard deviation of split frequencies: 0.024417 86000 -- (-1861.811) [-1874.390] (-1880.751) (-1869.575) * (-1876.845) [-1864.798] (-1866.837) (-1870.561) -- 0:05:08 87000 -- (-1881.756) [-1871.993] (-1880.077) (-1877.402) * (-1876.263) (-1879.534) [-1867.738] (-1870.428) -- 0:05:14 88000 -- [-1868.260] (-1873.049) (-1876.383) (-1868.105) * (-1871.651) (-1869.386) [-1872.876] (-1867.970) -- 0:05:10 89000 -- (-1879.729) [-1868.510] (-1877.507) (-1873.429) * (-1866.284) (-1883.499) (-1871.714) [-1868.331] -- 0:05:07 90000 -- (-1876.381) [-1863.868] (-1889.786) (-1871.667) * (-1867.292) (-1877.213) [-1868.341] (-1865.913) -- 0:05:13 Average standard deviation of split frequencies: 0.025524 91000 -- [-1868.963] (-1878.261) (-1883.692) (-1876.713) * (-1871.435) (-1865.067) (-1875.995) [-1873.156] -- 0:05:09 92000 -- (-1872.416) (-1869.486) [-1872.447] (-1878.705) * (-1865.201) (-1872.164) (-1874.482) [-1873.626] -- 0:05:05 93000 -- [-1873.461] (-1869.094) (-1884.527) (-1884.215) * [-1871.517] (-1867.009) (-1871.775) (-1868.799) -- 0:05:12 94000 -- [-1871.250] (-1872.031) (-1867.946) (-1875.709) * (-1875.392) (-1878.000) [-1867.772] (-1876.969) -- 0:05:08 95000 -- (-1876.478) (-1883.708) (-1883.966) [-1876.705] * (-1875.183) [-1875.865] (-1869.948) (-1875.137) -- 0:05:04 Average standard deviation of split frequencies: 0.026784 96000 -- (-1870.582) (-1867.149) (-1874.427) [-1868.513] * [-1863.536] (-1876.386) (-1873.815) (-1868.702) -- 0:05:10 97000 -- [-1876.070] (-1866.543) (-1881.229) (-1876.911) * (-1862.840) (-1870.955) [-1876.885] (-1869.511) -- 0:05:07 98000 -- [-1873.294] (-1879.917) (-1875.202) (-1875.042) * (-1873.768) (-1870.558) (-1876.606) [-1873.644] -- 0:05:03 99000 -- [-1877.151] (-1893.277) (-1876.318) (-1868.321) * [-1869.763] (-1875.099) (-1873.213) (-1873.673) -- 0:05:09 100000 -- (-1877.868) (-1873.723) (-1878.146) [-1869.307] * [-1866.879] (-1880.606) (-1867.814) (-1873.652) -- 0:05:06 Average standard deviation of split frequencies: 0.024266 101000 -- (-1861.712) [-1867.099] (-1876.492) (-1866.995) * [-1876.941] (-1892.309) (-1876.078) (-1872.325) -- 0:05:02 102000 -- (-1871.929) (-1869.318) (-1869.362) [-1864.077] * (-1885.411) (-1882.109) [-1873.850] (-1872.435) -- 0:05:08 103000 -- (-1870.606) [-1875.464] (-1869.764) (-1877.744) * (-1868.149) [-1874.058] (-1875.733) (-1889.709) -- 0:05:04 104000 -- (-1874.406) (-1868.838) [-1877.342] (-1872.010) * (-1871.193) (-1882.031) [-1866.624] (-1874.856) -- 0:05:01 105000 -- [-1869.510] (-1882.672) (-1881.039) (-1866.249) * (-1875.769) [-1873.715] (-1877.275) (-1879.007) -- 0:05:06 Average standard deviation of split frequencies: 0.023853 106000 -- [-1875.316] (-1874.770) (-1877.957) (-1869.237) * (-1876.769) [-1871.984] (-1867.255) (-1886.745) -- 0:05:03 107000 -- (-1892.407) (-1881.118) (-1888.410) [-1865.352] * (-1878.544) (-1865.333) (-1874.010) [-1866.575] -- 0:05:00 108000 -- (-1871.154) (-1883.157) (-1869.543) [-1870.137] * [-1871.808] (-1875.676) (-1881.157) (-1872.684) -- 0:05:05 109000 -- [-1869.955] (-1870.860) (-1874.575) (-1872.217) * (-1873.647) [-1872.287] (-1868.644) (-1874.175) -- 0:05:02 110000 -- [-1865.522] (-1875.096) (-1879.099) (-1871.829) * (-1876.424) (-1873.141) [-1868.858] (-1871.783) -- 0:04:59 Average standard deviation of split frequencies: 0.025171 111000 -- (-1878.322) (-1876.302) (-1876.568) [-1866.113] * (-1869.817) (-1864.977) (-1870.165) [-1871.597] -- 0:05:04 112000 -- (-1873.338) [-1876.351] (-1886.270) (-1884.140) * (-1876.868) (-1872.745) [-1871.494] (-1879.299) -- 0:05:01 113000 -- (-1874.064) (-1875.143) [-1873.079] (-1874.281) * (-1880.298) (-1872.329) (-1873.176) [-1879.345] -- 0:05:06 114000 -- (-1872.706) (-1875.158) (-1873.526) [-1873.393] * [-1867.686] (-1875.224) (-1877.015) (-1882.367) -- 0:05:03 115000 -- (-1871.804) [-1870.497] (-1873.472) (-1891.107) * [-1874.536] (-1875.181) (-1879.883) (-1877.919) -- 0:05:00 Average standard deviation of split frequencies: 0.020319 116000 -- (-1875.787) (-1872.208) [-1871.219] (-1882.889) * (-1867.893) [-1871.267] (-1879.762) (-1866.799) -- 0:05:04 117000 -- (-1875.460) [-1867.072] (-1872.301) (-1876.655) * (-1869.951) (-1875.179) (-1876.124) [-1869.199] -- 0:05:01 118000 -- [-1868.233] (-1873.628) (-1878.238) (-1872.170) * [-1871.067] (-1868.094) (-1871.352) (-1873.886) -- 0:04:58 119000 -- (-1879.308) [-1866.996] (-1880.664) (-1870.902) * (-1877.275) [-1871.538] (-1869.744) (-1874.476) -- 0:05:03 120000 -- (-1878.444) (-1877.244) (-1890.952) [-1873.111] * (-1876.171) [-1870.376] (-1872.293) (-1872.377) -- 0:05:00 Average standard deviation of split frequencies: 0.016337 121000 -- (-1874.327) (-1877.333) [-1870.141] (-1881.957) * (-1884.066) (-1869.206) (-1875.752) [-1867.126] -- 0:04:57 122000 -- (-1870.505) [-1867.819] (-1878.453) (-1879.263) * (-1874.843) [-1869.315] (-1871.136) (-1877.835) -- 0:05:02 123000 -- [-1866.874] (-1872.474) (-1889.919) (-1870.428) * (-1874.241) [-1867.873] (-1873.404) (-1866.827) -- 0:04:59 124000 -- (-1865.705) (-1871.375) (-1887.851) [-1874.016] * [-1875.563] (-1879.921) (-1879.358) (-1868.542) -- 0:04:56 125000 -- (-1874.523) [-1867.757] (-1873.924) (-1875.477) * (-1874.768) (-1869.973) [-1874.446] (-1881.875) -- 0:05:01 Average standard deviation of split frequencies: 0.017686 126000 -- (-1875.247) (-1869.085) (-1877.766) [-1875.679] * [-1867.103] (-1885.553) (-1869.782) (-1873.965) -- 0:04:58 127000 -- [-1868.583] (-1874.116) (-1880.622) (-1870.654) * [-1874.582] (-1878.650) (-1876.026) (-1876.451) -- 0:04:55 128000 -- (-1867.113) [-1873.786] (-1872.627) (-1872.342) * [-1867.626] (-1886.399) (-1875.707) (-1867.607) -- 0:04:59 129000 -- (-1881.219) (-1873.438) [-1875.486] (-1880.968) * (-1868.452) (-1876.340) [-1875.648] (-1870.917) -- 0:04:57 130000 -- (-1872.164) (-1875.932) [-1872.571] (-1870.710) * (-1865.104) (-1881.889) [-1868.354] (-1875.864) -- 0:04:54 Average standard deviation of split frequencies: 0.020662 131000 -- (-1867.678) [-1869.176] (-1870.779) (-1874.653) * [-1877.472] (-1875.117) (-1867.810) (-1871.814) -- 0:04:58 132000 -- (-1870.204) (-1873.741) (-1873.547) [-1875.831] * [-1875.829] (-1875.202) (-1881.084) (-1867.600) -- 0:04:55 133000 -- (-1869.408) [-1870.344] (-1876.559) (-1876.742) * [-1867.356] (-1877.020) (-1869.919) (-1872.709) -- 0:04:53 134000 -- (-1873.858) [-1867.312] (-1871.507) (-1873.553) * (-1879.275) (-1876.086) [-1865.339] (-1874.506) -- 0:04:57 135000 -- (-1868.887) (-1870.507) (-1873.891) [-1875.267] * (-1871.124) [-1862.957] (-1867.316) (-1875.469) -- 0:04:54 Average standard deviation of split frequencies: 0.021112 136000 -- [-1864.965] (-1866.665) (-1880.070) (-1875.313) * (-1868.421) (-1867.565) [-1876.043] (-1869.350) -- 0:04:52 137000 -- [-1867.027] (-1880.328) (-1873.123) (-1875.816) * [-1866.594] (-1874.879) (-1877.615) (-1872.737) -- 0:04:56 138000 -- (-1869.698) [-1867.387] (-1874.736) (-1886.078) * (-1877.027) [-1866.559] (-1874.062) (-1878.758) -- 0:04:53 139000 -- (-1870.033) (-1879.239) (-1876.637) [-1871.950] * (-1876.290) (-1870.032) (-1882.884) [-1868.195] -- 0:04:51 140000 -- (-1874.198) [-1870.568] (-1893.694) (-1878.069) * [-1874.314] (-1873.228) (-1876.891) (-1876.236) -- 0:04:54 Average standard deviation of split frequencies: 0.019803 141000 -- (-1877.729) [-1871.248] (-1886.596) (-1882.505) * (-1872.992) (-1876.946) [-1870.792] (-1871.717) -- 0:04:52 142000 -- (-1879.048) [-1866.218] (-1885.805) (-1868.769) * [-1870.958] (-1879.902) (-1869.832) (-1872.695) -- 0:04:56 143000 -- (-1864.557) [-1867.538] (-1877.608) (-1873.602) * [-1867.051] (-1880.554) (-1870.698) (-1871.953) -- 0:04:53 144000 -- (-1873.903) (-1878.645) [-1869.915] (-1873.693) * [-1872.950] (-1872.976) (-1869.573) (-1882.497) -- 0:04:51 145000 -- [-1873.584] (-1875.794) (-1871.690) (-1876.972) * (-1871.058) (-1878.032) (-1879.760) [-1872.420] -- 0:04:54 Average standard deviation of split frequencies: 0.018786 146000 -- (-1871.166) (-1871.393) (-1875.149) [-1867.855] * (-1872.513) (-1874.320) (-1871.874) [-1883.978] -- 0:04:52 147000 -- (-1869.937) [-1877.887] (-1877.717) (-1875.115) * (-1870.244) (-1881.036) (-1875.922) [-1873.298] -- 0:04:50 148000 -- (-1878.843) [-1871.587] (-1870.102) (-1877.110) * (-1889.824) (-1873.301) [-1871.227] (-1871.778) -- 0:04:53 149000 -- (-1871.360) (-1876.004) [-1864.811] (-1872.304) * (-1873.069) (-1873.193) [-1871.234] (-1865.669) -- 0:04:51 150000 -- (-1871.600) (-1875.539) [-1873.405] (-1878.438) * [-1878.440] (-1878.806) (-1868.176) (-1867.927) -- 0:04:49 Average standard deviation of split frequencies: 0.017066 151000 -- (-1869.280) (-1887.109) [-1873.232] (-1869.854) * (-1873.306) [-1878.852] (-1870.113) (-1871.958) -- 0:04:52 152000 -- (-1867.595) (-1872.338) (-1877.279) [-1870.894] * (-1875.362) [-1864.318] (-1882.010) (-1868.994) -- 0:04:50 153000 -- (-1879.289) (-1873.911) (-1870.686) [-1878.030] * (-1872.935) (-1874.295) [-1874.602] (-1866.968) -- 0:04:47 154000 -- (-1881.128) (-1870.810) (-1879.649) [-1875.384] * (-1871.057) (-1878.906) [-1870.804] (-1876.725) -- 0:04:51 155000 -- (-1880.207) (-1874.530) (-1872.449) [-1872.146] * (-1867.699) [-1874.469] (-1871.930) (-1869.558) -- 0:04:48 Average standard deviation of split frequencies: 0.018680 156000 -- (-1877.602) [-1869.556] (-1869.836) (-1880.287) * (-1875.510) (-1874.651) [-1872.292] (-1871.853) -- 0:04:46 157000 -- (-1885.329) [-1872.963] (-1871.655) (-1872.788) * (-1871.792) [-1865.835] (-1874.606) (-1871.172) -- 0:04:49 158000 -- (-1876.594) [-1870.896] (-1873.940) (-1876.316) * (-1874.928) (-1869.952) (-1881.399) [-1870.829] -- 0:04:47 159000 -- (-1883.161) (-1877.168) (-1871.231) [-1869.969] * [-1871.296] (-1872.096) (-1872.266) (-1862.383) -- 0:04:45 160000 -- (-1871.122) (-1876.226) (-1868.241) [-1866.841] * (-1868.202) (-1874.406) (-1873.502) [-1869.003] -- 0:04:48 Average standard deviation of split frequencies: 0.014937 161000 -- (-1877.445) [-1870.725] (-1880.641) (-1877.766) * (-1867.834) [-1867.450] (-1875.221) (-1870.370) -- 0:04:46 162000 -- [-1871.767] (-1875.667) (-1870.123) (-1869.221) * [-1866.027] (-1867.593) (-1876.181) (-1872.024) -- 0:04:44 163000 -- (-1880.432) (-1875.347) [-1870.378] (-1874.819) * (-1870.819) (-1863.454) [-1862.861] (-1870.812) -- 0:04:47 164000 -- (-1876.574) (-1881.239) (-1863.505) [-1869.993] * [-1869.751] (-1868.115) (-1878.717) (-1876.952) -- 0:04:45 165000 -- (-1871.816) (-1876.568) (-1877.104) [-1870.467] * (-1872.198) [-1867.909] (-1877.132) (-1877.694) -- 0:04:43 Average standard deviation of split frequencies: 0.019362 166000 -- (-1871.441) (-1878.036) [-1864.821] (-1878.307) * (-1883.589) [-1867.433] (-1872.558) (-1868.094) -- 0:04:46 167000 -- (-1866.065) (-1872.532) (-1865.023) [-1873.180] * (-1873.363) (-1869.578) [-1867.657] (-1875.837) -- 0:04:44 168000 -- (-1868.011) (-1867.467) (-1869.986) [-1867.585] * (-1874.228) [-1871.477] (-1880.588) (-1869.037) -- 0:04:42 169000 -- (-1876.473) [-1865.697] (-1876.839) (-1872.304) * (-1868.690) [-1867.203] (-1873.466) (-1875.291) -- 0:04:45 170000 -- (-1876.748) (-1864.043) [-1869.547] (-1870.045) * (-1869.857) [-1865.689] (-1867.471) (-1872.226) -- 0:04:43 Average standard deviation of split frequencies: 0.019837 171000 -- [-1871.873] (-1871.418) (-1876.144) (-1879.557) * (-1871.569) (-1881.474) (-1869.891) [-1872.618] -- 0:04:46 172000 -- (-1872.223) (-1870.089) [-1870.689] (-1871.391) * (-1869.890) (-1868.493) [-1872.880] (-1868.050) -- 0:04:44 173000 -- (-1867.880) [-1870.299] (-1872.201) (-1866.691) * (-1881.191) [-1878.202] (-1871.059) (-1877.108) -- 0:04:42 174000 -- (-1876.484) [-1872.215] (-1872.057) (-1877.873) * [-1871.623] (-1870.965) (-1867.291) (-1886.269) -- 0:04:44 175000 -- (-1873.373) [-1865.082] (-1870.056) (-1880.483) * [-1870.521] (-1880.145) (-1868.475) (-1874.904) -- 0:04:42 Average standard deviation of split frequencies: 0.019236 176000 -- (-1870.849) [-1871.165] (-1878.335) (-1876.182) * (-1867.607) (-1883.626) (-1868.408) [-1870.172] -- 0:04:40 177000 -- (-1870.970) (-1873.663) [-1868.010] (-1879.097) * (-1871.559) (-1883.142) (-1876.746) [-1869.809] -- 0:04:43 178000 -- [-1881.961] (-1870.100) (-1864.894) (-1874.717) * (-1868.510) [-1869.250] (-1871.104) (-1873.219) -- 0:04:41 179000 -- [-1867.835] (-1869.140) (-1862.962) (-1874.746) * [-1869.175] (-1878.208) (-1869.549) (-1871.561) -- 0:04:39 180000 -- [-1876.419] (-1872.697) (-1875.951) (-1878.036) * [-1876.563] (-1882.377) (-1871.953) (-1863.358) -- 0:04:42 Average standard deviation of split frequencies: 0.020874 181000 -- (-1866.008) (-1871.837) [-1869.424] (-1868.460) * [-1864.119] (-1872.913) (-1870.003) (-1870.061) -- 0:04:40 182000 -- (-1877.881) (-1874.412) [-1865.971] (-1882.314) * (-1873.080) (-1873.174) [-1872.234] (-1871.008) -- 0:04:38 183000 -- (-1870.102) [-1876.334] (-1875.291) (-1876.969) * (-1869.485) [-1873.860] (-1876.323) (-1871.778) -- 0:04:41 184000 -- [-1870.283] (-1882.372) (-1867.961) (-1875.216) * (-1868.750) [-1867.540] (-1885.825) (-1879.548) -- 0:04:39 185000 -- (-1872.518) (-1882.365) (-1869.569) [-1868.993] * (-1871.384) (-1876.677) (-1877.607) [-1873.981] -- 0:04:37 Average standard deviation of split frequencies: 0.020736 186000 -- (-1873.683) [-1870.455] (-1880.167) (-1875.533) * (-1869.601) (-1874.752) [-1869.143] (-1874.917) -- 0:04:40 187000 -- [-1867.511] (-1868.332) (-1872.534) (-1879.414) * [-1875.572] (-1872.573) (-1876.580) (-1872.723) -- 0:04:38 188000 -- (-1864.547) (-1874.926) [-1867.062] (-1879.544) * [-1872.597] (-1873.668) (-1875.108) (-1869.223) -- 0:04:36 189000 -- (-1870.581) [-1870.185] (-1868.569) (-1880.902) * (-1874.913) [-1873.776] (-1864.325) (-1871.596) -- 0:04:38 190000 -- (-1870.211) [-1870.792] (-1873.147) (-1875.684) * [-1868.146] (-1866.319) (-1879.226) (-1880.064) -- 0:04:37 Average standard deviation of split frequencies: 0.017756 191000 -- (-1873.425) [-1866.500] (-1868.778) (-1871.439) * [-1871.782] (-1869.038) (-1878.322) (-1876.783) -- 0:04:39 192000 -- (-1870.498) (-1887.852) [-1870.865] (-1868.807) * (-1871.001) (-1878.246) [-1867.989] (-1871.956) -- 0:04:37 193000 -- (-1871.775) (-1875.307) [-1873.709] (-1877.118) * (-1874.275) (-1879.692) [-1869.012] (-1876.239) -- 0:04:35 194000 -- (-1875.201) [-1875.631] (-1877.473) (-1884.684) * (-1872.660) (-1872.283) [-1878.635] (-1872.610) -- 0:04:38 195000 -- (-1872.989) [-1870.711] (-1874.955) (-1867.930) * (-1873.951) (-1866.905) (-1869.153) [-1870.304] -- 0:04:36 Average standard deviation of split frequencies: 0.016617 196000 -- (-1881.908) (-1867.802) [-1867.004] (-1863.818) * (-1873.535) (-1868.460) [-1875.002] (-1871.013) -- 0:04:34 197000 -- (-1877.238) [-1864.362] (-1877.749) (-1868.864) * [-1864.968] (-1868.242) (-1878.050) (-1875.696) -- 0:04:37 198000 -- (-1878.516) (-1882.751) (-1873.653) [-1863.501] * [-1867.287] (-1868.826) (-1876.090) (-1871.436) -- 0:04:35 199000 -- (-1873.193) (-1873.329) (-1872.529) [-1877.682] * (-1875.929) (-1873.402) [-1873.997] (-1887.018) -- 0:04:33 200000 -- (-1867.584) (-1881.029) [-1875.374] (-1876.918) * [-1865.760] (-1888.231) (-1870.085) (-1875.854) -- 0:04:36 Average standard deviation of split frequencies: 0.017299 201000 -- (-1876.035) (-1869.786) [-1869.368] (-1871.346) * [-1871.063] (-1893.903) (-1874.683) (-1874.277) -- 0:04:34 202000 -- (-1873.922) (-1866.943) (-1878.996) [-1870.021] * (-1876.689) (-1875.745) [-1870.763] (-1874.371) -- 0:04:32 203000 -- (-1871.632) [-1875.247] (-1869.304) (-1872.009) * (-1869.943) (-1881.010) (-1879.844) [-1871.173] -- 0:04:34 204000 -- (-1871.445) (-1872.408) (-1877.709) [-1879.529] * (-1867.381) [-1866.310] (-1878.782) (-1877.071) -- 0:04:33 205000 -- [-1867.661] (-1871.418) (-1873.257) (-1888.257) * [-1863.125] (-1865.781) (-1878.044) (-1870.456) -- 0:04:31 Average standard deviation of split frequencies: 0.019763 206000 -- [-1877.472] (-1873.855) (-1880.232) (-1879.169) * (-1869.258) (-1871.801) (-1875.299) [-1874.554] -- 0:04:33 207000 -- (-1871.912) (-1882.057) (-1879.650) [-1866.004] * (-1868.580) (-1882.652) [-1876.859] (-1872.107) -- 0:04:31 208000 -- (-1873.139) (-1875.507) (-1880.975) [-1874.108] * (-1874.290) [-1867.714] (-1879.272) (-1894.852) -- 0:04:34 209000 -- (-1875.141) (-1873.006) (-1870.430) [-1873.695] * (-1871.468) [-1869.890] (-1880.553) (-1874.582) -- 0:04:32 210000 -- (-1866.195) (-1877.199) [-1870.286] (-1866.625) * (-1873.871) (-1879.147) [-1872.942] (-1872.535) -- 0:04:34 Average standard deviation of split frequencies: 0.018715 211000 -- (-1873.482) [-1877.459] (-1881.759) (-1870.870) * (-1871.566) [-1872.833] (-1877.685) (-1877.460) -- 0:04:32 212000 -- (-1872.361) (-1871.745) (-1871.036) [-1864.438] * (-1887.563) (-1873.531) (-1878.682) [-1879.252] -- 0:04:31 213000 -- [-1865.537] (-1872.095) (-1876.560) (-1872.828) * (-1865.499) (-1875.762) (-1878.034) [-1876.183] -- 0:04:33 214000 -- (-1875.869) (-1870.752) [-1874.669] (-1873.153) * (-1870.280) (-1879.928) (-1882.671) [-1869.182] -- 0:04:31 215000 -- (-1884.649) (-1868.162) [-1868.892] (-1875.558) * (-1872.530) (-1872.344) (-1896.572) [-1867.732] -- 0:04:30 Average standard deviation of split frequencies: 0.019840 216000 -- (-1879.971) (-1870.575) (-1879.329) [-1870.849] * [-1873.067] (-1871.770) (-1877.237) (-1876.948) -- 0:04:32 217000 -- (-1870.373) (-1868.263) (-1882.661) [-1877.737] * [-1869.360] (-1870.885) (-1883.480) (-1873.532) -- 0:04:30 218000 -- (-1873.743) (-1869.584) [-1872.953] (-1878.527) * (-1866.949) [-1873.147] (-1866.948) (-1875.633) -- 0:04:29 219000 -- (-1872.763) (-1877.192) [-1873.803] (-1878.505) * (-1869.551) (-1873.293) (-1868.134) [-1880.300] -- 0:04:31 220000 -- (-1882.871) (-1879.406) (-1867.307) [-1868.272] * (-1869.065) (-1875.733) [-1873.152] (-1885.397) -- 0:04:29 Average standard deviation of split frequencies: 0.016313 221000 -- (-1870.342) (-1874.090) (-1878.803) [-1871.866] * [-1862.724] (-1879.373) (-1869.292) (-1871.132) -- 0:04:27 222000 -- (-1873.504) (-1874.280) [-1866.980] (-1890.436) * (-1876.392) (-1867.171) [-1872.930] (-1876.794) -- 0:04:29 223000 -- (-1876.848) [-1865.035] (-1872.981) (-1870.343) * [-1869.324] (-1862.207) (-1881.890) (-1873.412) -- 0:04:28 224000 -- (-1874.643) (-1867.100) [-1883.906] (-1873.281) * [-1871.378] (-1869.101) (-1878.093) (-1879.442) -- 0:04:26 225000 -- [-1873.857] (-1871.799) (-1867.844) (-1871.812) * (-1877.440) (-1865.094) [-1878.972] (-1873.075) -- 0:04:28 Average standard deviation of split frequencies: 0.014032 226000 -- (-1881.244) [-1880.165] (-1869.821) (-1863.470) * (-1867.160) (-1879.832) [-1872.994] (-1874.370) -- 0:04:27 227000 -- (-1879.838) (-1887.893) [-1868.545] (-1872.934) * (-1872.837) (-1881.430) (-1876.086) [-1871.583] -- 0:04:25 228000 -- [-1866.431] (-1869.211) (-1867.412) (-1869.618) * (-1877.240) (-1871.597) (-1878.158) [-1873.735] -- 0:04:27 229000 -- (-1883.026) (-1875.406) [-1869.775] (-1869.336) * [-1876.684] (-1872.497) (-1874.221) (-1873.460) -- 0:04:25 230000 -- (-1867.092) (-1868.374) [-1873.144] (-1873.134) * [-1870.056] (-1883.333) (-1864.362) (-1881.652) -- 0:04:24 Average standard deviation of split frequencies: 0.012819 231000 -- (-1873.176) (-1881.662) [-1867.189] (-1871.607) * [-1870.335] (-1866.847) (-1882.249) (-1870.614) -- 0:04:26 232000 -- (-1871.525) (-1870.629) [-1874.576] (-1887.221) * (-1866.525) [-1863.277] (-1889.517) (-1871.292) -- 0:04:24 233000 -- (-1875.542) (-1872.852) (-1863.275) [-1871.820] * (-1874.055) [-1868.413] (-1877.087) (-1870.978) -- 0:04:23 234000 -- [-1879.304] (-1876.951) (-1880.983) (-1866.779) * [-1865.158] (-1869.878) (-1878.817) (-1879.286) -- 0:04:25 235000 -- (-1871.072) (-1876.499) (-1873.786) [-1866.078] * (-1875.601) [-1875.163] (-1874.122) (-1878.019) -- 0:04:23 Average standard deviation of split frequencies: 0.012166 236000 -- (-1869.347) (-1874.123) [-1869.024] (-1865.324) * (-1872.171) (-1864.843) [-1868.846] (-1882.828) -- 0:04:22 237000 -- (-1879.715) (-1874.528) (-1880.436) [-1871.200] * (-1872.571) (-1881.317) (-1873.183) [-1877.514] -- 0:04:23 238000 -- [-1877.812] (-1876.207) (-1873.585) (-1866.816) * (-1882.068) (-1869.355) (-1872.545) [-1875.845] -- 0:04:22 239000 -- (-1868.174) (-1874.168) (-1871.998) [-1876.042] * (-1871.416) (-1874.868) [-1868.232] (-1877.715) -- 0:04:21 240000 -- [-1865.697] (-1892.616) (-1870.134) (-1874.770) * (-1879.431) [-1871.257] (-1868.864) (-1870.581) -- 0:04:22 Average standard deviation of split frequencies: 0.012643 241000 -- [-1866.249] (-1877.357) (-1865.973) (-1869.631) * (-1878.671) (-1879.079) (-1877.872) [-1875.653] -- 0:04:21 242000 -- [-1867.217] (-1871.661) (-1877.987) (-1875.434) * (-1879.444) [-1868.019] (-1877.440) (-1874.223) -- 0:04:23 243000 -- (-1872.224) [-1871.392] (-1867.109) (-1870.340) * (-1888.300) (-1874.713) [-1871.380] (-1872.822) -- 0:04:21 244000 -- (-1877.667) (-1875.527) [-1868.170] (-1877.372) * (-1872.271) (-1877.140) (-1871.928) [-1867.346] -- 0:04:20 245000 -- [-1876.067] (-1869.350) (-1867.867) (-1878.721) * (-1869.321) (-1870.645) (-1872.738) [-1863.720] -- 0:04:21 Average standard deviation of split frequencies: 0.009930 246000 -- [-1871.917] (-1872.834) (-1882.237) (-1874.213) * (-1877.081) (-1872.176) [-1872.544] (-1876.292) -- 0:04:20 247000 -- (-1874.980) [-1873.353] (-1878.727) (-1877.300) * (-1866.411) (-1884.925) [-1864.248] (-1878.898) -- 0:04:19 248000 -- (-1881.101) (-1873.627) [-1864.570] (-1877.106) * (-1865.252) (-1869.459) (-1871.744) [-1867.521] -- 0:04:20 249000 -- (-1873.839) (-1871.058) [-1868.768] (-1878.340) * (-1867.817) [-1869.499] (-1868.070) (-1878.447) -- 0:04:19 250000 -- [-1865.545] (-1877.757) (-1872.806) (-1877.477) * [-1874.758] (-1884.518) (-1866.919) (-1870.062) -- 0:04:18 Average standard deviation of split frequencies: 0.009745 251000 -- [-1876.547] (-1871.218) (-1880.130) (-1867.897) * (-1864.630) [-1866.603] (-1877.994) (-1867.660) -- 0:04:19 252000 -- [-1867.288] (-1870.568) (-1868.293) (-1869.971) * (-1876.588) [-1869.059] (-1877.775) (-1872.731) -- 0:04:18 253000 -- [-1871.572] (-1877.825) (-1873.316) (-1872.995) * (-1866.328) (-1878.761) [-1867.525] (-1871.324) -- 0:04:16 254000 -- (-1879.564) [-1878.796] (-1873.428) (-1867.379) * (-1867.787) (-1880.337) (-1872.891) [-1870.157] -- 0:04:18 255000 -- (-1874.455) [-1874.969] (-1869.341) (-1865.326) * (-1873.332) (-1874.505) [-1867.022] (-1876.643) -- 0:04:17 Average standard deviation of split frequencies: 0.009877 256000 -- (-1874.108) (-1880.778) [-1864.954] (-1869.373) * [-1871.864] (-1882.148) (-1879.481) (-1869.596) -- 0:04:15 257000 -- (-1870.003) [-1873.405] (-1877.580) (-1874.040) * (-1869.108) (-1881.727) [-1872.326] (-1871.217) -- 0:04:17 258000 -- (-1879.191) [-1864.425] (-1871.499) (-1879.581) * (-1869.180) (-1873.996) [-1866.690] (-1884.362) -- 0:04:15 259000 -- [-1874.860] (-1872.091) (-1873.304) (-1869.929) * [-1866.834] (-1869.562) (-1862.605) (-1882.168) -- 0:04:14 260000 -- (-1881.852) (-1880.436) (-1885.034) [-1871.872] * [-1880.511] (-1874.345) (-1871.051) (-1880.817) -- 0:04:16 Average standard deviation of split frequencies: 0.009371 261000 -- (-1871.086) (-1876.609) (-1875.955) [-1870.089] * (-1875.304) (-1866.263) (-1875.884) [-1879.522] -- 0:04:14 262000 -- (-1880.703) [-1866.988] (-1870.643) (-1874.807) * [-1868.150] (-1877.178) (-1874.513) (-1874.231) -- 0:04:13 263000 -- [-1867.622] (-1871.358) (-1875.408) (-1875.082) * (-1872.292) (-1876.655) [-1877.667] (-1875.993) -- 0:04:15 264000 -- (-1874.172) (-1874.956) [-1877.231] (-1866.923) * [-1866.570] (-1871.925) (-1877.981) (-1878.701) -- 0:04:13 265000 -- [-1872.831] (-1876.643) (-1867.608) (-1875.433) * (-1875.452) (-1876.516) [-1869.754] (-1873.643) -- 0:04:12 Average standard deviation of split frequencies: 0.007894 266000 -- (-1877.295) (-1871.963) (-1875.158) [-1870.652] * (-1871.766) (-1865.504) (-1873.293) [-1869.886] -- 0:04:13 267000 -- (-1875.166) (-1863.934) [-1874.514] (-1870.542) * [-1880.542] (-1869.836) (-1878.902) (-1872.326) -- 0:04:12 268000 -- [-1862.372] (-1879.777) (-1870.908) (-1875.270) * (-1871.185) [-1868.555] (-1878.771) (-1871.287) -- 0:04:11 269000 -- (-1875.531) [-1873.690] (-1869.651) (-1872.705) * (-1874.634) [-1871.157] (-1871.488) (-1874.914) -- 0:04:12 270000 -- (-1880.441) (-1862.930) [-1871.939] (-1869.631) * (-1875.096) [-1877.725] (-1868.846) (-1867.029) -- 0:04:11 Average standard deviation of split frequencies: 0.006017 271000 -- (-1877.694) (-1868.439) (-1867.141) [-1870.349] * (-1871.384) (-1871.545) [-1865.853] (-1872.016) -- 0:04:10 272000 -- (-1874.826) (-1877.392) (-1871.876) [-1869.860] * (-1867.675) (-1872.505) [-1866.462] (-1871.252) -- 0:04:11 273000 -- (-1874.270) [-1872.957] (-1870.155) (-1870.347) * (-1879.360) (-1872.160) (-1869.910) [-1867.598] -- 0:04:10 274000 -- (-1871.142) (-1875.027) (-1871.443) [-1863.255] * [-1868.224] (-1876.204) (-1870.288) (-1868.990) -- 0:04:09 275000 -- [-1871.998] (-1872.042) (-1867.112) (-1869.821) * (-1872.027) (-1880.136) [-1867.029] (-1876.828) -- 0:04:10 Average standard deviation of split frequencies: 0.007608 276000 -- (-1882.246) (-1876.800) (-1868.925) [-1874.094] * (-1881.867) (-1876.141) (-1879.118) [-1869.199] -- 0:04:09 277000 -- (-1877.164) (-1868.610) (-1872.510) [-1874.755] * [-1876.736] (-1867.764) (-1882.094) (-1871.261) -- 0:04:10 278000 -- [-1870.791] (-1868.129) (-1873.672) (-1871.778) * [-1867.752] (-1869.105) (-1873.257) (-1877.139) -- 0:04:09 279000 -- (-1866.956) (-1879.093) [-1868.212] (-1866.017) * (-1869.936) [-1872.270] (-1877.110) (-1874.137) -- 0:04:08 280000 -- (-1864.976) (-1872.573) (-1877.379) [-1871.445] * (-1878.113) (-1879.291) (-1878.658) [-1873.195] -- 0:04:09 Average standard deviation of split frequencies: 0.009161 281000 -- (-1871.067) [-1870.414] (-1878.137) (-1878.194) * [-1874.403] (-1886.799) (-1870.448) (-1870.277) -- 0:04:08 282000 -- [-1876.738] (-1870.493) (-1877.734) (-1876.544) * [-1872.737] (-1870.300) (-1867.631) (-1883.369) -- 0:04:06 283000 -- (-1882.476) [-1874.097] (-1881.844) (-1875.228) * (-1876.078) (-1873.790) (-1874.303) [-1874.494] -- 0:04:08 284000 -- (-1883.807) (-1884.704) (-1871.079) [-1871.472] * [-1872.385] (-1887.766) (-1877.082) (-1877.972) -- 0:04:07 285000 -- (-1875.692) [-1878.780] (-1878.100) (-1871.819) * (-1869.167) (-1879.500) (-1877.301) [-1870.422] -- 0:04:05 Average standard deviation of split frequencies: 0.009590 286000 -- (-1882.463) [-1869.350] (-1869.827) (-1875.741) * (-1872.110) (-1869.303) [-1871.641] (-1874.600) -- 0:04:07 287000 -- (-1875.756) (-1871.457) (-1869.906) [-1873.025] * (-1882.983) (-1887.332) [-1870.340] (-1874.722) -- 0:04:05 288000 -- (-1874.391) (-1869.566) (-1871.721) [-1867.309] * (-1873.161) (-1872.433) (-1872.072) [-1873.591] -- 0:04:04 289000 -- (-1874.973) (-1875.155) (-1888.091) [-1877.060] * (-1882.052) [-1874.398] (-1886.143) (-1885.492) -- 0:04:06 290000 -- (-1881.672) (-1865.254) (-1874.393) [-1872.789] * [-1876.875] (-1876.906) (-1877.174) (-1872.721) -- 0:04:04 Average standard deviation of split frequencies: 0.007962 291000 -- (-1868.207) [-1875.716] (-1886.468) (-1871.744) * (-1873.175) [-1866.369] (-1876.866) (-1875.140) -- 0:04:03 292000 -- (-1869.771) (-1866.282) [-1867.763] (-1874.639) * (-1874.604) (-1868.242) (-1871.014) [-1868.395] -- 0:04:04 293000 -- (-1878.000) [-1873.750] (-1872.794) (-1874.467) * (-1872.461) [-1873.546] (-1872.018) (-1877.141) -- 0:04:03 294000 -- (-1883.504) (-1868.714) (-1873.922) [-1864.981] * (-1867.879) (-1876.209) [-1873.277] (-1877.235) -- 0:04:02 295000 -- [-1874.413] (-1867.963) (-1877.938) (-1875.632) * (-1872.715) (-1870.598) (-1873.394) [-1869.421] -- 0:04:03 Average standard deviation of split frequencies: 0.008976 296000 -- (-1877.468) [-1867.126] (-1876.812) (-1873.061) * [-1867.383] (-1866.069) (-1865.709) (-1870.476) -- 0:04:02 297000 -- (-1867.639) (-1881.201) (-1875.035) [-1872.551] * (-1869.887) (-1871.498) [-1872.801] (-1867.141) -- 0:04:01 298000 -- [-1873.283] (-1873.205) (-1875.375) (-1875.227) * (-1870.780) (-1874.777) (-1870.148) [-1866.911] -- 0:04:02 299000 -- (-1876.212) (-1880.678) [-1869.205] (-1869.540) * (-1872.919) (-1873.372) (-1868.299) [-1868.621] -- 0:04:01 300000 -- (-1867.092) [-1871.914] (-1868.281) (-1865.155) * [-1868.876] (-1866.423) (-1873.130) (-1869.462) -- 0:04:00 Average standard deviation of split frequencies: 0.009407 301000 -- (-1875.301) [-1876.677] (-1870.882) (-1876.105) * (-1870.813) [-1871.189] (-1864.376) (-1876.260) -- 0:04:01 302000 -- (-1871.773) [-1869.011] (-1877.057) (-1874.154) * [-1866.865] (-1865.836) (-1864.415) (-1877.283) -- 0:04:00 303000 -- [-1867.561] (-1878.691) (-1871.772) (-1873.712) * (-1873.335) (-1878.791) (-1875.328) [-1871.733] -- 0:04:01 304000 -- (-1870.287) (-1872.899) (-1869.921) [-1872.503] * (-1870.578) [-1869.888] (-1871.830) (-1875.912) -- 0:04:00 305000 -- (-1878.991) (-1873.140) [-1877.270] (-1872.188) * (-1883.904) (-1882.663) [-1869.074] (-1875.870) -- 0:03:59 Average standard deviation of split frequencies: 0.009943 306000 -- (-1873.861) (-1870.775) [-1871.251] (-1878.158) * [-1872.990] (-1870.263) (-1873.116) (-1879.732) -- 0:04:00 307000 -- (-1873.994) [-1872.353] (-1868.531) (-1881.101) * (-1885.867) (-1869.003) [-1879.888] (-1886.141) -- 0:03:59 308000 -- (-1879.642) (-1878.345) (-1880.431) [-1874.799] * [-1870.361] (-1870.198) (-1875.348) (-1883.668) -- 0:03:58 309000 -- (-1873.143) (-1872.507) [-1875.045] (-1879.465) * (-1878.082) [-1869.391] (-1885.235) (-1875.450) -- 0:03:59 310000 -- (-1868.394) (-1880.146) [-1872.738] (-1871.251) * (-1870.558) (-1876.940) (-1880.791) [-1870.656] -- 0:03:58 Average standard deviation of split frequencies: 0.010484 311000 -- [-1871.057] (-1880.573) (-1869.996) (-1870.001) * (-1880.643) [-1872.822] (-1869.603) (-1876.524) -- 0:03:57 312000 -- [-1874.843] (-1884.275) (-1870.128) (-1871.188) * (-1879.028) (-1869.929) (-1873.578) [-1866.056] -- 0:03:58 313000 -- [-1866.307] (-1881.979) (-1887.799) (-1867.399) * (-1877.914) (-1880.514) (-1875.934) [-1870.069] -- 0:03:57 314000 -- (-1864.788) (-1875.841) (-1869.271) [-1875.727] * [-1870.436] (-1870.380) (-1875.351) (-1876.111) -- 0:03:55 315000 -- (-1873.538) (-1878.057) [-1865.932] (-1880.663) * (-1877.508) [-1866.395] (-1875.742) (-1876.257) -- 0:03:57 Average standard deviation of split frequencies: 0.011256 316000 -- (-1875.165) (-1878.278) [-1877.111] (-1868.826) * (-1878.464) [-1868.325] (-1867.658) (-1878.230) -- 0:03:55 317000 -- [-1869.457] (-1873.209) (-1874.794) (-1873.910) * (-1876.063) [-1872.272] (-1874.784) (-1874.458) -- 0:03:54 318000 -- (-1872.823) [-1865.747] (-1881.121) (-1872.179) * [-1873.770] (-1878.088) (-1870.389) (-1876.161) -- 0:03:55 319000 -- [-1870.905] (-1867.047) (-1868.721) (-1877.384) * (-1872.353) [-1867.608] (-1871.553) (-1869.592) -- 0:03:54 320000 -- [-1870.261] (-1876.063) (-1870.646) (-1876.682) * (-1874.130) (-1868.427) (-1870.843) [-1875.241] -- 0:03:53 Average standard deviation of split frequencies: 0.010291 321000 -- (-1870.134) [-1876.341] (-1876.055) (-1873.593) * [-1866.948] (-1863.340) (-1873.921) (-1869.578) -- 0:03:54 322000 -- (-1872.934) [-1866.963] (-1875.236) (-1883.226) * (-1867.516) (-1867.226) (-1872.921) [-1869.038] -- 0:03:53 323000 -- (-1876.894) (-1880.043) [-1880.037] (-1877.831) * [-1864.638] (-1872.992) (-1872.533) (-1868.869) -- 0:03:52 324000 -- (-1879.436) (-1876.177) [-1871.201] (-1875.205) * (-1883.956) [-1866.724] (-1880.961) (-1874.829) -- 0:03:53 325000 -- (-1883.517) (-1867.289) (-1871.183) [-1876.327] * (-1869.885) (-1875.602) [-1872.041] (-1873.382) -- 0:03:52 Average standard deviation of split frequencies: 0.009991 326000 -- (-1888.941) [-1873.991] (-1869.810) (-1872.959) * (-1873.545) [-1870.203] (-1877.233) (-1874.865) -- 0:03:51 327000 -- (-1878.637) (-1874.986) [-1873.836] (-1876.238) * (-1880.068) [-1873.539] (-1876.667) (-1867.868) -- 0:03:52 328000 -- (-1868.924) (-1866.104) [-1874.800] (-1874.227) * (-1876.398) (-1865.529) (-1879.418) [-1866.393] -- 0:03:51 329000 -- (-1876.806) (-1867.975) [-1870.980] (-1879.396) * (-1862.817) (-1879.100) (-1874.698) [-1871.177] -- 0:03:50 330000 -- [-1869.277] (-1873.571) (-1869.865) (-1872.162) * [-1875.900] (-1868.618) (-1876.316) (-1861.146) -- 0:03:51 Average standard deviation of split frequencies: 0.009202 331000 -- (-1872.896) (-1864.938) (-1870.778) [-1874.048] * (-1873.986) (-1880.825) (-1872.878) [-1870.155] -- 0:03:50 332000 -- (-1886.536) (-1873.163) [-1870.964] (-1866.779) * (-1866.617) (-1884.222) (-1873.733) [-1871.796] -- 0:03:51 333000 -- (-1879.519) [-1870.728] (-1869.880) (-1877.214) * (-1868.770) (-1869.650) (-1882.667) [-1878.183] -- 0:03:50 334000 -- [-1872.866] (-1878.792) (-1873.734) (-1870.685) * [-1867.774] (-1878.147) (-1865.154) (-1877.413) -- 0:03:49 335000 -- [-1874.891] (-1872.661) (-1879.226) (-1868.781) * (-1888.180) (-1867.161) (-1869.884) [-1881.267] -- 0:03:50 Average standard deviation of split frequencies: 0.010076 336000 -- [-1879.083] (-1876.969) (-1870.729) (-1868.294) * (-1868.894) (-1869.493) (-1879.202) [-1865.919] -- 0:03:49 337000 -- [-1876.642] (-1882.959) (-1871.540) (-1873.375) * [-1872.752] (-1862.702) (-1874.854) (-1878.564) -- 0:03:48 338000 -- [-1867.185] (-1881.670) (-1874.303) (-1879.505) * (-1873.779) (-1871.786) [-1869.208] (-1875.208) -- 0:03:49 339000 -- (-1867.352) [-1868.039] (-1874.265) (-1877.973) * (-1868.136) (-1870.484) [-1873.021] (-1874.609) -- 0:03:48 340000 -- (-1869.019) [-1869.127] (-1875.270) (-1877.442) * [-1868.916] (-1876.216) (-1870.068) (-1866.445) -- 0:03:47 Average standard deviation of split frequencies: 0.010064 341000 -- [-1870.321] (-1869.950) (-1870.536) (-1870.852) * (-1866.346) (-1870.633) [-1871.308] (-1870.644) -- 0:03:48 342000 -- [-1868.576] (-1871.979) (-1875.323) (-1875.980) * [-1862.563] (-1875.871) (-1874.118) (-1873.837) -- 0:03:47 343000 -- (-1887.416) (-1876.857) (-1875.712) [-1873.459] * [-1874.664] (-1873.743) (-1870.992) (-1877.038) -- 0:03:46 344000 -- [-1866.504] (-1873.307) (-1882.403) (-1873.143) * [-1865.750] (-1872.387) (-1868.437) (-1873.207) -- 0:03:46 345000 -- [-1869.857] (-1875.405) (-1877.797) (-1875.678) * (-1870.343) (-1872.562) (-1869.534) [-1876.479] -- 0:03:45 Average standard deviation of split frequencies: 0.010528 346000 -- (-1865.731) [-1868.465] (-1877.408) (-1873.621) * (-1876.204) (-1871.580) (-1872.926) [-1874.016] -- 0:03:44 347000 -- (-1873.568) [-1867.775] (-1870.082) (-1872.528) * (-1888.038) (-1870.173) (-1871.648) [-1876.458] -- 0:03:45 348000 -- (-1882.376) (-1876.811) [-1868.262] (-1869.843) * [-1869.673] (-1868.906) (-1888.577) (-1874.061) -- 0:03:44 349000 -- (-1884.787) (-1872.847) [-1870.965] (-1871.446) * [-1877.256] (-1872.892) (-1872.335) (-1876.635) -- 0:03:43 350000 -- (-1874.198) (-1871.956) [-1867.564] (-1877.964) * (-1869.228) [-1874.295] (-1874.834) (-1873.754) -- 0:03:44 Average standard deviation of split frequencies: 0.010510 351000 -- (-1880.453) [-1865.289] (-1876.913) (-1872.671) * (-1872.224) (-1876.542) [-1875.389] (-1874.716) -- 0:03:43 352000 -- (-1882.557) (-1868.862) [-1871.438] (-1875.289) * (-1871.380) (-1867.857) (-1876.214) [-1874.358] -- 0:03:42 353000 -- (-1885.714) (-1868.342) [-1872.554] (-1874.478) * [-1871.968] (-1870.395) (-1872.766) (-1878.746) -- 0:03:43 354000 -- [-1874.035] (-1871.352) (-1871.488) (-1871.048) * (-1870.449) (-1865.950) (-1883.631) [-1874.466] -- 0:03:42 355000 -- (-1880.547) (-1878.878) (-1867.295) [-1868.998] * (-1869.239) [-1869.248] (-1878.657) (-1874.126) -- 0:03:43 Average standard deviation of split frequencies: 0.009269 356000 -- (-1881.083) (-1881.814) (-1868.356) [-1869.231] * (-1872.060) (-1878.690) [-1868.041] (-1872.763) -- 0:03:42 357000 -- (-1877.545) (-1881.838) [-1868.104] (-1872.474) * (-1877.764) (-1870.463) [-1875.101] (-1869.311) -- 0:03:41 358000 -- (-1880.999) [-1868.043] (-1867.890) (-1870.282) * (-1878.501) (-1874.825) (-1880.574) [-1869.671] -- 0:03:42 359000 -- (-1873.578) (-1870.553) [-1871.299] (-1872.074) * [-1877.402] (-1880.926) (-1883.393) (-1872.291) -- 0:03:41 360000 -- (-1867.512) (-1869.888) [-1868.404] (-1878.098) * (-1874.679) [-1873.890] (-1874.251) (-1872.760) -- 0:03:40 Average standard deviation of split frequencies: 0.008555 361000 -- (-1874.400) (-1881.306) (-1878.510) [-1870.201] * (-1878.383) (-1871.200) (-1881.816) [-1873.010] -- 0:03:41 362000 -- [-1872.595] (-1871.586) (-1867.151) (-1880.777) * (-1864.483) [-1869.574] (-1877.167) (-1871.929) -- 0:03:40 363000 -- [-1871.425] (-1875.447) (-1870.897) (-1871.177) * (-1869.498) [-1870.263] (-1875.399) (-1865.512) -- 0:03:39 364000 -- (-1876.044) [-1872.529] (-1873.075) (-1871.771) * [-1873.017] (-1873.819) (-1875.298) (-1868.497) -- 0:03:40 365000 -- [-1868.205] (-1877.668) (-1870.396) (-1878.806) * (-1874.284) [-1868.948] (-1875.954) (-1867.268) -- 0:03:39 Average standard deviation of split frequencies: 0.007611 366000 -- (-1868.121) (-1862.934) [-1869.125] (-1873.325) * (-1872.363) [-1872.503] (-1870.827) (-1867.710) -- 0:03:38 367000 -- (-1869.102) (-1866.288) (-1870.824) [-1873.441] * [-1865.304] (-1883.684) (-1869.171) (-1872.223) -- 0:03:39 368000 -- (-1868.481) [-1872.159] (-1868.481) (-1881.839) * (-1872.702) (-1870.655) (-1865.856) [-1873.478] -- 0:03:38 369000 -- (-1873.247) [-1865.919] (-1871.301) (-1877.043) * (-1872.966) [-1869.213] (-1871.219) (-1867.432) -- 0:03:37 370000 -- (-1875.771) (-1874.188) [-1868.820] (-1877.078) * (-1869.690) (-1876.148) [-1878.291] (-1872.298) -- 0:03:37 Average standard deviation of split frequencies: 0.007977 371000 -- (-1871.459) [-1873.589] (-1870.510) (-1870.144) * [-1867.934] (-1868.048) (-1869.135) (-1870.319) -- 0:03:37 372000 -- (-1872.239) (-1872.216) [-1870.726] (-1877.261) * (-1872.618) (-1870.891) (-1874.201) [-1870.703] -- 0:03:36 373000 -- (-1870.751) (-1875.480) [-1863.965] (-1877.067) * (-1875.078) (-1877.830) (-1882.641) [-1873.088] -- 0:03:36 374000 -- [-1864.524] (-1877.608) (-1877.201) (-1870.829) * [-1865.601] (-1870.394) (-1888.077) (-1879.767) -- 0:03:35 375000 -- (-1874.312) (-1873.428) (-1871.663) [-1862.734] * (-1872.086) (-1864.365) (-1870.491) [-1870.101] -- 0:03:35 Average standard deviation of split frequencies: 0.007067 376000 -- (-1875.880) (-1877.690) [-1864.087] (-1869.899) * [-1866.967] (-1877.790) (-1891.349) (-1868.927) -- 0:03:35 377000 -- (-1883.473) (-1869.314) (-1886.994) [-1864.273] * (-1876.324) (-1880.540) (-1877.193) [-1879.063] -- 0:03:34 378000 -- (-1869.572) [-1868.886] (-1879.804) (-1871.341) * (-1879.882) (-1870.115) [-1871.166] (-1874.130) -- 0:03:35 379000 -- (-1877.621) [-1871.681] (-1872.820) (-1867.753) * (-1868.912) [-1865.653] (-1871.607) (-1872.489) -- 0:03:34 380000 -- (-1886.035) (-1871.604) (-1886.478) [-1867.280] * (-1872.216) [-1868.165] (-1871.256) (-1871.013) -- 0:03:33 Average standard deviation of split frequencies: 0.006417 381000 -- (-1862.535) [-1875.163] (-1878.409) (-1869.722) * [-1866.399] (-1871.920) (-1881.757) (-1870.189) -- 0:03:34 382000 -- (-1880.396) [-1876.868] (-1882.777) (-1865.172) * [-1872.722] (-1874.712) (-1885.243) (-1878.200) -- 0:03:33 383000 -- (-1873.711) (-1870.035) (-1871.893) [-1868.141] * (-1872.806) (-1873.500) [-1872.882] (-1874.463) -- 0:03:32 384000 -- (-1869.474) (-1881.983) [-1875.264] (-1880.436) * (-1877.081) (-1872.232) (-1869.939) [-1866.661] -- 0:03:33 385000 -- [-1874.629] (-1877.746) (-1879.544) (-1872.023) * (-1868.892) (-1877.372) [-1870.447] (-1873.556) -- 0:03:32 Average standard deviation of split frequencies: 0.007217 386000 -- (-1872.927) (-1870.679) [-1867.130] (-1872.838) * (-1865.983) [-1874.452] (-1870.854) (-1872.282) -- 0:03:31 387000 -- (-1876.887) (-1874.530) [-1876.643] (-1872.124) * (-1867.676) (-1872.697) (-1872.074) [-1868.689] -- 0:03:32 388000 -- (-1874.682) (-1868.115) (-1876.085) [-1870.148] * (-1880.327) [-1869.123] (-1866.395) (-1868.649) -- 0:03:31 389000 -- (-1869.618) (-1873.724) (-1878.174) [-1867.114] * (-1872.344) (-1869.743) [-1869.942] (-1874.190) -- 0:03:30 390000 -- [-1867.032] (-1869.123) (-1869.270) (-1870.270) * (-1872.994) (-1866.172) [-1870.842] (-1875.818) -- 0:03:31 Average standard deviation of split frequencies: 0.005704 391000 -- (-1875.770) (-1873.669) [-1867.640] (-1875.699) * (-1873.116) (-1869.553) (-1875.101) [-1867.792] -- 0:03:30 392000 -- (-1877.181) (-1872.042) [-1864.508] (-1872.092) * (-1873.282) (-1873.663) (-1875.461) [-1870.002] -- 0:03:29 393000 -- (-1869.660) (-1867.596) [-1881.441] (-1872.263) * (-1870.650) (-1875.517) (-1866.709) [-1866.908] -- 0:03:30 394000 -- (-1871.093) (-1870.730) (-1879.270) [-1864.341] * (-1875.811) (-1872.371) [-1874.754] (-1881.376) -- 0:03:29 395000 -- (-1883.487) [-1865.902] (-1891.820) (-1876.551) * (-1876.250) (-1875.047) [-1867.543] (-1879.689) -- 0:03:28 Average standard deviation of split frequencies: 0.005519 396000 -- [-1869.772] (-1870.026) (-1874.492) (-1874.257) * (-1874.816) (-1866.688) (-1864.647) [-1876.125] -- 0:03:28 397000 -- (-1887.772) (-1882.541) [-1867.349] (-1866.224) * (-1871.277) [-1870.922] (-1877.009) (-1873.606) -- 0:03:28 398000 -- (-1872.824) [-1866.522] (-1878.074) (-1871.550) * (-1867.501) (-1883.057) [-1867.832] (-1868.913) -- 0:03:28 399000 -- (-1868.661) (-1868.503) [-1873.226] (-1870.607) * (-1868.919) [-1867.381] (-1872.142) (-1881.170) -- 0:03:27 400000 -- [-1862.347] (-1872.105) (-1866.845) (-1874.276) * (-1878.539) [-1877.859] (-1869.674) (-1872.293) -- 0:03:27 Average standard deviation of split frequencies: 0.005990 401000 -- [-1873.282] (-1872.029) (-1872.894) (-1876.001) * [-1865.664] (-1880.151) (-1867.363) (-1869.042) -- 0:03:27 402000 -- (-1869.052) (-1875.445) (-1876.223) [-1866.930] * (-1872.342) (-1876.430) [-1871.090] (-1872.173) -- 0:03:26 403000 -- (-1872.647) (-1874.977) [-1865.193] (-1874.768) * [-1877.873] (-1871.948) (-1874.242) (-1879.460) -- 0:03:25 404000 -- [-1868.429] (-1874.344) (-1873.724) (-1873.187) * [-1870.425] (-1868.973) (-1874.205) (-1869.229) -- 0:03:26 405000 -- [-1865.389] (-1876.752) (-1873.953) (-1874.581) * (-1885.916) [-1868.859] (-1872.444) (-1874.796) -- 0:03:25 Average standard deviation of split frequencies: 0.006439 406000 -- (-1873.527) [-1867.888] (-1871.512) (-1868.528) * (-1879.882) (-1873.037) [-1872.537] (-1865.972) -- 0:03:24 407000 -- [-1868.050] (-1869.706) (-1866.905) (-1871.256) * (-1867.263) (-1869.392) [-1868.857] (-1871.170) -- 0:03:25 408000 -- (-1877.917) [-1880.329] (-1877.109) (-1871.644) * [-1871.376] (-1870.565) (-1870.446) (-1871.338) -- 0:03:24 409000 -- (-1873.305) [-1870.623] (-1872.962) (-1881.214) * (-1873.113) (-1875.140) (-1866.181) [-1878.294] -- 0:03:23 410000 -- (-1867.552) [-1872.330] (-1878.057) (-1871.566) * [-1867.508] (-1877.867) (-1872.266) (-1871.867) -- 0:03:24 Average standard deviation of split frequencies: 0.007409 411000 -- (-1873.197) [-1871.772] (-1875.748) (-1873.806) * (-1870.283) [-1864.341] (-1876.639) (-1874.169) -- 0:03:23 412000 -- [-1867.323] (-1872.766) (-1866.997) (-1876.723) * (-1871.332) (-1864.359) [-1870.402] (-1877.463) -- 0:03:24 413000 -- [-1866.933] (-1873.930) (-1878.843) (-1878.462) * (-1867.759) (-1867.567) [-1871.395] (-1873.847) -- 0:03:23 414000 -- (-1874.611) (-1875.676) (-1873.488) [-1869.616] * [-1872.941] (-1870.527) (-1871.800) (-1879.462) -- 0:03:22 415000 -- (-1871.681) (-1878.558) [-1866.874] (-1871.896) * (-1874.608) (-1872.015) [-1865.958] (-1873.147) -- 0:03:22 Average standard deviation of split frequencies: 0.006799 416000 -- (-1870.806) (-1870.101) [-1874.565] (-1887.392) * (-1868.970) [-1871.662] (-1868.199) (-1877.730) -- 0:03:22 417000 -- (-1872.159) (-1869.688) [-1873.416] (-1874.823) * (-1871.289) (-1871.067) (-1872.715) [-1874.614] -- 0:03:21 418000 -- (-1867.659) [-1868.061] (-1870.843) (-1865.013) * (-1865.748) [-1870.728] (-1886.112) (-1867.928) -- 0:03:21 419000 -- (-1872.455) (-1871.450) (-1871.116) [-1871.621] * (-1868.125) (-1867.336) [-1869.323] (-1878.634) -- 0:03:21 420000 -- [-1876.794] (-1878.603) (-1873.998) (-1869.150) * [-1862.774] (-1873.620) (-1876.955) (-1868.780) -- 0:03:20 Average standard deviation of split frequencies: 0.005297 421000 -- (-1886.748) (-1872.352) [-1874.733] (-1875.752) * (-1873.543) [-1871.764] (-1876.254) (-1877.743) -- 0:03:20 422000 -- [-1881.738] (-1874.281) (-1872.948) (-1868.005) * (-1864.413) [-1868.069] (-1875.593) (-1881.807) -- 0:03:19 423000 -- (-1872.847) (-1877.048) (-1872.943) [-1874.135] * (-1877.993) (-1874.562) (-1864.920) [-1868.090] -- 0:03:19 424000 -- (-1871.919) (-1875.724) [-1866.768] (-1873.444) * (-1877.224) (-1867.913) (-1872.203) [-1864.437] -- 0:03:19 425000 -- (-1873.096) (-1869.883) [-1866.260] (-1882.960) * (-1873.799) [-1865.008] (-1878.895) (-1866.382) -- 0:03:18 Average standard deviation of split frequencies: 0.005231 426000 -- [-1865.092] (-1870.377) (-1872.234) (-1879.916) * (-1873.983) (-1876.222) [-1863.607] (-1874.764) -- 0:03:18 427000 -- (-1867.819) (-1877.367) (-1870.377) [-1869.848] * (-1876.824) [-1871.302] (-1877.810) (-1878.922) -- 0:03:18 428000 -- [-1872.895] (-1876.923) (-1863.193) (-1868.187) * (-1875.014) (-1873.679) [-1878.472] (-1869.903) -- 0:03:17 429000 -- [-1870.699] (-1877.445) (-1867.084) (-1877.793) * [-1866.435] (-1874.982) (-1869.088) (-1870.783) -- 0:03:16 430000 -- (-1868.192) [-1883.586] (-1876.578) (-1872.092) * [-1868.765] (-1867.162) (-1871.404) (-1872.500) -- 0:03:17 Average standard deviation of split frequencies: 0.005274 431000 -- (-1874.138) (-1879.863) (-1870.702) [-1868.866] * [-1865.722] (-1877.708) (-1875.555) (-1871.801) -- 0:03:16 432000 -- (-1869.075) (-1890.475) (-1869.499) [-1873.254] * (-1871.359) (-1871.716) [-1864.908] (-1867.609) -- 0:03:17 433000 -- (-1874.582) (-1877.245) [-1869.735] (-1871.990) * (-1875.842) (-1872.556) [-1869.645] (-1876.799) -- 0:03:16 434000 -- [-1867.688] (-1869.233) (-1865.435) (-1869.992) * (-1879.206) (-1869.485) (-1885.561) [-1869.865] -- 0:03:15 435000 -- (-1868.245) (-1880.241) [-1869.892] (-1877.653) * (-1867.075) (-1879.557) [-1870.062] (-1869.899) -- 0:03:16 Average standard deviation of split frequencies: 0.004915 436000 -- (-1874.407) (-1873.815) [-1880.114] (-1878.180) * (-1875.421) (-1867.032) [-1867.955] (-1871.732) -- 0:03:15 437000 -- (-1877.591) [-1866.615] (-1870.631) (-1870.585) * (-1867.744) (-1871.751) [-1870.626] (-1870.200) -- 0:03:14 438000 -- (-1878.230) [-1874.680] (-1870.491) (-1878.596) * (-1876.264) [-1868.226] (-1872.895) (-1877.419) -- 0:03:15 439000 -- [-1871.845] (-1874.593) (-1870.178) (-1871.406) * (-1873.074) [-1872.819] (-1867.901) (-1873.168) -- 0:03:14 440000 -- [-1874.804] (-1867.145) (-1870.023) (-1873.807) * (-1877.498) (-1877.696) (-1872.253) [-1873.644] -- 0:03:13 Average standard deviation of split frequencies: 0.005349 441000 -- (-1868.258) (-1886.170) [-1871.820] (-1871.803) * (-1871.476) (-1878.045) [-1868.392] (-1877.765) -- 0:03:13 442000 -- (-1871.837) (-1872.941) [-1866.124] (-1882.250) * (-1872.274) [-1869.452] (-1870.151) (-1889.849) -- 0:03:13 443000 -- (-1871.682) [-1868.698] (-1868.437) (-1872.613) * (-1871.032) (-1871.842) (-1879.218) [-1867.761] -- 0:03:12 444000 -- (-1874.343) (-1868.388) (-1883.419) [-1879.920] * [-1873.481] (-1872.404) (-1880.703) (-1882.239) -- 0:03:12 445000 -- (-1869.093) [-1870.087] (-1870.796) (-1870.058) * [-1864.249] (-1874.882) (-1872.500) (-1877.279) -- 0:03:12 Average standard deviation of split frequencies: 0.005765 446000 -- (-1874.159) (-1873.172) [-1873.870] (-1865.012) * [-1868.137] (-1876.684) (-1882.310) (-1877.583) -- 0:03:11 447000 -- (-1871.506) (-1869.482) (-1866.691) [-1874.894] * (-1877.175) (-1878.294) [-1866.988] (-1882.724) -- 0:03:11 448000 -- (-1872.873) [-1870.734] (-1873.697) (-1871.634) * (-1869.197) [-1865.200] (-1867.393) (-1870.002) -- 0:03:10 449000 -- [-1876.762] (-1868.236) (-1865.582) (-1867.452) * [-1871.112] (-1871.552) (-1868.551) (-1889.596) -- 0:03:11 450000 -- (-1871.288) (-1883.545) (-1874.498) [-1870.282] * [-1868.148] (-1886.376) (-1873.524) (-1866.083) -- 0:03:10 Average standard deviation of split frequencies: 0.006086 451000 -- (-1866.988) (-1876.193) [-1869.313] (-1870.587) * (-1867.895) [-1871.454] (-1872.611) (-1876.530) -- 0:03:09 452000 -- (-1865.865) [-1869.327] (-1874.138) (-1880.850) * [-1863.841] (-1874.302) (-1877.966) (-1879.167) -- 0:03:10 453000 -- (-1868.013) (-1872.921) (-1870.445) [-1868.163] * (-1882.058) (-1881.287) [-1870.032] (-1877.929) -- 0:03:09 454000 -- (-1882.465) (-1868.600) (-1874.144) [-1874.080] * (-1877.008) [-1870.265] (-1868.075) (-1872.233) -- 0:03:08 455000 -- (-1876.215) (-1868.248) [-1870.241] (-1879.952) * [-1865.890] (-1866.839) (-1866.268) (-1871.480) -- 0:03:09 Average standard deviation of split frequencies: 0.007706 456000 -- (-1875.788) [-1865.348] (-1871.026) (-1872.635) * (-1871.293) (-1872.832) [-1873.025] (-1872.157) -- 0:03:08 457000 -- (-1876.467) (-1876.686) (-1873.730) [-1868.809] * (-1879.971) (-1879.515) (-1876.042) [-1861.018] -- 0:03:07 458000 -- (-1884.907) [-1875.118] (-1877.276) (-1871.248) * (-1882.929) (-1872.432) [-1867.631] (-1870.371) -- 0:03:08 459000 -- (-1876.612) (-1869.072) [-1875.218] (-1876.025) * (-1890.959) (-1878.211) [-1868.550] (-1870.561) -- 0:03:07 460000 -- (-1875.774) (-1866.012) [-1867.029] (-1871.635) * (-1877.177) (-1869.572) (-1873.846) [-1866.920] -- 0:03:06 Average standard deviation of split frequencies: 0.008280 461000 -- (-1870.078) (-1882.267) (-1875.120) [-1869.217] * [-1869.280] (-1874.421) (-1881.861) (-1878.348) -- 0:03:07 462000 -- (-1876.933) (-1869.483) [-1867.065] (-1877.997) * (-1877.997) [-1871.603] (-1873.109) (-1880.010) -- 0:03:06 463000 -- (-1872.964) (-1879.154) [-1870.872] (-1871.021) * (-1868.575) [-1873.964] (-1864.113) (-1875.300) -- 0:03:05 464000 -- (-1875.756) (-1865.549) (-1883.947) [-1874.555] * [-1871.103] (-1870.244) (-1876.303) (-1872.560) -- 0:03:05 465000 -- (-1869.655) [-1870.152] (-1871.444) (-1876.406) * (-1873.227) (-1869.273) [-1880.074] (-1876.622) -- 0:03:05 Average standard deviation of split frequencies: 0.008461 466000 -- (-1870.257) (-1866.311) [-1866.826] (-1874.087) * (-1867.455) [-1865.929] (-1884.034) (-1874.418) -- 0:03:04 467000 -- [-1873.672] (-1874.275) (-1871.074) (-1875.636) * (-1875.750) [-1870.702] (-1868.965) (-1885.690) -- 0:03:04 468000 -- (-1873.112) (-1876.473) [-1867.619] (-1873.147) * (-1871.270) [-1868.146] (-1872.885) (-1873.336) -- 0:03:04 469000 -- (-1867.432) (-1870.182) [-1867.360] (-1865.788) * (-1874.273) [-1875.141] (-1865.527) (-1867.295) -- 0:03:03 470000 -- (-1870.893) (-1865.430) [-1866.156] (-1874.807) * (-1871.023) (-1885.003) [-1874.838] (-1864.603) -- 0:03:03 Average standard deviation of split frequencies: 0.008195 471000 -- (-1879.955) (-1872.760) (-1868.026) [-1867.998] * (-1876.913) [-1883.544] (-1871.680) (-1869.668) -- 0:03:03 472000 -- (-1873.980) (-1874.521) [-1869.403] (-1886.298) * (-1878.654) (-1869.902) [-1868.924] (-1870.939) -- 0:03:02 473000 -- (-1887.679) (-1873.434) [-1867.021] (-1875.050) * (-1880.337) (-1864.923) (-1877.466) [-1866.440] -- 0:03:02 474000 -- (-1887.807) [-1873.305] (-1869.715) (-1872.755) * (-1866.311) [-1869.023] (-1877.886) (-1873.471) -- 0:03:01 475000 -- (-1873.622) (-1869.794) (-1870.433) [-1876.473] * (-1873.559) [-1866.562] (-1872.722) (-1878.238) -- 0:03:01 Average standard deviation of split frequencies: 0.007923 476000 -- (-1879.789) [-1877.143] (-1866.208) (-1873.679) * (-1867.225) (-1871.471) [-1866.373] (-1879.321) -- 0:03:01 477000 -- (-1875.316) [-1863.705] (-1874.645) (-1867.388) * (-1876.680) [-1867.929] (-1875.511) (-1867.604) -- 0:03:00 478000 -- [-1868.847] (-1872.166) (-1881.325) (-1885.592) * [-1873.697] (-1875.149) (-1872.473) (-1871.373) -- 0:03:00 479000 -- (-1886.657) (-1868.151) (-1875.257) [-1874.454] * (-1881.570) [-1870.981] (-1870.532) (-1869.634) -- 0:03:00 480000 -- (-1869.898) [-1873.007] (-1871.703) (-1867.954) * (-1880.789) (-1875.625) [-1865.084] (-1869.095) -- 0:02:59 Average standard deviation of split frequencies: 0.007400 481000 -- (-1871.248) [-1873.327] (-1873.127) (-1868.621) * (-1878.722) (-1871.988) (-1883.144) [-1874.395] -- 0:03:00 482000 -- (-1874.203) [-1869.183] (-1872.195) (-1875.491) * (-1869.967) [-1871.043] (-1885.003) (-1865.579) -- 0:02:59 483000 -- [-1864.203] (-1866.475) (-1878.061) (-1871.028) * (-1872.084) [-1873.881] (-1880.643) (-1869.455) -- 0:02:58 484000 -- (-1880.082) [-1866.854] (-1872.859) (-1871.361) * [-1873.945] (-1870.719) (-1876.156) (-1874.713) -- 0:02:59 485000 -- (-1879.486) (-1875.670) [-1863.417] (-1866.627) * (-1872.286) (-1878.044) (-1891.185) [-1867.911] -- 0:02:58 Average standard deviation of split frequencies: 0.007319 486000 -- (-1874.565) [-1871.140] (-1874.860) (-1870.649) * (-1872.829) (-1867.552) (-1873.526) [-1876.408] -- 0:02:57 487000 -- (-1863.978) [-1875.678] (-1869.938) (-1874.039) * (-1864.963) (-1870.912) [-1870.064] (-1871.373) -- 0:02:58 488000 -- (-1877.272) (-1871.082) [-1862.280] (-1872.611) * [-1868.372] (-1871.912) (-1872.137) (-1871.387) -- 0:02:57 489000 -- (-1881.540) [-1865.739] (-1866.323) (-1876.727) * (-1876.224) (-1870.817) (-1875.086) [-1868.655] -- 0:02:56 490000 -- [-1882.265] (-1870.473) (-1880.733) (-1877.784) * (-1892.244) (-1873.335) [-1873.948] (-1871.222) -- 0:02:56 Average standard deviation of split frequencies: 0.007249 491000 -- (-1873.351) (-1868.736) [-1866.236] (-1876.471) * (-1871.260) (-1871.206) [-1873.591] (-1875.472) -- 0:02:56 492000 -- (-1868.681) (-1883.210) (-1874.321) [-1873.806] * (-1872.922) [-1872.562] (-1865.098) (-1868.877) -- 0:02:55 493000 -- (-1879.776) (-1874.596) [-1866.544] (-1872.338) * (-1879.069) (-1874.567) (-1865.604) [-1867.222] -- 0:02:55 494000 -- (-1877.333) [-1863.710] (-1874.883) (-1867.901) * (-1878.304) (-1878.608) (-1881.697) [-1876.878] -- 0:02:55 495000 -- (-1882.817) (-1873.000) (-1868.894) [-1874.975] * (-1873.005) (-1871.258) (-1873.424) [-1876.737] -- 0:02:54 Average standard deviation of split frequencies: 0.007085 496000 -- [-1878.001] (-1872.539) (-1880.621) (-1868.769) * (-1870.158) [-1873.291] (-1874.434) (-1869.414) -- 0:02:54 497000 -- (-1869.976) (-1868.645) [-1877.297] (-1867.686) * (-1876.925) (-1879.678) [-1875.230] (-1869.852) -- 0:02:54 498000 -- (-1871.143) (-1879.722) (-1866.205) [-1871.431] * (-1874.322) (-1880.703) [-1874.141] (-1871.931) -- 0:02:53 499000 -- [-1870.805] (-1868.649) (-1868.291) (-1876.627) * (-1881.981) [-1868.538] (-1875.804) (-1876.617) -- 0:02:53 500000 -- (-1878.517) (-1869.866) [-1871.851] (-1875.829) * (-1880.860) [-1865.620] (-1867.748) (-1873.804) -- 0:02:53 Average standard deviation of split frequencies: 0.007532 501000 -- (-1870.927) (-1864.926) [-1874.061] (-1873.838) * [-1870.367] (-1883.951) (-1878.219) (-1874.569) -- 0:02:52 502000 -- (-1871.388) [-1875.885] (-1868.845) (-1878.939) * (-1889.091) (-1875.167) [-1874.880] (-1877.622) -- 0:02:52 503000 -- (-1880.536) [-1877.983] (-1870.180) (-1872.083) * (-1881.451) [-1869.368] (-1880.170) (-1870.865) -- 0:02:51 504000 -- (-1869.997) (-1872.684) (-1880.324) [-1872.602] * (-1873.897) (-1875.139) [-1871.182] (-1869.519) -- 0:02:51 505000 -- (-1876.003) (-1869.962) [-1874.442] (-1879.742) * (-1869.442) (-1870.553) (-1871.680) [-1866.378] -- 0:02:51 Average standard deviation of split frequencies: 0.008215 506000 -- (-1887.260) [-1865.280] (-1880.644) (-1875.615) * [-1864.833] (-1875.736) (-1868.632) (-1876.403) -- 0:02:50 507000 -- (-1865.911) (-1876.666) (-1878.501) [-1868.006] * [-1869.105] (-1873.382) (-1873.577) (-1866.919) -- 0:02:50 508000 -- [-1866.803] (-1878.533) (-1868.006) (-1869.767) * (-1878.712) (-1871.597) (-1877.240) [-1868.539] -- 0:02:50 509000 -- [-1878.852] (-1870.862) (-1877.395) (-1876.053) * (-1878.358) (-1872.230) [-1867.414] (-1867.098) -- 0:02:49 510000 -- (-1880.310) (-1873.680) [-1864.242] (-1867.046) * (-1875.819) (-1870.699) [-1869.566] (-1891.293) -- 0:02:50 Average standard deviation of split frequencies: 0.007217 511000 -- (-1874.647) (-1872.271) [-1866.382] (-1864.920) * (-1872.926) [-1876.518] (-1876.823) (-1870.350) -- 0:02:49 512000 -- (-1879.977) [-1867.774] (-1878.299) (-1873.489) * (-1874.595) (-1876.786) (-1873.713) [-1871.064] -- 0:02:48 513000 -- (-1872.376) (-1874.251) [-1866.604] (-1864.499) * (-1873.256) (-1868.216) (-1873.088) [-1871.415] -- 0:02:48 514000 -- (-1869.829) (-1871.635) (-1878.621) [-1875.010] * (-1880.038) [-1870.204] (-1881.475) (-1873.795) -- 0:02:48 515000 -- (-1874.622) (-1873.794) (-1874.987) [-1870.196] * (-1872.201) (-1866.333) (-1876.749) [-1873.500] -- 0:02:47 Average standard deviation of split frequencies: 0.007309 516000 -- (-1870.889) (-1872.320) (-1876.699) [-1874.753] * (-1885.735) [-1876.819] (-1873.851) (-1865.998) -- 0:02:47 517000 -- (-1866.555) (-1878.636) (-1871.403) [-1868.285] * [-1867.849] (-1869.598) (-1876.540) (-1883.125) -- 0:02:47 518000 -- [-1882.153] (-1878.830) (-1866.876) (-1873.925) * (-1867.866) (-1879.941) (-1870.152) [-1868.451] -- 0:02:46 519000 -- (-1873.987) (-1864.735) [-1867.109] (-1876.949) * (-1871.698) (-1869.884) [-1871.283] (-1873.763) -- 0:02:46 520000 -- (-1878.145) [-1870.428] (-1881.493) (-1871.416) * (-1882.582) (-1874.153) (-1870.109) [-1883.699] -- 0:02:46 Average standard deviation of split frequencies: 0.007408 521000 -- [-1869.499] (-1871.025) (-1870.639) (-1870.751) * (-1877.314) (-1872.689) [-1879.159] (-1871.647) -- 0:02:45 522000 -- (-1871.909) [-1870.224] (-1872.625) (-1875.173) * (-1877.928) (-1877.091) (-1879.089) [-1867.570] -- 0:02:45 523000 -- (-1865.024) (-1879.681) (-1870.894) [-1870.063] * (-1875.124) [-1872.450] (-1888.621) (-1872.271) -- 0:02:45 524000 -- (-1867.858) (-1873.477) (-1875.393) [-1869.694] * [-1869.689] (-1888.498) (-1875.941) (-1870.357) -- 0:02:44 525000 -- (-1872.214) (-1868.495) [-1871.266] (-1870.457) * (-1873.158) (-1875.246) [-1882.851] (-1880.252) -- 0:02:44 Average standard deviation of split frequencies: 0.007740 526000 -- (-1878.890) (-1870.485) [-1865.741] (-1872.486) * (-1869.941) (-1893.064) (-1877.027) [-1871.973] -- 0:02:44 527000 -- (-1864.952) (-1872.785) [-1871.927] (-1878.344) * (-1881.394) (-1872.836) [-1865.639] (-1872.844) -- 0:02:43 528000 -- [-1876.866] (-1879.754) (-1878.181) (-1874.348) * (-1876.705) (-1880.681) [-1872.361] (-1877.357) -- 0:02:43 529000 -- (-1877.536) (-1876.738) (-1871.562) [-1865.785] * [-1873.722] (-1878.667) (-1872.539) (-1875.026) -- 0:02:42 530000 -- (-1867.794) [-1864.505] (-1879.539) (-1875.962) * (-1869.179) (-1870.732) (-1872.974) [-1871.080] -- 0:02:42 Average standard deviation of split frequencies: 0.007026 531000 -- [-1870.877] (-1871.352) (-1877.307) (-1885.074) * (-1868.227) [-1876.359] (-1867.303) (-1871.254) -- 0:02:42 532000 -- (-1870.096) (-1873.863) (-1873.526) [-1867.188] * (-1875.374) (-1882.742) (-1869.943) [-1874.497] -- 0:02:41 533000 -- (-1874.960) (-1868.101) (-1880.096) [-1871.338] * (-1876.115) (-1875.842) [-1871.561] (-1874.848) -- 0:02:41 534000 -- (-1869.917) (-1877.062) [-1865.158] (-1886.168) * (-1872.073) [-1869.686] (-1876.487) (-1879.501) -- 0:02:41 535000 -- [-1870.340] (-1875.698) (-1871.414) (-1877.287) * (-1874.504) [-1867.759] (-1874.019) (-1871.307) -- 0:02:40 Average standard deviation of split frequencies: 0.006156 536000 -- [-1872.875] (-1875.645) (-1873.676) (-1872.100) * [-1874.330] (-1873.375) (-1868.934) (-1876.987) -- 0:02:40 537000 -- (-1875.815) [-1866.731] (-1876.392) (-1878.810) * [-1870.536] (-1873.669) (-1872.447) (-1878.433) -- 0:02:40 538000 -- (-1869.922) (-1870.548) (-1882.918) [-1869.051] * (-1876.713) [-1877.560] (-1871.568) (-1875.635) -- 0:02:39 539000 -- (-1868.804) (-1870.979) [-1871.123] (-1865.510) * (-1881.769) (-1869.017) (-1866.602) [-1867.743] -- 0:02:39 540000 -- (-1885.967) (-1871.116) [-1868.885] (-1880.091) * (-1867.104) (-1875.140) [-1873.803] (-1869.743) -- 0:02:39 Average standard deviation of split frequencies: 0.006658 541000 -- (-1877.544) [-1869.280] (-1867.442) (-1881.548) * [-1865.648] (-1871.746) (-1876.680) (-1875.483) -- 0:02:38 542000 -- (-1864.005) [-1871.033] (-1867.281) (-1869.579) * (-1875.605) [-1866.736] (-1877.208) (-1865.289) -- 0:02:38 543000 -- [-1873.968] (-1873.214) (-1874.021) (-1872.330) * [-1872.743] (-1876.835) (-1873.358) (-1876.707) -- 0:02:38 544000 -- [-1870.385] (-1869.884) (-1875.619) (-1872.139) * (-1878.381) (-1871.647) [-1877.580] (-1879.163) -- 0:02:37 545000 -- (-1863.649) (-1871.530) [-1870.462] (-1870.231) * [-1865.502] (-1864.856) (-1867.772) (-1876.307) -- 0:02:36 Average standard deviation of split frequencies: 0.006986 546000 -- [-1869.852] (-1887.612) (-1874.241) (-1879.259) * (-1871.523) (-1871.304) (-1877.959) [-1868.869] -- 0:02:37 547000 -- (-1871.085) (-1867.947) [-1869.380] (-1875.268) * (-1871.713) (-1879.978) (-1876.995) [-1866.189] -- 0:02:36 548000 -- [-1864.536] (-1872.307) (-1871.142) (-1878.024) * [-1870.803] (-1882.333) (-1872.404) (-1870.240) -- 0:02:36 549000 -- (-1876.251) [-1871.574] (-1871.062) (-1873.108) * (-1875.229) [-1866.244] (-1876.361) (-1869.578) -- 0:02:36 550000 -- (-1876.199) [-1869.955] (-1881.632) (-1867.073) * (-1872.022) (-1873.564) (-1886.788) [-1869.096] -- 0:02:35 Average standard deviation of split frequencies: 0.007160 551000 -- (-1879.471) (-1867.422) [-1868.578] (-1859.515) * (-1877.917) (-1865.562) [-1870.963] (-1870.497) -- 0:02:35 552000 -- (-1877.431) [-1870.535] (-1871.504) (-1873.485) * [-1872.160] (-1862.974) (-1877.272) (-1874.569) -- 0:02:35 553000 -- (-1864.753) [-1865.746] (-1876.410) (-1875.739) * [-1874.109] (-1867.376) (-1881.672) (-1876.529) -- 0:02:34 554000 -- (-1873.259) [-1871.886] (-1869.979) (-1869.828) * (-1874.462) (-1868.214) [-1862.822] (-1874.181) -- 0:02:34 555000 -- (-1883.461) [-1868.641] (-1879.308) (-1873.643) * (-1874.045) (-1872.317) [-1869.094] (-1878.022) -- 0:02:33 Average standard deviation of split frequencies: 0.007245 556000 -- [-1877.130] (-1873.161) (-1867.566) (-1873.534) * [-1869.703] (-1881.457) (-1875.442) (-1865.720) -- 0:02:33 557000 -- (-1879.882) (-1876.280) [-1867.366] (-1877.104) * (-1874.351) (-1880.066) (-1868.385) [-1870.485] -- 0:02:33 558000 -- (-1866.502) (-1875.796) [-1866.452] (-1872.243) * (-1868.246) (-1862.835) (-1870.271) [-1872.407] -- 0:02:32 559000 -- (-1874.316) (-1868.962) [-1866.342] (-1872.448) * (-1874.039) (-1875.556) (-1876.485) [-1865.359] -- 0:02:32 560000 -- (-1872.283) (-1872.428) [-1871.502] (-1871.460) * (-1870.787) (-1869.779) [-1869.293] (-1865.828) -- 0:02:32 Average standard deviation of split frequencies: 0.007338 561000 -- (-1876.114) [-1868.784] (-1870.495) (-1869.229) * (-1872.987) (-1870.857) (-1869.952) [-1868.253] -- 0:02:31 562000 -- (-1872.092) [-1866.403] (-1870.409) (-1866.975) * (-1871.453) (-1866.827) [-1867.112] (-1873.073) -- 0:02:31 563000 -- [-1874.471] (-1870.826) (-1872.584) (-1869.434) * (-1873.309) [-1870.447] (-1880.853) (-1872.070) -- 0:02:31 564000 -- [-1869.726] (-1882.782) (-1872.441) (-1879.651) * [-1877.849] (-1879.047) (-1873.297) (-1868.471) -- 0:02:30 565000 -- (-1877.141) (-1878.509) (-1878.696) [-1870.572] * [-1870.042] (-1866.186) (-1871.717) (-1874.262) -- 0:02:30 Average standard deviation of split frequencies: 0.006890 566000 -- (-1879.313) [-1870.365] (-1878.999) (-1871.846) * (-1886.398) (-1872.184) (-1871.503) [-1871.570] -- 0:02:30 567000 -- (-1877.491) (-1881.944) [-1887.874] (-1872.091) * [-1862.141] (-1870.929) (-1872.315) (-1871.705) -- 0:02:29 568000 -- (-1878.912) (-1871.601) (-1872.519) [-1871.291] * (-1870.859) (-1869.191) (-1870.397) [-1871.336] -- 0:02:29 569000 -- [-1864.678] (-1866.390) (-1879.319) (-1880.549) * (-1864.182) (-1869.079) [-1871.453] (-1874.685) -- 0:02:29 570000 -- (-1872.757) [-1864.446] (-1875.226) (-1865.348) * (-1867.207) (-1874.949) [-1864.470] (-1878.142) -- 0:02:28 Average standard deviation of split frequencies: 0.006909 571000 -- (-1869.468) (-1881.190) (-1874.184) [-1874.320] * [-1868.057] (-1871.037) (-1869.271) (-1880.868) -- 0:02:28 572000 -- [-1871.076] (-1877.112) (-1876.336) (-1882.271) * (-1874.688) (-1872.091) (-1871.693) [-1868.029] -- 0:02:28 573000 -- (-1874.705) (-1879.161) [-1866.942] (-1877.971) * (-1867.381) [-1873.605] (-1873.406) (-1881.139) -- 0:02:27 574000 -- (-1869.768) [-1872.246] (-1871.923) (-1886.101) * [-1869.506] (-1871.897) (-1877.954) (-1868.824) -- 0:02:26 575000 -- (-1875.827) (-1872.582) (-1872.761) [-1871.506] * (-1874.680) (-1874.368) [-1867.275] (-1876.120) -- 0:02:27 Average standard deviation of split frequencies: 0.006250 576000 -- (-1877.060) (-1879.206) (-1865.061) [-1875.368] * (-1872.742) (-1867.351) [-1868.990] (-1878.938) -- 0:02:26 577000 -- (-1871.292) [-1867.881] (-1871.520) (-1866.939) * (-1878.451) (-1871.554) [-1870.378] (-1872.552) -- 0:02:25 578000 -- (-1880.075) [-1868.821] (-1871.774) (-1871.830) * (-1876.768) (-1880.060) [-1867.691] (-1879.394) -- 0:02:26 579000 -- (-1879.077) (-1870.439) (-1881.356) [-1872.036] * (-1870.504) [-1868.269] (-1882.578) (-1868.847) -- 0:02:25 580000 -- [-1873.067] (-1865.545) (-1872.047) (-1871.532) * (-1881.750) (-1876.531) [-1873.078] (-1875.748) -- 0:02:24 Average standard deviation of split frequencies: 0.006199 581000 -- (-1869.684) (-1867.901) (-1873.397) [-1868.816] * [-1872.630] (-1881.133) (-1869.708) (-1877.534) -- 0:02:24 582000 -- (-1876.445) (-1869.885) [-1873.984] (-1872.903) * [-1869.244] (-1879.981) (-1871.424) (-1878.728) -- 0:02:24 583000 -- [-1867.552] (-1871.518) (-1875.605) (-1871.107) * (-1880.582) (-1884.041) [-1869.989] (-1867.020) -- 0:02:23 584000 -- (-1866.889) [-1869.836] (-1871.149) (-1867.491) * [-1868.629] (-1886.787) (-1866.812) (-1868.870) -- 0:02:23 585000 -- (-1878.439) (-1875.354) (-1867.228) [-1868.736] * (-1874.624) [-1872.868] (-1880.099) (-1874.507) -- 0:02:23 Average standard deviation of split frequencies: 0.006070 586000 -- [-1878.319] (-1878.566) (-1879.238) (-1864.207) * [-1869.996] (-1871.225) (-1872.150) (-1873.395) -- 0:02:22 587000 -- (-1876.366) (-1877.729) [-1871.918] (-1868.424) * [-1866.722] (-1874.519) (-1875.719) (-1871.785) -- 0:02:22 588000 -- [-1865.422] (-1867.427) (-1882.151) (-1870.420) * (-1865.769) [-1863.686] (-1884.747) (-1873.873) -- 0:02:22 589000 -- [-1866.658] (-1869.374) (-1875.271) (-1885.750) * [-1876.546] (-1871.999) (-1872.876) (-1878.956) -- 0:02:21 590000 -- (-1868.732) (-1877.887) [-1864.482] (-1876.977) * (-1879.419) (-1875.917) (-1873.094) [-1872.382] -- 0:02:21 Average standard deviation of split frequencies: 0.005804 591000 -- (-1866.110) (-1869.041) [-1873.504] (-1867.936) * (-1872.538) [-1870.040] (-1872.117) (-1872.437) -- 0:02:21 592000 -- (-1870.572) (-1869.314) (-1879.045) [-1866.213] * (-1873.272) [-1879.024] (-1867.670) (-1869.737) -- 0:02:20 593000 -- (-1878.014) (-1878.934) (-1880.098) [-1871.855] * (-1867.402) (-1878.541) (-1873.269) [-1872.353] -- 0:02:20 594000 -- (-1879.501) (-1870.094) [-1869.450] (-1876.328) * [-1865.430] (-1876.969) (-1880.535) (-1872.117) -- 0:02:20 595000 -- [-1871.247] (-1869.365) (-1872.125) (-1880.666) * (-1868.439) (-1877.482) [-1867.130] (-1870.380) -- 0:02:19 Average standard deviation of split frequencies: 0.004961 596000 -- (-1872.595) [-1864.137] (-1876.121) (-1867.144) * (-1869.287) (-1872.841) (-1866.146) [-1881.613] -- 0:02:19 597000 -- (-1875.280) (-1874.640) (-1879.383) [-1873.116] * (-1877.763) (-1871.703) (-1865.616) [-1864.892] -- 0:02:19 598000 -- (-1872.428) (-1872.058) [-1862.933] (-1885.022) * (-1874.973) [-1871.443] (-1873.647) (-1876.160) -- 0:02:18 599000 -- (-1877.589) (-1870.104) [-1867.242] (-1880.626) * (-1871.972) (-1876.335) (-1871.254) [-1867.856] -- 0:02:18 600000 -- (-1880.638) (-1870.995) [-1870.952] (-1871.796) * (-1878.375) (-1869.259) (-1871.947) [-1871.622] -- 0:02:18 Average standard deviation of split frequencies: 0.004423 601000 -- [-1868.977] (-1871.761) (-1870.545) (-1878.353) * (-1869.423) (-1881.875) (-1871.514) [-1877.103] -- 0:02:17 602000 -- [-1865.587] (-1876.157) (-1875.268) (-1875.662) * (-1874.682) [-1868.215] (-1880.339) (-1878.865) -- 0:02:17 603000 -- (-1868.967) (-1882.412) (-1874.740) [-1874.093] * (-1874.608) (-1877.858) [-1865.198] (-1873.161) -- 0:02:16 604000 -- [-1870.143] (-1887.149) (-1877.412) (-1871.514) * [-1877.164] (-1880.041) (-1875.717) (-1874.602) -- 0:02:17 605000 -- (-1869.939) (-1878.281) (-1871.658) [-1875.490] * [-1874.860] (-1877.755) (-1867.377) (-1883.571) -- 0:02:16 Average standard deviation of split frequencies: 0.004738 606000 -- (-1867.024) [-1872.496] (-1871.390) (-1872.698) * [-1872.872] (-1873.396) (-1871.745) (-1876.636) -- 0:02:15 607000 -- (-1873.180) (-1877.897) [-1865.118] (-1875.683) * (-1875.081) (-1877.753) [-1862.760] (-1871.377) -- 0:02:15 608000 -- (-1869.858) [-1870.069] (-1881.210) (-1865.923) * (-1874.132) (-1867.837) (-1874.266) [-1869.235] -- 0:02:15 609000 -- (-1875.417) [-1867.866] (-1869.200) (-1876.783) * (-1872.068) (-1878.873) (-1872.972) [-1870.261] -- 0:02:14 610000 -- (-1867.451) (-1872.873) (-1876.836) [-1869.822] * (-1886.432) (-1867.631) (-1864.881) [-1867.909] -- 0:02:14 Average standard deviation of split frequencies: 0.004912 611000 -- (-1878.239) (-1871.949) (-1884.193) [-1869.222] * (-1871.564) (-1866.965) (-1864.883) [-1870.364] -- 0:02:14 612000 -- (-1869.258) [-1869.167] (-1871.515) (-1877.269) * (-1870.300) (-1877.164) [-1872.697] (-1872.231) -- 0:02:13 613000 -- (-1869.802) (-1868.897) (-1871.761) [-1874.675] * (-1873.150) [-1869.819] (-1877.213) (-1890.214) -- 0:02:13 614000 -- [-1865.331] (-1882.360) (-1873.186) (-1879.748) * (-1880.097) (-1869.944) [-1875.286] (-1882.303) -- 0:02:13 615000 -- (-1883.110) (-1879.537) (-1874.033) [-1871.406] * (-1874.383) [-1871.766] (-1875.317) (-1882.124) -- 0:02:12 Average standard deviation of split frequencies: 0.004800 616000 -- (-1878.670) (-1873.885) (-1865.039) [-1868.454] * (-1869.877) (-1869.740) [-1866.724] (-1874.895) -- 0:02:12 617000 -- (-1871.499) (-1878.391) [-1869.172] (-1870.670) * (-1862.913) (-1883.238) [-1868.662] (-1877.370) -- 0:02:12 618000 -- (-1872.109) (-1870.467) (-1872.412) [-1873.592] * [-1874.179] (-1880.660) (-1875.714) (-1871.898) -- 0:02:11 619000 -- [-1872.586] (-1878.904) (-1873.547) (-1873.265) * (-1876.619) (-1886.150) (-1882.375) [-1876.033] -- 0:02:11 620000 -- (-1868.193) (-1870.357) (-1871.815) [-1877.548] * (-1877.073) (-1886.741) [-1872.086] (-1879.608) -- 0:02:11 Average standard deviation of split frequencies: 0.005455 621000 -- [-1868.995] (-1866.077) (-1868.157) (-1874.403) * [-1865.354] (-1880.424) (-1869.621) (-1868.031) -- 0:02:10 622000 -- [-1868.678] (-1868.117) (-1886.135) (-1874.265) * [-1873.307] (-1870.329) (-1871.059) (-1874.592) -- 0:02:10 623000 -- (-1872.964) (-1870.681) (-1886.914) [-1867.874] * [-1870.830] (-1874.368) (-1877.600) (-1880.592) -- 0:02:10 624000 -- (-1869.940) (-1875.316) (-1868.334) [-1869.394] * (-1870.478) [-1867.328] (-1876.210) (-1872.823) -- 0:02:09 625000 -- (-1878.091) (-1872.329) (-1866.795) [-1869.171] * (-1862.827) [-1868.377] (-1872.748) (-1870.861) -- 0:02:09 Average standard deviation of split frequencies: 0.005956 626000 -- [-1875.714] (-1870.318) (-1871.645) (-1882.913) * (-1870.861) (-1872.289) (-1881.790) [-1871.498] -- 0:02:09 627000 -- (-1872.329) (-1874.457) (-1877.641) [-1876.068] * [-1868.906] (-1881.066) (-1889.171) (-1874.733) -- 0:02:08 628000 -- [-1871.586] (-1875.308) (-1876.594) (-1874.155) * [-1872.590] (-1873.414) (-1868.517) (-1873.101) -- 0:02:08 629000 -- (-1876.680) [-1873.496] (-1865.591) (-1867.267) * (-1879.183) (-1875.978) [-1880.366] (-1871.223) -- 0:02:07 630000 -- (-1876.256) (-1877.806) [-1869.220] (-1868.981) * (-1874.929) (-1875.388) (-1883.135) [-1867.697] -- 0:02:07 Average standard deviation of split frequencies: 0.005640 631000 -- [-1869.306] (-1868.667) (-1875.472) (-1870.897) * (-1881.813) (-1872.734) [-1861.448] (-1865.621) -- 0:02:07 632000 -- (-1869.390) (-1869.478) [-1874.876] (-1872.311) * [-1871.816] (-1871.229) (-1860.256) (-1866.773) -- 0:02:06 633000 -- (-1879.719) [-1870.449] (-1881.384) (-1870.165) * (-1872.371) (-1877.241) (-1871.135) [-1875.331] -- 0:02:06 634000 -- (-1877.945) (-1868.815) (-1879.824) [-1877.420] * (-1871.971) [-1874.585] (-1874.174) (-1872.656) -- 0:02:06 635000 -- [-1870.740] (-1873.246) (-1876.752) (-1874.596) * (-1876.640) (-1877.896) [-1870.769] (-1878.164) -- 0:02:05 Average standard deviation of split frequencies: 0.005458 636000 -- (-1873.584) (-1881.298) (-1888.009) [-1877.973] * (-1872.511) (-1878.991) (-1872.197) [-1870.987] -- 0:02:05 637000 -- (-1865.901) [-1868.415] (-1884.775) (-1872.236) * (-1876.449) (-1878.966) [-1870.072] (-1881.069) -- 0:02:05 638000 -- (-1868.637) (-1875.032) (-1884.859) [-1866.750] * [-1879.404] (-1877.530) (-1869.687) (-1878.349) -- 0:02:04 639000 -- (-1874.221) [-1866.195] (-1871.641) (-1875.429) * [-1867.520] (-1876.602) (-1870.291) (-1874.472) -- 0:02:04 640000 -- (-1872.475) (-1871.789) [-1871.216] (-1877.224) * (-1865.584) [-1871.675] (-1873.878) (-1872.464) -- 0:02:04 Average standard deviation of split frequencies: 0.005619 641000 -- (-1872.042) (-1873.142) (-1877.596) [-1873.930] * (-1871.918) (-1865.916) [-1870.935] (-1876.172) -- 0:02:03 642000 -- (-1875.407) (-1878.061) (-1876.978) [-1878.053] * (-1878.096) (-1875.475) (-1873.776) [-1877.381] -- 0:02:03 643000 -- [-1866.235] (-1872.647) (-1873.161) (-1872.280) * (-1868.677) (-1876.247) (-1867.840) [-1873.952] -- 0:02:03 644000 -- (-1876.503) [-1878.764] (-1873.756) (-1866.166) * (-1880.503) (-1873.979) [-1865.003] (-1879.916) -- 0:02:02 645000 -- [-1882.486] (-1874.619) (-1873.436) (-1881.359) * (-1865.142) [-1867.564] (-1869.283) (-1875.187) -- 0:02:02 Average standard deviation of split frequencies: 0.006103 646000 -- [-1866.525] (-1878.455) (-1887.147) (-1876.021) * (-1875.837) (-1868.784) [-1867.538] (-1882.986) -- 0:02:02 647000 -- [-1874.285] (-1875.424) (-1876.131) (-1876.624) * [-1866.007] (-1872.942) (-1878.207) (-1875.508) -- 0:02:01 648000 -- (-1872.126) [-1871.959] (-1884.505) (-1865.320) * [-1872.489] (-1877.090) (-1873.445) (-1870.565) -- 0:02:01 649000 -- (-1867.925) (-1875.494) [-1865.781] (-1870.300) * (-1871.687) (-1878.130) [-1869.178] (-1868.220) -- 0:02:01 650000 -- [-1869.780] (-1878.668) (-1871.148) (-1869.115) * [-1875.556] (-1881.837) (-1870.192) (-1870.263) -- 0:02:00 Average standard deviation of split frequencies: 0.005994 651000 -- (-1877.405) (-1882.398) (-1874.715) [-1877.086] * (-1877.989) (-1871.398) (-1873.216) [-1873.474] -- 0:02:00 652000 -- [-1876.062] (-1878.759) (-1874.505) (-1869.518) * (-1891.630) (-1872.170) (-1876.117) [-1874.871] -- 0:02:00 653000 -- [-1874.387] (-1874.084) (-1883.735) (-1868.761) * [-1868.044] (-1870.562) (-1885.802) (-1882.971) -- 0:01:59 654000 -- (-1872.124) (-1869.083) (-1867.654) [-1871.250] * [-1871.459] (-1874.139) (-1878.537) (-1874.247) -- 0:01:59 655000 -- (-1881.602) (-1884.846) (-1872.978) [-1874.261] * (-1873.629) (-1874.711) [-1864.875] (-1871.596) -- 0:01:59 Average standard deviation of split frequencies: 0.005292 656000 -- (-1864.359) (-1869.920) (-1871.206) [-1870.578] * (-1876.855) (-1880.594) (-1870.130) [-1873.201] -- 0:01:58 657000 -- (-1874.112) (-1866.146) [-1869.151] (-1869.378) * (-1874.822) (-1876.989) (-1875.824) [-1868.659] -- 0:01:58 658000 -- (-1874.055) [-1870.588] (-1872.183) (-1871.285) * [-1867.243] (-1868.710) (-1871.017) (-1874.069) -- 0:01:57 659000 -- (-1878.391) [-1866.388] (-1873.949) (-1862.748) * [-1865.533] (-1871.852) (-1873.243) (-1865.525) -- 0:01:57 660000 -- (-1869.638) (-1875.999) (-1882.044) [-1875.202] * [-1872.072] (-1875.935) (-1873.828) (-1876.937) -- 0:01:57 Average standard deviation of split frequencies: 0.005060 661000 -- [-1870.470] (-1872.003) (-1875.351) (-1872.168) * (-1867.206) (-1879.248) (-1867.277) [-1867.996] -- 0:01:56 662000 -- (-1864.531) [-1865.919] (-1876.091) (-1866.107) * (-1881.811) (-1882.701) [-1869.332] (-1869.959) -- 0:01:56 663000 -- (-1870.949) (-1879.743) (-1875.197) [-1867.389] * (-1869.298) (-1881.297) (-1870.479) [-1866.825] -- 0:01:56 664000 -- (-1870.430) [-1870.655] (-1874.072) (-1875.281) * (-1881.024) (-1875.609) (-1887.852) [-1878.960] -- 0:01:55 665000 -- (-1886.143) [-1873.862] (-1879.092) (-1870.191) * [-1880.712] (-1864.742) (-1878.417) (-1876.087) -- 0:01:55 Average standard deviation of split frequencies: 0.005276 666000 -- (-1884.252) (-1880.577) [-1869.878] (-1867.065) * (-1878.324) (-1875.352) (-1871.063) [-1866.935] -- 0:01:55 667000 -- (-1868.985) (-1870.130) (-1871.268) [-1868.825] * [-1866.311] (-1864.875) (-1875.353) (-1873.537) -- 0:01:54 668000 -- (-1873.527) [-1871.701] (-1865.739) (-1871.389) * (-1867.823) [-1873.158] (-1878.535) (-1883.362) -- 0:01:54 669000 -- (-1872.211) [-1877.786] (-1878.649) (-1879.460) * (-1872.508) [-1871.941] (-1866.443) (-1875.360) -- 0:01:54 670000 -- (-1872.570) (-1881.670) [-1876.520] (-1874.501) * (-1879.698) (-1866.912) [-1872.317] (-1872.099) -- 0:01:53 Average standard deviation of split frequencies: 0.005751 671000 -- (-1867.675) (-1881.318) [-1878.678] (-1869.652) * [-1871.949] (-1871.309) (-1866.744) (-1867.464) -- 0:01:53 672000 -- (-1873.282) [-1875.084] (-1875.196) (-1873.880) * (-1875.544) [-1871.164] (-1872.733) (-1869.483) -- 0:01:53 673000 -- (-1875.680) [-1873.652] (-1868.687) (-1871.233) * (-1869.969) (-1875.789) [-1873.999] (-1869.830) -- 0:01:52 674000 -- (-1879.432) [-1865.726] (-1877.942) (-1875.874) * (-1876.514) [-1873.679] (-1876.675) (-1873.221) -- 0:01:52 675000 -- (-1876.580) (-1881.084) (-1875.576) [-1877.072] * (-1875.724) [-1876.214] (-1869.789) (-1880.963) -- 0:01:52 Average standard deviation of split frequencies: 0.005135 676000 -- [-1866.042] (-1875.932) (-1884.665) (-1874.501) * [-1875.774] (-1867.176) (-1882.023) (-1875.251) -- 0:01:51 677000 -- (-1877.556) (-1869.146) [-1869.175] (-1870.652) * (-1874.236) (-1867.253) [-1866.298] (-1868.604) -- 0:01:51 678000 -- (-1869.474) [-1876.688] (-1877.142) (-1869.458) * (-1872.880) (-1876.998) [-1868.382] (-1878.017) -- 0:01:51 679000 -- (-1874.453) [-1876.655] (-1870.368) (-1877.292) * (-1868.290) (-1868.940) (-1869.352) [-1871.169] -- 0:01:50 680000 -- (-1872.302) (-1872.752) [-1873.906] (-1875.239) * [-1869.999] (-1880.735) (-1869.200) (-1866.042) -- 0:01:50 Average standard deviation of split frequencies: 0.005603 681000 -- (-1880.772) [-1876.807] (-1871.294) (-1877.365) * (-1864.293) (-1868.129) (-1871.473) [-1866.836] -- 0:01:50 682000 -- [-1874.937] (-1875.901) (-1869.334) (-1869.347) * [-1871.321] (-1877.214) (-1870.964) (-1871.804) -- 0:01:50 683000 -- (-1864.897) (-1874.063) [-1866.371] (-1870.096) * (-1879.768) (-1885.899) [-1868.180] (-1870.177) -- 0:01:49 684000 -- [-1871.654] (-1874.985) (-1867.370) (-1882.087) * (-1874.571) [-1875.257] (-1878.228) (-1871.663) -- 0:01:49 685000 -- [-1867.445] (-1871.853) (-1871.212) (-1876.821) * (-1876.015) [-1866.041] (-1874.417) (-1877.171) -- 0:01:48 Average standard deviation of split frequencies: 0.005747 686000 -- (-1872.479) (-1869.795) [-1874.642] (-1865.314) * (-1879.446) (-1867.532) [-1868.049] (-1866.439) -- 0:01:48 687000 -- (-1874.080) (-1873.928) (-1882.296) [-1879.827] * (-1875.587) (-1882.483) (-1870.208) [-1865.510] -- 0:01:47 688000 -- [-1875.896] (-1864.111) (-1873.268) (-1869.702) * (-1868.196) [-1868.217] (-1864.990) (-1869.587) -- 0:01:47 689000 -- (-1872.137) (-1865.280) (-1879.307) [-1873.648] * [-1869.851] (-1870.543) (-1867.585) (-1867.736) -- 0:01:47 690000 -- [-1874.463] (-1882.032) (-1868.829) (-1872.726) * (-1874.978) (-1870.430) (-1873.937) [-1869.673] -- 0:01:46 Average standard deviation of split frequencies: 0.006639 691000 -- (-1884.041) [-1869.353] (-1872.766) (-1876.532) * [-1870.685] (-1873.932) (-1878.494) (-1865.664) -- 0:01:46 692000 -- (-1872.338) (-1873.315) (-1864.071) [-1873.743] * [-1876.484] (-1876.637) (-1871.969) (-1870.919) -- 0:01:46 693000 -- (-1870.314) [-1874.293] (-1873.159) (-1874.689) * (-1868.415) (-1881.557) (-1874.866) [-1868.912] -- 0:01:45 694000 -- (-1876.088) (-1875.722) (-1869.754) [-1868.909] * (-1873.016) (-1873.586) [-1872.587] (-1877.903) -- 0:01:45 695000 -- (-1875.320) (-1870.546) (-1870.236) [-1880.580] * (-1869.793) (-1872.344) (-1880.437) [-1872.990] -- 0:01:45 Average standard deviation of split frequencies: 0.007081 696000 -- (-1868.369) (-1862.579) (-1873.334) [-1867.331] * (-1872.048) (-1872.575) (-1879.564) [-1868.186] -- 0:01:45 697000 -- (-1874.960) (-1870.072) [-1879.102] (-1873.426) * (-1871.364) (-1879.263) (-1863.977) [-1870.549] -- 0:01:44 698000 -- (-1878.259) (-1866.610) [-1871.110] (-1872.373) * [-1875.805] (-1867.562) (-1874.906) (-1872.665) -- 0:01:44 699000 -- (-1877.921) [-1875.292] (-1870.956) (-1867.585) * (-1875.506) [-1868.699] (-1877.376) (-1875.960) -- 0:01:44 700000 -- (-1868.867) [-1875.923] (-1874.832) (-1871.415) * (-1870.715) (-1877.180) [-1870.068] (-1869.148) -- 0:01:43 Average standard deviation of split frequencies: 0.007217 701000 -- (-1875.968) (-1870.203) [-1878.802] (-1870.937) * (-1867.758) (-1867.574) (-1877.162) [-1870.406] -- 0:01:43 702000 -- (-1872.230) (-1869.373) (-1866.608) [-1872.826] * [-1874.918] (-1873.763) (-1889.616) (-1879.369) -- 0:01:43 703000 -- (-1879.370) (-1883.709) (-1878.137) [-1868.424] * (-1867.402) (-1876.404) (-1878.599) [-1865.920] -- 0:01:42 704000 -- (-1873.234) (-1868.437) [-1867.369] (-1875.874) * (-1874.689) [-1867.353] (-1881.386) (-1868.917) -- 0:01:42 705000 -- (-1867.887) (-1873.443) (-1880.251) [-1871.768] * (-1874.936) [-1867.638] (-1867.926) (-1869.868) -- 0:01:42 Average standard deviation of split frequencies: 0.007102 706000 -- (-1874.396) [-1868.571] (-1867.710) (-1867.172) * (-1868.770) (-1872.082) [-1872.148] (-1873.491) -- 0:01:41 707000 -- (-1871.074) (-1867.618) (-1886.380) [-1870.333] * [-1876.297] (-1878.779) (-1869.228) (-1871.431) -- 0:01:41 708000 -- (-1882.479) (-1876.819) (-1875.731) [-1866.492] * (-1875.472) (-1873.165) (-1865.675) [-1875.466] -- 0:01:41 709000 -- (-1874.030) [-1867.175] (-1875.571) (-1871.474) * (-1871.207) (-1879.690) (-1878.630) [-1866.274] -- 0:01:40 710000 -- (-1869.173) (-1876.075) [-1869.667] (-1886.002) * (-1873.719) (-1873.404) [-1867.077] (-1876.213) -- 0:01:40 Average standard deviation of split frequencies: 0.007538 711000 -- (-1870.825) (-1865.948) (-1870.524) [-1882.355] * (-1883.702) (-1875.038) [-1871.037] (-1869.688) -- 0:01:39 712000 -- [-1873.045] (-1868.281) (-1868.609) (-1867.990) * (-1873.831) (-1877.758) (-1876.761) [-1879.511] -- 0:01:39 713000 -- [-1866.795] (-1875.757) (-1879.858) (-1871.859) * (-1867.437) (-1874.772) (-1867.420) [-1879.228] -- 0:01:39 714000 -- (-1873.288) (-1868.705) [-1865.723] (-1872.575) * (-1877.186) (-1875.689) (-1879.503) [-1869.330] -- 0:01:38 715000 -- (-1881.601) (-1867.011) [-1873.969] (-1876.235) * (-1884.681) [-1873.118] (-1876.595) (-1884.105) -- 0:01:38 Average standard deviation of split frequencies: 0.007661 716000 -- [-1870.998] (-1874.537) (-1871.140) (-1875.199) * [-1868.215] (-1875.608) (-1871.760) (-1869.165) -- 0:01:37 717000 -- (-1861.369) (-1875.576) (-1882.387) [-1873.127] * (-1885.290) [-1872.392] (-1881.303) (-1869.538) -- 0:01:37 718000 -- (-1876.170) (-1870.767) [-1879.641] (-1867.385) * (-1879.733) (-1864.614) (-1871.476) [-1867.588] -- 0:01:37 719000 -- (-1871.689) [-1870.361] (-1875.824) (-1877.489) * (-1880.609) [-1870.554] (-1864.885) (-1865.592) -- 0:01:36 720000 -- (-1867.878) [-1870.733] (-1884.630) (-1870.625) * (-1875.680) [-1867.522] (-1874.792) (-1871.416) -- 0:01:36 Average standard deviation of split frequencies: 0.007612 721000 -- (-1870.144) (-1868.800) (-1874.248) [-1868.282] * (-1867.351) (-1881.766) [-1872.372] (-1872.442) -- 0:01:36 722000 -- (-1879.997) (-1874.886) [-1873.697] (-1871.710) * (-1876.747) (-1885.820) (-1870.656) [-1867.260] -- 0:01:35 723000 -- (-1878.601) (-1875.942) (-1873.621) [-1871.515] * (-1882.391) (-1874.373) [-1867.728] (-1874.050) -- 0:01:35 724000 -- [-1871.213] (-1874.756) (-1878.580) (-1873.692) * (-1880.531) [-1874.553] (-1866.199) (-1870.960) -- 0:01:35 725000 -- (-1873.955) (-1870.813) [-1874.336] (-1869.284) * [-1873.531] (-1870.966) (-1872.664) (-1874.708) -- 0:01:34 Average standard deviation of split frequencies: 0.008087 726000 -- [-1874.423] (-1868.050) (-1870.911) (-1866.873) * [-1864.028] (-1878.407) (-1873.556) (-1876.403) -- 0:01:34 727000 -- (-1866.775) [-1872.081] (-1884.877) (-1872.804) * (-1878.613) [-1868.416] (-1878.930) (-1875.058) -- 0:01:34 728000 -- [-1874.028] (-1883.204) (-1876.490) (-1870.373) * (-1876.789) (-1869.443) (-1869.539) [-1865.349] -- 0:01:33 729000 -- (-1878.456) (-1875.713) [-1866.202] (-1886.725) * (-1869.517) (-1869.744) (-1872.204) [-1881.375] -- 0:01:33 730000 -- (-1877.127) (-1865.798) [-1874.962] (-1878.117) * (-1879.645) (-1873.515) (-1875.192) [-1867.495] -- 0:01:33 Average standard deviation of split frequencies: 0.008974 731000 -- (-1871.549) [-1869.615] (-1871.978) (-1877.831) * (-1873.644) [-1872.941] (-1867.270) (-1867.343) -- 0:01:32 732000 -- (-1871.441) (-1877.692) (-1878.263) [-1871.372] * (-1875.944) [-1868.240] (-1865.266) (-1874.356) -- 0:01:32 733000 -- [-1869.118] (-1867.943) (-1869.241) (-1874.028) * [-1865.339] (-1874.458) (-1871.048) (-1877.343) -- 0:01:32 734000 -- [-1878.967] (-1884.346) (-1876.083) (-1870.634) * (-1870.970) [-1875.826] (-1877.996) (-1876.537) -- 0:01:31 735000 -- (-1865.996) [-1871.608] (-1890.554) (-1872.943) * (-1870.442) (-1870.230) [-1868.058] (-1877.448) -- 0:01:31 Average standard deviation of split frequencies: 0.009549 736000 -- [-1877.025] (-1871.707) (-1865.865) (-1876.335) * (-1869.017) (-1872.724) (-1872.817) [-1873.221] -- 0:01:31 737000 -- (-1864.626) (-1880.093) (-1869.339) [-1864.240] * [-1875.875] (-1867.949) (-1875.496) (-1873.524) -- 0:01:30 738000 -- (-1872.962) [-1869.138] (-1872.338) (-1874.433) * (-1869.308) (-1879.446) [-1882.448] (-1869.213) -- 0:01:30 739000 -- (-1873.331) (-1870.174) (-1879.671) [-1874.562] * (-1864.417) [-1867.568] (-1877.337) (-1880.842) -- 0:01:30 740000 -- [-1867.171] (-1868.835) (-1872.727) (-1876.508) * [-1875.464] (-1873.815) (-1872.534) (-1869.193) -- 0:01:29 Average standard deviation of split frequencies: 0.009894 741000 -- (-1877.615) (-1868.054) (-1871.368) [-1877.104] * (-1875.201) (-1862.483) [-1868.710] (-1872.985) -- 0:01:29 742000 -- (-1872.743) [-1874.090] (-1874.779) (-1874.187) * (-1874.618) (-1871.578) (-1873.039) [-1869.672] -- 0:01:29 743000 -- (-1873.307) (-1876.765) (-1881.678) [-1873.442] * (-1870.970) [-1868.545] (-1869.326) (-1865.779) -- 0:01:28 744000 -- (-1875.595) (-1884.327) (-1880.816) [-1865.971] * (-1872.475) [-1868.751] (-1869.316) (-1878.186) -- 0:01:28 745000 -- (-1871.705) [-1875.569] (-1875.193) (-1870.436) * (-1870.931) [-1868.652] (-1872.793) (-1866.842) -- 0:01:27 Average standard deviation of split frequencies: 0.009938 746000 -- (-1878.371) [-1868.731] (-1866.572) (-1866.631) * (-1868.330) (-1880.187) (-1868.154) [-1864.173] -- 0:01:27 747000 -- (-1870.955) [-1874.060] (-1874.959) (-1872.945) * [-1869.960] (-1872.484) (-1872.397) (-1879.470) -- 0:01:27 748000 -- (-1869.838) [-1871.549] (-1876.779) (-1876.830) * (-1877.574) [-1874.329] (-1877.968) (-1889.797) -- 0:01:26 749000 -- (-1871.260) (-1875.094) [-1872.870] (-1872.425) * (-1875.107) (-1875.943) (-1871.060) [-1873.930] -- 0:01:26 750000 -- [-1873.630] (-1870.951) (-1875.578) (-1867.718) * (-1876.894) [-1865.391] (-1873.980) (-1868.695) -- 0:01:26 Average standard deviation of split frequencies: 0.009248 751000 -- (-1872.250) [-1878.107] (-1875.249) (-1869.274) * (-1868.013) (-1878.831) (-1871.930) [-1876.021] -- 0:01:25 752000 -- (-1880.358) (-1875.300) (-1878.175) [-1882.247] * (-1876.246) (-1872.989) (-1883.935) [-1867.683] -- 0:01:25 753000 -- (-1868.928) (-1873.184) (-1867.852) [-1872.728] * (-1874.953) (-1877.581) [-1864.791] (-1879.734) -- 0:01:25 754000 -- [-1872.120] (-1885.303) (-1872.511) (-1881.181) * (-1871.363) (-1870.078) [-1868.542] (-1869.669) -- 0:01:24 755000 -- (-1871.708) (-1877.360) [-1870.737] (-1874.395) * (-1877.302) (-1874.787) (-1873.569) [-1873.391] -- 0:01:24 Average standard deviation of split frequencies: 0.009863 756000 -- (-1868.347) (-1866.991) [-1873.833] (-1869.862) * (-1873.621) (-1871.612) (-1864.109) [-1868.649] -- 0:01:24 757000 -- (-1872.576) (-1878.217) (-1878.475) [-1877.990] * (-1878.060) [-1870.141] (-1869.769) (-1877.578) -- 0:01:23 758000 -- [-1873.771] (-1867.247) (-1871.571) (-1878.385) * (-1870.399) (-1869.145) [-1866.733] (-1888.294) -- 0:01:23 759000 -- (-1876.089) [-1877.091] (-1877.538) (-1872.415) * (-1875.105) [-1868.443] (-1870.105) (-1871.305) -- 0:01:23 760000 -- (-1883.245) [-1877.600] (-1868.797) (-1868.770) * [-1866.999] (-1872.051) (-1876.933) (-1873.681) -- 0:01:22 Average standard deviation of split frequencies: 0.010197 761000 -- (-1884.558) (-1876.056) (-1867.578) [-1872.868] * [-1869.749] (-1869.294) (-1871.471) (-1872.735) -- 0:01:22 762000 -- (-1876.676) (-1869.263) [-1865.217] (-1885.714) * (-1872.715) (-1872.490) [-1868.093] (-1869.366) -- 0:01:22 763000 -- (-1867.753) [-1873.161] (-1877.027) (-1878.923) * (-1881.234) [-1877.108] (-1879.702) (-1877.246) -- 0:01:21 764000 -- (-1868.638) (-1876.692) (-1877.336) [-1881.664] * (-1871.223) (-1871.858) (-1872.902) [-1867.882] -- 0:01:21 765000 -- [-1868.874] (-1873.578) (-1879.589) (-1879.233) * (-1872.139) (-1876.763) [-1869.070] (-1876.289) -- 0:01:21 Average standard deviation of split frequencies: 0.010014 766000 -- [-1870.328] (-1868.360) (-1875.166) (-1871.257) * [-1868.919] (-1872.320) (-1872.527) (-1867.476) -- 0:01:20 767000 -- (-1870.369) [-1871.910] (-1870.475) (-1872.576) * (-1873.378) [-1866.651] (-1867.841) (-1875.632) -- 0:01:20 768000 -- (-1872.708) (-1875.096) (-1868.900) [-1871.496] * (-1869.126) [-1869.932] (-1871.417) (-1875.027) -- 0:01:20 769000 -- (-1877.342) (-1865.210) (-1866.998) [-1874.601] * (-1864.825) [-1866.836] (-1879.013) (-1872.493) -- 0:01:19 770000 -- (-1873.929) (-1866.767) (-1869.847) [-1868.007] * [-1869.552] (-1870.896) (-1877.304) (-1868.635) -- 0:01:19 Average standard deviation of split frequencies: 0.010176 771000 -- (-1873.311) (-1876.483) (-1867.548) [-1865.361] * (-1870.446) [-1871.251] (-1869.184) (-1871.763) -- 0:01:19 772000 -- (-1869.231) (-1876.620) (-1876.204) [-1872.730] * (-1878.421) (-1872.874) [-1868.341] (-1874.176) -- 0:01:18 773000 -- (-1874.584) (-1873.184) (-1878.297) [-1871.327] * (-1876.158) (-1874.287) [-1873.056] (-1881.406) -- 0:01:18 774000 -- (-1873.278) (-1895.527) (-1869.773) [-1866.749] * (-1871.072) (-1863.570) [-1875.622] (-1872.457) -- 0:01:17 775000 -- [-1872.737] (-1870.385) (-1868.287) (-1889.634) * [-1865.177] (-1872.919) (-1873.575) (-1873.274) -- 0:01:17 Average standard deviation of split frequencies: 0.010879 776000 -- (-1871.076) (-1875.991) (-1869.652) [-1872.424] * [-1865.737] (-1872.540) (-1878.287) (-1872.045) -- 0:01:17 777000 -- [-1870.040] (-1869.802) (-1877.558) (-1872.170) * (-1869.553) (-1865.488) (-1867.367) [-1870.237] -- 0:01:16 778000 -- [-1869.360] (-1868.580) (-1877.135) (-1870.437) * (-1872.208) [-1863.222] (-1869.826) (-1871.170) -- 0:01:16 779000 -- (-1873.088) (-1871.264) (-1872.056) [-1872.607] * [-1866.248] (-1865.846) (-1865.137) (-1870.822) -- 0:01:16 780000 -- (-1871.749) [-1869.417] (-1870.585) (-1869.373) * (-1864.893) (-1879.725) [-1871.484] (-1865.897) -- 0:01:15 Average standard deviation of split frequencies: 0.010759 781000 -- (-1867.343) (-1870.209) [-1871.966] (-1871.963) * (-1874.481) (-1873.779) [-1869.359] (-1866.784) -- 0:01:15 782000 -- (-1871.850) (-1877.097) [-1871.226] (-1871.107) * (-1871.021) (-1891.818) (-1868.921) [-1867.750] -- 0:01:15 783000 -- (-1869.569) (-1872.434) [-1872.313] (-1889.586) * (-1874.083) (-1871.116) (-1870.288) [-1867.465] -- 0:01:14 784000 -- (-1864.314) (-1869.486) (-1879.306) [-1866.355] * (-1875.897) (-1874.818) (-1868.810) [-1865.568] -- 0:01:14 785000 -- [-1869.297] (-1870.931) (-1877.632) (-1876.500) * [-1872.008] (-1868.896) (-1869.730) (-1875.655) -- 0:01:14 Average standard deviation of split frequencies: 0.010523 786000 -- (-1870.448) [-1871.562] (-1873.375) (-1867.575) * (-1874.122) (-1872.470) (-1871.558) [-1875.255] -- 0:01:13 787000 -- [-1869.138] (-1876.520) (-1867.604) (-1879.550) * (-1880.661) (-1869.546) (-1869.760) [-1869.395] -- 0:01:13 788000 -- (-1873.287) (-1873.507) (-1868.327) [-1876.005] * (-1869.869) (-1877.635) [-1874.767] (-1877.673) -- 0:01:13 789000 -- [-1869.126] (-1874.775) (-1870.866) (-1874.934) * (-1874.323) (-1870.285) (-1879.310) [-1870.597] -- 0:01:12 790000 -- (-1873.369) (-1875.492) (-1868.898) [-1870.260] * (-1872.292) (-1872.191) [-1870.960] (-1876.557) -- 0:01:12 Average standard deviation of split frequencies: 0.010461 791000 -- [-1868.993] (-1873.737) (-1871.655) (-1869.444) * [-1870.649] (-1874.300) (-1868.392) (-1867.335) -- 0:01:12 792000 -- [-1870.135] (-1879.898) (-1877.105) (-1880.022) * (-1872.943) (-1871.862) [-1866.448] (-1874.356) -- 0:01:11 793000 -- (-1873.070) (-1881.791) (-1869.540) [-1874.137] * (-1876.170) [-1875.642] (-1874.309) (-1874.018) -- 0:01:11 794000 -- (-1875.749) (-1873.965) (-1876.042) [-1867.863] * (-1871.898) (-1871.614) (-1867.748) [-1869.412] -- 0:01:11 795000 -- (-1874.992) (-1868.303) (-1876.128) [-1869.958] * [-1867.283] (-1866.935) (-1872.471) (-1867.158) -- 0:01:10 Average standard deviation of split frequencies: 0.010929 796000 -- (-1868.789) [-1864.127] (-1878.098) (-1869.384) * (-1867.688) (-1869.423) (-1872.671) [-1874.808] -- 0:01:10 797000 -- (-1874.302) (-1868.977) [-1869.909] (-1873.544) * (-1870.367) (-1872.951) [-1867.571] (-1868.573) -- 0:01:10 798000 -- (-1878.556) [-1871.225] (-1872.776) (-1872.095) * (-1874.301) (-1886.653) (-1867.327) [-1877.932] -- 0:01:09 799000 -- (-1884.400) [-1867.862] (-1883.143) (-1874.220) * (-1873.802) [-1876.251] (-1866.735) (-1875.169) -- 0:01:09 800000 -- (-1870.815) (-1870.108) (-1872.967) [-1866.410] * (-1870.171) (-1872.401) (-1874.570) [-1867.242] -- 0:01:09 Average standard deviation of split frequencies: 0.011187 801000 -- [-1873.552] (-1869.766) (-1871.054) (-1874.569) * (-1875.112) (-1881.690) [-1867.481] (-1872.155) -- 0:01:08 802000 -- (-1868.040) [-1867.196] (-1873.899) (-1883.605) * [-1872.756] (-1867.535) (-1873.104) (-1873.380) -- 0:01:08 803000 -- (-1875.708) (-1869.121) [-1868.838] (-1869.026) * [-1873.454] (-1870.523) (-1867.747) (-1874.894) -- 0:01:07 804000 -- (-1873.895) (-1870.389) (-1877.351) [-1869.023] * (-1880.231) [-1871.144] (-1872.090) (-1878.988) -- 0:01:07 805000 -- (-1875.000) (-1868.735) (-1874.125) [-1869.576] * (-1875.885) [-1867.258] (-1867.641) (-1876.139) -- 0:01:07 Average standard deviation of split frequencies: 0.010847 806000 -- (-1871.000) [-1865.974] (-1886.915) (-1876.763) * (-1884.528) [-1868.025] (-1877.057) (-1881.698) -- 0:01:06 807000 -- [-1866.146] (-1874.729) (-1869.056) (-1864.763) * (-1875.308) (-1874.147) (-1872.899) [-1866.407] -- 0:01:06 808000 -- (-1865.253) [-1874.768] (-1869.432) (-1869.135) * (-1878.586) (-1876.779) (-1866.901) [-1868.234] -- 0:01:06 809000 -- [-1874.879] (-1873.992) (-1876.696) (-1870.732) * (-1874.200) (-1874.329) (-1874.341) [-1875.697] -- 0:01:05 810000 -- (-1871.912) (-1870.953) [-1865.651] (-1872.632) * [-1871.303] (-1872.450) (-1865.591) (-1874.212) -- 0:01:05 Average standard deviation of split frequencies: 0.010943 811000 -- (-1875.679) (-1870.106) (-1871.782) [-1873.698] * (-1875.165) (-1875.870) [-1873.205] (-1869.324) -- 0:01:05 812000 -- (-1875.429) [-1865.769] (-1867.055) (-1873.883) * (-1874.397) (-1868.083) (-1871.583) [-1868.227] -- 0:01:04 813000 -- [-1874.576] (-1877.732) (-1876.576) (-1881.468) * (-1866.397) [-1876.194] (-1872.941) (-1886.244) -- 0:01:04 814000 -- (-1870.360) (-1877.350) (-1869.272) [-1872.492] * [-1866.651] (-1870.808) (-1872.361) (-1863.840) -- 0:01:04 815000 -- (-1870.839) [-1872.272] (-1877.833) (-1864.618) * (-1878.249) (-1866.796) (-1879.914) [-1872.332] -- 0:01:03 Average standard deviation of split frequencies: 0.010766 816000 -- [-1869.621] (-1872.197) (-1878.472) (-1868.681) * (-1878.380) [-1870.563] (-1878.592) (-1884.044) -- 0:01:03 817000 -- [-1871.152] (-1869.296) (-1871.417) (-1872.963) * (-1873.145) (-1871.386) (-1869.934) [-1874.372] -- 0:01:03 818000 -- (-1870.337) (-1874.118) [-1875.898] (-1876.041) * (-1869.548) (-1869.563) [-1874.159] (-1882.655) -- 0:01:02 819000 -- (-1869.193) [-1866.992] (-1879.454) (-1877.171) * (-1874.821) [-1865.750] (-1875.230) (-1876.651) -- 0:01:02 820000 -- (-1876.624) [-1880.241] (-1876.361) (-1882.779) * [-1872.244] (-1872.269) (-1868.635) (-1868.964) -- 0:01:02 Average standard deviation of split frequencies: 0.010809 821000 -- [-1871.849] (-1876.575) (-1873.685) (-1877.052) * (-1872.884) (-1870.112) [-1868.856] (-1875.044) -- 0:01:01 822000 -- (-1872.547) (-1878.045) [-1871.515] (-1873.289) * (-1869.401) (-1884.667) (-1869.154) [-1874.339] -- 0:01:01 823000 -- [-1880.737] (-1875.267) (-1881.408) (-1867.850) * (-1874.768) (-1869.503) (-1874.509) [-1872.220] -- 0:01:01 824000 -- (-1868.074) (-1869.914) [-1881.894] (-1871.847) * (-1871.540) (-1872.554) [-1877.883] (-1875.088) -- 0:01:00 825000 -- (-1875.025) (-1869.911) (-1873.798) [-1872.336] * (-1867.217) (-1879.525) [-1874.266] (-1866.079) -- 0:01:00 Average standard deviation of split frequencies: 0.010999 826000 -- [-1871.307] (-1878.614) (-1866.499) (-1870.083) * (-1865.175) [-1876.920] (-1873.657) (-1868.400) -- 0:01:00 827000 -- (-1871.227) (-1879.467) [-1869.512] (-1877.470) * (-1877.074) [-1871.531] (-1872.710) (-1867.287) -- 0:00:59 828000 -- (-1869.124) (-1866.820) [-1867.554] (-1877.725) * [-1867.609] (-1878.326) (-1867.421) (-1878.104) -- 0:00:59 829000 -- [-1875.304] (-1867.207) (-1878.461) (-1879.879) * (-1875.512) (-1882.574) (-1867.850) [-1871.618] -- 0:00:58 830000 -- (-1879.377) [-1868.315] (-1872.802) (-1881.433) * (-1871.523) [-1872.505] (-1868.702) (-1870.008) -- 0:00:58 Average standard deviation of split frequencies: 0.011453 831000 -- (-1869.319) (-1871.697) [-1867.451] (-1875.248) * (-1876.003) [-1866.900] (-1871.998) (-1876.483) -- 0:00:58 832000 -- [-1870.322] (-1870.714) (-1865.942) (-1868.332) * (-1871.370) [-1867.013] (-1873.098) (-1868.829) -- 0:00:57 833000 -- [-1871.911] (-1873.661) (-1866.903) (-1872.916) * [-1876.408] (-1868.943) (-1871.301) (-1879.395) -- 0:00:57 834000 -- (-1871.674) [-1875.553] (-1870.318) (-1875.559) * (-1864.171) (-1878.003) [-1867.661] (-1888.836) -- 0:00:57 835000 -- (-1875.564) (-1883.083) [-1873.727] (-1867.663) * [-1868.456] (-1866.282) (-1873.596) (-1881.598) -- 0:00:56 Average standard deviation of split frequencies: 0.011073 836000 -- (-1874.092) (-1896.229) (-1873.717) [-1867.402] * (-1868.444) (-1869.718) (-1880.126) [-1873.322] -- 0:00:56 837000 -- (-1870.568) (-1876.593) [-1881.010] (-1871.634) * (-1868.522) [-1876.289] (-1864.890) (-1874.683) -- 0:00:56 838000 -- [-1872.516] (-1875.244) (-1868.545) (-1874.333) * [-1873.715] (-1885.291) (-1868.661) (-1876.193) -- 0:00:55 839000 -- [-1867.011] (-1878.198) (-1873.784) (-1873.105) * [-1875.644] (-1868.926) (-1871.220) (-1868.937) -- 0:00:55 840000 -- (-1867.302) (-1871.075) [-1869.029] (-1872.313) * (-1868.331) (-1884.418) [-1867.251] (-1873.659) -- 0:00:55 Average standard deviation of split frequencies: 0.011419 841000 -- [-1877.014] (-1876.900) (-1872.696) (-1875.719) * [-1875.305] (-1878.206) (-1877.053) (-1873.461) -- 0:00:54 842000 -- (-1875.218) (-1871.615) [-1866.476] (-1874.660) * (-1867.575) [-1866.728] (-1875.957) (-1875.072) -- 0:00:54 843000 -- (-1868.447) (-1869.490) [-1863.526] (-1870.696) * (-1873.790) (-1871.515) [-1876.550] (-1875.951) -- 0:00:54 844000 -- (-1875.689) [-1868.558] (-1872.145) (-1874.641) * [-1867.010] (-1866.624) (-1874.433) (-1873.378) -- 0:00:53 845000 -- [-1874.762] (-1872.114) (-1875.480) (-1869.635) * (-1867.813) (-1874.266) [-1869.542] (-1873.139) -- 0:00:53 Average standard deviation of split frequencies: 0.011499 846000 -- (-1881.902) (-1869.042) (-1877.059) [-1867.170] * (-1875.853) (-1873.763) (-1869.816) [-1872.816] -- 0:00:53 847000 -- [-1875.705] (-1874.461) (-1873.992) (-1881.301) * [-1875.775] (-1885.006) (-1865.196) (-1874.976) -- 0:00:52 848000 -- (-1875.764) [-1867.663] (-1878.043) (-1865.118) * (-1869.479) (-1874.702) [-1867.585] (-1877.925) -- 0:00:52 849000 -- (-1874.509) [-1870.560] (-1865.195) (-1870.693) * (-1873.705) (-1876.610) [-1868.946] (-1871.960) -- 0:00:52 850000 -- (-1881.959) (-1878.615) [-1873.830] (-1869.969) * (-1865.869) [-1867.678] (-1880.832) (-1874.017) -- 0:00:51 Average standard deviation of split frequencies: 0.011134 851000 -- (-1872.412) (-1883.672) [-1865.372] (-1874.291) * (-1874.978) [-1869.976] (-1873.559) (-1869.644) -- 0:00:51 852000 -- (-1876.921) (-1874.264) (-1874.330) [-1872.014] * (-1870.603) (-1867.257) [-1866.857] (-1874.477) -- 0:00:51 853000 -- (-1875.722) [-1875.976] (-1871.359) (-1873.933) * [-1869.691] (-1867.856) (-1872.535) (-1868.586) -- 0:00:50 854000 -- (-1868.727) (-1878.662) [-1864.506] (-1867.601) * (-1875.386) [-1865.594] (-1871.475) (-1870.720) -- 0:00:50 855000 -- (-1871.262) [-1873.822] (-1872.340) (-1871.420) * (-1877.561) (-1871.250) [-1867.102] (-1874.856) -- 0:00:50 Average standard deviation of split frequencies: 0.010764 856000 -- (-1869.811) (-1878.108) [-1867.719] (-1880.287) * (-1870.817) (-1869.457) (-1870.329) [-1864.368] -- 0:00:49 857000 -- (-1870.301) (-1880.660) [-1869.121] (-1876.900) * (-1871.597) (-1889.314) (-1878.584) [-1867.858] -- 0:00:49 858000 -- (-1870.200) (-1881.493) (-1879.438) [-1869.526] * (-1866.784) (-1874.184) [-1868.191] (-1877.678) -- 0:00:48 859000 -- (-1868.962) (-1881.101) [-1872.359] (-1872.228) * [-1870.647] (-1871.841) (-1871.851) (-1870.560) -- 0:00:48 860000 -- (-1878.307) [-1870.642] (-1873.149) (-1866.471) * [-1868.859] (-1878.521) (-1882.404) (-1874.600) -- 0:00:48 Average standard deviation of split frequencies: 0.010108 861000 -- (-1879.407) (-1878.110) [-1871.573] (-1880.228) * (-1870.092) (-1875.034) [-1879.451] (-1866.343) -- 0:00:47 862000 -- (-1870.054) [-1875.047] (-1875.753) (-1868.897) * (-1879.692) (-1875.080) (-1872.905) [-1867.243] -- 0:00:47 863000 -- (-1871.088) (-1890.576) (-1864.492) [-1870.370] * (-1869.474) [-1872.676] (-1873.710) (-1874.823) -- 0:00:47 864000 -- (-1873.798) (-1871.748) (-1873.353) [-1864.424] * [-1866.710] (-1872.101) (-1890.460) (-1872.922) -- 0:00:46 865000 -- (-1875.762) [-1865.199] (-1881.644) (-1882.994) * [-1866.200] (-1876.692) (-1874.210) (-1873.563) -- 0:00:46 Average standard deviation of split frequencies: 0.009996 866000 -- [-1870.965] (-1873.972) (-1879.408) (-1875.604) * [-1872.150] (-1872.366) (-1875.299) (-1878.478) -- 0:00:46 867000 -- (-1870.480) [-1867.107] (-1870.716) (-1868.565) * [-1869.429] (-1874.407) (-1873.382) (-1878.732) -- 0:00:45 868000 -- [-1868.305] (-1874.605) (-1869.654) (-1876.850) * (-1873.759) [-1874.125] (-1877.744) (-1888.115) -- 0:00:45 869000 -- [-1879.662] (-1872.299) (-1876.167) (-1865.094) * (-1880.279) (-1875.738) [-1882.919] (-1873.593) -- 0:00:45 870000 -- [-1864.493] (-1873.596) (-1879.006) (-1871.876) * (-1882.413) [-1871.766] (-1875.205) (-1874.914) -- 0:00:44 Average standard deviation of split frequencies: 0.009844 871000 -- [-1874.481] (-1873.634) (-1867.322) (-1867.027) * [-1871.821] (-1876.997) (-1871.950) (-1873.292) -- 0:00:44 872000 -- (-1875.763) [-1866.244] (-1872.734) (-1883.565) * (-1877.196) [-1868.832] (-1867.013) (-1867.536) -- 0:00:44 873000 -- (-1876.913) (-1865.354) (-1865.869) [-1875.720] * (-1871.959) [-1873.610] (-1869.242) (-1867.823) -- 0:00:43 874000 -- (-1871.513) [-1877.238] (-1866.658) (-1874.813) * (-1871.435) (-1872.565) [-1866.558] (-1877.633) -- 0:00:43 875000 -- (-1875.013) (-1877.698) [-1869.812] (-1869.439) * [-1866.839] (-1875.645) (-1874.082) (-1874.235) -- 0:00:43 Average standard deviation of split frequencies: 0.010029 876000 -- (-1876.784) [-1866.148] (-1871.589) (-1869.527) * [-1871.590] (-1872.810) (-1868.612) (-1872.373) -- 0:00:42 877000 -- (-1877.627) (-1866.040) [-1877.293] (-1868.527) * [-1870.811] (-1875.953) (-1874.120) (-1874.429) -- 0:00:42 878000 -- [-1869.791] (-1881.296) (-1872.139) (-1882.644) * (-1870.235) [-1865.321] (-1881.832) (-1864.866) -- 0:00:42 879000 -- [-1871.336] (-1878.498) (-1866.804) (-1867.605) * (-1870.689) (-1875.688) (-1874.998) [-1873.386] -- 0:00:41 880000 -- (-1866.714) (-1870.464) (-1880.163) [-1869.857] * [-1875.946] (-1880.149) (-1878.004) (-1867.153) -- 0:00:41 Average standard deviation of split frequencies: 0.009538 881000 -- [-1879.217] (-1870.228) (-1875.638) (-1872.086) * (-1877.939) (-1864.868) [-1868.816] (-1877.108) -- 0:00:41 882000 -- (-1876.063) (-1871.408) [-1869.258] (-1871.360) * (-1875.031) [-1879.243] (-1874.383) (-1885.683) -- 0:00:40 883000 -- (-1877.973) [-1873.599] (-1877.772) (-1869.620) * (-1872.427) [-1864.636] (-1876.870) (-1868.113) -- 0:00:40 884000 -- [-1866.704] (-1870.740) (-1874.906) (-1879.361) * (-1883.770) (-1868.448) [-1874.062] (-1870.064) -- 0:00:40 885000 -- [-1871.177] (-1883.523) (-1881.583) (-1877.818) * (-1874.268) (-1865.048) (-1878.503) [-1871.279] -- 0:00:39 Average standard deviation of split frequencies: 0.009577 886000 -- (-1871.629) (-1878.422) [-1866.468] (-1866.917) * [-1869.176] (-1870.153) (-1875.442) (-1869.369) -- 0:00:39 887000 -- (-1871.663) (-1874.770) [-1871.847] (-1873.417) * [-1867.450] (-1871.902) (-1863.508) (-1876.967) -- 0:00:38 888000 -- (-1866.954) (-1873.772) (-1870.164) [-1869.777] * (-1875.570) [-1869.466] (-1870.998) (-1871.657) -- 0:00:38 889000 -- (-1876.639) [-1867.287] (-1875.044) (-1866.726) * (-1873.107) [-1866.830] (-1872.649) (-1865.132) -- 0:00:38 890000 -- (-1875.152) (-1872.577) (-1875.552) [-1869.009] * (-1873.895) (-1872.309) [-1866.919] (-1873.135) -- 0:00:37 Average standard deviation of split frequencies: 0.009575 891000 -- (-1872.569) [-1874.228] (-1872.653) (-1869.822) * [-1865.785] (-1873.579) (-1870.700) (-1876.892) -- 0:00:37 892000 -- (-1875.127) (-1865.341) (-1874.022) [-1873.478] * (-1874.316) [-1872.470] (-1878.314) (-1874.303) -- 0:00:37 893000 -- (-1865.245) (-1879.332) [-1864.542] (-1877.025) * (-1868.857) (-1875.983) [-1869.984] (-1873.448) -- 0:00:36 894000 -- [-1871.345] (-1878.768) (-1863.439) (-1883.473) * (-1873.422) (-1890.011) [-1873.296] (-1878.405) -- 0:00:36 895000 -- (-1884.279) (-1883.124) [-1867.238] (-1872.650) * (-1877.008) [-1867.892] (-1879.635) (-1870.618) -- 0:00:36 Average standard deviation of split frequencies: 0.009470 896000 -- (-1875.080) [-1868.786] (-1875.592) (-1872.847) * (-1871.092) (-1873.021) [-1869.635] (-1875.822) -- 0:00:35 897000 -- (-1877.604) (-1878.005) (-1877.488) [-1876.193] * (-1869.628) (-1869.859) [-1868.325] (-1874.230) -- 0:00:35 898000 -- [-1871.319] (-1871.861) (-1869.950) (-1876.387) * (-1870.970) (-1869.525) (-1876.038) [-1866.651] -- 0:00:35 899000 -- [-1869.870] (-1872.663) (-1871.681) (-1869.695) * [-1872.692] (-1871.227) (-1877.259) (-1877.948) -- 0:00:34 900000 -- (-1871.368) [-1873.776] (-1879.432) (-1882.822) * (-1878.976) (-1876.295) (-1871.264) [-1872.235] -- 0:00:34 Average standard deviation of split frequencies: 0.009469 901000 -- (-1872.936) (-1879.615) (-1871.674) [-1868.904] * [-1866.420] (-1879.452) (-1867.394) (-1870.182) -- 0:00:34 902000 -- [-1868.978] (-1870.380) (-1873.354) (-1872.367) * (-1875.417) (-1868.236) (-1873.254) [-1890.743] -- 0:00:33 903000 -- (-1869.550) [-1869.090] (-1877.970) (-1872.666) * (-1872.032) [-1872.962] (-1870.971) (-1877.254) -- 0:00:33 904000 -- [-1869.597] (-1871.589) (-1869.473) (-1878.579) * [-1872.922] (-1869.783) (-1874.920) (-1867.345) -- 0:00:33 905000 -- (-1874.252) (-1870.268) (-1864.764) [-1876.594] * [-1873.419] (-1882.217) (-1876.880) (-1869.664) -- 0:00:32 Average standard deviation of split frequencies: 0.009318 906000 -- (-1871.312) (-1864.129) (-1876.065) [-1867.305] * (-1884.466) (-1878.047) (-1867.491) [-1870.858] -- 0:00:32 907000 -- (-1869.161) (-1871.135) (-1870.976) [-1874.070] * (-1872.726) (-1875.873) (-1878.304) [-1873.811] -- 0:00:32 908000 -- (-1868.144) (-1868.977) [-1874.123] (-1875.414) * (-1872.154) (-1871.084) [-1869.567] (-1875.636) -- 0:00:31 909000 -- [-1871.482] (-1867.809) (-1871.442) (-1872.886) * [-1876.800] (-1879.247) (-1879.970) (-1872.412) -- 0:00:31 910000 -- (-1876.959) [-1872.793] (-1871.391) (-1874.419) * (-1882.625) [-1884.698] (-1874.200) (-1869.243) -- 0:00:31 Average standard deviation of split frequencies: 0.008894 911000 -- (-1877.540) (-1878.171) [-1866.900] (-1876.875) * [-1869.305] (-1870.135) (-1876.746) (-1860.298) -- 0:00:30 912000 -- (-1880.757) (-1875.533) (-1874.280) [-1870.819] * (-1871.174) (-1872.743) (-1876.274) [-1866.902] -- 0:00:30 913000 -- [-1879.347] (-1867.110) (-1877.515) (-1870.681) * [-1871.441] (-1878.186) (-1873.211) (-1881.002) -- 0:00:30 914000 -- (-1865.910) (-1871.032) [-1871.372] (-1881.332) * (-1890.514) [-1868.173] (-1877.120) (-1870.263) -- 0:00:29 915000 -- (-1872.783) (-1872.126) [-1874.795] (-1875.189) * (-1866.958) (-1874.317) [-1873.235] (-1870.405) -- 0:00:29 Average standard deviation of split frequencies: 0.008749 916000 -- (-1883.708) [-1865.633] (-1869.568) (-1872.013) * (-1868.538) [-1862.502] (-1881.034) (-1876.653) -- 0:00:28 917000 -- [-1880.045] (-1875.098) (-1869.959) (-1872.190) * (-1872.451) [-1874.883] (-1866.789) (-1867.838) -- 0:00:28 918000 -- (-1875.267) (-1869.620) [-1873.458] (-1870.483) * (-1874.563) [-1870.089] (-1867.779) (-1874.324) -- 0:00:28 919000 -- (-1873.327) (-1873.406) [-1872.668] (-1868.933) * [-1877.390] (-1870.290) (-1881.201) (-1884.254) -- 0:00:27 920000 -- [-1870.354] (-1873.636) (-1891.660) (-1877.656) * (-1882.433) (-1874.913) [-1869.022] (-1877.179) -- 0:00:27 Average standard deviation of split frequencies: 0.009170 921000 -- (-1882.012) (-1876.567) [-1866.987] (-1878.734) * [-1871.072] (-1877.151) (-1872.579) (-1874.326) -- 0:00:27 922000 -- [-1870.503] (-1876.245) (-1872.742) (-1888.486) * (-1883.586) (-1876.497) [-1871.057] (-1868.016) -- 0:00:26 923000 -- (-1871.307) (-1873.990) [-1864.896] (-1873.246) * (-1872.960) [-1873.640] (-1871.700) (-1880.522) -- 0:00:26 924000 -- [-1871.693] (-1883.290) (-1869.524) (-1878.208) * (-1872.770) [-1872.943] (-1870.405) (-1872.114) -- 0:00:26 925000 -- [-1867.295] (-1873.915) (-1876.792) (-1872.373) * (-1875.336) (-1881.700) (-1875.841) [-1871.967] -- 0:00:25 Average standard deviation of split frequencies: 0.009395 926000 -- (-1870.035) (-1874.760) (-1867.483) [-1873.507] * (-1880.490) (-1875.008) [-1868.074] (-1874.517) -- 0:00:25 927000 -- (-1873.281) (-1863.760) [-1869.088] (-1868.392) * [-1867.819] (-1868.723) (-1882.693) (-1872.200) -- 0:00:25 928000 -- (-1869.992) (-1868.575) (-1873.192) [-1868.854] * (-1882.006) (-1869.616) (-1872.213) [-1870.802] -- 0:00:24 929000 -- (-1868.587) (-1877.345) [-1873.979] (-1867.919) * [-1874.490] (-1870.923) (-1871.873) (-1866.581) -- 0:00:24 930000 -- (-1874.894) [-1869.755] (-1875.605) (-1872.108) * (-1881.303) [-1865.527] (-1873.623) (-1877.268) -- 0:00:24 Average standard deviation of split frequencies: 0.009532 931000 -- (-1869.863) [-1866.487] (-1879.955) (-1882.205) * [-1876.774] (-1870.540) (-1879.187) (-1871.389) -- 0:00:23 932000 -- (-1877.412) (-1871.330) [-1869.669] (-1878.318) * [-1864.088] (-1866.988) (-1862.264) (-1868.462) -- 0:00:23 933000 -- [-1868.841] (-1870.432) (-1872.740) (-1887.942) * [-1869.318] (-1879.347) (-1867.216) (-1877.739) -- 0:00:23 934000 -- (-1882.948) [-1868.392] (-1871.672) (-1876.985) * (-1870.991) (-1876.509) (-1869.641) [-1870.132] -- 0:00:22 935000 -- (-1871.121) [-1873.642] (-1867.060) (-1878.869) * (-1879.630) [-1866.940] (-1879.853) (-1873.762) -- 0:00:22 Average standard deviation of split frequencies: 0.010073 936000 -- (-1875.125) [-1871.918] (-1870.861) (-1881.959) * (-1873.902) [-1869.925] (-1883.837) (-1876.043) -- 0:00:22 937000 -- (-1876.025) (-1882.531) (-1868.979) [-1869.760] * [-1870.253] (-1872.050) (-1880.407) (-1865.999) -- 0:00:21 938000 -- [-1865.165] (-1870.444) (-1880.857) (-1876.502) * (-1876.888) (-1866.344) [-1868.630] (-1867.905) -- 0:00:21 939000 -- [-1868.643] (-1880.665) (-1876.531) (-1868.768) * (-1872.874) (-1879.313) (-1872.963) [-1871.533] -- 0:00:21 940000 -- (-1867.119) (-1874.017) [-1868.300] (-1871.841) * (-1877.800) (-1885.589) (-1867.759) [-1867.278] -- 0:00:20 Average standard deviation of split frequencies: 0.009977 941000 -- [-1867.717] (-1867.381) (-1885.850) (-1877.239) * (-1882.244) (-1875.977) [-1883.071] (-1873.489) -- 0:00:20 942000 -- (-1868.680) (-1875.963) (-1874.583) [-1872.738] * (-1883.128) [-1869.941] (-1872.577) (-1870.908) -- 0:00:20 943000 -- [-1869.698] (-1880.131) (-1867.700) (-1881.862) * (-1890.756) (-1869.532) (-1872.138) [-1867.267] -- 0:00:19 944000 -- (-1884.735) (-1867.502) (-1873.682) [-1872.814] * (-1874.099) (-1869.902) [-1870.859] (-1881.739) -- 0:00:19 945000 -- [-1872.093] (-1867.520) (-1867.699) (-1876.408) * (-1869.961) [-1875.793] (-1870.477) (-1870.259) -- 0:00:18 Average standard deviation of split frequencies: 0.009468 946000 -- (-1872.061) (-1885.365) (-1871.055) [-1872.991] * [-1872.502] (-1869.025) (-1872.074) (-1873.162) -- 0:00:18 947000 -- (-1871.482) (-1870.681) [-1877.974] (-1875.432) * [-1876.066] (-1866.757) (-1876.308) (-1867.427) -- 0:00:18 948000 -- [-1872.450] (-1881.250) (-1873.832) (-1880.149) * (-1881.356) (-1870.925) [-1873.796] (-1868.144) -- 0:00:17 949000 -- [-1868.423] (-1878.332) (-1869.016) (-1874.930) * [-1882.228] (-1873.504) (-1874.059) (-1885.257) -- 0:00:17 950000 -- [-1869.827] (-1883.362) (-1873.830) (-1872.438) * (-1876.839) [-1873.443] (-1880.982) (-1871.851) -- 0:00:17 Average standard deviation of split frequencies: 0.009196 951000 -- (-1873.947) (-1868.112) [-1868.302] (-1871.192) * (-1867.642) (-1878.999) (-1883.581) [-1871.804] -- 0:00:16 952000 -- (-1877.271) (-1877.091) (-1870.840) [-1877.044] * (-1872.812) (-1878.277) [-1875.050] (-1872.721) -- 0:00:16 953000 -- (-1868.628) (-1872.915) [-1876.846] (-1867.324) * (-1867.137) [-1866.077] (-1879.072) (-1873.106) -- 0:00:16 954000 -- (-1867.913) (-1864.498) (-1876.398) [-1873.052] * (-1876.901) (-1867.342) [-1866.077] (-1881.605) -- 0:00:15 955000 -- (-1870.236) [-1878.730] (-1868.396) (-1865.774) * (-1873.252) (-1868.862) (-1876.723) [-1876.572] -- 0:00:15 Average standard deviation of split frequencies: 0.009369 956000 -- (-1871.105) (-1869.479) (-1868.551) [-1878.946] * (-1879.580) [-1871.010] (-1870.599) (-1867.411) -- 0:00:15 957000 -- (-1873.544) (-1867.905) (-1882.299) [-1866.322] * (-1889.594) (-1873.503) [-1873.320] (-1878.733) -- 0:00:14 958000 -- (-1876.564) (-1880.183) [-1870.443] (-1872.955) * (-1873.024) (-1884.323) (-1881.547) [-1873.898] -- 0:00:14 959000 -- (-1872.042) [-1873.632] (-1872.936) (-1874.691) * (-1873.143) (-1870.729) (-1878.849) [-1875.946] -- 0:00:14 960000 -- (-1876.954) (-1877.778) (-1875.123) [-1868.309] * (-1881.045) (-1870.284) [-1869.482] (-1870.396) -- 0:00:13 Average standard deviation of split frequencies: 0.009190 961000 -- (-1873.944) (-1872.100) [-1865.852] (-1871.689) * (-1869.337) [-1869.820] (-1878.235) (-1870.554) -- 0:00:13 962000 -- (-1867.989) (-1870.905) (-1872.235) [-1867.230] * (-1869.690) [-1868.658] (-1884.669) (-1874.839) -- 0:00:13 963000 -- (-1873.752) (-1881.205) (-1871.611) [-1866.497] * (-1876.046) [-1869.716] (-1870.595) (-1879.102) -- 0:00:12 964000 -- (-1871.968) (-1873.210) [-1880.623] (-1870.959) * (-1875.446) (-1873.606) (-1871.682) [-1870.363] -- 0:00:12 965000 -- (-1875.299) (-1866.982) (-1875.476) [-1870.186] * (-1873.504) [-1865.241] (-1880.419) (-1869.172) -- 0:00:12 Average standard deviation of split frequencies: 0.009494 966000 -- [-1875.391] (-1869.712) (-1873.918) (-1874.392) * (-1875.632) (-1867.021) [-1871.214] (-1867.409) -- 0:00:11 967000 -- (-1872.429) (-1872.607) (-1875.074) [-1873.658] * (-1884.660) (-1866.930) (-1869.636) [-1862.364] -- 0:00:11 968000 -- (-1878.926) [-1866.743] (-1882.660) (-1870.422) * (-1877.771) (-1874.252) (-1870.556) [-1867.101] -- 0:00:11 969000 -- (-1872.933) [-1869.085] (-1877.122) (-1869.500) * (-1867.414) [-1868.694] (-1874.411) (-1868.677) -- 0:00:10 970000 -- (-1872.795) (-1882.628) (-1870.960) [-1877.228] * (-1878.790) (-1874.663) [-1871.707] (-1891.156) -- 0:00:10 Average standard deviation of split frequencies: 0.009404 971000 -- [-1876.691] (-1889.686) (-1863.710) (-1870.933) * (-1874.557) (-1875.903) [-1876.284] (-1868.416) -- 0:00:10 972000 -- [-1866.419] (-1868.096) (-1878.686) (-1873.905) * (-1870.176) (-1869.060) [-1877.241] (-1866.497) -- 0:00:09 973000 -- [-1871.165] (-1867.259) (-1871.670) (-1874.273) * (-1885.978) (-1873.550) (-1871.932) [-1870.959] -- 0:00:09 974000 -- [-1869.889] (-1867.964) (-1869.160) (-1875.259) * [-1874.316] (-1874.626) (-1883.645) (-1869.960) -- 0:00:08 975000 -- (-1871.409) (-1871.576) (-1869.967) [-1868.772] * (-1881.800) (-1877.927) (-1878.062) [-1872.734] -- 0:00:08 Average standard deviation of split frequencies: 0.009309 976000 -- (-1871.608) (-1884.626) [-1869.350] (-1869.846) * [-1870.979] (-1873.839) (-1873.541) (-1874.467) -- 0:00:08 977000 -- (-1875.364) (-1874.796) [-1872.437] (-1867.387) * [-1865.505] (-1867.387) (-1867.585) (-1878.297) -- 0:00:07 978000 -- (-1873.507) (-1876.647) [-1873.587] (-1868.539) * [-1869.598] (-1874.174) (-1878.373) (-1869.859) -- 0:00:07 979000 -- (-1871.903) (-1865.180) (-1865.161) [-1867.372] * (-1874.727) (-1866.987) (-1881.924) [-1875.321] -- 0:00:07 980000 -- (-1878.621) (-1871.108) [-1872.908] (-1873.876) * [-1868.712] (-1873.519) (-1875.116) (-1885.275) -- 0:00:06 Average standard deviation of split frequencies: 0.009701 981000 -- [-1873.859] (-1878.270) (-1879.882) (-1872.026) * [-1865.382] (-1874.539) (-1876.330) (-1867.382) -- 0:00:06 982000 -- (-1872.253) (-1868.830) (-1876.190) [-1876.174] * (-1872.872) [-1868.841] (-1874.660) (-1877.197) -- 0:00:06 983000 -- (-1872.564) (-1870.155) [-1873.125] (-1870.605) * (-1872.135) (-1866.858) (-1878.947) [-1870.348] -- 0:00:05 984000 -- (-1880.045) [-1868.325] (-1875.240) (-1874.602) * (-1872.664) (-1877.425) [-1866.780] (-1872.977) -- 0:00:05 985000 -- [-1876.882] (-1874.691) (-1867.130) (-1874.525) * (-1873.160) (-1881.114) (-1868.555) [-1872.108] -- 0:00:05 Average standard deviation of split frequencies: 0.009910 986000 -- (-1869.482) (-1874.840) (-1872.584) [-1869.630] * (-1879.932) (-1873.021) [-1874.181] (-1876.509) -- 0:00:04 987000 -- (-1867.717) (-1873.041) (-1867.706) [-1869.639] * (-1871.105) (-1870.616) (-1879.450) [-1867.427] -- 0:00:04 988000 -- (-1874.720) (-1869.153) [-1869.022] (-1872.324) * (-1870.060) [-1870.803] (-1869.856) (-1875.756) -- 0:00:04 989000 -- (-1876.929) [-1873.114] (-1867.531) (-1870.249) * (-1864.978) (-1870.513) [-1876.681] (-1873.803) -- 0:00:03 990000 -- (-1876.899) [-1872.608] (-1872.085) (-1871.870) * (-1870.204) [-1875.280] (-1869.676) (-1870.054) -- 0:00:03 Average standard deviation of split frequencies: 0.009950 991000 -- [-1867.714] (-1879.949) (-1872.246) (-1878.662) * [-1880.533] (-1876.582) (-1879.355) (-1868.023) -- 0:00:03 992000 -- (-1872.585) (-1867.301) (-1863.253) [-1871.454] * (-1874.658) [-1867.038] (-1874.490) (-1880.222) -- 0:00:02 993000 -- (-1872.110) (-1882.079) [-1869.112] (-1873.921) * (-1867.636) (-1869.367) [-1867.168] (-1866.721) -- 0:00:02 994000 -- (-1880.622) [-1873.124] (-1877.176) (-1869.271) * (-1876.773) [-1876.351] (-1874.893) (-1872.063) -- 0:00:02 995000 -- (-1885.476) [-1873.169] (-1877.101) (-1873.687) * (-1871.263) (-1876.952) [-1869.911] (-1875.113) -- 0:00:01 Average standard deviation of split frequencies: 0.010025 996000 -- (-1865.248) (-1874.358) (-1873.496) [-1874.406] * (-1875.384) [-1871.925] (-1873.173) (-1877.860) -- 0:00:01 997000 -- [-1871.815] (-1872.776) (-1876.158) (-1874.193) * [-1874.549] (-1870.812) (-1870.157) (-1878.865) -- 0:00:01 998000 -- (-1871.383) (-1871.515) [-1875.611] (-1877.874) * [-1877.489] (-1871.282) (-1869.228) (-1864.215) -- 0:00:00 999000 -- [-1875.351] (-1869.813) (-1883.757) (-1883.904) * [-1867.920] (-1866.073) (-1872.998) (-1868.241) -- 0:00:00 1000000 -- (-1878.751) (-1867.439) [-1873.666] (-1873.504) * (-1874.834) [-1870.002] (-1867.480) (-1873.116) -- 0:00:00 Average standard deviation of split frequencies: 0.010278 Analysis completed in 5 mins 45 seconds Analysis used 345.17 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1859.23 Likelihood of best state for "cold" chain of run 2 was -1859.23 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 56.0 % ( 44 %) Dirichlet(Revmat{all}) 70.4 % ( 59 %) Slider(Revmat{all}) 25.9 % ( 26 %) Dirichlet(Pi{all}) 28.5 % ( 30 %) Slider(Pi{all}) 44.2 % ( 23 %) Multiplier(Alpha{1,2}) 56.5 % ( 23 %) Multiplier(Alpha{3}) 55.4 % ( 35 %) Slider(Pinvar{all}) 28.0 % ( 30 %) ExtSPR(Tau{all},V{all}) 13.5 % ( 12 %) ExtTBR(Tau{all},V{all}) 32.1 % ( 29 %) NNI(Tau{all},V{all}) 38.4 % ( 36 %) ParsSPR(Tau{all},V{all}) 26.8 % ( 29 %) Multiplier(V{all}) 37.9 % ( 36 %) Nodeslider(V{all}) 25.7 % ( 28 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 54.3 % ( 55 %) Dirichlet(Revmat{all}) 69.9 % ( 56 %) Slider(Revmat{all}) 26.1 % ( 24 %) Dirichlet(Pi{all}) 28.4 % ( 21 %) Slider(Pi{all}) 45.6 % ( 28 %) Multiplier(Alpha{1,2}) 55.5 % ( 27 %) Multiplier(Alpha{3}) 56.4 % ( 31 %) Slider(Pinvar{all}) 27.9 % ( 16 %) ExtSPR(Tau{all},V{all}) 13.5 % ( 22 %) ExtTBR(Tau{all},V{all}) 32.0 % ( 27 %) NNI(Tau{all},V{all}) 38.1 % ( 40 %) ParsSPR(Tau{all},V{all}) 26.9 % ( 20 %) Multiplier(V{all}) 37.6 % ( 38 %) Nodeslider(V{all}) 25.7 % ( 19 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.77 0.58 0.42 2 | 167198 0.79 0.61 3 | 167199 166340 0.80 4 | 166263 166071 166929 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.77 0.58 0.42 2 | 166356 0.79 0.61 3 | 167065 166724 0.80 4 | 166264 166713 166878 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p Writing summary statistics to file /data/mrbayes_input.nex.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1869.03 | 2 * 2 2 1 | | 1 1 1 221 2 | |1 1 1 2 1 11 2 2 2 2 11 1 2 | |2 22 21 1 2 * 1 * 2 222 22 *1 2 211 2* 21 2| | 221 1222 1 1 2 1 1 22 * 2 2 * | | 1 1 22 1 2 1 1 1 111 * 21 2 1 12 1 | | 2 12 2 2 1 * 2 2 2 1| | 1 11 1 | | 1 1 1 | | | | | | | | | | | | 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1876.10 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/mrbayes_input.nex.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1866.29 -1880.71 2 -1865.75 -1883.48 -------------------------------------- TOTAL -1865.98 -1882.85 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/mrbayes_input.nex.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.454744 0.005531 0.329214 0.613640 0.446573 935.08 974.18 1.001 r(A<->C){all} 0.068797 0.000797 0.014604 0.121193 0.066365 623.23 717.04 1.001 r(A<->G){all} 0.185632 0.001737 0.109017 0.265175 0.183081 563.71 609.85 1.002 r(A<->T){all} 0.116121 0.000760 0.062855 0.168001 0.113857 806.19 991.51 1.000 r(C<->G){all} 0.083755 0.000911 0.029321 0.143933 0.080386 714.29 721.66 1.000 r(C<->T){all} 0.514757 0.003232 0.406166 0.626012 0.514075 488.69 524.94 1.000 r(G<->T){all} 0.030939 0.000321 0.000291 0.063956 0.028279 838.17 872.93 1.000 pi(A){all} 0.268546 0.000239 0.236834 0.296885 0.268551 1019.36 1061.71 1.000 pi(C){all} 0.227624 0.000193 0.201378 0.255440 0.227224 1266.77 1323.91 1.000 pi(G){all} 0.193908 0.000183 0.167777 0.219698 0.193864 1285.77 1302.99 1.000 pi(T){all} 0.309923 0.000243 0.279230 0.339718 0.309353 822.44 989.20 1.001 alpha{1,2} 0.163266 0.005086 0.011242 0.287990 0.158931 879.12 919.56 1.000 alpha{3} 2.118194 1.325221 0.436457 4.396305 1.875850 974.24 1021.87 1.000 pinvar{all} 0.500870 0.007872 0.314484 0.654058 0.514605 865.50 951.18 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 7 -- C7 8 -- C8 9 -- C9 Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"): ID -- Partition --------------- 1 -- .******** 2 -- .*....... 3 -- ..*...... 4 -- ...*..... 5 -- ....*.... 6 -- .....*... 7 -- ......*.. 8 -- .......*. 9 -- ........* 10 -- ...**.... 11 -- .....***. 12 -- ...****** 13 -- .....**** 14 -- ..******* 15 -- ......**. 16 -- .....**.. 17 -- .....*.*. 18 -- .**...... 19 -- ...**...* 20 -- .*.****** --------------- Summary statistics for informative taxon bipartitions (saved to file "/data/mrbayes_input.nex.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 10 3002 1.000000 0.000000 1.000000 1.000000 2 11 3002 1.000000 0.000000 1.000000 1.000000 2 12 2966 0.988008 0.002827 0.986009 0.990007 2 13 1921 0.639907 0.027794 0.620253 0.659560 2 14 1424 0.474350 0.005653 0.470353 0.478348 2 15 1009 0.336109 0.020257 0.321785 0.350433 2 16 1007 0.335443 0.005182 0.331779 0.339107 2 17 986 0.328448 0.015075 0.317788 0.339107 2 18 884 0.294470 0.010364 0.287142 0.301799 2 19 819 0.272818 0.021199 0.257828 0.287808 2 20 694 0.231179 0.004711 0.227848 0.234510 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/mrbayes_input.nex.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.017918 0.000078 0.000749 0.033682 0.017344 1.001 2 length{all}[2] 0.255049 0.003181 0.152467 0.365468 0.248365 1.001 2 length{all}[3] 0.034017 0.000126 0.011188 0.055111 0.033125 1.000 2 length{all}[4] 0.001577 0.000003 0.000000 0.004743 0.001082 1.000 2 length{all}[5] 0.001589 0.000002 0.000001 0.004576 0.001124 1.000 2 length{all}[6] 0.001619 0.000003 0.000002 0.004736 0.001119 1.000 2 length{all}[7] 0.001657 0.000003 0.000001 0.004863 0.001129 1.000 2 length{all}[8] 0.001617 0.000003 0.000000 0.004800 0.001101 1.001 2 length{all}[9] 0.032064 0.000094 0.015313 0.051659 0.030787 1.000 2 length{all}[10] 0.041119 0.000134 0.020350 0.063807 0.039814 1.000 2 length{all}[11] 0.021945 0.000061 0.008438 0.038082 0.021028 1.000 2 length{all}[12] 0.024872 0.000090 0.006967 0.043568 0.024039 1.000 2 length{all}[13] 0.008084 0.000028 0.000016 0.017966 0.007200 1.000 2 length{all}[14] 0.011350 0.000057 0.000020 0.025226 0.010277 1.000 2 length{all}[15] 0.001598 0.000003 0.000003 0.004636 0.001107 0.999 2 length{all}[16] 0.001581 0.000003 0.000001 0.004714 0.001117 0.999 2 length{all}[17] 0.001702 0.000003 0.000001 0.004946 0.001219 1.004 2 length{all}[18] 0.010642 0.000064 0.000030 0.025515 0.009003 0.999 2 length{all}[19] 0.006617 0.000020 0.000009 0.015132 0.005675 0.999 2 length{all}[20] 0.010119 0.000068 0.000031 0.026008 0.008087 0.999 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.010278 Maximum standard deviation of split frequencies = 0.027794 Average PSRF for parameter values (excluding NA and >10.0) = 1.000 Maximum PSRF for parameter values = 1.004 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) | + /------------------ C4 (4) | /----------------100----------------+ | | \------------------ C5 (5) | | | | /------------------ C6 (6) \--------99-------+ | | /-------100-------+------------------ C7 (7) | | | \--------64-------+ \------------------ C8 (8) | \------------------------------------ C9 (9) Phylogram (based on average branch lengths): /----- C1 (1) | |------------------------------------------------------------------------ C2 (2) | |---------- C3 (3) | + / C4 (4) | /-----------+ | | \ C5 (5) | | | | / C6 (6) \------+ | | /-----+ C7 (7) | | | \-+ \ C8 (8) | \--------- C9 (9) |-------------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (45 trees sampled): 50 % credible set contains 6 trees 90 % credible set contains 18 trees 95 % credible set contains 22 trees 99 % credible set contains 28 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' Running FUBAR... [2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C2,C3,((C4,C5),((C6,C7,C8),C9)))` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **9** sequences, **257** codons, and **1** partitions from `/data//pss_subsets/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -1911.98, AIC-c = 3866.09 (21 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.237 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 2.815 * non-synonymous rate = 0.357 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results | Codon | Partition | alpha | beta |Posterior prob for positive selection| |:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:| | 9 | 1 | 0.716 | 8.029 | Pos. posterior = 0.9463 | | 55 | 1 | 0.700 | 7.164 | Pos. posterior = 0.9484 | | 88 | 1 | 1.315 | 7.573 | Pos. posterior = 0.9198 | ---- ## FUBAR inferred 3 sites subject to diversifying positive selection at posterior probability >= 0.9 Of these, 0.19 are expected to be false positives (95% confidence interval of 0-1 )
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=9, Len=257 BY140535_orf4b_AWH65913_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MTDDSMDLSLDCVIAQPSSEIVMMPLSPISTRKRRRHPMNKRRYAKRRFT BtPa_GD2013_NA_AIA62346_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MTDDSMDLNLDCVIAQPSSEIVMMPLSPISTRKRRRHPKNKTRYAKRRFS BY140562_orf4b_AWH65924_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MTDDSMDLSLDCVIAQPSSEIVMMPLSPISTRKRRRHPMNKRRYAKRRFT HKU5_1_LMH03f_NS3c_YP_001039965_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT LMH03f_NS3c_ABN10878_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT TT06f_NS3c_ABN10896_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT TT07f_NS3c_ABN10905_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT YD13403_orf4b_AWH65935_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT ******.********** ****************** ** *******: BY140535_orf4b_AWH65913_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 PVVPSDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV BtPa_GD2013_NA_AIA62346_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PLEPRDIIMCEKPTHCIRLVFDQSLRWLHFDGVKNILADYGVTFSSDLHV BY140562_orf4b_AWH65924_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV HKU5_1_LMH03f_NS3c_YP_001039965_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PVEPNDIIMCDKPTHCIRLVFDQSLRWVHFDGIKNILTDYDVIFNPDLHV LMH03f_NS3c_ABN10878_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PVEPNDIIMCDKPTHCIRLVFDQSLRWVHFDGIKNILTDYDVIFNPDLHV TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV TT06f_NS3c_ABN10896_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV TT07f_NS3c_ABN10905_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV YD13403_orf4b_AWH65935_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV *: * *****:****************:****:****:**.* *..**** BY140535_orf4b_AWH65913_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL BtPa_GD2013_NA_AIA62346_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 TVALVCAGNGVTFSDLTPLTFLLADMLLEFNGISTLGQTLVIGVREYPWL BY140562_orf4b_AWH65924_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFNLGQTLVIGAREYCWL HKU5_1_LMH03f_NS3c_YP_001039965_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL LMH03f_NS3c_ABN10878_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL TT06f_NS3c_ABN10896_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL TT07f_NS3c_ABN10905_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL YD13403_orf4b_AWH65935_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 TIALVCAGNGVTFSDLTPLTFILAEMLLEFNGNFTLGQTLVIGAREYHWL *:*******************:**:******* .********.*** ** BY140535_orf4b_AWH65913_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 PQELKTNVGKAIPQSKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY BtPa_GD2013_NA_AIA62346_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PKDLKSNVGQAIPQSKEWLVEHGYNVYHTGLPTHMSLAKLHSLDFVQQSY BY140562_orf4b_AWH65924_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 PQELKANVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDSVQQSY HKU5_1_LMH03f_NS3c_YP_001039965_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY LMH03f_NS3c_ABN10878_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY TT06f_NS3c_ABN10896_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY TT07f_NS3c_ABN10905_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY YD13403_orf4b_AWH65935_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 PQELKTNVGKAIPQAKEWLVHHGYNVYHTGLPTHMSLAKLHSLDFVQQSY *::**:***:****:*****.*********************** ***** BY140535_orf4b_AWH65913_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY BtPa_GD2013_NA_AIA62346_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY BY140562_orf4b_AWH65924_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY HKU5_1_LMH03f_NS3c_YP_001039965_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY LMH03f_NS3c_ABN10878_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY TT06f_NS3c_ABN10896_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY TT07f_NS3c_ABN10905_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY YD13403_orf4b_AWH65935_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY ************************************************** BY140535_orf4b_AWH65913_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 RACFPGR BtPa_GD2013_NA_AIA62346_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 RACFPGR BY140562_orf4b_AWH65924_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 RACFPGR HKU5_1_LMH03f_NS3c_YP_001039965_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 RACFPGR LMH03f_NS3c_ABN10878_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 RACFPGR TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 RACFPGR TT06f_NS3c_ABN10896_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 RACFPGR TT07f_NS3c_ABN10905_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 RACFPGR YD13403_orf4b_AWH65935_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 RACFPGR *******
>BY140535_orf4b_AWH65913_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ATGACGGACGACTCGATGGATTTGAGCTTAGACTGCGTTATAGCACAGCCTTCCAGCGAAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGCAAACGTCGTCGTCATCCAATGAATAAAAGACGCTATGCTAAGCGCCGTTTTACTCCTGTTGTGCCGAGCGATATCATAATGTGTGAAAAACCCACACATTGCATTCGCTTGGTTTTCGACCAATCATTACGCTGGGTGCATTTTGATGGTATCAAAAACATCCTCAGTGATTATGATGTTATCTTCAACCCTGATTTACACGTTACTGTTGCATTAGTTTGCGCAGGTAACGGTGTTACATTCAGTGATCTCACACCACTAACATTCATTCTAGCTGACATGCTGCTTGAATTTAATGGTATCTTTACTTTGGGACAGACTTTGGTCATTGGTGCTCGTGAGTACCACTGGCTACCACAAGAGCTCAAAACTAATGTGGGCAAAGCTATCCCTCAGTCTAAAGAATGGCTTGTAGATCATGGTTACAACGTGTACCATACAGGCCTTCCTACTCATATGTCGCTTGCAAAGCTGCATTCTTTAGACTTTGTCCAACAATCTTACGTTGGCAGCAAGTTCTTTATTAAACATTCTCACACCACCGAATATGCTATGCCTGTTTGTTTACAGGTAATAGCTATTGATGGTGAGAAAGTTGATGGTCGATCGAAACCCTTGTTTCAGTATCCCATCCATAATCATTACAGACACTATCGTGCCTGCTTTCCTGGCCGC >BtPa_GD2013_NA_AIA62346_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGACGGACGACTCGATGGATTTGAACTTAGACTGCGTTATAGCACAGCCTTCCAGCGAAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGAAAACGCCGTCGTCACCCGAAGAATAAAACGCGCTATGCAAAGCGCCGTTTTAGTCCTCTTGAACCTCGCGATATTATAATGTGTGAAAAGCCTACCCATTGTATTCGCTTGGTTTTCGACCAATCCTTGAGATGGTTGCATTTTGATGGCGTCAAAAACATCCTTGCTGATTATGGCGTCACATTTTCCTCTGATTTACACGTTACAGTGGCATTAGTTTGCGCAGGTAATGGTGTTACATTCAGTGATTTAACACCACTAACATTCTTACTAGCTGACATGCTACTGGAATTTAATGGTATTTCTACTTTGGGACAGACCTTAGTCATTGGTGTGCGCGAGTACCCATGGCTACCAAAAGACCTTAAATCTAATGTAGGTCAGGCTATCCCTCAGTCCAAAGAATGGCTTGTAGAACATGGTTACAACGTGTACCATACAGGCCTTCCAACTCATATGTCGCTTGCAAAGCTTCACTCATTAGATTTTGTCCAACAGTCCTATGTTGGCAGCAAATTTTTCATTAAACATTCTCACACCACTGAATATGCTATGCCTGTTTGTTTACAGGTAATAGCTATTGACGGTGAGAAAGTTGATGGTCGATCGAAACCTTTGTTTCAGTATCCCATTCATAATCATTACAGACACTATCGTGCCTGCTTTCCTGGCCGC >BY140562_orf4b_AWH65924_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ATGACGGACGACTCGATGGATTTGAGCTTAGACTGCGTTATAGCACAGCCTTCCAGCGAAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGGAAACGTCGTCGTCATCCAATGAATAAAAGACGCTACGCTAAGCGCCGTTTTACTCCTGTTGAGCCAAACGACATCATAATGTGTGAAAAACCCACACATTGCATTCGCTTGGTTTTCGACCAATCATTACGCTGGGTGCATTTTGATGGTATCAAAAACATCCTCAGTGATTATGATGTTATCTTCAACCCTGATTTACACGTTACTGTAGCATTAGTTTGCGCAGGTAATGGTGTAACATTCAGTGATCTCACACCACTAACATTCATTCTAGCTGACATGCTGCTTGAATTTAATGGTATCTTCAATTTGGGACAGACTTTAGTCATTGGTGCTCGTGAGTACTGCTGGCTTCCACAGGAGCTCAAAGCTAATGTGGGCAAAGCTATCCCTCAGGCTAAAGAATGGCTTGTAGATCATGGCTACAATGTGTACCATACAGGCCTTCCAACTCATATGTCGCTTGCAAAGCTGCATTCATTAGACTCTGTCCAACAATCATATGTTGGCAGCAAGTTCTTTATTAAACATTCTCACACCACTGAATATGCTATGCCTGTTTGTCTACAGGTAATAGCTATTGATGGTGAGAAAGTTGATGGTCGATCGAAACCCCTGTTTCAGTATCCCATTCATAATCATTACAGACACTATCGTGCCTGCTTTCCTGGCCGC >HKU5_1_LMH03f_NS3c_YP_001039965_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ---ATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGCAAACGTCGTCGTCATCCCATGAATAAAAGACGCTACGCTAAGCGCCGTTTTACTCCTGTAGAGCCAAACGATATTATAATGTGTGATAAACCCACACATTGTATTCGCTTGGTTTTTGATCAATCATTACGCTGGGTGCATTTTGATGGTATCAAAAACATCCTCACTGATTATGATGTTATTTTTAACCCTGATTTACACGTTACTGTTGCTTTAGTTTGTGCAGGTAATGGTGTTACATTCAGTGATCTCACACCACTAACATTCATTCTAGCTGACATGCTGCTTGAATTTAATGGTATCTTTACTTTGGGACAGACTTTGGTCATTGGTGCTCGTGAGTACCATTGGCTACCACAAGAGCTTAAAACTAATGTGGGCAAAGCTATCCCTCAGGCTAAAGAATGGCTTGTAGATCATGGCTACAACGTGTACCATACAGGCCTTCCTACTCATATGTCGCTTGCAAAGCTTCATTCACTTGACTTCGTCCAACAATCATATGTTGGCAGTAAGTTCTTTATTAAGCATTCTCATACCACTGAATATGCTATGCCCGTTTGTTTACAGGTAATAGCTATTGATGGTGAGAAAGTTGATGGTCGATCGAAACCCCTGTTTCAGTATCCCATCCATAATCATTACAGACACTATCGTGCCTGCTTTCCTGGCCGC >LMH03f_NS3c_ABN10878_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ---ATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGCAAACGTCGTCGTCATCCCATGAATAAAAGACGCTACGCTAAGCGCCGTTTTACTCCTGTAGAGCCAAACGATATTATAATGTGTGATAAACCCACACATTGTATTCGCTTGGTTTTTGATCAATCATTACGCTGGGTGCATTTTGATGGTATCAAAAACATCCTCACTGATTATGATGTTATTTTTAACCCTGATTTACACGTTACTGTTGCTTTAGTTTGTGCAGGTAATGGTGTTACATTCAGTGATCTCACACCACTAACATTCATTCTAGCTGACATGCTGCTTGAATTTAATGGTATCTTTACTTTGGGACAGACTTTGGTCATTGGTGCTCGTGAGTACCATTGGCTACCACAAGAGCTTAAAACTAATGTGGGCAAAGCTATCCCTCAGGCTAAAGAATGGCTTGTAGATCATGGCTACAACGTGTACCATACAGGCCTTCCTACTCATATGTCGCTTGCAAAGCTTCATTCACTTGACTTCGTCCAACAATCATATGTTGGCAGTAAGTTCTTTATTAAGCATTCTCATACCACTGAATATGCTATGCCCGTTTGTTTACAGGTAATAGCTATTGATGGTGAGAAAGTTGATGGTCGATCGAAACCCCTGTTTCAGTATCCCATCCATAATCATTACAGACACTATCGTGCCTGCTTTCCTGGCCGC >TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ---ATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGGAAACGTCGTCGTCATCCGATGAATAAAAGACGCTATGCTAAGCGCCGTTTTACTCCTGTTGAGCCAAACGATATAATAATGTGTGAAAAACCCACACATTGTATTCGCTTGGTTTTCGACCAATCATTACGCTGGGTGCATTTTGATGGTATCAAAAACATCCTCAGTGATTATGATGTTATCTTTAACCCTGATTTACACGTTACTGTAGCATTAGTTTGCGCAGGTAACGGTGTTACATTCAGTGATCTCACACCACTAACATTCATTCTAGCTGACATGCTGCTTGAATTTAATGGCATCTTTACTTTGGGACAGACTTTGGTCATTGGTGCACGAGAGTACCATTGGCTACCACAAGAGCTCAAAACTAATGTGGGCAAAGCGATCCCTCAGGCTAAAGAATGGCTTGTAGACCATGGCTACAATGTGTACCATACAGGCCTTCCTACTCATATGTCGCTTGCAAAGCTGCATTCATTAGACTTCGTCCAACAATCATATGTTGGCAGTAAGTTCTTTATTAAACATTCTCACACCACCGAATACGCTATGCCTGTTTGCTTACAGGTAATAGCTATTGATGGTGAGAAAGTTGATGGTCGATCGAAACCTCTGTTTCAGTATCCCATCCATAATCACTACAGACACTATCGTGCCTGCTTTCCTGGCCGC >TT06f_NS3c_ABN10896_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ---ATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGGAAACGTCGTCGTCATCCGATGAATAAAAGACGCTATGCTAAGCGCCGTTTTACTCCTGTTGAGCCAAACGATATAATAATGTGTGAAAAACCCACACATTGTATTCGCTTGGTTTTCGACCAATCATTACGCTGGGTGCATTTTGATGGTATCAAAAACATCCTCAGTGATTATGATGTTATCTTTAACCCTGATTTACACGTTACTGTAGCATTAGTTTGCGCAGGTAACGGTGTTACATTCAGTGATCTCACACCACTAACATTCATTCTAGCTGACATGCTGCTTGAATTTAATGGCATCTTTACTTTGGGACAGACTTTGGTCATTGGTGCACGAGAGTACCATTGGCTACCACAAGAGCTCAAAACTAATGTGGGCAAAGCGATCCCTCAGGCTAAAGAATGGCTTGTAGACCATGGCTACAATGTGTACCATACAGGCCTTCCTACTCATATGTCGCTTGCAAAGCTGCATTCATTAGACTTCGTCCAACAATCATATGTTGGCAGTAAGTTCTTTATTAAACATTCTCACACCACCGAATACGCTATGCCTGTTTGCTTACAGGTAATAGCTATTGATGGTGAGAAAGTTGATGGTCGATCGAAACCTCTGTTTCAGTATCCCATCCATAATCACTACAGACACTATCGTGCCTGCTTTCCTGGCCGC >TT07f_NS3c_ABN10905_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ---ATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGGAAACGTCGTCGTCATCCGATGAATAAAAGACGCTATGCTAAGCGCCGTTTTACTCCTGTTGAGCCAAACGATATAATAATGTGTGAAAAACCCACACATTGTATTCGCTTGGTTTTCGACCAATCATTACGCTGGGTGCATTTTGATGGTATCAAAAACATCCTCAGTGATTATGATGTTATCTTTAACCCTGATTTACACGTTACTGTAGCATTAGTTTGCGCAGGTAACGGTGTTACATTCAGTGATCTCACACCACTAACATTCATTCTAGCTGACATGCTGCTTGAATTTAATGGCATCTTTACTTTGGGACAGACTTTGGTCATTGGTGCACGAGAGTACCATTGGCTACCACAAGAGCTCAAAACTAATGTGGGCAAAGCGATCCCTCAGGCTAAAGAATGGCTTGTAGACCATGGCTACAATGTGTACCATACAGGCCTTCCTACTCATATGTCGCTTGCAAAGCTGCATTCATTAGACTTCGTCCAACAATCATATGTTGGCAGTAAGTTCTTTATTAAACATTCTCACACCACCGAATACGCTATGCCTGTTTGCTTACAGGTAATAGCTATTGATGGTGAGAAAGTTGATGGTCGATCGAAACCTCTGTTTCAGTATCCCATCCATAATCACTACAGACACTATCGTGCCTGCTTTCCTGGCCGC >YD13403_orf4b_AWH65935_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ---ATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGGAAACGTCGTCGTCATCCGATGAATAAAAGACGCTATGCCAAGCGCCGTTTTACTCCTGTTGAGCCAAACGATATCATAATGTGTGAAAAACCCACACATTGCATTCGCTTGGTTTTTGACCAATCATTACGCTGGGTGCATTTTGATGGTATCAAAAACATCCTCAGTGATTATGATGTTATCTTTAACCCTGATTTACACGTTACTATTGCTCTAGTTTGCGCAGGTAACGGTGTTACATTCAGTGATCTCACACCACTAACATTCATCCTAGCTGAAATGCTGCTTGAATTTAATGGTAACTTTACTTTGGGACAGACTTTGGTCATTGGTGCACGAGAGTACCATTGGCTACCACAAGAGCTAAAAACTAATGTGGGCAAAGCTATCCCTCAGGCTAAAGAATGGCTTGTACATCATGGTTACAACGTGTACCATACAGGCCTTCCAACTCATATGTCGCTTGCAAAGCTGCATTCATTAGACTTCGTCCAACAATCATACGTTGGCAGTAAGTTCTTTATTAAACATTCTCACACCACTGAATATGCTATGCCTGTTTGTTTACAGGTAATAGCTATTGATGGTGAGAAAGTTGATGGTCGATCAAAACCTCTGTTTCAGTATCCCATTCACAATCATTACAGACACTATCGTGCCTGCTTTCCTGGCCGC
>BY140535_orf4b_AWH65913_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MTDDSMDLSLDCVIAQPSSEIVMMPLSPISTRKRRRHPMNKRRYAKRRFT PVVPSDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL PQELKTNVGKAIPQSKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY RACFPGR >BtPa_GD2013_NA_AIA62346_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MTDDSMDLNLDCVIAQPSSEIVMMPLSPISTRKRRRHPKNKTRYAKRRFS PLEPRDIIMCEKPTHCIRLVFDQSLRWLHFDGVKNILADYGVTFSSDLHV TVALVCAGNGVTFSDLTPLTFLLADMLLEFNGISTLGQTLVIGVREYPWL PKDLKSNVGQAIPQSKEWLVEHGYNVYHTGLPTHMSLAKLHSLDFVQQSY VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY RACFPGR >BY140562_orf4b_AWH65924_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MTDDSMDLSLDCVIAQPSSEIVMMPLSPISTRKRRRHPMNKRRYAKRRFT PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFNLGQTLVIGAREYCWL PQELKANVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDSVQQSY VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY RACFPGR >HKU5_1_LMH03f_NS3c_YP_001039965_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT PVEPNDIIMCDKPTHCIRLVFDQSLRWVHFDGIKNILTDYDVIFNPDLHV TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY RACFPGR >LMH03f_NS3c_ABN10878_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT PVEPNDIIMCDKPTHCIRLVFDQSLRWVHFDGIKNILTDYDVIFNPDLHV TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY RACFPGR >TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY RACFPGR >TT06f_NS3c_ABN10896_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY RACFPGR >TT07f_NS3c_ABN10905_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV TVALVCAGNGVTFSDLTPLTFILADMLLEFNGIFTLGQTLVIGAREYHWL PQELKTNVGKAIPQAKEWLVDHGYNVYHTGLPTHMSLAKLHSLDFVQQSY VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY RACFPGR >YD13403_orf4b_AWH65935_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 -MDDSMDLDLDCVIAQPSSTIVMMPLSPISTRKRRRHPMNKRRYAKRRFT PVEPNDIIMCEKPTHCIRLVFDQSLRWVHFDGIKNILSDYDVIFNPDLHV TIALVCAGNGVTFSDLTPLTFILAEMLLEFNGNFTLGQTLVIGAREYHWL PQELKTNVGKAIPQAKEWLVHHGYNVYHTGLPTHMSLAKLHSLDFVQQSY VGSKFFIKHSHTTEYAMPVCLQVIAIDGEKVDGRSKPLFQYPIHNHYRHY RACFPGR
Reading sequence file /data//pss_subsets/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/fasta/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1 Found 9 sequences of length 771 Alignment looks like a valid DNA alignment. Estimated diversity is (pairwise deletion - ignoring missing/ambig): 5.7% Found 51 informative sites. Writing alignment of informative sites to: Phi.inf.sites Writing list of informative sites to: Phi.inf.list Calculating all pairwise incompatibilities... Done: 0.0%100.0% Using a window size of 80 with k as 5 Calculating analytical mean and variance Doing permutation test for PHI Doing permutation test for NSS Doing Permutation test for MAXCHI Writing alignment of polymorphic unambig sites to: Phi.poly.sites Window size is 84 polymorphic sites **p-Value(s)** ---------- NSS: 7.44e-01 (1000 permutations) Max Chi^2: 9.00e-03 (1000 permutations) PHI (Permutation): 2.30e-02 (1000 permutations) PHI (Normal): 2.24e-02
#NEXUS [ID: 4172891057] begin taxa; dimensions ntax=9; taxlabels BY140535_orf4b_AWH65913_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 BtPa_GD2013_NA_AIA62346_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 BY140562_orf4b_AWH65924_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 HKU5_1_LMH03f_NS3c_YP_001039965_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 LMH03f_NS3c_ABN10878_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 TT06f_NS3c_ABN10896_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 TT07f_NS3c_ABN10905_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 YD13403_orf4b_AWH65935_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ; end; begin trees; translate 1 BY140535_orf4b_AWH65913_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5, 2 BtPa_GD2013_NA_AIA62346_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5, 3 BY140562_orf4b_AWH65924_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5, 4 HKU5_1_LMH03f_NS3c_YP_001039965_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5, 5 LMH03f_NS3c_ABN10878_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5, 6 TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5, 7 TT06f_NS3c_ABN10896_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5, 8 TT07f_NS3c_ABN10905_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5, 9 YD13403_orf4b_AWH65935_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:1.734427e-02,2:2.483648e-01,3:3.312531e-02,((4:1.082352e-03,5:1.124199e-03)1.000:3.981382e-02,((6:1.118673e-03,7:1.128736e-03,8:1.101125e-03)1.000:2.102840e-02,9:3.078703e-02)0.640:7.199698e-03)0.988:2.403912e-02); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:1.734427e-02,2:2.483648e-01,3:3.312531e-02,((4:1.082352e-03,5:1.124199e-03):3.981382e-02,((6:1.118673e-03,7:1.128736e-03,8:1.101125e-03):2.102840e-02,9:3.078703e-02):7.199698e-03):2.403912e-02); end;
Estimated marginal likelihoods for runs sampled in files "/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/mrbayes_input.nex.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1865.80 -1879.55 2 -1865.96 -1879.94 -------------------------------------- TOTAL -1865.88 -1879.76 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/mrbayes_input.nex.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.451659 0.005179 0.323877 0.597337 0.445167 1230.19 1275.51 1.000 r(A<->C){all} 0.069541 0.000812 0.020476 0.126434 0.066554 671.91 780.18 1.002 r(A<->G){all} 0.187722 0.001733 0.107723 0.268560 0.184180 760.38 801.50 1.000 r(A<->T){all} 0.117332 0.000831 0.067041 0.178537 0.115295 780.34 796.02 1.000 r(C<->G){all} 0.083463 0.000925 0.028729 0.142312 0.080474 811.69 819.43 1.000 r(C<->T){all} 0.510754 0.003250 0.390813 0.616064 0.510946 723.80 740.97 1.000 r(G<->T){all} 0.031189 0.000316 0.001092 0.065092 0.028921 914.98 929.28 1.000 pi(A){all} 0.267854 0.000231 0.237550 0.297582 0.267691 1091.38 1201.93 1.001 pi(C){all} 0.227746 0.000197 0.200981 0.256092 0.227221 1085.74 1293.37 1.001 pi(G){all} 0.194010 0.000183 0.168189 0.220006 0.193778 1310.99 1355.43 1.000 pi(T){all} 0.310390 0.000249 0.281256 0.343061 0.310388 1177.66 1211.45 1.000 alpha{1,2} 0.167802 0.005098 0.024165 0.303018 0.161687 977.08 1044.71 1.005 alpha{3} 2.116727 1.265798 0.479979 4.366005 1.874239 1005.88 1093.26 1.001 pinvar{all} 0.503875 0.007331 0.332414 0.659123 0.516264 873.67 876.92 1.002 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C2,C3,((C4,C5),((C6,C7,C8),C9)))` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **9** sequences, **257** codons, and **1** partitions from `/data//pss_subsets/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3c_ABN10887_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -1911.98, AIC-c = 3866.09 (21 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.237 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 2.815 * non-synonymous rate = 0.357 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results | Codon | Partition | alpha | beta |Posterior prob for positive selection| |:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:| | 9 | 1 | 0.716 | 8.029 | Pos. posterior = 0.9463 | | 55 | 1 | 0.700 | 7.164 | Pos. posterior = 0.9484 | | 88 | 1 | 1.315 | 7.573 | Pos. posterior = 0.9198 | ---- ## FUBAR inferred 3 sites subject to diversifying positive selection at posterior probability >= 0.9 Of these, 0.19 are expected to be false positives (95% confidence interval of 0-1 )
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500