--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -839.16 -851.97
2 -838.68 -851.79
--------------------------------------
TOTAL -838.89 -851.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.304420 0.004249 0.192208 0.436590 0.295201 867.53 937.34 1.000
r(A<->C){all} 0.087069 0.001616 0.013860 0.160857 0.082410 553.39 620.23 1.000
r(A<->G){all} 0.157403 0.002704 0.069745 0.263839 0.151584 497.65 528.29 1.001
r(A<->T){all} 0.100707 0.001639 0.026705 0.177595 0.096963 349.86 400.34 1.002
r(C<->G){all} 0.053979 0.001010 0.003957 0.117868 0.048972 525.66 679.42 1.001
r(C<->T){all} 0.542941 0.006004 0.404741 0.705339 0.542053 440.86 467.87 1.001
r(G<->T){all} 0.057900 0.001009 0.005587 0.120305 0.052467 398.34 539.83 1.000
pi(A){all} 0.267532 0.000490 0.223611 0.308719 0.267272 1089.42 1190.71 1.001
pi(C){all} 0.260152 0.000492 0.217138 0.303646 0.259480 1168.94 1334.97 1.001
pi(G){all} 0.227061 0.000475 0.186221 0.271200 0.226350 1137.35 1178.08 1.000
pi(T){all} 0.245256 0.000473 0.201398 0.286221 0.245012 1236.80 1282.96 1.000
alpha{1,2} 0.120502 0.011230 0.000061 0.294930 0.100671 1067.70 1113.04 1.000
alpha{3} 2.309624 1.642257 0.473627 4.929037 2.024246 1259.95 1319.39 1.000
pinvar{all} 0.472338 0.013584 0.237283 0.681523 0.479801 1168.29 1183.77 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
-- Starting log on Tue Oct 25 21:14:53 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=9, Len=119
C1 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNIQYPIKWRCIYT
C2 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYT
C3 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYT
C4 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYT
C5 MDYVSLLNQVWQKQVNSAHEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYT
C6 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C7 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C8 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C9 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGTLQYPIKWRCIYT
*****************::******:***:*******.:* *********
C1 FAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C2 FAGYTGTSTEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C3 FAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C4 FAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C5 FAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C6 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C7 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C8 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C9 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
*******:*****.***************: ****** *********::*
C1 RYDASKSYFYTQTSSSSNE
C2 RYDASKSYFYTETSSSSNE
C3 RYDASKSYFYTQTSSSSHE
C4 RYDASKSYFYTQTSSSSHE
C5 RYDASKSYFYTKTPSSPEE
C6 RYDASKSYFYTETSSSSDE
C7 RYDASKSYFYTETSSSSDE
C8 RYDASKSYFYTETSSSSDE
C9 RYDASKSYFYTETSSSSDE
***********:*.**..*
-- Starting log on Tue Oct 25 21:15:34 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=9, Len=119
C1 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNIQYPIKWRCIYT
C2 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYT
C3 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYT
C4 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYT
C5 MDYVSLLNQVWQKQVNSAHEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYT
C6 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C7 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C8 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C9 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGTLQYPIKWRCIYT
*****************::******:***:*******.:* *********
C1 FAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C2 FAGYTGTSTEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C3 FAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C4 FAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C5 FAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C6 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C7 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C8 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C9 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
*******:*****.***************: ****** *********::*
C1 RYDASKSYFYTQTSSSSNE
C2 RYDASKSYFYTETSSSSNE
C3 RYDASKSYFYTQTSSSSHE
C4 RYDASKSYFYTQTSSSSHE
C5 RYDASKSYFYTKTPSSPEE
C6 RYDASKSYFYTETSSSSDE
C7 RYDASKSYFYTETSSSSDE
C8 RYDASKSYFYTETSSSSDE
C9 RYDASKSYFYTETSSSSDE
***********:*.**..*
-- Starting log on Tue Oct 25 21:14:53 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=9, Len=119
C1 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNIQYPIKWRCIYT
C2 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYT
C3 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYT
C4 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYT
C5 MDYVSLLNQVWQKQVNSAHEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYT
C6 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C7 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C8 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
C9 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGTLQYPIKWRCIYT
*****************::******:***:*******.:* *********
C1 FAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C2 FAGYTGTSTEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C3 FAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C4 FAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C5 FAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
C6 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C7 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C8 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
C9 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
*******:*****.***************: ****** *********::*
C1 RYDASKSYFYTQTSSSSNE
C2 RYDASKSYFYTETSSSSNE
C3 RYDASKSYFYTQTSSSSHE
C4 RYDASKSYFYTQTSSSSHE
C5 RYDASKSYFYTKTPSSPEE
C6 RYDASKSYFYTETSSSSDE
C7 RYDASKSYFYTETSSSSDE
C8 RYDASKSYFYTETSSSSDE
C9 RYDASKSYFYTETSSSSDE
***********:*.**..*
-- Starting log on Tue Oct 25 21:27:59 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/gapped_alignment/fubar,TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 9 taxa and 357 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666733281
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 288980266
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4282605921
Seed = 1802050743
Swapseed = 1666733281
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 14 unique site patterns
Division 2 has 10 unique site patterns
Division 3 has 33 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1030.159173 -- 32.479477
Chain 2 -- -998.759157 -- 32.479477
Chain 3 -- -1057.347696 -- 32.479477
Chain 4 -- -1058.048168 -- 32.479477
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1033.371573 -- 32.479477
Chain 2 -- -1021.477098 -- 32.479477
Chain 3 -- -1001.796756 -- 32.479477
Chain 4 -- -1020.197557 -- 32.479477
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1030.159] (-998.759) (-1057.348) (-1058.048) * [-1033.372] (-1021.477) (-1001.797) (-1020.198)
1000 -- (-860.468) [-859.288] (-872.267) (-868.349) * (-868.587) (-870.384) [-860.544] (-869.107) -- 0:00:00
2000 -- (-862.242) (-857.048) (-865.316) [-847.027] * (-846.312) [-854.615] (-849.141) (-868.632) -- 0:08:19
3000 -- (-853.596) (-853.796) (-867.747) [-844.929] * [-843.300] (-853.321) (-844.731) (-866.270) -- 0:05:32
4000 -- (-844.815) (-852.832) (-871.355) [-847.394] * (-850.776) (-849.916) [-848.427] (-856.378) -- 0:04:09
5000 -- [-845.597] (-850.055) (-866.674) (-852.251) * (-845.891) (-849.969) [-840.232] (-851.412) -- 0:03:19
Average standard deviation of split frequencies: 0.042855
6000 -- [-847.293] (-844.441) (-865.239) (-843.287) * (-851.650) (-851.432) (-844.504) [-844.199] -- 0:05:31
7000 -- (-853.176) [-840.711] (-857.432) (-858.026) * [-841.426] (-855.361) (-848.332) (-843.838) -- 0:04:43
8000 -- (-844.542) [-845.885] (-855.801) (-856.603) * [-841.732] (-851.699) (-845.449) (-840.434) -- 0:04:08
9000 -- (-847.763) (-844.388) (-852.441) [-842.169] * [-842.818] (-848.468) (-852.002) (-849.322) -- 0:03:40
10000 -- (-849.914) (-843.083) [-851.654] (-846.490) * [-844.343] (-848.359) (-849.346) (-845.145) -- 0:04:57
Average standard deviation of split frequencies: 0.056247
11000 -- (-838.953) [-845.930] (-849.856) (-841.085) * (-862.659) (-852.488) (-851.485) [-842.093] -- 0:04:29
12000 -- (-841.116) [-846.186] (-848.232) (-844.106) * (-855.205) [-845.057] (-851.245) (-843.413) -- 0:04:07
13000 -- (-845.594) (-840.115) [-844.684] (-847.448) * (-839.814) (-843.330) (-846.486) [-839.830] -- 0:03:47
14000 -- (-842.388) [-838.083] (-848.577) (-844.040) * (-841.895) [-841.140] (-847.752) (-843.425) -- 0:04:41
15000 -- (-841.964) (-848.515) [-847.767] (-850.973) * (-853.098) (-844.645) [-841.332] (-855.224) -- 0:04:22
Average standard deviation of split frequencies: 0.050890
16000 -- (-848.104) [-852.070] (-844.821) (-846.556) * (-849.180) (-848.912) [-841.585] (-839.226) -- 0:04:06
17000 -- (-847.822) (-844.008) [-847.186] (-845.539) * [-843.881] (-844.134) (-847.507) (-843.068) -- 0:03:51
18000 -- [-834.670] (-842.126) (-846.760) (-855.076) * (-845.483) [-843.288] (-846.537) (-845.792) -- 0:04:32
19000 -- (-846.372) (-841.815) (-853.574) [-838.978] * (-844.591) (-854.059) (-843.272) [-844.102] -- 0:04:18
20000 -- (-840.796) (-842.582) [-839.651] (-843.698) * [-844.577] (-853.163) (-852.071) (-843.129) -- 0:04:05
Average standard deviation of split frequencies: 0.058062
21000 -- (-840.409) (-850.942) [-838.823] (-852.565) * (-839.690) (-846.989) [-843.923] (-846.369) -- 0:03:53
22000 -- (-841.130) [-842.368] (-840.637) (-850.293) * (-857.243) (-841.372) [-837.033] (-848.338) -- 0:04:26
23000 -- [-844.229] (-838.979) (-838.929) (-842.170) * (-848.360) (-845.142) [-849.384] (-848.215) -- 0:04:14
24000 -- [-849.075] (-851.631) (-846.673) (-841.851) * (-844.981) (-844.893) (-844.027) [-841.091] -- 0:04:04
25000 -- (-848.372) (-844.266) (-840.905) [-845.305] * (-845.540) (-853.222) [-843.623] (-845.604) -- 0:03:54
Average standard deviation of split frequencies: 0.046151
26000 -- (-852.080) (-848.186) (-837.926) [-844.587] * (-848.816) (-844.551) (-843.081) [-846.845] -- 0:04:22
27000 -- (-843.185) (-841.625) (-840.433) [-840.100] * [-841.537] (-847.030) (-842.708) (-844.125) -- 0:04:12
28000 -- (-848.698) [-844.017] (-845.275) (-841.899) * (-844.043) [-852.236] (-846.532) (-845.734) -- 0:04:03
29000 -- [-849.566] (-843.379) (-843.438) (-844.756) * (-836.995) [-847.340] (-860.730) (-843.558) -- 0:04:27
30000 -- (-855.562) [-846.983] (-846.695) (-846.545) * [-843.776] (-844.721) (-840.444) (-844.214) -- 0:04:18
Average standard deviation of split frequencies: 0.033539
31000 -- [-846.347] (-842.139) (-842.908) (-845.093) * (-843.098) [-836.504] (-842.595) (-849.217) -- 0:04:10
32000 -- (-850.811) (-837.196) [-839.505] (-845.947) * (-839.001) [-844.792] (-840.754) (-851.675) -- 0:04:02
33000 -- (-843.290) [-843.889] (-848.386) (-853.198) * (-843.015) (-847.074) (-848.241) [-849.862] -- 0:04:23
34000 -- (-843.662) (-845.259) [-843.379] (-841.910) * (-846.085) [-838.034] (-842.135) (-844.574) -- 0:04:15
35000 -- (-847.027) (-845.074) [-844.554] (-851.113) * (-845.116) [-845.586] (-845.821) (-840.961) -- 0:04:08
Average standard deviation of split frequencies: 0.051188
36000 -- (-846.661) (-846.928) [-838.079] (-846.042) * (-850.765) [-843.077] (-841.269) (-845.106) -- 0:04:01
37000 -- [-849.415] (-851.742) (-837.857) (-841.520) * (-841.236) (-845.092) (-847.996) [-843.872] -- 0:04:20
38000 -- (-848.440) (-847.792) [-848.664] (-848.293) * (-844.062) (-850.603) [-844.374] (-843.924) -- 0:04:13
39000 -- [-852.059] (-847.093) (-842.526) (-849.437) * (-843.583) [-848.980] (-850.037) (-855.969) -- 0:04:06
40000 -- (-844.079) (-855.330) [-844.793] (-851.294) * [-846.564] (-850.021) (-846.726) (-843.945) -- 0:04:00
Average standard deviation of split frequencies: 0.041099
41000 -- (-841.159) [-839.458] (-845.512) (-848.650) * [-843.404] (-845.873) (-850.379) (-846.298) -- 0:04:17
42000 -- (-840.217) [-839.959] (-839.635) (-846.093) * (-841.128) (-855.520) [-841.848] (-844.639) -- 0:04:10
43000 -- (-843.211) (-839.103) [-836.563] (-845.329) * (-838.126) (-841.165) (-843.413) [-843.834] -- 0:04:04
44000 -- (-843.146) [-842.879] (-844.638) (-844.743) * [-849.610] (-856.757) (-849.311) (-847.793) -- 0:03:59
45000 -- (-851.960) (-850.776) (-846.789) [-843.295] * (-842.724) [-839.498] (-847.905) (-852.406) -- 0:04:14
Average standard deviation of split frequencies: 0.027949
46000 -- (-845.186) (-848.641) (-846.268) [-848.013] * (-840.864) (-841.675) [-841.509] (-846.832) -- 0:04:08
47000 -- (-853.279) (-841.045) (-846.442) [-844.183] * (-845.438) (-843.605) [-842.868] (-840.386) -- 0:04:03
48000 -- (-840.543) (-847.923) (-853.887) [-842.616] * (-846.848) (-846.596) [-840.318] (-839.288) -- 0:03:58
49000 -- (-846.951) [-837.570] (-849.353) (-843.451) * (-848.294) (-846.898) [-845.465] (-848.362) -- 0:04:12
50000 -- (-854.190) (-843.914) [-844.494] (-839.522) * (-849.995) (-852.164) [-843.158] (-850.331) -- 0:04:06
Average standard deviation of split frequencies: 0.030450
51000 -- (-851.385) (-846.998) (-846.157) [-839.122] * [-839.376] (-848.475) (-847.150) (-847.437) -- 0:04:01
52000 -- (-854.551) [-841.396] (-855.542) (-849.442) * (-842.792) (-843.750) (-840.426) [-844.646] -- 0:03:57
53000 -- [-846.460] (-848.344) (-844.854) (-851.362) * [-840.039] (-845.693) (-844.890) (-847.458) -- 0:04:10
54000 -- (-850.588) (-847.723) (-852.064) [-847.340] * (-841.036) (-846.153) [-840.449] (-842.391) -- 0:04:05
55000 -- [-851.216] (-840.847) (-844.927) (-852.760) * (-848.500) (-850.007) [-844.523] (-854.557) -- 0:04:00
Average standard deviation of split frequencies: 0.029845
56000 -- (-847.316) (-847.444) (-851.354) [-838.160] * (-844.666) (-848.405) (-839.450) [-847.302] -- 0:03:56
57000 -- (-839.477) [-842.109] (-842.502) (-843.492) * (-844.918) [-840.655] (-852.470) (-840.014) -- 0:04:08
58000 -- (-845.770) [-838.010] (-847.072) (-842.738) * (-853.113) (-846.055) (-849.322) [-850.717] -- 0:04:03
59000 -- (-848.540) [-847.581] (-849.827) (-842.242) * (-845.445) [-845.881] (-844.968) (-852.065) -- 0:03:59
60000 -- (-851.439) [-843.099] (-853.736) (-854.649) * (-850.816) (-863.553) (-844.375) [-842.382] -- 0:03:55
Average standard deviation of split frequencies: 0.024018
61000 -- (-842.222) (-845.662) (-843.574) [-841.763] * (-846.720) (-854.319) (-851.819) [-835.006] -- 0:04:06
62000 -- (-848.830) (-845.909) (-846.361) [-840.846] * (-841.537) (-847.462) (-845.809) [-845.336] -- 0:04:02
63000 -- (-843.450) (-851.713) (-861.691) [-840.445] * (-844.771) (-854.628) (-847.957) [-840.290] -- 0:03:57
64000 -- [-843.475] (-851.818) (-848.596) (-836.337) * (-842.892) [-839.551] (-847.504) (-847.267) -- 0:03:54
65000 -- (-847.120) (-849.844) [-844.702] (-841.385) * (-848.128) (-851.763) (-850.274) [-846.192] -- 0:04:04
Average standard deviation of split frequencies: 0.028570
66000 -- [-840.103] (-845.515) (-841.509) (-840.802) * (-857.077) [-848.186] (-843.777) (-837.187) -- 0:04:00
67000 -- [-850.189] (-849.602) (-841.285) (-846.692) * (-854.567) (-842.764) (-842.780) [-837.518] -- 0:03:56
68000 -- (-847.264) [-845.650] (-851.449) (-842.043) * (-844.796) (-850.743) (-851.572) [-837.709] -- 0:03:53
69000 -- (-847.697) [-849.554] (-842.309) (-850.762) * (-849.946) (-843.274) [-839.247] (-840.693) -- 0:04:02
70000 -- (-859.394) (-844.221) (-848.540) [-841.789] * (-852.351) (-846.152) (-842.879) [-840.025] -- 0:03:59
Average standard deviation of split frequencies: 0.032748
71000 -- (-854.119) (-847.547) [-848.578] (-848.334) * (-844.953) [-850.124] (-850.376) (-844.653) -- 0:03:55
72000 -- [-844.627] (-843.418) (-847.400) (-848.208) * (-853.983) (-843.072) (-845.780) [-842.668] -- 0:03:52
73000 -- [-845.869] (-846.218) (-845.209) (-853.465) * (-849.973) (-837.314) [-838.288] (-844.072) -- 0:04:01
74000 -- (-844.782) (-843.750) [-845.548] (-847.100) * (-852.460) (-848.681) (-846.899) [-842.261] -- 0:03:57
75000 -- (-844.353) [-839.836] (-848.974) (-850.495) * (-848.428) [-839.414] (-847.708) (-845.177) -- 0:03:54
Average standard deviation of split frequencies: 0.036088
76000 -- (-844.792) (-845.306) [-845.659] (-842.628) * (-846.924) (-841.973) (-840.282) [-842.700] -- 0:03:51
77000 -- (-844.845) (-846.966) [-842.829] (-844.728) * (-847.795) (-848.573) [-838.865] (-843.617) -- 0:03:59
78000 -- (-842.076) (-845.497) (-848.825) [-848.409] * (-848.925) (-844.009) [-841.858] (-840.004) -- 0:03:56
79000 -- [-835.802] (-843.328) (-846.788) (-847.639) * [-844.531] (-841.748) (-846.094) (-842.696) -- 0:03:53
80000 -- [-842.487] (-848.254) (-849.623) (-843.134) * (-846.013) [-841.776] (-843.120) (-845.487) -- 0:03:50
Average standard deviation of split frequencies: 0.031876
81000 -- (-845.022) (-847.666) (-858.445) [-843.832] * (-845.929) (-845.501) [-841.872] (-839.228) -- 0:03:58
82000 -- (-857.804) [-841.664] (-844.775) (-841.462) * (-843.294) (-848.718) (-842.815) [-848.062] -- 0:03:55
83000 -- (-845.472) [-842.519] (-847.484) (-852.060) * (-848.424) [-849.062] (-844.437) (-853.281) -- 0:03:52
84000 -- [-839.130] (-846.167) (-851.260) (-846.193) * (-844.353) (-862.042) [-851.244] (-838.929) -- 0:03:49
85000 -- (-837.548) (-851.701) (-850.028) [-846.047] * (-842.707) (-849.466) (-844.588) [-839.750] -- 0:03:56
Average standard deviation of split frequencies: 0.027906
86000 -- (-844.319) [-842.065] (-847.497) (-844.183) * (-845.375) [-850.293] (-849.574) (-843.391) -- 0:03:53
87000 -- [-843.192] (-850.872) (-851.652) (-845.685) * (-854.791) (-846.720) [-845.648] (-843.726) -- 0:03:50
88000 -- (-849.820) (-841.923) [-843.255] (-842.962) * (-842.424) (-847.864) [-849.779] (-846.029) -- 0:03:48
89000 -- (-839.957) [-842.419] (-840.808) (-845.261) * (-842.563) [-853.036] (-853.931) (-843.705) -- 0:03:55
90000 -- (-847.009) (-846.376) [-839.506] (-847.780) * [-847.825] (-840.524) (-851.119) (-852.974) -- 0:03:52
Average standard deviation of split frequencies: 0.024579
91000 -- (-844.961) (-846.801) (-840.636) [-844.260] * (-845.121) [-850.817] (-845.349) (-844.977) -- 0:03:49
92000 -- (-847.379) (-844.459) [-843.678] (-847.432) * [-836.397] (-843.567) (-851.731) (-848.935) -- 0:03:47
93000 -- (-845.826) (-840.697) [-846.720] (-849.875) * [-841.565] (-845.250) (-855.360) (-853.037) -- 0:03:54
94000 -- [-841.875] (-846.360) (-850.874) (-844.747) * (-844.295) (-846.595) (-849.361) [-842.691] -- 0:03:51
95000 -- [-841.290] (-842.031) (-835.791) (-846.220) * (-840.761) (-854.482) [-844.553] (-837.187) -- 0:03:48
Average standard deviation of split frequencies: 0.021874
96000 -- (-850.947) (-842.483) [-846.608] (-846.363) * [-846.897] (-849.657) (-844.273) (-846.493) -- 0:03:46
97000 -- [-841.745] (-843.472) (-846.437) (-843.528) * (-837.947) (-844.418) (-846.106) [-839.773] -- 0:03:52
98000 -- (-846.228) (-847.871) (-850.564) [-837.827] * [-836.645] (-849.843) (-845.200) (-843.771) -- 0:03:50
99000 -- (-844.466) (-847.997) [-849.737] (-857.978) * (-842.962) (-859.654) (-841.961) [-844.946] -- 0:03:47
100000 -- [-842.939] (-842.673) (-842.430) (-843.838) * (-842.061) (-850.260) (-840.497) [-836.958] -- 0:03:45
Average standard deviation of split frequencies: 0.023840
101000 -- (-848.447) (-850.827) (-844.346) [-843.216] * [-843.748] (-843.163) (-847.801) (-840.623) -- 0:03:51
102000 -- (-847.107) (-849.239) (-844.969) [-841.631] * [-837.289] (-856.748) (-849.834) (-842.675) -- 0:03:48
103000 -- (-844.400) (-846.838) [-837.991] (-841.903) * [-847.956] (-853.047) (-849.690) (-847.725) -- 0:03:46
104000 -- [-842.876] (-849.145) (-844.488) (-847.197) * (-854.469) (-851.024) [-839.980] (-846.163) -- 0:03:44
105000 -- [-843.023] (-848.733) (-848.956) (-842.504) * (-839.171) [-851.183] (-844.799) (-845.184) -- 0:03:50
Average standard deviation of split frequencies: 0.020215
106000 -- (-841.830) (-839.629) [-840.746] (-846.573) * (-839.119) [-848.948] (-841.156) (-849.372) -- 0:03:47
107000 -- (-850.508) [-840.400] (-843.677) (-843.137) * (-843.811) (-855.553) [-837.629] (-840.073) -- 0:03:45
108000 -- (-846.926) (-844.272) [-842.890] (-847.978) * (-855.580) [-841.240] (-843.624) (-842.548) -- 0:03:51
109000 -- (-843.780) (-843.484) [-836.429] (-845.703) * (-844.854) (-864.201) (-846.165) [-842.105] -- 0:03:48
110000 -- [-844.371] (-851.316) (-844.517) (-838.799) * (-842.640) [-845.759] (-845.211) (-844.358) -- 0:03:46
Average standard deviation of split frequencies: 0.020137
111000 -- [-843.323] (-855.410) (-840.980) (-847.816) * (-844.166) [-846.586] (-845.466) (-844.766) -- 0:03:44
112000 -- (-843.700) (-843.015) [-844.828] (-841.918) * (-844.018) (-849.948) (-842.557) [-841.435] -- 0:03:42
113000 -- (-842.264) (-848.808) (-837.391) [-851.825] * (-845.338) (-847.791) [-838.489] (-851.645) -- 0:03:47
114000 -- (-840.802) (-844.073) [-839.568] (-855.803) * (-852.513) (-847.483) [-836.939] (-846.838) -- 0:03:45
115000 -- [-839.714] (-840.791) (-846.469) (-842.852) * (-843.485) (-843.887) (-843.133) [-846.526] -- 0:03:43
Average standard deviation of split frequencies: 0.017364
116000 -- [-842.753] (-846.967) (-839.279) (-850.039) * [-845.492] (-846.061) (-849.318) (-842.192) -- 0:03:41
117000 -- [-838.113] (-836.919) (-842.718) (-848.109) * [-850.106] (-842.845) (-843.345) (-852.781) -- 0:03:46
118000 -- (-840.466) (-848.120) (-838.724) [-836.641] * (-851.008) (-839.813) [-844.376] (-846.057) -- 0:03:44
119000 -- (-847.255) (-847.075) (-842.468) [-839.274] * (-847.193) [-840.365] (-840.379) (-844.682) -- 0:03:42
120000 -- (-834.586) (-847.847) [-842.367] (-846.471) * (-854.773) [-842.291] (-838.970) (-847.620) -- 0:03:40
Average standard deviation of split frequencies: 0.014561
121000 -- (-847.108) (-849.714) (-849.899) [-849.227] * [-840.705] (-843.785) (-842.793) (-852.551) -- 0:03:45
122000 -- (-836.512) (-845.620) (-844.978) [-849.013] * (-845.142) (-838.276) (-846.027) [-840.066] -- 0:03:43
123000 -- (-839.802) [-844.463] (-847.441) (-848.786) * [-842.299] (-849.055) (-853.025) (-846.234) -- 0:03:41
124000 -- (-843.688) (-846.167) (-852.934) [-848.014] * [-842.935] (-850.146) (-845.028) (-838.388) -- 0:03:46
125000 -- (-847.710) (-855.524) (-852.936) [-840.938] * (-844.476) (-849.387) (-843.071) [-836.835] -- 0:03:44
Average standard deviation of split frequencies: 0.020747
126000 -- [-844.864] (-851.042) (-854.124) (-850.482) * (-845.250) (-844.380) [-841.278] (-847.386) -- 0:03:41
127000 -- [-844.711] (-850.738) (-844.280) (-851.761) * (-845.856) (-844.439) (-852.015) [-846.154] -- 0:03:39
128000 -- (-846.132) (-843.216) [-843.794] (-855.146) * (-844.638) [-843.288] (-846.717) (-855.172) -- 0:03:44
129000 -- (-858.122) (-848.838) (-850.529) [-850.605] * [-840.166] (-851.481) (-845.104) (-842.898) -- 0:03:42
130000 -- (-844.172) (-839.494) [-841.997] (-839.404) * (-849.806) [-842.656] (-844.411) (-854.933) -- 0:03:40
Average standard deviation of split frequencies: 0.019350
131000 -- (-849.571) [-845.444] (-843.372) (-848.199) * (-846.409) [-844.306] (-848.455) (-850.797) -- 0:03:38
132000 -- (-857.543) [-843.365] (-844.144) (-843.748) * (-847.038) (-847.834) [-838.562] (-847.320) -- 0:03:43
133000 -- (-863.979) (-845.855) (-842.385) [-841.902] * (-849.921) [-843.198] (-856.180) (-843.489) -- 0:03:41
134000 -- (-853.149) (-858.653) [-845.109] (-842.661) * (-848.861) [-845.633] (-849.969) (-843.086) -- 0:03:39
135000 -- (-849.085) (-849.896) [-845.183] (-842.573) * (-847.217) (-846.998) [-843.516] (-849.388) -- 0:03:37
Average standard deviation of split frequencies: 0.013550
136000 -- (-846.783) (-851.113) [-837.002] (-847.835) * (-856.269) (-842.521) (-847.227) [-843.072] -- 0:03:42
137000 -- (-846.578) (-843.338) (-843.821) [-840.831] * (-848.452) (-847.489) (-840.844) [-846.210] -- 0:03:40
138000 -- (-854.482) [-847.070] (-842.392) (-848.966) * (-853.314) (-846.960) (-841.653) [-843.095] -- 0:03:38
139000 -- [-848.664] (-849.977) (-841.886) (-846.331) * (-843.418) (-846.659) (-852.689) [-843.278] -- 0:03:42
140000 -- (-847.091) (-841.170) (-846.324) [-847.489] * [-844.950] (-839.341) (-846.465) (-843.159) -- 0:03:41
Average standard deviation of split frequencies: 0.011577
141000 -- [-844.486] (-843.532) (-847.300) (-850.145) * (-849.369) [-846.419] (-845.065) (-842.855) -- 0:03:39
142000 -- [-844.380] (-849.333) (-845.912) (-853.908) * (-842.780) [-846.470] (-847.861) (-848.489) -- 0:03:37
143000 -- (-843.549) (-849.757) [-851.215] (-846.931) * (-839.887) (-840.233) (-843.509) [-842.970] -- 0:03:41
144000 -- (-839.134) (-841.507) (-847.314) [-844.897] * (-845.163) [-836.389] (-848.846) (-842.827) -- 0:03:39
145000 -- (-847.573) (-842.791) (-852.158) [-846.084] * [-843.504] (-850.618) (-843.101) (-846.985) -- 0:03:38
Average standard deviation of split frequencies: 0.007632
146000 -- (-855.983) (-838.550) [-842.583] (-842.795) * [-840.643] (-841.091) (-852.526) (-850.731) -- 0:03:36
147000 -- [-838.406] (-849.875) (-844.183) (-845.800) * (-853.203) (-843.752) (-841.831) [-837.394] -- 0:03:40
148000 -- (-847.629) [-840.659] (-851.796) (-842.874) * (-846.615) (-841.110) (-851.038) [-840.265] -- 0:03:38
149000 -- (-850.073) (-846.170) (-841.914) [-849.229] * (-848.138) [-849.918] (-847.058) (-848.859) -- 0:03:37
150000 -- (-845.103) (-849.186) (-842.189) [-841.286] * (-848.262) [-838.923] (-842.642) (-850.699) -- 0:03:35
Average standard deviation of split frequencies: 0.008533
151000 -- (-848.937) (-842.984) [-841.852] (-847.678) * (-845.313) (-838.258) [-839.121] (-849.533) -- 0:03:39
152000 -- (-843.562) (-847.655) (-843.248) [-842.496] * (-843.005) (-846.601) [-838.608] (-842.277) -- 0:03:37
153000 -- (-848.033) (-847.763) [-844.611] (-853.382) * (-847.220) (-853.006) (-843.602) [-844.912] -- 0:03:35
154000 -- (-842.721) (-840.374) (-851.114) [-842.179] * [-847.148] (-846.822) (-841.477) (-844.781) -- 0:03:34
155000 -- (-843.110) [-835.665] (-851.105) (-844.801) * [-844.597] (-842.245) (-843.448) (-845.725) -- 0:03:38
Average standard deviation of split frequencies: 0.007417
156000 -- (-842.268) (-845.044) (-848.713) [-849.322] * (-845.802) [-842.558] (-845.205) (-851.307) -- 0:03:36
157000 -- (-843.339) [-842.069] (-846.789) (-843.758) * [-849.907] (-852.147) (-840.493) (-843.997) -- 0:03:34
158000 -- (-841.196) [-840.404] (-845.884) (-845.885) * (-846.598) (-848.065) (-845.063) [-846.260] -- 0:03:33
159000 -- (-839.521) (-844.852) (-852.861) [-843.293] * [-850.332] (-846.806) (-843.243) (-862.088) -- 0:03:36
160000 -- (-846.777) (-853.860) (-843.801) [-839.800] * [-837.370] (-837.051) (-843.209) (-843.804) -- 0:03:35
Average standard deviation of split frequencies: 0.008002
161000 -- (-839.508) (-843.937) (-852.452) [-840.572] * (-845.388) [-843.377] (-849.442) (-846.448) -- 0:03:33
162000 -- (-841.271) (-851.836) (-846.805) [-848.515] * (-846.781) (-844.814) (-850.439) [-843.255] -- 0:03:32
163000 -- (-844.106) (-847.509) [-841.874] (-844.223) * (-838.674) [-846.434] (-844.428) (-847.410) -- 0:03:35
164000 -- (-838.789) [-840.968] (-847.161) (-841.345) * (-847.030) [-838.549] (-851.474) (-854.361) -- 0:03:34
165000 -- (-846.341) (-856.530) (-844.557) [-842.184] * (-854.581) [-846.306] (-843.929) (-847.679) -- 0:03:32
Average standard deviation of split frequencies: 0.008261
166000 -- [-851.255] (-840.153) (-842.217) (-846.083) * (-845.833) (-845.676) (-847.841) [-841.526] -- 0:03:31
167000 -- (-845.921) [-840.019] (-842.031) (-843.410) * (-854.027) [-843.343] (-846.785) (-845.056) -- 0:03:34
168000 -- [-841.384] (-839.863) (-848.884) (-848.248) * (-854.174) [-845.980] (-842.912) (-840.164) -- 0:03:32
169000 -- (-840.554) [-839.156] (-848.418) (-848.908) * (-850.600) (-847.187) [-846.672] (-840.802) -- 0:03:31
170000 -- [-844.086] (-864.018) (-847.590) (-854.669) * (-843.508) (-843.139) [-839.153] (-840.493) -- 0:03:29
Average standard deviation of split frequencies: 0.007282
171000 -- (-842.324) (-849.284) (-861.299) [-856.953] * (-847.396) (-846.191) (-849.813) [-845.895] -- 0:03:33
172000 -- (-847.219) (-854.794) (-848.177) [-854.402] * (-845.903) [-845.989] (-853.295) (-842.071) -- 0:03:31
173000 -- (-847.732) [-844.018] (-843.903) (-849.200) * (-848.860) (-839.719) [-845.959] (-845.309) -- 0:03:30
174000 -- (-838.899) [-844.020] (-851.454) (-851.872) * (-857.016) (-844.969) [-841.247] (-851.927) -- 0:03:28
175000 -- (-842.890) (-844.865) [-842.653] (-846.067) * (-855.487) (-840.913) (-846.479) [-841.203] -- 0:03:32
Average standard deviation of split frequencies: 0.011931
176000 -- [-849.634] (-840.477) (-852.177) (-846.119) * (-847.543) [-841.230] (-847.918) (-843.183) -- 0:03:30
177000 -- (-853.247) [-845.374] (-846.468) (-839.914) * (-841.896) (-844.729) [-844.203] (-853.064) -- 0:03:29
178000 -- (-853.450) (-837.473) (-853.573) [-843.688] * (-842.784) [-840.216] (-844.154) (-851.591) -- 0:03:27
179000 -- [-838.390] (-848.168) (-851.340) (-859.368) * [-839.816] (-847.552) (-842.494) (-846.236) -- 0:03:30
180000 -- (-846.052) [-847.512] (-849.526) (-849.845) * [-841.230] (-847.351) (-840.263) (-845.164) -- 0:03:29
Average standard deviation of split frequencies: 0.015181
181000 -- (-837.716) (-848.829) (-842.869) [-841.622] * (-845.727) [-844.004] (-842.362) (-845.192) -- 0:03:28
182000 -- (-851.169) (-853.457) [-844.010] (-843.634) * (-850.305) (-846.626) [-854.700] (-848.270) -- 0:03:26
183000 -- [-838.491] (-840.348) (-845.438) (-840.171) * (-847.355) (-848.760) (-850.865) [-842.539] -- 0:03:29
184000 -- [-838.168] (-845.090) (-845.864) (-845.299) * (-842.414) (-847.184) [-848.846] (-840.642) -- 0:03:28
185000 -- (-845.109) (-852.284) (-844.375) [-837.468] * [-848.062] (-847.013) (-847.053) (-847.476) -- 0:03:27
Average standard deviation of split frequencies: 0.013363
186000 -- (-848.275) [-848.559] (-846.715) (-843.169) * (-843.503) (-832.679) [-845.647] (-844.872) -- 0:03:25
187000 -- [-842.522] (-849.001) (-843.015) (-840.591) * (-843.042) (-842.319) (-844.650) [-844.690] -- 0:03:28
188000 -- (-847.416) [-852.772] (-844.202) (-845.560) * (-847.122) (-840.892) (-841.259) [-840.159] -- 0:03:27
189000 -- (-848.793) (-853.191) (-840.977) [-840.055] * (-839.673) (-846.749) [-851.149] (-838.386) -- 0:03:25
190000 -- (-843.790) (-854.314) (-840.676) [-843.835] * (-843.638) (-843.262) [-841.665] (-843.660) -- 0:03:28
Average standard deviation of split frequencies: 0.013261
191000 -- (-848.101) (-852.489) [-838.832] (-851.453) * (-844.448) (-848.990) [-840.098] (-843.196) -- 0:03:27
192000 -- [-838.656] (-855.187) (-839.238) (-847.903) * (-844.943) (-846.573) (-850.219) [-840.120] -- 0:03:26
193000 -- (-841.334) (-849.701) [-841.013] (-852.988) * (-850.904) (-851.968) (-852.516) [-845.794] -- 0:03:24
194000 -- (-840.285) [-844.845] (-850.147) (-840.109) * (-844.554) (-840.506) [-846.689] (-847.799) -- 0:03:27
195000 -- (-846.883) (-849.732) (-841.603) [-841.968] * (-850.080) [-837.760] (-841.643) (-839.318) -- 0:03:26
Average standard deviation of split frequencies: 0.010932
196000 -- (-838.255) [-843.067] (-845.079) (-845.107) * (-845.297) (-849.624) (-846.716) [-835.858] -- 0:03:25
197000 -- [-841.303] (-846.424) (-840.159) (-845.725) * (-843.376) [-840.287] (-845.224) (-838.630) -- 0:03:23
198000 -- (-841.052) (-842.309) (-841.620) [-841.890] * (-837.905) (-848.379) [-841.719] (-850.507) -- 0:03:26
199000 -- (-846.071) (-843.336) [-841.757] (-842.841) * [-848.952] (-843.952) (-845.279) (-848.277) -- 0:03:25
200000 -- (-854.303) (-844.110) [-841.874] (-841.416) * (-854.005) [-847.493] (-852.330) (-849.506) -- 0:03:24
Average standard deviation of split frequencies: 0.011960
201000 -- (-846.863) [-839.182] (-845.754) (-843.689) * (-843.487) (-834.365) (-841.989) [-842.400] -- 0:03:22
202000 -- (-851.501) (-844.520) (-838.129) [-846.117] * (-852.808) (-840.495) [-847.052] (-843.564) -- 0:03:25
203000 -- [-838.198] (-846.016) (-841.954) (-841.842) * (-846.483) (-847.817) (-849.285) [-836.395] -- 0:03:24
204000 -- (-843.494) (-841.769) (-843.264) [-852.823] * (-843.482) [-841.801] (-842.589) (-841.731) -- 0:03:22
205000 -- [-841.563] (-841.813) (-839.449) (-847.837) * (-845.839) (-845.774) [-851.084] (-841.513) -- 0:03:21
Average standard deviation of split frequencies: 0.012482
206000 -- [-840.560] (-841.646) (-843.127) (-844.497) * (-843.720) (-841.373) (-853.793) [-844.356] -- 0:03:24
207000 -- [-842.567] (-852.263) (-838.860) (-841.233) * (-851.509) [-855.060] (-840.747) (-851.391) -- 0:03:23
208000 -- (-843.941) (-848.473) [-843.077] (-856.777) * (-842.683) (-846.313) [-837.732] (-844.813) -- 0:03:21
209000 -- (-858.496) [-842.987] (-840.453) (-847.684) * (-851.174) [-842.906] (-847.575) (-840.098) -- 0:03:20
210000 -- (-847.522) [-842.459] (-837.179) (-840.369) * (-843.643) (-852.552) [-850.072] (-841.178) -- 0:03:23
Average standard deviation of split frequencies: 0.012206
211000 -- (-855.950) (-847.404) (-844.304) [-838.291] * (-845.105) [-838.772] (-846.775) (-847.305) -- 0:03:21
212000 -- (-842.299) (-846.644) (-839.866) [-854.644] * (-851.936) (-848.826) [-838.599] (-838.714) -- 0:03:20
213000 -- (-844.935) (-844.480) (-844.665) [-842.621] * (-844.238) [-842.969] (-845.634) (-844.746) -- 0:03:19
214000 -- (-849.397) [-840.851] (-843.604) (-843.526) * (-848.596) [-847.718] (-851.986) (-844.843) -- 0:03:22
215000 -- (-841.360) [-839.438] (-850.827) (-844.901) * (-846.302) (-844.513) [-840.784] (-841.772) -- 0:03:20
Average standard deviation of split frequencies: 0.013095
216000 -- (-842.612) (-846.494) [-843.399] (-849.186) * (-851.304) (-842.324) (-852.377) [-840.955] -- 0:03:19
217000 -- (-841.427) (-856.616) (-844.143) [-841.966] * (-848.021) (-842.755) [-838.991] (-853.895) -- 0:03:22
218000 -- (-859.287) (-848.862) [-850.214] (-845.072) * [-843.094] (-851.979) (-847.103) (-843.042) -- 0:03:20
219000 -- [-845.167] (-847.613) (-849.333) (-842.291) * [-846.203] (-846.973) (-850.332) (-842.396) -- 0:03:19
220000 -- [-848.209] (-849.663) (-846.677) (-842.641) * (-849.980) (-857.340) [-841.365] (-841.526) -- 0:03:18
Average standard deviation of split frequencies: 0.013400
221000 -- (-848.637) (-843.693) (-846.055) [-840.206] * [-843.723] (-859.132) (-839.173) (-846.225) -- 0:03:20
222000 -- [-846.530] (-849.171) (-846.791) (-846.921) * [-838.739] (-855.121) (-838.645) (-844.613) -- 0:03:19
223000 -- (-856.526) (-854.894) (-843.410) [-844.212] * [-844.659] (-849.998) (-842.023) (-851.408) -- 0:03:18
224000 -- (-848.290) [-845.057] (-840.662) (-845.700) * [-850.330] (-854.800) (-846.769) (-845.081) -- 0:03:17
225000 -- (-840.485) (-852.248) [-842.390] (-843.116) * (-848.713) [-852.590] (-840.971) (-844.063) -- 0:03:19
Average standard deviation of split frequencies: 0.014411
226000 -- (-847.206) [-846.680] (-845.109) (-845.014) * [-842.849] (-852.577) (-849.093) (-843.403) -- 0:03:18
227000 -- (-844.827) (-846.514) [-842.155] (-845.797) * [-851.707] (-849.885) (-845.128) (-846.674) -- 0:03:17
228000 -- (-853.090) (-840.772) [-849.772] (-839.722) * (-842.009) (-847.912) [-844.458] (-850.106) -- 0:03:16
229000 -- (-855.750) (-843.651) [-840.274] (-845.450) * [-842.738] (-840.639) (-844.004) (-842.531) -- 0:03:18
230000 -- (-849.523) (-845.331) (-846.439) [-840.762] * (-847.404) (-850.181) (-843.160) [-838.918] -- 0:03:17
Average standard deviation of split frequencies: 0.016721
231000 -- (-851.998) (-846.276) [-840.415] (-839.415) * (-851.838) [-841.454] (-850.904) (-843.583) -- 0:03:16
232000 -- (-849.573) [-840.375] (-840.853) (-839.576) * (-845.529) (-851.858) (-842.773) [-840.202] -- 0:03:15
233000 -- (-847.715) (-848.016) (-842.468) [-841.039] * (-837.569) (-843.392) (-839.998) [-846.458] -- 0:03:17
234000 -- (-845.512) (-843.667) (-843.126) [-843.889] * [-841.586] (-841.397) (-849.631) (-853.671) -- 0:03:16
235000 -- (-843.670) (-845.111) (-838.374) [-844.258] * [-840.967] (-835.650) (-846.614) (-843.247) -- 0:03:15
Average standard deviation of split frequencies: 0.016343
236000 -- (-847.592) (-837.727) [-840.314] (-852.293) * (-853.211) [-842.509] (-837.495) (-844.198) -- 0:03:14
237000 -- [-840.027] (-840.157) (-847.937) (-845.410) * [-849.098] (-839.522) (-842.475) (-839.658) -- 0:03:16
238000 -- [-837.401] (-847.815) (-844.019) (-843.690) * [-839.309] (-836.778) (-843.508) (-846.954) -- 0:03:15
239000 -- (-850.766) [-841.105] (-847.738) (-838.609) * (-845.607) [-843.896] (-842.849) (-849.983) -- 0:03:14
240000 -- (-843.338) (-848.710) [-836.035] (-839.485) * [-838.313] (-849.840) (-846.356) (-838.687) -- 0:03:13
Average standard deviation of split frequencies: 0.016204
241000 -- [-845.733] (-837.940) (-839.894) (-852.730) * [-849.815] (-842.064) (-842.035) (-854.682) -- 0:03:15
242000 -- (-839.050) (-843.528) [-839.591] (-840.143) * [-844.489] (-841.503) (-841.477) (-846.327) -- 0:03:14
243000 -- (-845.042) [-838.643] (-851.448) (-840.046) * [-850.174] (-850.892) (-846.110) (-839.977) -- 0:03:13
244000 -- (-845.128) (-846.132) (-848.558) [-841.505] * (-848.276) [-842.510] (-854.825) (-844.195) -- 0:03:12
245000 -- (-854.924) [-841.605] (-856.053) (-843.451) * (-845.065) (-842.508) (-844.723) [-841.450] -- 0:03:14
Average standard deviation of split frequencies: 0.014808
246000 -- (-855.736) [-845.029] (-846.127) (-844.110) * (-845.011) (-841.586) (-848.182) [-843.303] -- 0:03:13
247000 -- (-853.179) (-842.820) (-849.660) [-839.000] * (-841.186) (-847.102) [-837.200] (-841.719) -- 0:03:12
248000 -- [-845.442] (-849.054) (-852.406) (-846.552) * (-847.403) [-839.477] (-846.835) (-847.566) -- 0:03:11
249000 -- (-848.376) (-841.352) (-836.517) [-839.189] * [-843.034] (-853.220) (-845.604) (-849.361) -- 0:03:13
250000 -- (-846.832) [-841.429] (-840.501) (-835.673) * (-843.795) (-838.764) (-846.566) [-844.393] -- 0:03:12
Average standard deviation of split frequencies: 0.013335
251000 -- (-839.627) (-852.578) (-850.027) [-845.344] * (-841.156) (-845.429) (-842.308) [-843.402] -- 0:03:10
252000 -- [-844.276] (-847.574) (-853.578) (-850.097) * (-838.851) (-852.182) [-841.534] (-836.843) -- 0:03:09
253000 -- [-838.123] (-850.128) (-846.080) (-841.422) * (-845.638) (-844.371) (-851.863) [-838.843] -- 0:03:11
254000 -- [-840.678] (-846.433) (-853.148) (-844.858) * (-848.308) [-845.427] (-846.535) (-842.412) -- 0:03:10
255000 -- (-844.651) (-845.832) (-853.462) [-836.899] * [-844.965] (-850.337) (-848.260) (-842.942) -- 0:03:09
Average standard deviation of split frequencies: 0.012220
256000 -- (-846.189) (-840.524) (-842.876) [-843.560] * (-854.802) (-839.719) (-853.661) [-842.581] -- 0:03:08
257000 -- (-849.076) [-849.359] (-843.318) (-844.522) * (-847.489) [-834.991] (-848.025) (-843.013) -- 0:03:10
258000 -- (-841.044) (-847.245) (-848.630) [-842.243] * (-844.451) (-846.500) (-847.338) [-846.495] -- 0:03:09
259000 -- [-836.326] (-844.721) (-848.836) (-847.709) * (-845.801) (-850.503) [-844.519] (-847.935) -- 0:03:08
260000 -- (-843.658) (-847.682) (-846.740) [-840.354] * (-843.872) (-845.548) (-849.712) [-848.944] -- 0:03:07
Average standard deviation of split frequencies: 0.011837
261000 -- (-853.403) [-843.182] (-847.176) (-849.410) * [-845.067] (-853.550) (-841.622) (-844.640) -- 0:03:09
262000 -- (-848.895) (-851.508) [-838.912] (-845.111) * [-841.730] (-855.681) (-849.641) (-853.138) -- 0:03:08
263000 -- [-851.736] (-847.697) (-845.728) (-844.055) * (-850.419) (-842.319) (-849.063) [-841.562] -- 0:03:07
264000 -- (-851.922) [-842.950] (-839.578) (-846.720) * (-852.912) (-843.900) (-850.409) [-843.381] -- 0:03:06
265000 -- (-848.361) [-847.427] (-845.026) (-841.263) * (-846.162) [-841.842] (-845.774) (-850.401) -- 0:03:08
Average standard deviation of split frequencies: 0.012244
266000 -- [-843.054] (-854.528) (-848.350) (-846.557) * (-849.033) [-839.806] (-842.416) (-856.043) -- 0:03:07
267000 -- (-846.160) (-846.894) (-853.165) [-843.227] * (-847.568) [-842.048] (-844.638) (-849.862) -- 0:03:06
268000 -- (-840.653) (-844.449) [-842.419] (-848.169) * [-846.275] (-849.007) (-847.997) (-858.457) -- 0:03:05
269000 -- (-850.450) (-839.241) (-843.107) [-843.550] * (-848.274) [-841.934] (-855.256) (-849.571) -- 0:03:07
270000 -- (-848.684) (-836.997) (-847.307) [-842.614] * [-843.707] (-842.226) (-848.471) (-845.928) -- 0:03:06
Average standard deviation of split frequencies: 0.011717
271000 -- (-853.752) [-846.499] (-847.765) (-849.551) * (-849.964) [-847.532] (-841.450) (-841.981) -- 0:03:05
272000 -- [-851.090] (-846.472) (-849.537) (-848.905) * [-840.194] (-842.574) (-849.851) (-842.873) -- 0:03:07
273000 -- (-853.426) (-849.648) [-840.117] (-841.307) * [-843.400] (-847.559) (-848.660) (-843.097) -- 0:03:06
274000 -- [-851.767] (-849.098) (-845.929) (-851.095) * [-844.010] (-850.262) (-849.628) (-845.747) -- 0:03:05
275000 -- (-844.870) [-847.759] (-848.899) (-845.375) * (-844.122) (-843.467) (-847.867) [-841.177] -- 0:03:04
Average standard deviation of split frequencies: 0.012266
276000 -- (-845.106) [-847.020] (-851.891) (-853.540) * (-845.999) (-846.055) (-852.876) [-842.344] -- 0:03:06
277000 -- (-849.996) (-848.713) [-852.620] (-849.711) * (-842.158) (-841.040) (-841.891) [-848.248] -- 0:03:05
278000 -- (-846.510) [-838.164] (-861.879) (-843.252) * [-845.501] (-848.042) (-844.921) (-839.008) -- 0:03:04
279000 -- [-846.057] (-841.951) (-845.870) (-840.037) * (-844.218) (-850.981) (-842.729) [-838.756] -- 0:03:03
280000 -- (-837.678) (-847.661) (-848.762) [-841.100] * (-841.312) (-845.242) (-849.956) [-840.936] -- 0:03:05
Average standard deviation of split frequencies: 0.009925
281000 -- (-842.944) (-849.496) (-849.428) [-843.054] * (-851.470) (-848.859) [-843.387] (-847.496) -- 0:03:04
282000 -- [-841.556] (-840.486) (-856.957) (-850.722) * (-839.969) (-855.627) [-841.688] (-839.142) -- 0:03:03
283000 -- (-847.934) (-842.684) [-843.586] (-849.810) * [-842.187] (-845.646) (-844.429) (-842.726) -- 0:03:02
284000 -- (-843.571) [-841.616] (-846.718) (-852.428) * (-847.928) [-842.017] (-841.540) (-846.676) -- 0:03:04
285000 -- (-852.438) [-842.808] (-839.077) (-851.598) * (-845.238) [-841.317] (-850.903) (-845.858) -- 0:03:03
Average standard deviation of split frequencies: 0.010939
286000 -- (-847.737) (-847.995) (-844.487) [-837.692] * (-848.503) [-839.978] (-842.831) (-853.834) -- 0:03:02
287000 -- (-842.466) [-851.214] (-843.024) (-847.268) * [-846.382] (-854.130) (-840.111) (-850.315) -- 0:03:01
288000 -- (-841.779) (-840.562) (-844.270) [-849.412] * (-847.886) [-853.303] (-852.653) (-848.853) -- 0:03:02
289000 -- (-849.071) [-844.825] (-851.867) (-846.576) * [-838.999] (-845.437) (-845.672) (-849.075) -- 0:03:02
290000 -- (-846.457) (-842.155) [-840.572] (-857.424) * (-854.097) (-842.080) [-842.188] (-843.040) -- 0:03:01
Average standard deviation of split frequencies: 0.011353
291000 -- (-841.345) (-842.328) [-846.465] (-846.483) * (-849.367) (-846.805) (-846.186) [-845.731] -- 0:03:00
292000 -- (-845.827) (-847.785) (-840.718) [-846.597] * [-843.374] (-845.170) (-843.412) (-843.072) -- 0:03:01
293000 -- [-847.422] (-845.796) (-844.367) (-845.666) * (-842.112) [-840.782] (-845.106) (-845.629) -- 0:03:00
294000 -- (-849.849) (-846.742) [-847.994] (-851.117) * (-842.786) (-839.787) [-846.847] (-853.436) -- 0:03:00
295000 -- (-854.466) (-845.868) (-847.216) [-841.151] * [-845.276] (-837.522) (-848.823) (-861.297) -- 0:02:59
Average standard deviation of split frequencies: 0.011582
296000 -- [-839.399] (-847.758) (-844.902) (-855.337) * (-851.674) (-840.599) [-841.349] (-852.301) -- 0:03:00
297000 -- [-845.264] (-841.263) (-843.335) (-842.354) * (-858.724) (-842.918) [-843.136] (-853.457) -- 0:02:59
298000 -- (-840.611) [-842.982] (-845.261) (-850.605) * (-847.808) [-839.556] (-839.357) (-847.803) -- 0:02:59
299000 -- (-844.759) (-848.060) [-845.438] (-848.703) * (-856.898) [-838.894] (-850.998) (-855.839) -- 0:02:58
300000 -- [-838.385] (-851.296) (-849.817) (-846.539) * (-849.317) (-845.587) [-840.790] (-849.906) -- 0:02:59
Average standard deviation of split frequencies: 0.010833
301000 -- (-851.551) (-843.964) [-841.100] (-837.717) * (-853.912) (-853.010) [-847.480] (-843.495) -- 0:02:58
302000 -- [-847.756] (-842.439) (-841.936) (-852.589) * (-848.637) (-854.398) (-849.935) [-841.002] -- 0:02:57
303000 -- [-844.955] (-856.773) (-841.439) (-845.350) * (-838.789) (-842.402) [-846.656] (-840.502) -- 0:02:57
304000 -- [-844.318] (-847.850) (-857.648) (-846.794) * (-843.264) (-851.564) [-846.277] (-843.776) -- 0:02:58
305000 -- (-852.794) [-848.569] (-842.411) (-841.936) * (-841.908) (-848.578) [-844.661] (-843.389) -- 0:02:57
Average standard deviation of split frequencies: 0.011064
306000 -- (-842.783) (-843.673) (-841.223) [-844.736] * (-852.315) [-840.262] (-838.500) (-842.809) -- 0:02:56
307000 -- (-839.691) [-846.260] (-840.986) (-855.969) * (-861.027) (-849.930) [-840.241] (-838.046) -- 0:02:56
308000 -- [-845.392] (-844.637) (-839.776) (-843.574) * (-857.504) (-845.234) [-842.096] (-838.502) -- 0:02:57
309000 -- [-842.528] (-841.681) (-847.536) (-849.767) * (-848.967) (-840.355) (-847.170) [-843.690] -- 0:02:56
310000 -- (-843.693) [-836.328] (-851.826) (-841.668) * (-850.800) [-841.556] (-841.249) (-839.961) -- 0:02:55
Average standard deviation of split frequencies: 0.011174
311000 -- (-835.674) [-839.762] (-853.041) (-838.057) * [-842.909] (-851.821) (-840.388) (-844.201) -- 0:02:55
312000 -- (-845.484) (-846.337) (-850.402) [-842.693] * (-852.108) (-843.149) [-841.000] (-846.305) -- 0:02:56
313000 -- (-845.770) [-848.732] (-849.044) (-845.875) * (-843.238) (-846.419) [-847.421] (-856.570) -- 0:02:55
314000 -- (-852.525) (-844.301) [-843.875] (-854.987) * [-847.600] (-846.418) (-847.004) (-853.533) -- 0:02:54
315000 -- [-838.726] (-842.241) (-844.737) (-846.234) * (-850.536) (-846.678) (-839.922) [-852.146] -- 0:02:53
Average standard deviation of split frequencies: 0.010307
316000 -- (-846.563) (-851.077) (-845.879) [-845.860] * (-845.153) [-840.670] (-849.172) (-850.578) -- 0:02:55
317000 -- (-850.163) [-839.408] (-847.405) (-847.055) * (-840.875) [-836.049] (-843.069) (-844.111) -- 0:02:54
318000 -- (-848.200) [-838.045] (-839.068) (-844.888) * (-839.249) [-842.738] (-840.514) (-845.730) -- 0:02:53
319000 -- (-852.624) (-839.942) [-843.422] (-850.043) * (-838.636) [-846.702] (-849.842) (-838.667) -- 0:02:52
320000 -- (-843.470) [-840.727] (-843.798) (-840.398) * [-838.191] (-844.327) (-839.943) (-851.686) -- 0:02:54
Average standard deviation of split frequencies: 0.010825
321000 -- [-846.638] (-844.047) (-843.538) (-846.861) * (-853.809) (-845.293) (-839.174) [-838.737] -- 0:02:53
322000 -- (-853.293) [-839.987] (-851.345) (-837.219) * (-845.704) (-861.174) (-841.189) [-839.483] -- 0:02:52
323000 -- (-861.551) (-845.919) (-845.847) [-840.209] * (-845.930) [-849.178] (-847.464) (-844.884) -- 0:02:51
324000 -- (-851.527) (-841.679) [-845.801] (-847.096) * (-858.599) [-839.257] (-841.304) (-846.088) -- 0:02:53
325000 -- (-837.020) [-839.346] (-845.328) (-844.950) * (-847.343) (-845.992) (-839.612) [-844.460] -- 0:02:52
Average standard deviation of split frequencies: 0.010911
326000 -- (-851.306) (-842.247) (-839.601) [-843.400] * (-849.785) [-845.493] (-853.696) (-843.835) -- 0:02:51
327000 -- (-849.268) (-845.024) [-846.605] (-841.049) * (-859.576) (-846.200) (-848.812) [-836.319] -- 0:02:50
328000 -- (-858.736) (-846.902) (-844.314) [-846.795] * (-842.597) (-838.715) (-845.760) [-844.735] -- 0:02:52
329000 -- (-853.334) (-838.085) [-837.069] (-839.579) * (-851.632) (-847.164) [-848.774] (-842.428) -- 0:02:51
330000 -- (-839.594) (-842.156) [-840.983] (-849.392) * (-858.676) (-846.249) (-843.614) [-843.103] -- 0:02:50
Average standard deviation of split frequencies: 0.008295
331000 -- (-849.591) [-842.055] (-852.346) (-841.508) * (-841.488) [-838.943] (-845.744) (-843.506) -- 0:02:49
332000 -- (-844.258) (-843.006) [-843.708] (-847.955) * (-839.591) [-843.620] (-851.020) (-852.104) -- 0:02:51
333000 -- (-848.659) [-845.396] (-844.368) (-846.924) * [-841.997] (-854.584) (-841.375) (-847.885) -- 0:02:50
334000 -- [-854.365] (-840.379) (-846.001) (-842.198) * (-838.876) (-846.136) [-841.366] (-843.566) -- 0:02:49
335000 -- (-840.259) [-842.984] (-848.939) (-842.770) * (-838.542) [-841.157] (-843.189) (-843.635) -- 0:02:50
Average standard deviation of split frequencies: 0.007908
336000 -- (-852.225) (-843.150) (-848.889) [-846.104] * (-842.590) (-846.219) (-840.143) [-847.014] -- 0:02:49
337000 -- (-845.380) (-842.966) (-841.667) [-843.122] * (-842.166) (-845.614) [-844.049] (-856.679) -- 0:02:49
338000 -- [-842.705] (-864.303) (-838.759) (-854.550) * (-842.209) (-849.666) [-848.221] (-848.570) -- 0:02:48
339000 -- (-842.229) (-845.623) [-844.585] (-847.344) * [-840.862] (-845.693) (-839.829) (-851.024) -- 0:02:49
340000 -- (-843.773) [-845.417] (-846.741) (-848.480) * (-846.127) (-842.091) (-849.133) [-845.952] -- 0:02:48
Average standard deviation of split frequencies: 0.007422
341000 -- (-838.359) [-843.277] (-849.596) (-848.176) * [-850.549] (-841.802) (-855.319) (-840.478) -- 0:02:48
342000 -- (-846.023) [-848.514] (-842.420) (-845.841) * (-842.077) [-837.837] (-841.286) (-845.497) -- 0:02:47
343000 -- (-841.200) [-845.180] (-844.752) (-845.791) * (-845.559) [-847.220] (-847.403) (-853.309) -- 0:02:48
344000 -- (-842.398) [-838.472] (-847.031) (-851.405) * [-839.087] (-847.649) (-840.646) (-848.516) -- 0:02:47
345000 -- (-847.875) (-838.465) (-851.759) [-847.586] * (-842.112) [-840.711] (-847.946) (-844.204) -- 0:02:47
Average standard deviation of split frequencies: 0.009042
346000 -- (-846.108) [-847.250] (-843.229) (-850.353) * (-850.225) (-846.490) (-844.645) [-846.108] -- 0:02:46
347000 -- (-848.105) (-858.740) [-840.057] (-840.538) * [-850.362] (-847.354) (-840.938) (-846.823) -- 0:02:47
348000 -- (-848.737) (-849.834) (-842.949) [-843.511] * (-845.566) (-847.075) (-846.016) [-844.710] -- 0:02:46
349000 -- (-852.712) (-841.478) (-842.986) [-836.028] * (-843.377) [-847.452] (-842.458) (-848.703) -- 0:02:46
350000 -- (-860.261) [-840.351] (-849.579) (-844.109) * (-844.484) [-846.962] (-848.514) (-848.117) -- 0:02:45
Average standard deviation of split frequencies: 0.009532
351000 -- (-852.638) (-842.622) (-846.443) [-842.353] * [-840.223] (-845.673) (-844.898) (-840.433) -- 0:02:46
352000 -- (-843.386) (-844.389) (-851.666) [-843.543] * (-845.739) [-840.317] (-848.369) (-845.720) -- 0:02:45
353000 -- [-842.530] (-841.784) (-847.586) (-845.970) * (-846.236) [-843.629] (-841.635) (-853.611) -- 0:02:44
354000 -- (-850.366) [-840.814] (-852.695) (-846.513) * (-844.782) [-844.143] (-847.607) (-845.884) -- 0:02:44
355000 -- (-853.130) (-841.101) [-846.011] (-852.858) * (-847.857) (-838.693) (-845.136) [-842.085] -- 0:02:45
Average standard deviation of split frequencies: 0.009028
356000 -- [-844.419] (-849.755) (-856.347) (-843.030) * (-847.567) (-842.195) (-848.918) [-850.161] -- 0:02:44
357000 -- [-841.081] (-849.129) (-845.812) (-846.470) * [-846.168] (-846.652) (-844.276) (-851.991) -- 0:02:43
358000 -- (-849.766) (-841.244) (-847.796) [-836.896] * [-846.176] (-843.463) (-846.424) (-844.345) -- 0:02:43
359000 -- (-841.447) (-840.411) [-836.205] (-852.400) * [-843.755] (-843.441) (-840.860) (-838.999) -- 0:02:44
360000 -- (-844.338) (-842.510) (-848.618) [-841.187] * (-844.320) (-847.636) [-846.537] (-843.384) -- 0:02:43
Average standard deviation of split frequencies: 0.008793
361000 -- (-836.954) (-839.506) [-840.734] (-851.758) * (-849.879) [-850.440] (-842.823) (-849.402) -- 0:02:42
362000 -- (-851.503) [-843.118] (-847.542) (-845.972) * (-847.767) (-841.405) [-841.850] (-850.584) -- 0:02:42
363000 -- (-840.067) [-845.210] (-847.410) (-841.369) * (-849.543) (-847.101) (-844.564) [-846.089] -- 0:02:43
364000 -- (-848.325) (-849.585) (-840.520) [-844.503] * [-851.732] (-858.844) (-848.164) (-846.650) -- 0:02:42
365000 -- (-851.001) (-848.125) [-849.144] (-851.934) * (-846.757) [-848.359] (-844.150) (-841.849) -- 0:02:41
Average standard deviation of split frequencies: 0.008313
366000 -- (-847.213) [-840.169] (-847.826) (-842.463) * (-852.290) (-854.968) [-847.075] (-841.831) -- 0:02:41
367000 -- (-847.618) (-847.260) [-839.957] (-847.108) * [-849.287] (-842.586) (-847.426) (-842.924) -- 0:02:42
368000 -- (-846.374) (-854.221) [-842.282] (-838.877) * [-847.709] (-845.289) (-845.005) (-842.996) -- 0:02:41
369000 -- (-847.705) (-848.163) (-838.731) [-845.343] * [-840.600] (-845.234) (-848.610) (-857.096) -- 0:02:40
370000 -- (-842.508) (-846.585) [-838.593] (-845.909) * (-841.744) [-842.842] (-849.990) (-847.260) -- 0:02:40
Average standard deviation of split frequencies: 0.008093
371000 -- [-844.550] (-839.796) (-846.692) (-841.776) * (-841.954) [-846.470] (-849.140) (-845.044) -- 0:02:41
372000 -- (-854.225) (-841.616) (-842.289) [-841.457] * [-839.738] (-849.846) (-843.241) (-857.441) -- 0:02:40
373000 -- (-847.828) (-840.604) (-856.513) [-837.980] * [-839.548] (-849.375) (-845.367) (-847.332) -- 0:02:39
374000 -- [-844.328] (-838.937) (-855.627) (-837.914) * [-841.300] (-850.552) (-847.640) (-861.787) -- 0:02:39
375000 -- (-851.425) (-856.485) (-842.287) [-846.865] * (-842.079) (-851.949) (-852.532) [-849.267] -- 0:02:40
Average standard deviation of split frequencies: 0.008662
376000 -- (-849.302) (-842.756) (-840.600) [-843.275] * (-846.451) [-848.286] (-848.028) (-844.421) -- 0:02:39
377000 -- (-845.225) (-846.435) [-848.042] (-848.834) * (-843.692) (-849.006) [-839.352] (-846.471) -- 0:02:38
378000 -- (-846.829) [-842.449] (-844.170) (-847.575) * (-845.721) [-844.072] (-853.226) (-842.980) -- 0:02:37
379000 -- (-846.391) (-840.536) (-844.030) [-839.590] * [-840.983] (-855.215) (-847.799) (-846.365) -- 0:02:38
380000 -- (-840.276) (-845.161) [-845.476] (-843.035) * [-844.601] (-851.136) (-853.532) (-841.447) -- 0:02:38
Average standard deviation of split frequencies: 0.009569
381000 -- [-842.364] (-847.262) (-844.921) (-841.138) * (-850.577) (-843.981) (-848.468) [-842.165] -- 0:02:37
382000 -- (-841.136) [-842.100] (-847.939) (-851.919) * (-846.046) (-843.014) (-840.071) [-844.710] -- 0:02:36
383000 -- (-847.512) (-843.353) [-840.809] (-851.875) * (-847.559) (-839.984) [-844.233] (-852.378) -- 0:02:37
384000 -- (-844.286) (-852.319) (-849.310) [-839.993] * (-852.912) (-847.568) [-843.082] (-848.715) -- 0:02:37
385000 -- (-846.710) (-851.614) [-838.843] (-852.075) * [-847.779] (-850.547) (-837.812) (-843.177) -- 0:02:36
Average standard deviation of split frequencies: 0.009215
386000 -- (-837.618) (-855.704) (-840.434) [-840.389] * [-843.812] (-843.617) (-839.189) (-848.463) -- 0:02:35
387000 -- (-840.311) [-842.938] (-848.560) (-845.229) * [-843.679] (-846.558) (-838.293) (-844.171) -- 0:02:36
388000 -- (-843.021) (-846.086) (-842.258) [-842.948] * (-843.709) [-841.802] (-846.925) (-845.902) -- 0:02:36
389000 -- (-854.141) (-841.532) (-858.460) [-844.929] * [-841.415] (-855.576) (-839.316) (-844.678) -- 0:02:35
390000 -- (-842.556) (-848.015) (-842.149) [-841.450] * (-847.900) (-839.137) [-840.645] (-841.522) -- 0:02:34
Average standard deviation of split frequencies: 0.009434
391000 -- [-842.756] (-844.909) (-851.069) (-847.520) * (-849.731) (-840.790) (-849.222) [-841.747] -- 0:02:35
392000 -- [-845.235] (-852.634) (-839.897) (-849.815) * (-843.581) (-847.415) [-842.285] (-851.997) -- 0:02:35
393000 -- (-848.858) (-846.003) [-845.092] (-847.095) * [-839.447] (-844.288) (-851.637) (-845.029) -- 0:02:34
394000 -- (-849.670) (-847.715) (-841.499) [-843.810] * (-843.320) (-845.890) [-844.093] (-847.820) -- 0:02:33
395000 -- (-842.888) [-840.925] (-843.075) (-847.635) * (-839.136) [-841.888] (-845.171) (-844.289) -- 0:02:34
Average standard deviation of split frequencies: 0.008658
396000 -- (-846.901) [-839.930] (-847.129) (-837.573) * [-844.690] (-847.246) (-848.831) (-844.892) -- 0:02:34
397000 -- (-850.735) [-843.081] (-853.116) (-843.673) * (-851.974) (-841.171) [-839.225] (-845.342) -- 0:02:33
398000 -- (-839.964) [-844.153] (-844.708) (-842.884) * [-841.369] (-847.320) (-840.111) (-835.839) -- 0:02:32
399000 -- (-843.928) (-845.169) [-842.409] (-839.451) * (-853.278) (-847.987) [-844.558] (-843.608) -- 0:02:33
400000 -- (-839.909) (-847.777) [-837.648] (-848.872) * (-844.960) (-846.343) [-838.427] (-850.541) -- 0:02:33
Average standard deviation of split frequencies: 0.008022
401000 -- (-842.537) [-846.630] (-843.011) (-842.942) * [-846.615] (-842.428) (-844.494) (-845.172) -- 0:02:32
402000 -- (-843.773) [-842.030] (-839.383) (-848.567) * (-845.804) (-854.726) [-838.439] (-839.423) -- 0:02:31
403000 -- (-843.582) (-841.823) [-840.546] (-838.291) * (-845.174) (-843.400) (-835.704) [-840.065] -- 0:02:32
404000 -- (-848.125) [-841.957] (-842.489) (-852.440) * (-843.750) (-845.922) [-848.935] (-842.623) -- 0:02:31
405000 -- [-842.838] (-843.265) (-843.414) (-841.543) * (-844.071) (-841.698) (-849.364) [-845.730] -- 0:02:31
Average standard deviation of split frequencies: 0.008867
406000 -- [-849.686] (-848.086) (-846.012) (-845.568) * (-839.945) [-848.884] (-846.545) (-844.636) -- 0:02:30
407000 -- (-845.704) [-841.038] (-845.283) (-848.398) * [-844.355] (-838.855) (-838.820) (-846.850) -- 0:02:31
408000 -- (-840.680) [-842.239] (-843.508) (-845.470) * [-844.297] (-840.237) (-842.706) (-841.596) -- 0:02:30
409000 -- (-850.975) (-845.796) (-843.984) [-849.776] * (-845.424) [-850.871] (-844.744) (-845.203) -- 0:02:30
410000 -- [-843.786] (-839.731) (-842.078) (-841.160) * (-843.866) [-840.009] (-844.261) (-848.238) -- 0:02:29
Average standard deviation of split frequencies: 0.008870
411000 -- (-849.736) (-846.318) [-847.904] (-854.561) * (-845.589) (-855.717) [-841.809] (-845.087) -- 0:02:30
412000 -- (-843.681) (-842.762) [-846.319] (-839.767) * (-844.299) [-834.574] (-850.522) (-845.520) -- 0:02:29
413000 -- [-843.782] (-849.080) (-862.277) (-839.978) * [-841.998] (-842.006) (-847.919) (-845.508) -- 0:02:29
414000 -- (-853.952) (-845.579) [-840.553] (-848.357) * (-845.651) [-840.361] (-846.779) (-844.403) -- 0:02:30
415000 -- (-843.383) (-848.056) [-844.177] (-841.622) * (-841.521) (-840.910) (-842.399) [-839.320] -- 0:02:29
Average standard deviation of split frequencies: 0.008962
416000 -- (-850.526) (-844.024) [-842.354] (-850.527) * (-836.562) [-845.256] (-841.964) (-843.119) -- 0:02:28
417000 -- [-841.468] (-842.089) (-848.127) (-840.777) * (-841.692) (-843.323) (-853.711) [-841.910] -- 0:02:28
418000 -- (-849.613) (-844.268) [-844.224] (-839.324) * (-852.923) (-842.718) (-837.694) [-844.914] -- 0:02:28
419000 -- (-860.881) (-839.665) (-843.443) [-838.465] * (-844.871) (-843.244) [-842.679] (-851.015) -- 0:02:28
420000 -- [-848.651] (-840.527) (-845.768) (-850.901) * [-847.341] (-850.621) (-844.283) (-853.964) -- 0:02:27
Average standard deviation of split frequencies: 0.007437
421000 -- (-863.431) [-843.462] (-859.693) (-843.173) * (-841.725) (-851.917) [-843.054] (-843.654) -- 0:02:27
422000 -- (-850.957) (-847.439) (-840.687) [-842.289] * (-839.576) (-846.326) (-843.817) [-845.867] -- 0:02:27
423000 -- (-848.020) (-845.585) [-840.619] (-844.363) * (-843.356) [-850.093] (-851.294) (-848.323) -- 0:02:27
424000 -- (-843.274) [-840.754] (-845.050) (-846.250) * (-841.812) (-849.700) [-844.608] (-846.772) -- 0:02:26
425000 -- (-840.428) (-845.380) (-858.007) [-842.610] * (-851.112) [-854.492] (-838.582) (-851.438) -- 0:02:26
Average standard deviation of split frequencies: 0.007847
426000 -- [-837.414] (-844.655) (-842.225) (-849.976) * [-839.328] (-845.930) (-844.936) (-844.759) -- 0:02:26
427000 -- (-844.420) (-841.919) [-842.253] (-850.804) * (-845.214) [-845.353] (-841.350) (-842.268) -- 0:02:26
428000 -- (-843.400) [-844.046] (-844.074) (-842.343) * (-853.742) [-843.553] (-842.438) (-844.062) -- 0:02:25
429000 -- (-841.693) (-845.998) (-847.004) [-844.432] * (-850.152) (-845.964) [-838.234] (-843.171) -- 0:02:25
430000 -- [-840.512] (-845.487) (-848.981) (-845.324) * (-847.553) (-853.902) [-842.159] (-837.594) -- 0:02:25
Average standard deviation of split frequencies: 0.008259
431000 -- (-840.372) [-840.768] (-854.344) (-849.418) * [-845.046] (-844.705) (-856.658) (-841.795) -- 0:02:25
432000 -- (-845.513) (-850.453) (-848.208) [-849.012] * (-843.040) [-842.913] (-850.940) (-841.385) -- 0:02:24
433000 -- (-841.990) (-848.307) (-843.680) [-841.234] * (-847.958) (-839.557) (-843.396) [-842.519] -- 0:02:24
434000 -- (-847.601) [-846.461] (-840.432) (-841.136) * (-848.356) (-844.868) [-841.095] (-850.098) -- 0:02:24
435000 -- (-843.685) (-849.091) (-842.893) [-850.986] * (-840.743) (-844.245) (-842.662) [-845.503] -- 0:02:24
Average standard deviation of split frequencies: 0.007372
436000 -- [-839.103] (-842.336) (-845.949) (-847.392) * [-838.938] (-843.936) (-845.440) (-840.997) -- 0:02:23
437000 -- (-839.626) [-859.621] (-842.653) (-840.195) * (-845.195) [-842.854] (-847.021) (-844.053) -- 0:02:23
438000 -- [-841.658] (-846.093) (-845.888) (-849.650) * (-847.751) (-854.334) (-854.191) [-846.813] -- 0:02:23
439000 -- (-855.821) [-848.936] (-840.354) (-847.389) * (-843.080) [-843.178] (-849.140) (-839.911) -- 0:02:23
440000 -- (-846.058) (-846.498) [-841.662] (-837.933) * (-847.983) (-844.326) [-845.193] (-844.229) -- 0:02:22
Average standard deviation of split frequencies: 0.006321
441000 -- (-851.908) (-842.647) (-844.723) [-843.304] * (-838.264) (-851.350) [-845.471] (-847.899) -- 0:02:21
442000 -- [-848.019] (-841.723) (-843.665) (-850.486) * (-850.464) (-846.061) (-851.658) [-839.207] -- 0:02:22
443000 -- (-846.223) (-847.744) (-845.865) [-849.319] * (-846.007) (-838.896) (-852.685) [-850.432] -- 0:02:22
444000 -- (-840.373) [-840.656] (-851.775) (-843.301) * [-843.979] (-839.945) (-847.824) (-845.288) -- 0:02:21
445000 -- (-843.869) [-842.118] (-844.363) (-843.053) * (-851.224) (-845.374) [-844.348] (-845.077) -- 0:02:20
Average standard deviation of split frequencies: 0.006438
446000 -- [-842.395] (-843.923) (-843.966) (-846.846) * (-842.011) (-843.007) (-848.114) [-843.137] -- 0:02:21
447000 -- [-840.167] (-850.808) (-849.804) (-847.693) * (-845.966) (-837.374) (-842.861) [-839.233] -- 0:02:21
448000 -- [-846.865] (-848.039) (-838.875) (-843.978) * (-858.955) (-843.601) (-842.895) [-846.956] -- 0:02:20
449000 -- (-839.629) [-842.238] (-850.551) (-840.940) * (-840.539) (-843.908) (-846.888) [-840.508] -- 0:02:19
450000 -- (-848.460) [-848.833] (-843.497) (-840.351) * [-838.706] (-847.459) (-837.737) (-843.553) -- 0:02:20
Average standard deviation of split frequencies: 0.008273
451000 -- (-847.346) [-842.036] (-843.249) (-841.363) * [-837.835] (-841.726) (-852.970) (-844.857) -- 0:02:19
452000 -- [-848.970] (-844.299) (-852.624) (-843.075) * (-841.033) (-847.611) (-845.558) [-842.419] -- 0:02:19
453000 -- [-837.663] (-839.492) (-848.692) (-843.042) * (-839.533) (-841.994) (-842.777) [-842.627] -- 0:02:18
454000 -- [-844.728] (-843.358) (-844.018) (-853.334) * (-842.140) (-835.879) (-841.082) [-838.866] -- 0:02:19
455000 -- (-844.613) [-843.611] (-850.998) (-851.419) * (-850.563) (-847.991) (-842.233) [-844.982] -- 0:02:18
Average standard deviation of split frequencies: 0.007988
456000 -- (-846.793) [-836.950] (-844.044) (-848.036) * (-844.915) [-853.674] (-846.670) (-841.276) -- 0:02:18
457000 -- (-848.889) [-844.167] (-845.427) (-845.362) * [-845.254] (-845.639) (-841.422) (-850.191) -- 0:02:19
458000 -- [-847.506] (-840.528) (-854.505) (-848.155) * [-841.278] (-845.631) (-842.126) (-850.216) -- 0:02:18
459000 -- (-852.712) (-844.525) (-841.825) [-853.246] * [-840.948] (-854.840) (-844.695) (-842.637) -- 0:02:17
460000 -- (-853.091) (-847.015) [-841.265] (-849.517) * (-849.137) [-840.014] (-845.156) (-843.616) -- 0:02:17
Average standard deviation of split frequencies: 0.008652
461000 -- (-860.283) (-842.501) [-843.805] (-850.727) * (-847.218) [-838.882] (-847.978) (-836.425) -- 0:02:17
462000 -- (-850.602) [-840.046] (-846.803) (-845.455) * [-841.671] (-844.662) (-842.240) (-853.165) -- 0:02:17
463000 -- [-842.805] (-840.703) (-851.132) (-855.003) * (-847.270) (-841.318) [-848.461] (-846.500) -- 0:02:16
464000 -- (-842.256) (-843.666) (-842.177) [-841.430] * (-845.674) [-845.128] (-843.787) (-843.027) -- 0:02:16
465000 -- (-855.210) (-854.190) [-845.514] (-847.014) * (-843.761) (-841.911) (-848.486) [-834.486] -- 0:02:16
Average standard deviation of split frequencies: 0.009472
466000 -- (-837.909) (-845.694) [-840.777] (-847.349) * (-852.036) [-847.754] (-847.978) (-837.739) -- 0:02:16
467000 -- (-845.030) (-842.455) (-838.003) [-841.287] * [-849.630] (-843.173) (-843.006) (-847.203) -- 0:02:15
468000 -- (-842.476) (-842.837) [-837.095] (-846.728) * (-853.066) [-835.804] (-841.628) (-845.865) -- 0:02:15
469000 -- (-845.482) (-844.151) [-847.519] (-847.269) * (-853.609) (-844.997) [-841.045] (-844.331) -- 0:02:15
470000 -- (-841.590) (-846.495) (-847.384) [-838.394] * (-854.568) (-847.295) [-847.103] (-853.838) -- 0:02:15
Average standard deviation of split frequencies: 0.010107
471000 -- (-836.562) (-846.547) (-851.436) [-842.271] * (-844.149) (-848.157) (-850.515) [-842.054] -- 0:02:14
472000 -- (-850.711) (-852.770) [-851.554] (-846.645) * (-849.773) [-846.160] (-845.726) (-848.007) -- 0:02:14
473000 -- (-848.488) (-844.903) (-842.417) [-844.070] * (-842.367) [-843.891] (-847.690) (-845.529) -- 0:02:14
474000 -- [-846.962] (-843.567) (-848.949) (-842.107) * [-840.937] (-846.780) (-842.859) (-848.844) -- 0:02:14
475000 -- (-838.004) [-841.962] (-845.399) (-846.308) * (-846.344) (-847.950) [-849.558] (-845.160) -- 0:02:13
Average standard deviation of split frequencies: 0.009093
476000 -- [-852.948] (-841.419) (-846.892) (-840.266) * (-852.830) [-841.579] (-846.242) (-847.254) -- 0:02:13
477000 -- (-849.232) (-837.268) (-851.327) [-846.158] * (-849.509) (-844.334) [-845.049] (-860.424) -- 0:02:13
478000 -- (-846.883) (-848.085) [-841.224] (-838.206) * (-850.792) (-837.919) [-839.821] (-845.285) -- 0:02:13
479000 -- (-855.966) (-840.131) [-844.695] (-846.560) * (-844.829) (-845.334) (-841.602) [-844.512] -- 0:02:12
480000 -- (-849.300) (-841.260) [-841.344] (-851.904) * (-843.913) (-843.080) [-839.880] (-843.610) -- 0:02:12
Average standard deviation of split frequencies: 0.009272
481000 -- (-846.804) (-841.693) [-844.654] (-845.113) * (-841.454) (-847.487) (-846.532) [-839.591] -- 0:02:12
482000 -- (-847.881) (-851.966) [-856.563] (-844.410) * (-856.969) [-850.323] (-845.804) (-846.668) -- 0:02:12
483000 -- (-845.523) (-852.856) (-867.342) [-837.057] * (-850.796) (-838.630) [-841.609] (-844.303) -- 0:02:11
484000 -- [-839.845] (-837.583) (-850.705) (-843.287) * (-853.716) [-845.277] (-841.833) (-846.614) -- 0:02:11
485000 -- (-846.895) (-844.358) (-844.558) [-842.665] * [-845.233] (-847.643) (-845.694) (-844.454) -- 0:02:11
Average standard deviation of split frequencies: 0.010141
486000 -- (-842.662) [-843.371] (-840.776) (-841.505) * (-846.215) [-840.896] (-837.145) (-844.802) -- 0:02:11
487000 -- [-839.450] (-844.913) (-856.851) (-848.480) * (-847.850) (-846.707) [-840.319] (-839.237) -- 0:02:10
488000 -- (-841.952) [-846.425] (-850.971) (-849.867) * (-846.867) (-845.260) [-843.891] (-841.615) -- 0:02:10
489000 -- (-856.358) [-841.745] (-848.216) (-843.179) * (-849.767) (-845.923) (-842.604) [-847.320] -- 0:02:10
490000 -- (-841.344) (-845.663) (-841.886) [-840.052] * (-849.893) (-848.865) (-852.499) [-841.256] -- 0:02:10
Average standard deviation of split frequencies: 0.010393
491000 -- (-838.969) (-852.723) (-854.050) [-844.801] * [-851.130] (-847.084) (-842.906) (-846.681) -- 0:02:09
492000 -- (-846.131) [-847.077] (-841.066) (-847.670) * [-846.337] (-843.482) (-846.334) (-842.254) -- 0:02:09
493000 -- (-855.511) (-843.204) (-843.598) [-841.975] * (-849.854) (-847.434) [-846.504] (-842.740) -- 0:02:09
494000 -- [-841.918] (-846.321) (-842.226) (-840.731) * (-844.583) [-842.097] (-847.090) (-841.010) -- 0:02:09
495000 -- [-839.411] (-852.998) (-842.506) (-840.763) * (-848.531) [-846.591] (-847.461) (-850.790) -- 0:02:08
Average standard deviation of split frequencies: 0.010455
496000 -- (-846.296) [-843.036] (-837.426) (-847.344) * (-852.733) [-850.700] (-840.393) (-845.619) -- 0:02:08
497000 -- (-839.131) (-845.590) [-838.731] (-849.197) * (-853.498) (-847.387) (-843.613) [-844.328] -- 0:02:08
498000 -- (-844.463) [-837.311] (-842.280) (-853.414) * (-850.164) (-848.176) (-846.664) [-841.538] -- 0:02:08
499000 -- (-859.150) [-838.197] (-853.738) (-849.506) * (-855.701) (-844.494) [-843.156] (-841.692) -- 0:02:07
500000 -- (-846.521) [-843.809] (-841.204) (-842.607) * [-840.197] (-853.106) (-840.803) (-839.697) -- 0:02:07
Average standard deviation of split frequencies: 0.010100
501000 -- [-847.969] (-844.754) (-852.565) (-839.825) * (-849.625) (-851.744) [-841.541] (-855.618) -- 0:02:07
502000 -- (-838.279) [-843.778] (-847.441) (-845.172) * (-863.045) (-844.929) [-849.514] (-846.670) -- 0:02:06
503000 -- (-844.667) (-844.207) (-843.941) [-848.477] * (-846.302) (-844.572) (-843.177) [-845.309] -- 0:02:06
504000 -- [-846.056] (-843.381) (-840.250) (-848.624) * (-850.697) (-850.930) (-852.310) [-843.645] -- 0:02:05
505000 -- (-851.242) (-846.238) (-843.272) [-841.112] * (-849.871) [-843.553] (-855.406) (-841.535) -- 0:02:06
Average standard deviation of split frequencies: 0.009232
506000 -- (-844.872) (-848.467) (-846.338) [-842.138] * (-840.255) (-840.993) [-842.983] (-848.548) -- 0:02:05
507000 -- (-840.762) (-854.540) (-848.001) [-847.708] * (-841.263) (-849.374) (-844.971) [-839.569] -- 0:02:05
508000 -- [-839.451] (-842.709) (-841.528) (-839.447) * [-842.051] (-852.503) (-851.686) (-843.672) -- 0:02:04
509000 -- [-841.934] (-847.224) (-841.930) (-844.681) * (-840.639) (-843.143) [-847.820] (-846.364) -- 0:02:05
510000 -- (-842.812) [-840.570] (-842.482) (-848.728) * (-848.400) (-843.957) (-846.612) [-841.901] -- 0:02:04
Average standard deviation of split frequencies: 0.008308
511000 -- (-842.865) (-848.352) (-844.520) [-843.291] * [-841.526] (-846.510) (-849.034) (-846.212) -- 0:02:04
512000 -- [-847.574] (-840.054) (-850.027) (-843.823) * [-840.413] (-844.274) (-846.877) (-840.212) -- 0:02:03
513000 -- [-843.283] (-843.635) (-841.330) (-852.242) * (-843.641) (-841.585) [-844.121] (-849.441) -- 0:02:04
514000 -- [-838.842] (-846.021) (-852.963) (-844.921) * (-847.022) (-851.891) [-839.330] (-841.612) -- 0:02:03
515000 -- (-843.210) (-848.575) [-843.815] (-838.016) * (-845.463) [-838.984] (-836.280) (-847.525) -- 0:02:03
Average standard deviation of split frequencies: 0.006312
516000 -- (-846.874) (-843.333) [-847.856] (-845.389) * (-851.610) (-844.599) (-845.798) [-840.753] -- 0:02:02
517000 -- (-851.046) [-846.958] (-844.370) (-849.818) * [-841.842] (-856.341) (-837.151) (-838.786) -- 0:02:03
518000 -- (-845.664) (-846.626) [-841.343] (-851.061) * (-849.706) (-861.779) [-847.672] (-847.014) -- 0:02:02
519000 -- [-844.191] (-846.950) (-848.998) (-849.558) * [-846.145] (-848.001) (-844.299) (-840.961) -- 0:02:02
520000 -- (-841.856) [-848.610] (-844.669) (-837.867) * (-852.509) (-840.764) [-844.173] (-842.939) -- 0:02:01
Average standard deviation of split frequencies: 0.005844
521000 -- (-848.679) [-843.979] (-841.997) (-837.235) * (-846.452) (-846.106) (-847.972) [-840.230] -- 0:02:02
522000 -- [-842.713] (-853.105) (-840.767) (-844.289) * (-844.885) [-842.944] (-846.806) (-842.087) -- 0:02:01
523000 -- (-841.861) [-846.283] (-843.070) (-853.134) * [-846.796] (-850.139) (-840.068) (-841.560) -- 0:02:01
524000 -- (-845.830) [-845.088] (-844.116) (-847.383) * [-844.295] (-847.699) (-843.415) (-841.452) -- 0:02:01
525000 -- (-847.091) (-849.724) (-846.520) [-843.061] * (-849.767) [-841.716] (-850.831) (-852.037) -- 0:02:01
Average standard deviation of split frequencies: 0.006273
526000 -- (-845.058) [-840.493] (-842.951) (-840.149) * (-849.742) (-844.647) [-838.961] (-845.006) -- 0:02:00
527000 -- (-843.980) (-842.652) [-844.496] (-847.974) * (-851.826) [-841.660] (-846.638) (-844.449) -- 0:02:00
528000 -- (-859.831) [-850.529] (-847.887) (-845.597) * (-853.435) [-840.390] (-851.446) (-848.218) -- 0:02:00
529000 -- [-840.371] (-856.725) (-842.246) (-845.520) * (-847.770) [-849.002] (-850.012) (-846.059) -- 0:02:00
530000 -- (-846.397) [-843.949] (-845.618) (-846.914) * [-839.669] (-846.364) (-849.705) (-847.246) -- 0:01:59
Average standard deviation of split frequencies: 0.005734
531000 -- (-840.405) [-842.216] (-841.183) (-847.034) * (-848.042) (-842.534) (-847.605) [-842.313] -- 0:01:59
532000 -- [-842.057] (-841.047) (-850.357) (-850.594) * [-841.477] (-843.096) (-841.025) (-841.875) -- 0:01:59
533000 -- (-849.225) (-843.403) [-849.568] (-855.170) * [-844.234] (-845.766) (-845.140) (-842.664) -- 0:01:59
534000 -- (-841.131) (-843.539) [-841.335] (-850.376) * (-849.568) [-844.164] (-846.124) (-854.359) -- 0:01:58
535000 -- (-841.385) [-842.382] (-841.245) (-851.430) * (-847.576) [-845.477] (-844.609) (-841.719) -- 0:01:58
Average standard deviation of split frequencies: 0.005437
536000 -- (-847.696) [-843.386] (-848.091) (-844.543) * (-846.483) [-847.692] (-842.389) (-848.453) -- 0:01:58
537000 -- (-844.638) (-855.764) (-852.250) [-842.233] * (-841.441) [-843.700] (-850.234) (-846.144) -- 0:01:58
538000 -- (-846.067) (-849.127) [-850.150] (-844.034) * (-843.294) (-851.797) (-840.197) [-840.537] -- 0:01:57
539000 -- [-846.956] (-849.657) (-841.202) (-844.576) * (-849.425) (-840.587) [-844.746] (-857.097) -- 0:01:57
540000 -- (-841.231) (-848.115) (-840.083) [-837.941] * [-844.311] (-844.343) (-838.883) (-839.285) -- 0:01:57
Average standard deviation of split frequencies: 0.005865
541000 -- (-850.905) [-848.416] (-841.293) (-853.166) * (-843.543) [-841.508] (-851.847) (-840.697) -- 0:01:57
542000 -- (-849.891) (-846.082) [-841.131] (-853.267) * (-839.168) [-842.089] (-846.026) (-846.039) -- 0:01:56
543000 -- (-842.303) (-844.231) (-850.719) [-839.148] * (-845.551) (-840.804) (-845.233) [-844.535] -- 0:01:56
544000 -- (-842.202) (-846.816) [-841.044] (-845.852) * [-849.503] (-843.216) (-843.510) (-845.130) -- 0:01:56
545000 -- (-840.792) [-843.330] (-838.278) (-849.140) * [-837.257] (-847.002) (-844.164) (-849.645) -- 0:01:56
Average standard deviation of split frequencies: 0.006279
546000 -- (-840.308) [-836.413] (-847.127) (-842.109) * [-840.851] (-844.853) (-842.642) (-857.898) -- 0:01:55
547000 -- [-844.698] (-838.873) (-847.298) (-846.328) * (-843.431) (-850.432) [-846.135] (-847.147) -- 0:01:55
548000 -- [-841.842] (-848.269) (-848.207) (-847.575) * (-844.119) (-846.438) (-848.717) [-847.354] -- 0:01:55
549000 -- (-847.905) (-853.354) (-849.589) [-852.530] * (-851.832) (-847.334) (-865.839) [-837.715] -- 0:01:55
550000 -- (-845.664) (-843.675) (-840.765) [-839.954] * [-847.287] (-841.103) (-846.887) (-841.574) -- 0:01:54
Average standard deviation of split frequencies: 0.005603
551000 -- (-853.391) (-845.223) [-842.764] (-850.402) * (-836.836) [-843.068] (-848.974) (-841.758) -- 0:01:54
552000 -- (-843.360) (-844.692) [-838.302] (-855.393) * (-846.276) (-841.285) (-844.559) [-844.715] -- 0:01:54
553000 -- (-840.545) (-848.180) [-847.255] (-844.001) * (-838.406) (-851.423) [-836.562] (-842.174) -- 0:01:53
554000 -- (-851.552) (-852.197) [-838.707] (-843.055) * [-835.897] (-842.385) (-843.435) (-843.296) -- 0:01:53
555000 -- (-839.554) (-852.052) (-841.867) [-835.193] * [-843.836] (-839.736) (-846.711) (-849.784) -- 0:01:53
Average standard deviation of split frequencies: 0.005087
556000 -- (-842.701) (-855.740) (-841.217) [-844.158] * (-845.795) (-847.731) [-840.861] (-840.849) -- 0:01:53
557000 -- [-845.802] (-848.639) (-844.397) (-846.530) * (-849.894) [-845.028] (-844.673) (-852.302) -- 0:01:52
558000 -- (-842.080) [-846.064] (-848.977) (-842.783) * [-838.236] (-855.377) (-839.638) (-844.583) -- 0:01:52
559000 -- [-840.736] (-842.076) (-844.827) (-845.256) * (-842.213) (-849.008) (-841.563) [-851.860] -- 0:01:52
560000 -- (-840.939) (-840.131) (-838.933) [-845.050] * [-842.917] (-850.663) (-844.048) (-842.335) -- 0:01:52
Average standard deviation of split frequencies: 0.005886
561000 -- (-846.234) (-845.954) (-841.483) [-848.009] * (-850.064) [-843.382] (-842.170) (-837.148) -- 0:01:51
562000 -- (-845.013) (-843.112) (-844.316) [-843.438] * [-843.781] (-839.456) (-842.402) (-845.138) -- 0:01:51
563000 -- [-845.886] (-847.907) (-844.044) (-838.581) * (-852.456) (-836.593) [-841.260] (-842.771) -- 0:01:51
564000 -- [-842.498] (-845.960) (-847.229) (-839.623) * (-841.921) [-848.344] (-851.250) (-844.990) -- 0:01:51
565000 -- (-839.351) (-844.798) [-846.289] (-849.599) * [-842.514] (-847.769) (-851.441) (-844.539) -- 0:01:50
Average standard deviation of split frequencies: 0.006512
566000 -- (-843.082) (-847.516) [-847.792] (-844.683) * (-850.055) (-843.643) [-841.514] (-843.341) -- 0:01:50
567000 -- (-854.796) [-844.485] (-845.460) (-847.249) * (-858.011) (-844.765) [-845.024] (-845.228) -- 0:01:50
568000 -- (-841.865) [-838.795] (-841.566) (-845.958) * (-844.174) [-846.548] (-848.464) (-847.578) -- 0:01:50
569000 -- (-840.694) (-845.324) [-845.465] (-845.993) * (-840.151) (-843.121) (-850.473) [-841.001] -- 0:01:49
570000 -- [-846.940] (-846.913) (-844.005) (-846.132) * (-842.465) (-845.334) (-846.248) [-839.140] -- 0:01:49
Average standard deviation of split frequencies: 0.006233
571000 -- (-843.652) [-844.313] (-849.863) (-845.188) * (-844.113) (-847.386) [-844.653] (-840.649) -- 0:01:49
572000 -- [-840.158] (-840.773) (-846.392) (-850.245) * (-841.326) [-843.305] (-853.236) (-847.270) -- 0:01:49
573000 -- (-840.543) (-840.815) [-838.387] (-841.749) * (-846.986) (-840.855) [-847.998] (-843.059) -- 0:01:48
574000 -- [-842.626] (-850.943) (-846.739) (-848.184) * (-848.353) [-836.193] (-844.781) (-845.453) -- 0:01:48
575000 -- [-840.046] (-845.108) (-848.441) (-853.454) * [-843.622] (-840.491) (-849.135) (-848.679) -- 0:01:48
Average standard deviation of split frequencies: 0.005878
576000 -- (-844.487) [-840.512] (-849.988) (-847.253) * [-842.659] (-845.437) (-847.907) (-851.939) -- 0:01:48
577000 -- (-835.325) [-842.093] (-858.645) (-847.358) * (-845.978) (-843.986) [-838.521] (-840.866) -- 0:01:47
578000 -- (-839.082) (-846.765) (-837.517) [-840.846] * [-840.509] (-860.251) (-842.684) (-842.412) -- 0:01:47
579000 -- (-844.356) (-843.925) [-842.577] (-852.359) * [-843.304] (-843.701) (-841.354) (-852.537) -- 0:01:47
580000 -- (-841.835) (-844.109) (-841.069) [-846.586] * (-839.649) (-842.441) (-844.928) [-848.171] -- 0:01:47
Average standard deviation of split frequencies: 0.005535
581000 -- (-845.746) [-855.023] (-848.528) (-845.972) * (-837.728) (-848.957) (-842.295) [-850.521] -- 0:01:46
582000 -- [-852.168] (-840.742) (-841.164) (-840.800) * [-844.320] (-842.954) (-841.414) (-844.491) -- 0:01:46
583000 -- (-845.593) (-852.055) (-837.598) [-842.807] * (-840.844) (-841.929) [-844.926] (-840.751) -- 0:01:46
584000 -- (-843.700) (-838.210) [-844.870] (-853.281) * [-839.155] (-849.452) (-844.554) (-843.440) -- 0:01:46
585000 -- (-848.876) (-847.137) [-839.909] (-836.970) * (-844.167) (-851.582) [-840.626] (-841.649) -- 0:01:45
Average standard deviation of split frequencies: 0.004754
586000 -- [-840.937] (-841.305) (-847.650) (-842.436) * (-844.168) (-851.245) [-845.954] (-843.967) -- 0:01:45
587000 -- [-834.239] (-840.318) (-843.534) (-847.568) * (-846.366) (-853.048) (-850.351) [-843.688] -- 0:01:45
588000 -- (-853.623) (-847.626) (-854.673) [-836.838] * [-837.253] (-848.083) (-847.590) (-849.074) -- 0:01:45
589000 -- (-842.989) (-840.853) [-848.819] (-840.514) * [-846.756] (-848.756) (-842.681) (-846.494) -- 0:01:44
590000 -- (-851.234) (-837.605) [-845.003] (-851.132) * (-840.960) (-849.871) [-842.741] (-843.094) -- 0:01:44
Average standard deviation of split frequencies: 0.004571
591000 -- (-855.360) (-848.276) [-839.349] (-844.440) * (-849.631) (-847.441) [-845.774] (-843.147) -- 0:01:44
592000 -- (-843.353) [-839.657] (-841.780) (-844.055) * (-846.009) [-847.515] (-843.439) (-847.431) -- 0:01:44
593000 -- (-848.027) [-838.809] (-848.305) (-846.199) * (-841.949) (-843.732) [-846.391] (-842.470) -- 0:01:43
594000 -- (-851.611) (-842.195) (-841.378) [-841.145] * (-841.785) [-839.042] (-844.843) (-842.826) -- 0:01:43
595000 -- (-850.646) (-846.323) (-845.007) [-842.609] * (-844.219) (-853.299) [-843.188] (-842.032) -- 0:01:43
Average standard deviation of split frequencies: 0.004314
596000 -- (-852.364) [-843.555] (-846.300) (-843.514) * (-851.449) (-841.223) (-843.972) [-844.980] -- 0:01:43
597000 -- (-843.780) [-843.366] (-847.216) (-855.317) * (-848.965) (-845.538) (-851.826) [-845.421] -- 0:01:42
598000 -- (-847.042) (-843.437) (-841.935) [-844.539] * [-840.913] (-846.173) (-845.370) (-846.874) -- 0:01:42
599000 -- (-851.471) (-841.609) (-850.423) [-840.635] * (-844.480) (-843.014) (-846.005) [-842.546] -- 0:01:42
600000 -- (-852.043) [-837.442] (-846.575) (-854.758) * (-839.213) (-852.535) [-838.608] (-845.038) -- 0:01:42
Average standard deviation of split frequencies: 0.004923
601000 -- (-845.003) (-853.083) (-838.355) [-842.032] * [-845.675] (-843.026) (-840.263) (-850.223) -- 0:01:41
602000 -- (-846.375) (-842.222) [-848.654] (-840.364) * (-843.735) (-850.659) (-850.408) [-843.088] -- 0:01:41
603000 -- (-840.405) (-840.655) [-841.815] (-852.950) * (-842.769) (-844.103) [-846.859] (-844.889) -- 0:01:41
604000 -- [-842.001] (-842.471) (-846.797) (-847.270) * [-853.501] (-845.190) (-847.777) (-849.688) -- 0:01:40
605000 -- [-846.780] (-843.713) (-841.300) (-843.240) * [-848.632] (-844.775) (-842.921) (-850.425) -- 0:01:40
Average standard deviation of split frequencies: 0.005375
606000 -- (-856.074) (-843.016) [-849.645] (-846.668) * [-850.967] (-847.044) (-849.351) (-849.662) -- 0:01:40
607000 -- (-846.747) (-847.483) (-842.161) [-840.331] * [-851.669] (-853.841) (-846.741) (-851.796) -- 0:01:40
608000 -- (-847.335) [-845.878] (-845.575) (-842.500) * (-843.327) (-843.853) [-846.648] (-856.461) -- 0:01:39
609000 -- (-852.770) (-839.444) (-848.864) [-840.400] * (-846.891) (-848.440) (-851.501) [-842.914] -- 0:01:39
610000 -- (-846.295) [-841.393] (-842.769) (-845.636) * (-845.786) (-853.327) [-839.486] (-850.813) -- 0:01:39
Average standard deviation of split frequencies: 0.005404
611000 -- [-849.267] (-847.469) (-842.565) (-846.625) * [-841.759] (-848.281) (-846.172) (-837.725) -- 0:01:39
612000 -- (-854.129) (-843.851) (-853.100) [-841.348] * [-845.865] (-843.818) (-845.398) (-844.903) -- 0:01:38
613000 -- (-848.275) (-842.824) (-854.260) [-838.979] * (-844.436) [-844.110] (-843.325) (-841.694) -- 0:01:38
614000 -- (-841.237) (-853.848) (-839.064) [-843.086] * (-846.063) [-843.160] (-841.340) (-848.017) -- 0:01:38
615000 -- [-841.312] (-848.731) (-841.260) (-842.880) * (-854.196) [-840.938] (-850.810) (-846.881) -- 0:01:38
Average standard deviation of split frequencies: 0.005496
616000 -- (-848.021) [-840.709] (-841.677) (-842.480) * (-847.456) (-845.178) [-835.293] (-837.781) -- 0:01:37
617000 -- (-837.820) (-849.057) (-846.267) [-855.006] * (-840.305) (-851.351) (-838.649) [-838.760] -- 0:01:37
618000 -- (-842.212) (-841.965) [-841.220] (-838.660) * (-850.429) [-839.399] (-848.893) (-847.796) -- 0:01:37
619000 -- [-838.366] (-855.601) (-846.476) (-846.898) * (-847.609) (-842.830) (-850.772) [-846.494] -- 0:01:37
620000 -- [-847.457] (-851.222) (-853.622) (-838.024) * [-841.402] (-846.679) (-848.749) (-844.200) -- 0:01:36
Average standard deviation of split frequencies: 0.005317
621000 -- [-848.643] (-845.041) (-840.774) (-842.769) * (-851.995) (-834.560) (-843.681) [-846.656] -- 0:01:36
622000 -- (-842.191) [-848.939] (-842.295) (-841.621) * (-853.027) [-844.945] (-846.908) (-850.567) -- 0:01:36
623000 -- (-842.764) (-849.039) (-847.287) [-843.982] * [-845.304] (-842.602) (-848.529) (-848.107) -- 0:01:36
624000 -- (-844.222) [-844.285] (-848.296) (-844.350) * (-842.645) [-838.015] (-842.491) (-848.793) -- 0:01:35
625000 -- (-848.068) (-844.009) (-846.524) [-847.881] * [-846.085] (-839.848) (-841.147) (-850.533) -- 0:01:35
Average standard deviation of split frequencies: 0.005066
626000 -- (-839.498) (-846.769) (-842.109) [-838.185] * (-842.283) [-842.254] (-844.594) (-841.010) -- 0:01:34
627000 -- (-841.462) [-850.962] (-844.738) (-851.897) * (-850.304) (-847.747) [-841.198] (-849.075) -- 0:01:35
628000 -- (-845.012) (-840.833) [-836.954] (-841.496) * [-851.881] (-851.200) (-845.530) (-853.297) -- 0:01:34
629000 -- (-848.215) (-840.353) (-841.641) [-839.506] * (-845.334) [-840.342] (-839.272) (-841.926) -- 0:01:34
630000 -- [-850.905] (-848.695) (-838.268) (-844.439) * (-843.211) (-845.848) (-841.428) [-850.135] -- 0:01:34
Average standard deviation of split frequencies: 0.005164
631000 -- (-848.347) (-853.425) (-843.346) [-840.869] * [-842.809] (-839.716) (-838.261) (-843.918) -- 0:01:34
632000 -- (-853.712) [-848.307] (-845.943) (-843.705) * [-855.219] (-850.799) (-840.881) (-848.707) -- 0:01:33
633000 -- (-841.840) [-845.239] (-839.384) (-841.003) * (-845.709) (-843.772) (-842.930) [-842.723] -- 0:01:33
634000 -- [-844.388] (-843.812) (-854.628) (-854.722) * (-843.124) (-850.310) (-838.570) [-843.150] -- 0:01:33
635000 -- (-847.532) (-850.658) [-845.938] (-843.146) * [-844.892] (-848.442) (-839.559) (-847.524) -- 0:01:33
Average standard deviation of split frequencies: 0.004986
636000 -- [-845.341] (-849.439) (-846.415) (-844.259) * [-836.501] (-855.481) (-844.170) (-845.106) -- 0:01:32
637000 -- [-841.029] (-843.006) (-843.473) (-849.386) * (-851.565) (-837.849) (-851.918) [-843.315] -- 0:01:32
638000 -- [-839.403] (-839.070) (-849.168) (-844.406) * (-845.747) (-849.571) [-840.482] (-842.855) -- 0:01:32
639000 -- (-849.115) [-838.554] (-844.665) (-848.097) * (-842.311) [-840.304] (-845.552) (-854.039) -- 0:01:32
640000 -- [-839.797] (-842.520) (-851.356) (-843.173) * (-855.448) (-840.957) [-844.390] (-849.201) -- 0:01:31
Average standard deviation of split frequencies: 0.005552
641000 -- (-847.563) (-839.993) [-840.182] (-853.584) * (-843.486) (-843.523) [-844.263] (-845.829) -- 0:01:31
642000 -- [-851.147] (-853.901) (-851.478) (-841.744) * (-846.398) [-842.346] (-848.483) (-853.644) -- 0:01:31
643000 -- (-848.236) [-842.974] (-848.990) (-850.031) * (-846.276) (-839.646) (-851.318) [-841.569] -- 0:01:31
644000 -- (-847.337) [-842.240] (-847.257) (-845.980) * (-847.376) [-845.066] (-848.027) (-846.642) -- 0:01:30
645000 -- (-848.166) [-843.078] (-850.388) (-842.215) * [-841.574] (-850.286) (-849.726) (-850.407) -- 0:01:30
Average standard deviation of split frequencies: 0.005042
646000 -- (-843.475) (-838.597) (-854.856) [-839.026] * [-837.594] (-847.079) (-847.305) (-843.112) -- 0:01:30
647000 -- (-854.639) (-842.202) (-841.643) [-843.271] * (-845.564) (-838.157) (-848.024) [-841.246] -- 0:01:30
648000 -- [-842.658] (-846.534) (-848.497) (-841.815) * [-837.176] (-843.719) (-848.330) (-840.810) -- 0:01:29
649000 -- (-847.430) (-844.978) (-847.286) [-840.175] * (-846.288) (-842.327) (-843.508) [-842.520] -- 0:01:29
650000 -- (-841.356) (-840.835) (-845.667) [-839.294] * [-842.123] (-851.944) (-843.335) (-842.169) -- 0:01:29
Average standard deviation of split frequencies: 0.005203
651000 -- (-851.627) [-840.687] (-845.363) (-845.318) * (-849.013) (-839.140) [-840.281] (-855.658) -- 0:01:28
652000 -- (-845.392) (-846.224) (-843.073) [-843.100] * [-847.599] (-848.493) (-847.727) (-839.512) -- 0:01:28
653000 -- [-841.078] (-850.945) (-845.755) (-850.896) * [-839.915] (-844.325) (-840.387) (-844.395) -- 0:01:28
654000 -- (-843.553) (-848.278) (-850.511) [-836.184] * [-849.100] (-846.294) (-844.848) (-843.546) -- 0:01:28
655000 -- (-849.062) (-852.315) (-857.897) [-841.144] * [-846.972] (-849.343) (-845.994) (-840.737) -- 0:01:27
Average standard deviation of split frequencies: 0.005226
656000 -- (-850.651) [-840.045] (-847.118) (-838.609) * [-846.959] (-849.501) (-840.496) (-839.742) -- 0:01:27
657000 -- [-847.336] (-848.101) (-859.096) (-842.936) * [-839.775] (-849.798) (-840.770) (-841.450) -- 0:01:27
658000 -- (-836.877) (-845.534) [-839.190] (-840.792) * (-846.446) (-848.991) (-844.974) [-840.219] -- 0:01:27
659000 -- (-846.220) (-847.962) [-841.591] (-847.584) * (-843.530) (-846.040) [-840.188] (-855.274) -- 0:01:26
660000 -- (-851.732) [-841.464] (-845.742) (-847.153) * (-848.868) (-847.514) [-841.022] (-839.510) -- 0:01:26
Average standard deviation of split frequencies: 0.004541
661000 -- (-844.758) (-845.688) (-856.283) [-841.701] * [-838.021] (-842.033) (-850.471) (-843.169) -- 0:01:26
662000 -- (-847.653) [-846.036] (-852.717) (-842.813) * (-843.032) [-842.258] (-845.152) (-852.747) -- 0:01:26
663000 -- (-844.926) [-849.262] (-849.391) (-844.188) * (-845.180) (-846.380) [-839.666] (-850.945) -- 0:01:25
664000 -- [-837.186] (-841.648) (-843.496) (-849.376) * (-848.693) (-844.047) [-849.833] (-851.028) -- 0:01:25
665000 -- (-841.343) (-849.841) (-844.512) [-843.373] * [-838.302] (-847.817) (-842.879) (-843.872) -- 0:01:25
Average standard deviation of split frequencies: 0.005405
666000 -- (-841.278) [-845.463] (-844.242) (-851.603) * [-842.920] (-844.976) (-836.414) (-847.884) -- 0:01:25
667000 -- (-858.422) (-840.196) [-842.582] (-845.320) * (-848.357) (-844.488) [-848.889] (-849.242) -- 0:01:24
668000 -- (-843.906) (-845.945) [-852.863] (-843.327) * (-855.320) (-844.057) (-850.894) [-849.687] -- 0:01:24
669000 -- [-849.667] (-851.852) (-847.778) (-841.124) * (-844.245) (-851.145) [-848.160] (-849.598) -- 0:01:24
670000 -- (-847.217) (-848.987) (-847.492) [-843.964] * (-840.909) [-846.060] (-846.602) (-842.308) -- 0:01:24
Average standard deviation of split frequencies: 0.005559
671000 -- (-852.290) (-850.103) (-849.992) [-848.315] * [-841.216] (-840.055) (-844.409) (-846.901) -- 0:01:23
672000 -- (-844.802) (-844.872) [-843.451] (-847.651) * [-844.354] (-843.176) (-852.247) (-842.673) -- 0:01:23
673000 -- [-843.641] (-851.993) (-850.126) (-845.297) * [-846.281] (-842.144) (-839.386) (-849.749) -- 0:01:23
674000 -- (-839.984) (-847.966) [-843.587] (-847.733) * (-854.196) [-837.034] (-837.185) (-851.163) -- 0:01:23
675000 -- (-844.520) [-850.498] (-847.646) (-845.730) * (-850.781) [-843.722] (-846.556) (-845.633) -- 0:01:22
Average standard deviation of split frequencies: 0.006149
676000 -- (-844.939) (-846.995) (-847.078) [-850.855] * (-855.223) (-846.857) (-846.438) [-841.942] -- 0:01:22
677000 -- (-847.155) [-849.779] (-839.921) (-849.024) * (-847.283) (-844.097) [-843.239] (-854.377) -- 0:01:22
678000 -- (-845.268) (-839.391) [-843.549] (-853.433) * (-849.534) [-849.305] (-842.660) (-843.870) -- 0:01:22
679000 -- (-849.852) (-855.259) (-841.230) [-845.581] * (-850.246) (-854.116) [-847.426] (-851.629) -- 0:01:21
680000 -- (-854.174) (-842.953) [-841.219] (-848.304) * (-842.469) (-850.622) [-837.897] (-848.819) -- 0:01:21
Average standard deviation of split frequencies: 0.006107
681000 -- [-848.712] (-843.322) (-840.687) (-841.940) * [-843.367] (-851.042) (-849.162) (-852.162) -- 0:01:21
682000 -- [-843.917] (-849.931) (-845.198) (-846.550) * (-843.787) (-853.938) (-841.660) [-845.041] -- 0:01:21
683000 -- (-853.920) (-843.546) (-849.425) [-843.205] * (-844.154) [-839.095] (-846.332) (-845.275) -- 0:01:20
684000 -- (-852.940) [-843.625] (-842.936) (-841.208) * (-841.176) (-846.529) [-848.668] (-847.145) -- 0:01:20
685000 -- (-848.417) [-849.000] (-847.082) (-852.987) * (-838.902) [-838.022] (-847.121) (-847.219) -- 0:01:20
Average standard deviation of split frequencies: 0.006185
686000 -- (-842.693) (-846.993) [-843.170] (-855.614) * (-847.258) (-851.182) (-840.590) [-846.472] -- 0:01:20
687000 -- [-847.025] (-841.798) (-847.014) (-842.696) * (-845.098) (-855.394) [-841.105] (-851.736) -- 0:01:19
688000 -- (-851.029) (-840.489) (-841.702) [-849.519] * (-842.573) [-850.203] (-844.548) (-852.080) -- 0:01:19
689000 -- (-843.925) (-845.543) [-838.511] (-839.427) * (-847.788) (-850.204) (-842.258) [-840.880] -- 0:01:19
690000 -- (-846.391) (-847.562) (-846.711) [-840.283] * [-846.113] (-847.907) (-843.855) (-846.459) -- 0:01:19
Average standard deviation of split frequencies: 0.006391
691000 -- [-839.895] (-851.831) (-847.417) (-860.475) * [-841.503] (-846.868) (-843.496) (-840.069) -- 0:01:18
692000 -- (-839.743) [-841.509] (-843.613) (-839.870) * [-835.596] (-844.830) (-842.414) (-847.520) -- 0:01:18
693000 -- (-843.408) [-843.585] (-843.318) (-845.926) * (-846.675) (-845.175) (-842.186) [-842.486] -- 0:01:18
694000 -- (-851.909) [-836.514] (-843.233) (-847.829) * [-846.572] (-837.685) (-842.725) (-837.588) -- 0:01:18
695000 -- [-838.603] (-842.064) (-850.880) (-849.186) * [-841.794] (-846.986) (-845.221) (-841.775) -- 0:01:17
Average standard deviation of split frequencies: 0.006650
696000 -- [-849.713] (-843.365) (-846.243) (-853.525) * (-840.508) (-851.323) [-842.422] (-840.547) -- 0:01:17
697000 -- (-843.570) (-847.867) (-846.352) [-847.844] * (-847.320) [-840.950] (-844.005) (-842.704) -- 0:01:17
698000 -- (-842.015) (-839.774) [-842.154] (-847.008) * [-844.405] (-841.316) (-844.926) (-841.005) -- 0:01:17
699000 -- (-850.865) (-846.157) (-840.771) [-845.842] * [-842.439] (-846.358) (-851.434) (-843.654) -- 0:01:16
700000 -- [-846.667] (-848.672) (-860.835) (-843.188) * (-841.733) (-844.075) [-840.994] (-849.519) -- 0:01:16
Average standard deviation of split frequencies: 0.006667
701000 -- (-844.658) (-851.195) (-841.170) [-837.049] * (-843.814) (-847.330) [-847.549] (-845.219) -- 0:01:16
702000 -- (-850.584) (-852.652) (-855.924) [-842.288] * (-849.267) (-847.454) (-845.794) [-842.904] -- 0:01:15
703000 -- (-847.098) (-846.321) (-844.912) [-843.071] * [-844.434] (-838.176) (-842.915) (-843.698) -- 0:01:15
704000 -- (-845.448) [-843.813] (-843.786) (-846.212) * (-851.659) (-839.950) (-853.721) [-842.942] -- 0:01:15
705000 -- [-847.763] (-849.670) (-855.126) (-840.509) * [-842.904] (-838.785) (-841.263) (-851.556) -- 0:01:15
Average standard deviation of split frequencies: 0.006981
706000 -- (-848.877) [-840.456] (-841.696) (-843.200) * (-846.459) (-844.410) (-847.021) [-837.766] -- 0:01:14
707000 -- (-853.181) [-844.730] (-847.944) (-846.379) * (-844.152) (-842.320) [-850.678] (-843.356) -- 0:01:14
708000 -- [-843.958] (-846.422) (-841.715) (-847.377) * (-846.684) (-843.889) [-845.420] (-848.347) -- 0:01:14
709000 -- (-844.112) [-847.620] (-845.161) (-839.296) * (-849.427) (-851.470) [-843.662] (-846.680) -- 0:01:14
710000 -- (-844.616) [-843.957] (-848.081) (-848.199) * (-847.281) (-853.223) [-840.294] (-844.050) -- 0:01:13
Average standard deviation of split frequencies: 0.007116
711000 -- (-852.205) (-855.344) [-847.782] (-849.592) * (-838.820) (-847.817) [-842.525] (-842.045) -- 0:01:13
712000 -- (-850.698) (-851.423) (-839.829) [-842.666] * (-845.394) [-849.392] (-847.709) (-842.272) -- 0:01:13
713000 -- (-858.599) (-840.863) (-856.190) [-840.466] * [-840.593] (-845.941) (-845.801) (-844.380) -- 0:01:13
714000 -- (-852.735) (-842.306) (-848.240) [-847.723] * [-844.540] (-850.729) (-853.723) (-844.394) -- 0:01:12
715000 -- (-854.646) (-840.550) [-842.089] (-846.957) * (-845.887) (-850.609) (-851.305) [-843.958] -- 0:01:12
Average standard deviation of split frequencies: 0.006763
716000 -- [-840.746] (-841.934) (-856.428) (-844.192) * (-846.381) (-849.101) (-841.263) [-843.377] -- 0:01:12
717000 -- [-840.158] (-844.345) (-842.566) (-859.627) * (-841.966) (-838.461) [-844.473] (-836.746) -- 0:01:12
718000 -- (-847.881) (-852.048) (-843.011) [-837.413] * (-852.129) (-847.636) [-838.079] (-841.442) -- 0:01:11
719000 -- (-844.385) [-845.642] (-850.419) (-842.357) * (-845.431) (-849.174) (-841.867) [-840.166] -- 0:01:11
720000 -- (-847.794) (-845.896) [-836.706] (-855.440) * (-842.078) (-841.539) (-841.537) [-845.105] -- 0:01:11
Average standard deviation of split frequencies: 0.006660
721000 -- [-838.222] (-845.090) (-852.908) (-856.733) * (-849.881) [-843.129] (-842.091) (-849.151) -- 0:01:11
722000 -- (-845.876) (-841.029) [-838.101] (-844.740) * (-841.995) (-837.882) (-863.069) [-841.069] -- 0:01:10
723000 -- (-837.621) (-851.772) (-842.254) [-840.827] * (-853.327) [-845.947] (-849.175) (-850.188) -- 0:01:10
724000 -- (-859.127) (-848.278) [-845.169] (-845.399) * (-853.252) (-848.879) (-841.853) [-848.051] -- 0:01:10
725000 -- (-846.094) (-839.502) (-845.896) [-846.197] * (-847.194) [-850.576] (-852.364) (-847.629) -- 0:01:10
Average standard deviation of split frequencies: 0.007379
726000 -- (-851.133) (-844.266) (-851.718) [-845.564] * (-849.850) (-849.399) (-842.482) [-842.590] -- 0:01:09
727000 -- (-849.790) (-847.019) [-842.618] (-840.027) * (-847.222) (-850.434) [-840.953] (-845.186) -- 0:01:09
728000 -- [-846.455] (-851.836) (-843.913) (-837.947) * (-851.073) (-841.750) [-846.400] (-845.977) -- 0:01:09
729000 -- (-854.543) (-847.959) (-841.977) [-845.071] * [-844.290] (-847.909) (-843.470) (-846.318) -- 0:01:09
730000 -- (-847.632) (-839.801) [-836.756] (-844.215) * (-840.584) (-845.568) [-852.837] (-844.525) -- 0:01:08
Average standard deviation of split frequencies: 0.006804
731000 -- (-840.602) (-844.101) [-840.727] (-854.529) * (-846.531) [-847.882] (-845.526) (-841.585) -- 0:01:08
732000 -- (-836.631) [-849.408] (-843.319) (-856.831) * (-852.095) (-846.995) [-841.993] (-848.765) -- 0:01:08
733000 -- (-836.005) (-843.385) [-845.080] (-849.041) * (-845.300) [-845.995] (-851.952) (-840.580) -- 0:01:08
734000 -- (-846.406) (-839.115) (-843.143) [-839.164] * (-861.337) (-850.642) (-845.334) [-845.626] -- 0:01:07
735000 -- (-849.464) (-853.994) [-847.139] (-840.802) * (-853.786) (-848.321) (-843.685) [-844.166] -- 0:01:07
Average standard deviation of split frequencies: 0.006754
736000 -- (-846.425) (-855.371) [-846.275] (-845.892) * [-837.211] (-848.451) (-848.644) (-848.771) -- 0:01:07
737000 -- [-839.928] (-841.634) (-841.705) (-847.564) * (-844.723) (-845.346) [-842.469] (-855.336) -- 0:01:07
738000 -- (-843.640) (-851.510) (-839.685) [-836.577] * [-838.495] (-850.654) (-856.013) (-848.144) -- 0:01:06
739000 -- (-842.420) (-851.300) [-845.767] (-847.200) * (-854.844) [-838.286] (-848.350) (-855.067) -- 0:01:06
740000 -- [-839.610] (-851.831) (-850.074) (-840.636) * (-842.079) (-838.997) (-851.586) [-842.628] -- 0:01:06
Average standard deviation of split frequencies: 0.006365
741000 -- (-847.237) (-847.917) [-848.074] (-841.298) * (-848.381) (-843.318) [-846.391] (-844.245) -- 0:01:06
742000 -- (-846.878) (-845.335) [-847.233] (-845.696) * [-846.275] (-841.059) (-853.129) (-852.883) -- 0:01:05
743000 -- (-849.466) (-838.347) (-844.592) [-848.433] * (-850.723) [-843.531] (-846.100) (-848.494) -- 0:01:05
744000 -- (-845.164) [-839.581] (-839.959) (-840.759) * (-844.491) (-851.532) (-841.907) [-843.815] -- 0:01:05
745000 -- (-840.884) (-858.012) (-839.585) [-839.577] * (-842.593) (-841.493) (-846.825) [-842.037] -- 0:01:05
Average standard deviation of split frequencies: 0.007813
746000 -- (-843.599) (-843.901) [-842.982] (-841.321) * [-845.701] (-842.632) (-846.725) (-849.532) -- 0:01:04
747000 -- (-839.451) [-847.868] (-838.740) (-849.046) * [-846.330] (-840.011) (-851.050) (-844.760) -- 0:01:04
748000 -- (-844.827) (-848.263) (-839.801) [-840.602] * (-860.269) (-837.983) [-843.139] (-850.422) -- 0:01:04
749000 -- (-841.902) [-846.191] (-844.788) (-843.999) * (-841.207) [-845.937] (-845.792) (-843.132) -- 0:01:04
750000 -- (-841.537) (-844.132) (-838.733) [-848.000] * (-844.387) [-833.836] (-856.373) (-853.157) -- 0:01:03
Average standard deviation of split frequencies: 0.007650
751000 -- (-842.829) (-845.777) [-847.910] (-842.492) * (-846.044) [-841.059] (-849.089) (-845.400) -- 0:01:03
752000 -- (-852.123) (-846.007) (-842.502) [-839.989] * (-839.049) (-842.357) [-844.601] (-844.722) -- 0:01:02
753000 -- [-837.730] (-847.502) (-851.305) (-839.842) * (-852.909) [-844.577] (-849.241) (-844.051) -- 0:01:02
754000 -- (-843.561) (-846.291) [-842.972] (-846.834) * (-844.821) (-844.005) [-839.430] (-842.192) -- 0:01:02
755000 -- [-841.116] (-846.833) (-845.837) (-845.640) * [-844.734] (-852.787) (-844.535) (-842.358) -- 0:01:02
Average standard deviation of split frequencies: 0.007653
756000 -- [-839.382] (-843.017) (-842.122) (-847.277) * (-842.535) [-844.105] (-844.378) (-844.243) -- 0:01:01
757000 -- (-844.372) (-844.919) [-847.334] (-853.448) * [-841.392] (-840.958) (-841.356) (-841.262) -- 0:01:01
758000 -- (-847.111) [-840.949] (-839.609) (-846.715) * (-838.818) (-847.718) [-838.084] (-852.492) -- 0:01:01
759000 -- (-847.987) (-845.735) [-848.482] (-849.287) * (-848.858) (-839.148) (-850.323) [-839.211] -- 0:01:01
760000 -- (-845.567) (-842.680) (-843.747) [-836.336] * (-850.512) (-853.561) (-847.396) [-841.281] -- 0:01:00
Average standard deviation of split frequencies: 0.008338
761000 -- (-847.476) [-847.762] (-850.106) (-847.362) * (-845.978) (-846.979) [-851.889] (-852.663) -- 0:01:00
762000 -- (-845.668) (-849.109) (-841.133) [-842.587] * [-842.809] (-845.603) (-836.925) (-838.891) -- 0:01:00
763000 -- (-842.395) (-848.203) [-838.742] (-851.627) * [-846.087] (-853.088) (-853.662) (-847.836) -- 0:01:00
764000 -- [-842.309] (-840.437) (-846.672) (-851.406) * [-843.085] (-850.402) (-848.954) (-848.165) -- 0:00:59
765000 -- (-847.845) [-842.797] (-845.741) (-846.505) * [-841.050] (-845.684) (-846.786) (-842.345) -- 0:00:59
Average standard deviation of split frequencies: 0.007609
766000 -- (-841.032) (-850.716) [-842.931] (-843.098) * (-849.203) (-848.984) (-852.818) [-842.139] -- 0:00:59
767000 -- (-847.748) (-847.263) [-838.371] (-840.643) * (-851.620) [-841.132] (-839.729) (-847.956) -- 0:00:59
768000 -- (-843.376) [-839.717] (-845.405) (-842.914) * (-850.953) [-843.014] (-844.670) (-837.824) -- 0:00:58
769000 -- [-839.608] (-842.677) (-836.880) (-848.135) * [-840.134] (-844.821) (-843.144) (-846.224) -- 0:00:58
770000 -- (-848.045) (-842.504) (-845.273) [-840.954] * [-848.499] (-843.174) (-842.839) (-847.737) -- 0:00:58
Average standard deviation of split frequencies: 0.007618
771000 -- (-846.599) (-851.625) [-846.954] (-845.821) * (-838.928) [-854.445] (-852.575) (-846.377) -- 0:00:58
772000 -- (-843.793) (-844.023) [-842.871] (-847.971) * (-842.876) (-842.962) [-843.891] (-844.453) -- 0:00:57
773000 -- (-842.050) (-846.431) (-848.192) [-844.254] * (-843.378) (-849.420) (-840.062) [-850.985] -- 0:00:57
774000 -- (-847.130) [-845.696] (-844.786) (-840.719) * (-847.971) (-851.012) [-842.972] (-843.402) -- 0:00:57
775000 -- (-842.615) [-849.429] (-848.226) (-844.973) * [-845.132] (-844.261) (-840.884) (-839.108) -- 0:00:57
Average standard deviation of split frequencies: 0.008118
776000 -- (-844.299) (-845.244) (-842.818) [-845.636] * (-847.696) (-853.191) [-841.791] (-844.193) -- 0:00:56
777000 -- (-852.328) [-845.595] (-841.374) (-842.482) * [-836.940] (-854.444) (-841.167) (-845.935) -- 0:00:56
778000 -- (-854.029) (-842.151) (-845.979) [-836.759] * (-850.942) (-839.990) [-848.512] (-841.040) -- 0:00:56
779000 -- (-844.707) (-842.203) (-842.467) [-841.457] * (-840.010) (-840.608) [-846.330] (-843.456) -- 0:00:56
780000 -- (-845.221) [-844.495] (-844.585) (-850.719) * [-842.043] (-846.665) (-848.532) (-852.236) -- 0:00:55
Average standard deviation of split frequencies: 0.008015
781000 -- (-846.318) (-847.814) (-853.047) [-848.914] * (-845.163) (-851.834) [-845.672] (-847.766) -- 0:00:55
782000 -- (-844.889) (-837.219) [-848.484] (-850.332) * (-849.723) (-853.403) [-837.931] (-848.497) -- 0:00:55
783000 -- (-844.675) [-844.912] (-861.993) (-842.577) * (-847.258) (-846.063) [-840.208] (-851.697) -- 0:00:55
784000 -- (-839.952) [-840.156] (-846.184) (-840.582) * (-844.481) (-846.640) [-839.638] (-847.953) -- 0:00:54
785000 -- [-843.710] (-847.153) (-841.586) (-845.944) * [-841.095] (-845.558) (-840.954) (-848.427) -- 0:00:54
Average standard deviation of split frequencies: 0.008397
786000 -- (-843.683) (-843.916) [-841.595] (-844.655) * (-843.218) (-843.937) [-838.761] (-851.807) -- 0:00:54
787000 -- [-837.630] (-844.411) (-847.274) (-844.757) * (-850.267) (-844.150) [-844.186] (-847.097) -- 0:00:54
788000 -- [-839.453] (-842.821) (-851.365) (-843.423) * (-843.574) (-840.742) [-842.088] (-842.791) -- 0:00:53
789000 -- (-842.029) (-842.808) [-840.452] (-842.198) * (-845.437) (-848.714) [-843.291] (-843.684) -- 0:00:53
790000 -- [-848.031] (-845.842) (-847.597) (-839.052) * [-849.676] (-841.811) (-843.710) (-843.196) -- 0:00:53
Average standard deviation of split frequencies: 0.008184
791000 -- (-841.487) [-846.087] (-846.327) (-841.757) * (-848.635) (-850.368) (-843.390) [-842.515] -- 0:00:53
792000 -- (-844.531) [-845.029] (-847.076) (-843.782) * (-843.127) (-847.418) [-840.198] (-839.541) -- 0:00:53
793000 -- (-844.131) (-854.678) [-841.118] (-841.230) * [-840.527] (-845.704) (-843.455) (-848.725) -- 0:00:52
794000 -- [-838.952] (-855.382) (-842.974) (-843.166) * [-847.784] (-845.550) (-847.524) (-846.718) -- 0:00:52
795000 -- (-846.301) [-844.378] (-850.652) (-847.858) * (-848.104) [-846.625] (-846.921) (-849.503) -- 0:00:52
Average standard deviation of split frequencies: 0.008722
796000 -- (-847.214) [-842.667] (-848.111) (-861.699) * (-835.324) (-849.053) (-856.188) [-843.687] -- 0:00:52
797000 -- (-850.691) (-848.299) (-854.045) [-838.465] * (-855.994) (-841.893) [-844.382] (-843.370) -- 0:00:51
798000 -- (-848.984) [-841.609] (-843.645) (-845.174) * (-846.202) (-844.800) (-840.413) [-844.960] -- 0:00:51
799000 -- [-847.025] (-843.623) (-845.780) (-844.924) * [-838.195] (-843.233) (-847.459) (-850.007) -- 0:00:51
800000 -- (-847.325) (-840.850) (-851.341) [-851.556] * (-846.871) [-840.812] (-846.720) (-853.877) -- 0:00:50
Average standard deviation of split frequencies: 0.009046
801000 -- (-841.515) (-850.042) (-846.137) [-842.700] * (-841.184) (-850.705) [-841.023] (-860.802) -- 0:00:50
802000 -- (-847.776) (-844.053) [-844.327] (-847.085) * (-845.879) (-843.585) (-847.493) [-841.057] -- 0:00:50
803000 -- (-843.476) [-843.166] (-844.131) (-852.977) * (-841.370) (-840.228) [-845.519] (-847.642) -- 0:00:50
804000 -- (-842.327) (-843.661) (-840.356) [-839.732] * (-850.950) (-840.115) [-844.442] (-842.306) -- 0:00:49
805000 -- (-840.541) (-850.041) (-843.926) [-841.489] * (-842.807) (-847.036) (-840.762) [-843.690] -- 0:00:49
Average standard deviation of split frequencies: 0.009039
806000 -- (-841.531) (-848.752) [-842.452] (-846.285) * (-839.609) [-849.970] (-846.649) (-841.205) -- 0:00:49
807000 -- (-848.000) [-839.877] (-844.571) (-843.449) * (-842.639) [-842.819] (-851.429) (-852.410) -- 0:00:49
808000 -- (-845.328) [-838.850] (-847.263) (-840.456) * (-849.257) (-844.486) (-846.442) [-843.699] -- 0:00:48
809000 -- (-850.566) (-837.957) (-838.713) [-842.163] * (-848.954) (-845.626) [-838.960] (-846.520) -- 0:00:48
810000 -- (-848.025) (-843.556) [-838.505] (-843.907) * (-847.461) (-841.127) [-843.626] (-851.388) -- 0:00:48
Average standard deviation of split frequencies: 0.008987
811000 -- (-840.563) (-848.016) [-840.882] (-854.455) * (-846.130) [-843.670] (-850.125) (-841.621) -- 0:00:48
812000 -- [-842.197] (-848.248) (-846.305) (-841.407) * [-851.309] (-841.748) (-844.434) (-840.193) -- 0:00:47
813000 -- [-839.809] (-854.785) (-852.126) (-849.068) * (-842.178) [-844.517] (-848.051) (-850.945) -- 0:00:47
814000 -- (-848.309) (-847.949) (-846.150) [-841.419] * (-841.309) [-839.933] (-849.938) (-843.251) -- 0:00:47
815000 -- [-845.457] (-840.662) (-844.266) (-851.729) * (-842.114) (-842.116) (-844.126) [-852.936] -- 0:00:46
Average standard deviation of split frequencies: 0.008560
816000 -- [-837.165] (-846.331) (-849.811) (-840.423) * (-848.498) [-846.706] (-848.190) (-844.712) -- 0:00:46
817000 -- (-849.194) (-848.717) [-843.846] (-846.392) * (-838.283) [-841.005] (-843.123) (-855.312) -- 0:00:46
818000 -- [-846.410] (-851.118) (-845.669) (-844.147) * (-846.284) (-844.176) (-842.083) [-842.745] -- 0:00:46
819000 -- (-837.747) (-847.022) [-847.743] (-854.026) * (-841.803) (-852.532) (-848.194) [-841.858] -- 0:00:45
820000 -- (-843.720) (-847.600) [-840.126] (-853.544) * (-843.397) (-865.609) [-848.103] (-846.318) -- 0:00:45
Average standard deviation of split frequencies: 0.007990
821000 -- (-849.061) (-844.827) (-841.594) [-843.453] * (-838.503) (-845.844) [-847.742] (-853.498) -- 0:00:45
822000 -- [-849.046] (-842.843) (-843.559) (-847.624) * (-842.818) (-851.546) (-849.186) [-843.879] -- 0:00:45
823000 -- [-835.206] (-843.082) (-858.942) (-845.127) * (-861.590) (-846.526) [-840.416] (-838.668) -- 0:00:44
824000 -- (-843.151) (-844.280) [-842.232] (-843.327) * (-841.334) (-845.331) (-843.814) [-842.397] -- 0:00:44
825000 -- (-847.658) [-840.231] (-844.165) (-844.868) * (-844.157) (-844.711) [-838.813] (-845.214) -- 0:00:44
Average standard deviation of split frequencies: 0.007938
826000 -- (-847.875) [-838.298] (-848.878) (-842.723) * (-851.076) (-853.689) [-838.295] (-850.136) -- 0:00:44
827000 -- [-847.897] (-845.528) (-849.210) (-843.758) * (-844.833) [-838.575] (-844.112) (-851.619) -- 0:00:43
828000 -- (-840.536) (-840.731) (-842.762) [-842.370] * (-848.742) (-846.121) [-844.113] (-839.582) -- 0:00:43
829000 -- [-840.482] (-844.754) (-842.224) (-845.404) * [-850.043] (-840.176) (-840.768) (-852.242) -- 0:00:43
830000 -- (-846.331) [-844.273] (-839.158) (-839.294) * (-851.851) [-843.968] (-846.553) (-850.934) -- 0:00:43
Average standard deviation of split frequencies: 0.007945
831000 -- (-842.206) [-843.052] (-843.503) (-846.877) * (-849.388) (-842.187) (-853.644) [-853.001] -- 0:00:42
832000 -- [-850.177] (-848.079) (-847.400) (-848.268) * (-844.067) (-848.576) (-846.327) [-843.990] -- 0:00:42
833000 -- (-843.649) (-846.944) (-851.702) [-853.116] * (-842.766) (-842.192) [-841.218] (-850.669) -- 0:00:42
834000 -- (-842.867) (-849.029) [-844.430] (-848.900) * (-846.483) [-840.725] (-843.967) (-844.432) -- 0:00:42
835000 -- [-840.478] (-857.162) (-840.928) (-851.418) * (-847.104) (-851.580) (-845.788) [-841.620] -- 0:00:41
Average standard deviation of split frequencies: 0.007638
836000 -- (-849.069) (-845.619) [-840.217] (-857.281) * [-837.161] (-847.288) (-842.954) (-849.104) -- 0:00:41
837000 -- (-848.022) (-850.461) [-847.357] (-848.646) * (-847.189) (-849.274) (-841.392) [-844.547] -- 0:00:41
838000 -- (-849.533) (-849.228) (-838.880) [-841.762] * (-836.781) [-841.124] (-846.421) (-856.774) -- 0:00:41
839000 -- (-844.122) (-847.065) (-839.421) [-843.631] * [-853.930] (-841.527) (-844.079) (-847.654) -- 0:00:40
840000 -- (-844.658) [-837.446] (-846.162) (-843.061) * [-838.807] (-850.937) (-847.447) (-838.058) -- 0:00:40
Average standard deviation of split frequencies: 0.007647
841000 -- (-840.760) [-844.818] (-849.961) (-838.581) * (-845.140) (-846.871) [-842.482] (-843.523) -- 0:00:40
842000 -- (-849.596) (-847.282) (-849.805) [-842.414] * [-842.414] (-852.771) (-844.541) (-851.035) -- 0:00:40
843000 -- (-852.579) (-858.172) (-854.489) [-844.417] * (-855.097) [-846.461] (-842.598) (-853.810) -- 0:00:39
844000 -- (-847.723) [-846.265] (-859.669) (-845.841) * (-843.335) [-840.453] (-850.042) (-845.247) -- 0:00:39
845000 -- (-848.466) (-840.309) (-845.138) [-841.727] * (-839.779) [-843.681] (-847.632) (-843.726) -- 0:00:39
Average standard deviation of split frequencies: 0.007598
846000 -- [-843.341] (-853.114) (-847.192) (-847.493) * (-854.556) (-844.720) [-840.459] (-849.152) -- 0:00:39
847000 -- [-844.563] (-843.589) (-838.954) (-853.192) * (-846.713) (-849.601) (-847.252) [-848.213] -- 0:00:38
848000 -- [-841.908] (-845.599) (-866.613) (-852.812) * (-842.648) (-835.914) [-842.823] (-853.046) -- 0:00:38
849000 -- (-846.239) (-838.069) (-842.446) [-844.883] * (-848.218) [-840.534] (-844.019) (-843.659) -- 0:00:38
850000 -- (-863.111) [-834.631] (-843.265) (-838.829) * (-844.026) (-846.058) [-843.416] (-840.908) -- 0:00:38
Average standard deviation of split frequencies: 0.007305
851000 -- (-848.568) (-849.489) (-842.490) [-847.562] * (-841.933) (-841.284) (-848.573) [-841.043] -- 0:00:37
852000 -- (-841.725) [-852.181] (-846.605) (-845.092) * (-846.578) (-846.830) [-839.784] (-845.047) -- 0:00:37
853000 -- [-838.877] (-842.448) (-854.683) (-848.122) * (-843.605) (-850.036) [-839.151] (-839.058) -- 0:00:37
854000 -- (-848.852) [-843.480] (-840.640) (-845.656) * (-846.542) (-845.902) (-843.268) [-837.990] -- 0:00:37
855000 -- (-841.638) (-843.853) (-843.119) [-839.143] * [-845.930] (-841.809) (-843.506) (-848.045) -- 0:00:36
Average standard deviation of split frequencies: 0.007209
856000 -- (-852.151) [-844.760] (-844.419) (-848.652) * (-848.430) (-847.825) (-846.885) [-844.603] -- 0:00:36
857000 -- (-851.686) [-837.211] (-844.864) (-848.096) * (-841.582) (-851.561) [-842.828] (-846.443) -- 0:00:36
858000 -- (-854.385) (-841.273) (-848.158) [-840.290] * (-848.793) (-845.205) (-841.847) [-838.169] -- 0:00:36
859000 -- (-847.590) [-837.943] (-850.576) (-855.549) * (-848.657) (-838.491) [-843.163] (-850.969) -- 0:00:35
860000 -- [-840.180] (-834.899) (-842.308) (-848.548) * (-842.476) (-844.646) [-840.068] (-847.764) -- 0:00:35
Average standard deviation of split frequencies: 0.006921
861000 -- (-850.984) [-844.439] (-844.606) (-847.959) * [-845.201] (-848.578) (-854.921) (-844.962) -- 0:00:35
862000 -- [-849.886] (-847.358) (-842.409) (-847.944) * (-854.063) (-843.907) (-842.016) [-846.432] -- 0:00:35
863000 -- (-847.699) (-849.851) (-852.331) [-846.841] * [-852.444] (-846.589) (-842.598) (-842.473) -- 0:00:34
864000 -- (-844.499) (-839.059) [-840.725] (-844.526) * (-843.295) (-842.275) (-838.714) [-844.692] -- 0:00:34
865000 -- (-853.389) (-844.727) (-844.870) [-842.649] * (-847.509) [-836.426] (-846.388) (-842.725) -- 0:00:34
Average standard deviation of split frequencies: 0.006879
866000 -- (-845.356) [-841.494] (-841.885) (-843.272) * (-842.994) (-843.938) (-846.079) [-844.320] -- 0:00:34
867000 -- (-847.149) (-852.181) [-842.237] (-848.749) * (-842.883) (-847.864) (-846.849) [-848.799] -- 0:00:33
868000 -- [-838.034] (-854.946) (-854.214) (-844.559) * (-846.249) (-845.892) (-842.501) [-840.345] -- 0:00:33
869000 -- (-848.336) (-860.612) [-846.788] (-844.875) * (-848.447) [-846.246] (-851.748) (-842.785) -- 0:00:33
870000 -- (-839.987) (-852.869) (-839.083) [-846.845] * (-848.452) (-852.726) (-845.710) [-842.432] -- 0:00:33
Average standard deviation of split frequencies: 0.007039
871000 -- (-849.620) (-847.686) [-843.224] (-843.492) * (-850.953) (-838.888) [-843.380] (-852.671) -- 0:00:32
872000 -- (-842.903) (-858.201) (-839.854) [-852.986] * (-849.089) (-852.436) (-850.939) [-849.474] -- 0:00:32
873000 -- (-845.792) (-846.370) (-842.752) [-845.402] * (-851.918) (-843.362) [-845.174] (-846.438) -- 0:00:32
874000 -- (-850.310) (-842.018) (-851.564) [-841.097] * (-865.093) (-841.693) (-843.808) [-850.095] -- 0:00:32
875000 -- [-845.039] (-841.416) (-851.976) (-847.825) * (-847.207) (-840.959) (-852.990) [-847.836] -- 0:00:31
Average standard deviation of split frequencies: 0.007045
876000 -- (-844.516) [-840.447] (-848.318) (-849.269) * (-843.495) (-850.349) (-858.919) [-849.646] -- 0:00:31
877000 -- [-842.438] (-839.966) (-843.635) (-849.591) * [-838.979] (-838.890) (-845.053) (-850.162) -- 0:00:31
878000 -- [-840.891] (-848.513) (-843.337) (-849.587) * (-849.752) [-841.692] (-839.503) (-842.905) -- 0:00:30
879000 -- (-846.550) [-838.743] (-852.591) (-846.621) * (-848.155) (-846.369) [-839.371] (-849.194) -- 0:00:30
880000 -- (-839.497) (-847.979) (-840.051) [-843.929] * (-844.790) [-843.842] (-844.245) (-848.369) -- 0:00:30
Average standard deviation of split frequencies: 0.006861
881000 -- (-854.462) (-837.982) [-840.216] (-846.423) * [-841.547] (-845.126) (-852.544) (-842.963) -- 0:00:30
882000 -- (-847.967) (-851.594) [-842.145] (-843.921) * (-846.777) (-839.604) (-855.913) [-848.779] -- 0:00:29
883000 -- (-842.691) [-841.174] (-840.637) (-841.553) * (-841.993) [-839.000] (-846.468) (-851.362) -- 0:00:29
884000 -- (-848.701) (-844.992) (-842.573) [-846.360] * (-841.149) (-842.263) [-847.532] (-851.439) -- 0:00:29
885000 -- (-850.632) [-844.104] (-845.753) (-843.552) * (-847.769) (-840.610) [-843.568] (-840.852) -- 0:00:29
Average standard deviation of split frequencies: 0.006820
886000 -- (-843.440) [-843.948] (-842.954) (-844.977) * (-843.191) [-845.124] (-846.196) (-847.333) -- 0:00:28
887000 -- (-843.852) (-841.400) (-861.376) [-845.598] * (-853.118) (-842.440) [-843.643] (-848.994) -- 0:00:28
888000 -- (-841.683) (-853.589) [-841.411] (-851.526) * (-844.577) (-847.028) (-842.913) [-839.442] -- 0:00:28
889000 -- (-849.498) (-849.001) [-843.973] (-839.133) * (-843.579) [-840.212] (-845.461) (-846.022) -- 0:00:28
890000 -- (-849.502) (-846.166) [-841.905] (-849.806) * (-844.131) [-846.363] (-850.826) (-838.112) -- 0:00:27
Average standard deviation of split frequencies: 0.006544
891000 -- (-843.763) (-848.723) [-840.103] (-842.440) * (-847.493) (-845.105) [-842.519] (-836.487) -- 0:00:27
892000 -- (-850.017) (-841.687) [-848.870] (-845.080) * (-844.477) (-849.695) [-838.651] (-850.549) -- 0:00:27
893000 -- (-847.438) [-842.600] (-845.015) (-848.444) * [-838.442] (-847.818) (-845.441) (-841.502) -- 0:00:27
894000 -- (-839.421) (-849.580) [-837.910] (-840.502) * (-846.798) (-849.331) (-838.269) [-840.233] -- 0:00:26
895000 -- (-853.145) (-846.640) (-851.109) [-836.653] * (-839.291) (-841.740) [-842.416] (-850.497) -- 0:00:26
Average standard deviation of split frequencies: 0.006744
896000 -- (-850.175) (-841.666) (-849.428) [-841.421] * (-838.371) (-845.438) [-838.976] (-840.569) -- 0:00:26
897000 -- [-843.586] (-843.466) (-843.433) (-848.143) * (-848.949) (-840.751) [-838.731] (-840.234) -- 0:00:26
898000 -- (-842.080) [-836.143] (-845.783) (-844.555) * (-851.033) [-840.518] (-850.753) (-845.388) -- 0:00:25
899000 -- (-845.573) (-853.475) (-853.034) [-841.969] * (-845.713) (-850.525) (-841.581) [-844.371] -- 0:00:25
900000 -- [-848.177] (-846.713) (-848.729) (-843.184) * (-844.005) (-846.160) (-845.265) [-841.201] -- 0:00:25
Average standard deviation of split frequencies: 0.006614
901000 -- (-843.880) (-845.636) [-845.061] (-844.188) * (-847.382) [-840.870] (-844.860) (-843.546) -- 0:00:25
902000 -- (-838.785) (-844.604) (-844.655) [-843.441] * (-849.041) [-845.960] (-839.696) (-846.604) -- 0:00:24
903000 -- (-843.042) (-836.681) (-844.808) [-849.265] * [-845.797] (-845.506) (-851.229) (-845.095) -- 0:00:24
904000 -- (-839.472) (-856.041) (-844.089) [-841.344] * (-836.149) (-844.662) (-849.376) [-844.191] -- 0:00:24
905000 -- (-846.541) [-838.067] (-849.656) (-846.043) * [-836.964] (-843.605) (-842.149) (-840.996) -- 0:00:24
Average standard deviation of split frequencies: 0.007190
906000 -- (-846.039) [-845.686] (-849.271) (-839.476) * [-837.688] (-841.199) (-852.618) (-851.537) -- 0:00:23
907000 -- (-837.674) [-848.714] (-850.657) (-852.015) * (-847.307) [-847.607] (-858.378) (-841.666) -- 0:00:23
908000 -- (-840.184) [-847.625] (-850.171) (-843.374) * (-846.454) (-847.477) (-850.520) [-844.112] -- 0:00:23
909000 -- [-840.615] (-847.440) (-849.837) (-840.825) * [-837.254] (-842.311) (-852.325) (-843.715) -- 0:00:23
910000 -- (-843.993) (-843.805) [-846.662] (-843.093) * (-842.039) (-844.178) (-844.104) [-849.364] -- 0:00:22
Average standard deviation of split frequencies: 0.006965
911000 -- (-851.361) (-851.337) [-847.798] (-850.455) * [-846.743] (-842.574) (-841.869) (-841.053) -- 0:00:22
912000 -- (-846.107) (-850.927) [-850.012] (-841.555) * (-847.718) (-851.422) (-848.348) [-837.108] -- 0:00:22
913000 -- [-844.181] (-852.135) (-859.534) (-846.532) * (-847.251) [-849.346] (-844.332) (-844.733) -- 0:00:22
914000 -- [-842.404] (-843.840) (-847.707) (-845.572) * (-845.094) [-839.870] (-840.585) (-846.755) -- 0:00:21
915000 -- (-842.108) [-844.720] (-853.075) (-856.391) * (-839.082) (-849.525) [-843.163] (-853.320) -- 0:00:21
Average standard deviation of split frequencies: 0.007018
916000 -- (-845.202) [-850.022] (-842.800) (-846.074) * (-844.836) (-845.953) [-840.629] (-842.603) -- 0:00:21
917000 -- [-843.225] (-849.757) (-849.828) (-845.735) * (-845.240) (-849.776) [-842.080] (-845.491) -- 0:00:21
918000 -- (-852.895) (-852.298) [-841.409] (-848.892) * (-856.891) [-850.292] (-851.037) (-847.177) -- 0:00:20
919000 -- (-846.785) (-841.227) [-842.007] (-842.272) * (-846.937) [-842.712] (-840.511) (-847.306) -- 0:00:20
920000 -- (-844.236) (-844.239) [-844.374] (-853.153) * (-837.340) (-846.624) (-841.698) [-845.757] -- 0:00:20
Average standard deviation of split frequencies: 0.006843
921000 -- (-859.354) (-849.133) (-845.932) [-849.107] * (-841.085) [-845.340] (-848.220) (-842.290) -- 0:00:20
922000 -- (-850.421) (-841.375) (-840.450) [-838.389] * (-844.123) (-843.849) [-842.717] (-842.717) -- 0:00:19
923000 -- (-846.894) (-841.927) [-844.257] (-845.712) * [-844.639] (-846.062) (-840.027) (-853.765) -- 0:00:19
924000 -- (-850.300) (-840.142) (-842.451) [-845.207] * (-840.207) [-840.394] (-848.716) (-848.450) -- 0:00:19
925000 -- (-850.442) [-837.707] (-845.102) (-844.927) * (-844.270) (-851.571) [-841.137] (-855.554) -- 0:00:19
Average standard deviation of split frequencies: 0.006988
926000 -- (-840.844) [-851.333] (-844.759) (-847.601) * (-849.320) (-845.520) [-837.348] (-846.038) -- 0:00:18
927000 -- (-843.274) [-846.491] (-847.998) (-843.369) * [-842.211] (-854.012) (-847.829) (-840.275) -- 0:00:18
928000 -- [-844.956] (-847.392) (-847.697) (-843.348) * [-841.777] (-851.266) (-844.590) (-853.065) -- 0:00:18
929000 -- (-845.607) (-852.254) (-851.636) [-841.274] * (-845.121) [-844.517] (-842.437) (-849.583) -- 0:00:18
930000 -- (-847.842) [-846.823] (-847.316) (-843.417) * (-850.670) (-849.258) (-846.268) [-847.488] -- 0:00:17
Average standard deviation of split frequencies: 0.006631
931000 -- (-850.840) (-845.073) (-847.731) [-850.911] * [-841.634] (-839.296) (-853.915) (-847.810) -- 0:00:17
932000 -- [-843.041] (-861.023) (-843.756) (-839.384) * (-855.020) (-853.047) [-843.303] (-855.380) -- 0:00:17
933000 -- [-836.689] (-848.958) (-844.836) (-846.800) * (-850.427) [-845.384] (-837.946) (-859.524) -- 0:00:17
934000 -- (-844.075) (-842.498) (-843.596) [-846.362] * (-857.662) (-840.905) [-847.905] (-854.389) -- 0:00:16
935000 -- (-851.824) (-847.159) [-845.964] (-839.190) * (-840.996) [-847.382] (-859.981) (-843.497) -- 0:00:16
Average standard deviation of split frequencies: 0.006822
936000 -- (-844.987) [-841.669] (-855.037) (-845.061) * (-841.090) (-846.423) [-840.249] (-841.259) -- 0:00:16
937000 -- (-852.821) [-839.192] (-847.513) (-843.802) * (-839.504) [-838.524] (-840.579) (-856.953) -- 0:00:16
938000 -- (-844.810) (-844.901) [-844.113] (-848.843) * (-838.182) (-847.862) [-842.489] (-847.123) -- 0:00:15
939000 -- (-847.189) (-840.553) [-840.704] (-847.849) * (-845.575) (-861.967) (-847.531) [-842.306] -- 0:00:15
940000 -- (-847.655) (-848.652) [-850.386] (-844.751) * (-848.568) (-845.497) (-840.158) [-840.659] -- 0:00:15
Average standard deviation of split frequencies: 0.006743
941000 -- (-856.213) (-846.696) [-841.684] (-849.911) * [-840.997] (-842.257) (-853.401) (-848.091) -- 0:00:14
942000 -- (-848.796) [-848.094] (-846.738) (-846.415) * (-853.410) (-838.762) [-844.670] (-852.220) -- 0:00:14
943000 -- (-844.294) (-842.601) (-850.620) [-843.037] * (-847.879) [-848.526] (-847.912) (-847.419) -- 0:00:14
944000 -- (-851.129) [-837.385] (-847.609) (-837.418) * (-845.118) (-848.122) [-842.526] (-845.535) -- 0:00:14
945000 -- (-840.106) (-855.293) (-847.311) [-850.743] * (-851.496) [-839.910] (-854.353) (-837.158) -- 0:00:13
Average standard deviation of split frequencies: 0.006705
946000 -- (-847.743) (-845.161) [-837.946] (-842.999) * (-850.586) (-843.098) [-845.414] (-841.699) -- 0:00:13
947000 -- (-856.868) (-849.415) [-842.373] (-841.300) * [-842.118] (-846.420) (-843.378) (-839.322) -- 0:00:13
948000 -- [-849.581] (-844.819) (-845.720) (-842.552) * (-849.914) (-857.741) [-836.764] (-845.082) -- 0:00:13
949000 -- (-850.685) (-853.802) (-850.791) [-837.813] * [-844.210] (-846.464) (-846.457) (-841.971) -- 0:00:12
950000 -- (-851.944) (-840.868) (-843.947) [-841.977] * [-844.319] (-838.046) (-839.196) (-856.822) -- 0:00:12
Average standard deviation of split frequencies: 0.007032
951000 -- (-852.331) (-840.061) [-846.605] (-856.166) * (-846.365) (-848.162) [-839.037] (-844.639) -- 0:00:12
952000 -- (-848.003) [-850.182] (-847.830) (-857.057) * (-854.930) (-846.071) [-845.034] (-857.947) -- 0:00:12
953000 -- (-844.868) (-839.845) (-847.540) [-848.251] * (-844.281) (-851.169) [-846.532] (-841.916) -- 0:00:11
954000 -- (-838.048) (-844.613) (-847.283) [-839.809] * [-835.695] (-847.092) (-845.153) (-845.925) -- 0:00:11
955000 -- (-843.911) (-849.081) [-844.260] (-842.271) * [-840.404] (-851.127) (-841.297) (-848.774) -- 0:00:11
Average standard deviation of split frequencies: 0.006903
956000 -- [-850.186] (-838.102) (-861.788) (-844.872) * (-848.238) (-849.377) (-844.692) [-837.955] -- 0:00:11
957000 -- [-850.876] (-844.735) (-850.178) (-843.856) * (-849.258) [-844.849] (-844.689) (-851.430) -- 0:00:10
958000 -- (-848.783) (-840.174) (-842.560) [-841.197] * (-850.983) [-848.664] (-842.118) (-845.993) -- 0:00:10
959000 -- (-857.395) (-851.368) (-845.414) [-842.608] * [-841.548] (-850.711) (-846.430) (-843.059) -- 0:00:10
960000 -- (-846.268) (-854.569) [-841.350] (-842.676) * (-847.661) [-841.042] (-844.566) (-845.525) -- 0:00:10
Average standard deviation of split frequencies: 0.006245
961000 -- [-842.977] (-846.573) (-849.565) (-845.336) * (-854.740) (-843.105) [-842.663] (-843.527) -- 0:00:09
962000 -- [-839.776] (-840.677) (-847.316) (-848.283) * (-840.617) (-840.916) [-843.172] (-843.552) -- 0:00:09
963000 -- (-847.772) [-841.302] (-839.227) (-845.874) * (-844.041) (-842.952) [-846.161] (-840.554) -- 0:00:09
964000 -- (-842.572) [-844.829] (-849.393) (-858.061) * [-838.498] (-840.353) (-838.198) (-851.616) -- 0:00:09
965000 -- (-842.143) (-848.944) [-839.010] (-841.777) * (-841.418) (-842.827) [-840.354] (-849.282) -- 0:00:08
Average standard deviation of split frequencies: 0.006610
966000 -- [-840.929] (-849.947) (-844.494) (-844.715) * (-844.383) (-845.522) (-843.223) [-848.854] -- 0:00:08
967000 -- [-849.751] (-839.416) (-846.874) (-844.700) * (-842.340) (-840.625) [-841.793] (-850.241) -- 0:00:08
968000 -- (-856.822) (-840.313) (-838.326) [-840.093] * (-855.736) [-843.192] (-838.926) (-845.459) -- 0:00:08
969000 -- (-849.296) (-848.644) [-840.350] (-838.260) * (-853.875) (-859.125) [-843.732] (-838.445) -- 0:00:07
970000 -- (-837.774) [-842.349] (-843.149) (-841.497) * [-839.601] (-846.933) (-849.495) (-845.153) -- 0:00:07
Average standard deviation of split frequencies: 0.006269
971000 -- (-850.829) (-847.104) [-843.664] (-847.381) * (-844.911) [-847.820] (-838.781) (-844.780) -- 0:00:07
972000 -- (-850.723) (-847.262) (-848.757) [-841.102] * (-841.980) (-846.113) (-836.867) [-837.676] -- 0:00:07
973000 -- [-844.115] (-844.847) (-842.071) (-846.707) * [-840.247] (-842.040) (-850.041) (-850.738) -- 0:00:06
974000 -- [-838.684] (-844.792) (-847.198) (-844.161) * (-843.206) (-840.603) (-846.699) [-838.707] -- 0:00:06
975000 -- (-841.517) (-850.310) (-849.607) [-840.781] * (-848.096) [-840.544] (-849.881) (-852.280) -- 0:00:06
Average standard deviation of split frequencies: 0.006586
976000 -- [-847.468] (-846.828) (-852.357) (-841.241) * [-842.082] (-851.079) (-842.442) (-843.850) -- 0:00:06
977000 -- [-848.061] (-849.681) (-844.581) (-845.166) * (-844.011) [-845.613] (-841.162) (-845.701) -- 0:00:05
978000 -- (-848.637) [-846.348] (-842.931) (-847.474) * (-840.199) [-837.984] (-838.352) (-841.219) -- 0:00:05
979000 -- (-839.249) (-847.703) [-847.040] (-842.910) * (-846.366) (-845.296) [-844.416] (-853.968) -- 0:00:05
980000 -- (-850.909) (-840.088) [-843.143] (-841.285) * [-843.934] (-845.122) (-845.702) (-838.726) -- 0:00:05
Average standard deviation of split frequencies: 0.005812
981000 -- (-848.059) (-848.340) [-843.695] (-840.011) * (-844.650) (-843.781) [-841.396] (-842.417) -- 0:00:04
982000 -- [-852.355] (-845.964) (-848.972) (-851.005) * [-850.935] (-846.513) (-848.399) (-842.606) -- 0:00:04
983000 -- [-846.263] (-844.009) (-851.953) (-852.791) * (-848.266) (-839.720) [-842.789] (-846.165) -- 0:00:04
984000 -- [-839.941] (-838.102) (-836.621) (-859.794) * (-862.972) (-841.840) [-843.729] (-839.896) -- 0:00:04
985000 -- (-846.128) (-839.532) (-846.363) [-841.535] * (-855.281) (-840.708) (-844.828) [-843.813] -- 0:00:03
Average standard deviation of split frequencies: 0.006128
986000 -- (-842.275) (-845.226) (-843.730) [-843.000] * [-850.934] (-844.737) (-854.030) (-848.232) -- 0:00:03
987000 -- (-852.281) (-847.499) (-839.151) [-840.245] * (-844.756) [-845.408] (-839.356) (-852.287) -- 0:00:03
988000 -- (-850.859) [-847.239] (-843.576) (-847.065) * [-850.654] (-842.887) (-847.806) (-846.194) -- 0:00:03
989000 -- (-842.019) [-847.415] (-839.740) (-851.093) * (-848.569) (-841.432) [-843.205] (-849.056) -- 0:00:02
990000 -- (-846.622) (-844.389) [-843.477] (-846.258) * (-847.224) (-839.846) (-856.006) [-842.897] -- 0:00:02
Average standard deviation of split frequencies: 0.006662
991000 -- (-849.171) [-842.697] (-843.478) (-844.264) * (-844.627) [-843.338] (-844.664) (-846.405) -- 0:00:02
992000 -- (-849.196) (-850.679) (-838.536) [-844.090] * (-839.112) (-853.687) (-853.016) [-843.104] -- 0:00:02
993000 -- (-859.826) [-839.100] (-841.896) (-843.960) * (-850.961) (-843.958) (-853.927) [-837.012] -- 0:00:01
994000 -- (-848.708) [-853.760] (-847.807) (-840.408) * (-838.616) (-843.518) (-848.013) [-846.126] -- 0:00:01
995000 -- (-849.742) (-842.507) (-846.841) [-844.015] * (-844.554) [-846.266] (-843.245) (-856.198) -- 0:00:01
Average standard deviation of split frequencies: 0.006411
996000 -- (-840.900) (-845.922) (-847.645) [-837.476] * (-842.429) [-842.159] (-855.592) (-847.814) -- 0:00:01
997000 -- [-842.568] (-855.161) (-846.751) (-845.412) * (-844.907) (-848.625) (-846.647) [-841.336] -- 0:00:00
998000 -- (-848.619) (-849.662) (-841.356) [-844.476] * (-843.021) (-845.326) [-846.398] (-848.957) -- 0:00:00
999000 -- (-845.422) [-840.961] (-842.501) (-839.986) * (-841.688) [-838.480] (-846.563) (-837.379) -- 0:00:00
1000000 -- (-843.416) [-843.865] (-846.326) (-851.310) * [-840.771] (-850.854) (-847.311) (-848.665) -- 0:00:00
Average standard deviation of split frequencies: 0.006595
Analysis completed in 4 mins 14 seconds
Analysis used 253.75 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -831.65
Likelihood of best state for "cold" chain of run 2 was -831.77
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
63.9 % ( 57 %) Dirichlet(Revmat{all})
78.5 % ( 77 %) Slider(Revmat{all})
35.2 % ( 35 %) Dirichlet(Pi{all})
35.4 % ( 31 %) Slider(Pi{all})
68.4 % ( 49 %) Multiplier(Alpha{1,2})
62.5 % ( 38 %) Multiplier(Alpha{3})
70.5 % ( 43 %) Slider(Pinvar{all})
26.5 % ( 32 %) ExtSPR(Tau{all},V{all})
17.5 % ( 20 %) ExtTBR(Tau{all},V{all})
34.3 % ( 39 %) NNI(Tau{all},V{all})
37.2 % ( 37 %) ParsSPR(Tau{all},V{all})
27.0 % ( 23 %) Multiplier(V{all})
41.8 % ( 34 %) Nodeslider(V{all})
26.4 % ( 19 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
63.9 % ( 65 %) Dirichlet(Revmat{all})
77.9 % ( 72 %) Slider(Revmat{all})
35.1 % ( 33 %) Dirichlet(Pi{all})
36.4 % ( 32 %) Slider(Pi{all})
66.9 % ( 44 %) Multiplier(Alpha{1,2})
62.0 % ( 37 %) Multiplier(Alpha{3})
70.7 % ( 47 %) Slider(Pinvar{all})
25.9 % ( 28 %) ExtSPR(Tau{all},V{all})
17.2 % ( 16 %) ExtTBR(Tau{all},V{all})
34.1 % ( 30 %) NNI(Tau{all},V{all})
37.1 % ( 37 %) ParsSPR(Tau{all},V{all})
27.0 % ( 24 %) Multiplier(V{all})
41.8 % ( 45 %) Nodeslider(V{all})
26.5 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.74 0.53 0.37
2 | 166532 0.76 0.56
3 | 167220 166497 0.78
4 | 166626 166745 166380
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.75 0.53 0.37
2 | 166609 0.76 0.56
3 | 167092 166286 0.78
4 | 166071 167274 166668
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -841.63
| 2 1 1 2 |
|1 1 2 2 |
| 2 2 1 1 2 * |
| 1 2 1 1* 2 |
| 2 1 121 1 2 22 2 2 2 1 2 2 1 |
| 2* 1 222 11 1 2 |
| 2 1 1 2 1 11 22 1 * 1 211 22|
|2 21 12 1 * 2 121 2 1|
| 1 22 1 1 2 1 1 1 |
| * 1 2 1 2 1 2 12 |
| 1 2 1 2 1 1 |
| 2 1 2 |
| 2 * 2 2 1 |
| 11 1 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -845.46
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -839.13 -852.69
2 -838.60 -852.39
--------------------------------------
TOTAL -838.83 -852.55
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.307331 0.004585 0.187078 0.438805 0.298793 1154.19 1180.44 1.000
r(A<->C){all} 0.084874 0.001575 0.021467 0.168725 0.079951 371.91 407.28 1.000
r(A<->G){all} 0.156285 0.002580 0.068186 0.260132 0.151139 675.68 729.42 1.002
r(A<->T){all} 0.098169 0.001552 0.027461 0.175485 0.094890 601.38 675.97 1.001
r(C<->G){all} 0.052967 0.001002 0.000809 0.112848 0.048798 405.17 505.00 1.000
r(C<->T){all} 0.547964 0.006146 0.388466 0.691291 0.547392 575.82 625.58 1.000
r(G<->T){all} 0.059741 0.001039 0.005542 0.121671 0.055051 579.79 596.47 1.001
pi(A){all} 0.267685 0.000477 0.224621 0.310232 0.267113 1182.89 1228.95 1.000
pi(C){all} 0.260039 0.000478 0.217422 0.303168 0.259910 1225.25 1262.41 1.000
pi(G){all} 0.226317 0.000462 0.185227 0.269127 0.226020 1311.99 1313.34 1.002
pi(T){all} 0.245959 0.000451 0.203573 0.285478 0.245518 1197.35 1294.89 1.001
alpha{1,2} 0.119799 0.011727 0.000142 0.285446 0.101815 1205.82 1219.59 1.000
alpha{3} 2.339974 1.658014 0.390326 4.916463 2.081782 1312.59 1351.93 1.000
pinvar{all} 0.475264 0.013752 0.244223 0.696565 0.485121 1142.81 1164.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
---------------
1 -- .********
2 -- .*.......
3 -- ..*......
4 -- ...*.....
5 -- ....*....
6 -- .....*...
7 -- ......*..
8 -- .......*.
9 -- ........*
10 -- ..**.****
11 -- ..**.....
12 -- .....***.
13 -- ..*******
14 -- ..**.***.
15 -- .....**..
16 -- ..**....*
17 -- ......**.
18 -- .....*.*.
19 -- .....****
20 -- .*..*....
---------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
10 3002 1.000000 0.000000 1.000000 1.000000 2
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 2986 0.994670 0.000942 0.994004 0.995336 2
13 2450 0.816123 0.001884 0.814790 0.817455 2
14 1228 0.409061 0.005653 0.405063 0.413058 2
15 1048 0.349101 0.016017 0.337775 0.360426 2
16 979 0.326116 0.008951 0.319787 0.332445 2
17 974 0.324450 0.007537 0.319121 0.329780 2
18 972 0.323784 0.007537 0.318454 0.329114 2
19 794 0.264490 0.015075 0.253831 0.275150 2
20 401 0.133578 0.008951 0.127249 0.139907 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.047953 0.000343 0.017494 0.085226 0.045293 1.000 2
length{all}[2] 0.031529 0.000221 0.007388 0.061461 0.029002 1.000 2
length{all}[3] 0.003017 0.000009 0.000001 0.009088 0.002114 1.000 2
length{all}[4] 0.002933 0.000009 0.000001 0.008581 0.002045 1.000 2
length{all}[5] 0.048326 0.000389 0.015827 0.087784 0.044787 1.000 2
length{all}[6] 0.003154 0.000010 0.000000 0.009397 0.002182 1.000 2
length{all}[7] 0.003109 0.000010 0.000002 0.009265 0.002206 1.000 2
length{all}[8] 0.003127 0.000010 0.000000 0.009554 0.002182 1.000 2
length{all}[9] 0.040561 0.000236 0.014767 0.070827 0.038401 1.000 2
length{all}[10] 0.043520 0.000372 0.011782 0.079829 0.040469 1.000 2
length{all}[11] 0.034408 0.000203 0.010503 0.062491 0.031879 1.000 2
length{all}[12] 0.019454 0.000098 0.003296 0.038696 0.017938 1.000 2
length{all}[13] 0.018283 0.000147 0.000193 0.041312 0.015977 1.000 2
length{all}[14] 0.007042 0.000047 0.000004 0.020956 0.004886 0.999 2
length{all}[15] 0.003086 0.000010 0.000008 0.009275 0.002091 0.999 2
length{all}[16] 0.006529 0.000039 0.000003 0.018719 0.004620 0.999 2
length{all}[17] 0.003075 0.000010 0.000001 0.009425 0.002170 0.999 2
length{all}[18] 0.002930 0.000008 0.000004 0.008657 0.002019 0.999 2
length{all}[19] 0.006100 0.000036 0.000005 0.017910 0.004307 1.000 2
length{all}[20] 0.010643 0.000078 0.000024 0.027367 0.008909 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006595
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
| /------------------ C3 (3)
| /-------100-------+
| | \------------------ C4 (4)
+ |
| | /------------------ C6 (6)
| | |
| /-------100-------+--------99-------+------------------ C7 (7)
| | | |
| | | \------------------ C8 (8)
\--------82-------+ |
| \------------------------------------ C9 (9)
|
\------------------------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/---------------------------------- C1 (1)
|
|---------------------- C2 (2)
|
| /-- C3 (3)
| /-----------------------+
| | \-- C4 (4)
+ |
| | /-- C6 (6)
| | |
| /------------------------------+------------+-- C7 (7)
| | | |
| | | \-- C8 (8)
\-----------+ |
| \----------------------------- C9 (9)
|
\---------------------------------- C5 (5)
|--------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (39 trees sampled):
50 % credible set contains 5 trees
90 % credible set contains 15 trees
95 % credible set contains 19 trees
99 % credible set contains 26 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
Running FUBAR...
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\
***************** TYPES OF STANDARD ANALYSES *****************
(1) Selection Analyses
(2) Evolutionary Hypothesis Testing
(3) Relative evolutionary rate inference
(4) Coevolutionary analysis
(5) Basic Analyses
(6) Codon Selection Analyses
(7) Compartmentalization
(8) Data File Tools
(9) Miscellaneous
(10) Model Comparison
(11) Kernel Analysis Tools
(12) Molecular Clock
(13) Phylogeny Reconstruction
(14) Positive Selection
(15) Recombination
(16) Selection/Recombination
(17) Relative Rate
(18) Relative Ratio
(19) Substitution Rates
Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' *****************
(1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution).
(2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood).
(3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting).
(4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection).
(5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification).
(6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood).
(7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation).
Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types):
Analysis Description
--------------------
Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a
coding sequence alignment to determine whether some sites have been
subject to pervasive purifying or diversifying selection. v2.1
introduces two more methods for estimating the posterior distribution of
grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation
Bayes approximation (fastest). Please note that a FUBAR analysis
generates a cache and a results JSON file in the same directory as
directory as the original alignment. HyPhy needs to have write
privileges to this directory. For example if the original file is in
/home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there
will also exist FUBAR-generated files
/home/sergei/FUBAR/data/pol.nex.FUBAR.json,
/home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide
checkpointing so that a partially completed analysis can be restarted.
- __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree
(one per partition)
- __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring
selection (2013), Mol Biol Evol. 30(5):1196-205
- __Written by__: Sergei L Kosakovsky Pond
- __Contact Information__: spond@temple.edu
- __Analysis Version__: 2.1
####Choose Genetic Code
1. [**Universal**] Universal code. (Genebank transl_table=1).
2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2).
3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3).
4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4).
5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5).
6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6).
7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9).
8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10).
9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12).
10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13).
11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14).
12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15).
13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16).
14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21).
15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22).
16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23).
17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24).
18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25).
19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26).
>Please choose an option (or press q to cancel selection):
>Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`)
>A tree was found in the data file: `(C1,C2,(((C3,C4),(C6,C7,C8),C9),C5))`
>Would you like to use it (y/n)?
>Loaded a multiple sequence alignment with **9** sequences, **119** codons, and **1** partitions from `/data//pss_subsets/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna`
> FUBAR will write cache and result files to _/data//pss_subsets/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna.FUBAR.json_, respectively
> Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer):
####Posterior estimation method
1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation)
2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed)
3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default)
>Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5):
### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model
* Log(L) = -849.66, AIC-c = 1741.61 (21 estimated parameters)
* Tree length (expected substitutions/site) for partition 1 : 0.188
### Computing the phylogenetic likelihood function on the grid
* Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid
* Best scaling achieved for
* synonymous rate = 2.815
* non-synonymous rate = 0.571
* Computing conditional site likelihoods on a 20 x 20 rate grid
### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights
* Using the following settings
* Dirichlet alpha : 0.5
### Tabulating site-level results
| Codon | Partition | alpha | beta |Posterior prob for positive selection|
|:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:|
| 112 | 1 | 1.521 | 11.711 | Pos. posterior = 0.9321 |
| 118 | 1 | 1.418 | 10.740 | Pos. posterior = 0.9419 |
----
## FUBAR inferred 2 sites subject to diversifying positive selection at posterior probability >= 0.9
Of these, 0.13 are expected to be false positives (95% confidence interval of 0-1 )
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=9, Len=119
BY140535_orf4a_AWH65912_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNIQYPIKWRCIYT
BY140562_orf4a_AWH65923_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYT
LMH03f_NS3b_ABN10877_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYT
HKU5_1_LMH03f_NS3b_YP_001039964_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYT
BtPa_GD2013_NA_AIA62345_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAHEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYT
TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
TT07f_NS3b_ABN10904_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
TT06f_NS3b_ABN10895_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT
YD13403_orf4a_AWH65934_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGTLQYPIKWRCIYT
*****************::******:***:*******.:* *********
BY140535_orf4a_AWH65912_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 FAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
BY140562_orf4a_AWH65923_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 FAGYTGTSTEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
LMH03f_NS3b_ABN10877_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 FAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
HKU5_1_LMH03f_NS3b_YP_001039964_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 FAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
BtPa_GD2013_NA_AIA62345_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 FAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN
TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
TT07f_NS3b_ABN10904_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
TT06f_NS3b_ABN10895_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
YD13403_orf4a_AWH65934_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN
*******:*****.***************: ****** *********::*
BY140535_orf4a_AWH65912_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 RYDASKSYFYTQTSSSSNE
BY140562_orf4a_AWH65923_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 RYDASKSYFYTETSSSSNE
LMH03f_NS3b_ABN10877_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 RYDASKSYFYTQTSSSSHE
HKU5_1_LMH03f_NS3b_YP_001039964_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 RYDASKSYFYTQTSSSSHE
BtPa_GD2013_NA_AIA62345_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 RYDASKSYFYTKTPSSPEE
TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 RYDASKSYFYTETSSSSDE
TT07f_NS3b_ABN10904_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 RYDASKSYFYTETSSSSDE
TT06f_NS3b_ABN10895_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 RYDASKSYFYTETSSSSDE
YD13403_orf4a_AWH65934_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 RYDASKSYFYTETSSSSDE
***********:*.**..*
>BY140535_orf4a_AWH65912_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCGCTGCTCAACCAGGTTTGGCAGAAACAGGTTAATTCCGCTCAAGAAGGAACCTTGGCTCCTATTCGCCCTACGTACGCCTATCGGCCAGTGCAGGGAAATATTCAGTACCCAATTAAGTGGCGCTGCATCTACACCTTCGCAGGCTACACAGGCACTGCAACCGAGCCAACCAAAGCATTAGCAAAACAAGAAGCCGCTAGGAAGGTTTGCCTCAGGCTTCAAGATGACGGACGACTCGATGGATTTGAGCTTAGACTGCGTTATAGCACAGCCTTCCAGCGAAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGCAAACGTCGTCGTCATCCAATGAA >BY140562_orf4a_AWH65923_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCACTGCTCAACCAGGTTTGGCAGAAACAGGTTAATTCCGCTCAAGAAGGAACCTTGGCTCCTATTCGCCCTACATTTGCCTACAGGCCAGTGCAGGGAAATCTTCAGTGTCCTATTAAGTGGCGCTGCATTTACACATTTGCAGGCTACACAGGCACTTCAACTGAGCCAACCAAAGCATTAGCAAAACAAGAAGCCGCTAGGAAGGTTTGCCTTAGGCTTCAAGATGACGGACGACTCGATGGATTTGAGCTTAGACTGCGTTATAGCACAGCCTTCCAGCGAAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGGAAACGTCGTCGTCATCCAATGAA >LMH03f_NS3b_ABN10877_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCGCTGCTCAACCAGGTTTGGCAGAAACAGGTTAATTCCTCTCAAGAAGGAACTTTGGCTCCTGTTCGCCCTACATACGCCTATCGGCCAGTGCAGGGAAATCTTCAGTGTCCTATCAAGTGGCGTTGCATTTACACTTTTGCAGGCTACACAGGTACTGCAACTGAGCCAACTAAAGTATTAGCAAAACAAGAAGCCGCTAGGAAGGTTTGCCTTAGGCTTCAAGAGTATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGCAAACGTCGTCGTCATCCCATGAA >HKU5_1_LMH03f_NS3b_YP_001039964_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCGCTGCTCAACCAGGTTTGGCAGAAACAGGTTAATTCCTCTCAAGAAGGAACTTTGGCTCCTGTTCGCCCTACATACGCCTATCGGCCAGTGCAGGGAAATCTTCAGTGTCCTATCAAGTGGCGTTGCATTTACACTTTTGCAGGCTACACAGGTACTGCAACTGAGCCAACTAAAGTATTAGCAAAACAAGAAGCCGCTAGGAAGGTTTGCCTTAGGCTTCAAGAGTATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGCAAACGTCGTCGTCATCCCATGAA >BtPa_GD2013_NA_AIA62345_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCGCTGCTCAACCAGGTTTGGCAGAAACAGGTTAATTCCGCTCACGAAGGAACTTTGGCTCCTATTCGCCCCACATTTGCCTATCGGCCAGTGCAGGGTAATCTTCAGTGTCCTATCAAGTGGCGCTGCATCTATACTTTTGCAGGCTACACGGGTACTGCAACTGAGCCAACCAAAGCATTAGCAAAACAAGAAGCCGCTAGGAAGGTTTGCCTTAGGCTTCAAGATGACGGACGACTCGATGGATTTGAACTTAGACTGCGTTATAGCACAGCCTTCCAGCGAAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGAAAACGCCGTCGTCACCCGAAGAA >TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCGCTGCTCAACCAGGTTTGGCAGAAACAGGTCAATTCCGCTCAAGAAGGAACTTTGGCTCCTATTCGCCCTACATACGCCTATCGGCCAGTGCAGGGTAACCTTCAGTGTCCTATTAAGTGGCGCTGCATCTACACTTTTGCAGGCTACACAGGCACTGCAACCGAGCCAACTAAAGCATTAGCAAAACAAGAAGCCGCTAGGAAGGTTTGCCTTAGGCTTCAAGAGTATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGGAAACGTCGTCGTCATCCGATGAA >TT07f_NS3b_ABN10904_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCGCTGCTCAACCAGGTTTGGCAGAAACAGGTCAATTCCGCTCAAGAAGGAACTTTGGCTCCTATTCGCCCTACATACGCCTATCGGCCAGTGCAGGGTAACCTTCAGTGTCCTATTAAGTGGCGCTGCATCTACACTTTTGCAGGCTACACAGGCACTGCAACCGAGCCAACTAAAGCATTAGCAAAACAAGAAGCCGCTAGGAAGGTTTGCCTTAGGCTTCAAGAGTATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGGAAACGTCGTCGTCATCCGATGAA >TT06f_NS3b_ABN10895_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCGCTGCTCAACCAGGTTTGGCAGAAACAGGTCAATTCCGCTCAAGAAGGAACTTTGGCTCCTATTCGCCCTACATACGCCTATCGGCCAGTGCAGGGTAACCTTCAGTGTCCTATTAAGTGGCGCTGCATCTACACTTTTGCAGGCTACACAGGCACTGCAACCGAGCCAACTAAAGCATTAGCAAAACAAGAAGCCGCTAGGAAGGTTTGCCTTAGGCTTCAAGAGTATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGGAAACGTCGTCGTCATCCGATGAA >YD13403_orf4a_AWH65934_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ATGGATTACGTGTCGCTGCTCAACCAGGTTTGGCAGAAACAGGTTAATTCCGCTCAAGAAGGGACTTTGGCTCCTATTCGCCCTACATACGCCTACAGGCCAGTGCAGGGAACTCTCCAGTACCCTATTAAGTGGCGCTGCATCTACACTTTTGCAGGCTACACAGGTACTGCTACTGAGCCAACCAAAGCATTAGCAAAACAAGAAGCCGCTAGGAAGGTCTGCCTTAGGCTTCAAGAGTATGGACGACTCGATGGATTTGGACTTAGACTGCGTTATAGCACAGCCTTCGAGCACAATCGTTATGATGCCTCTAAGTCCTATTTCTACACGGAAACGTCGTCGTCATCCGATGAA
>BY140535_orf4a_AWH65912_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNIQYPIKWRCIYT FAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN RYDASKSYFYTQTSSSSNE >BY140562_orf4a_AWH65923_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYT FAGYTGTSTEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN RYDASKSYFYTETSSSSNE >LMH03f_NS3b_ABN10877_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYT FAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN RYDASKSYFYTQTSSSSHE >HKU5_1_LMH03f_NS3b_YP_001039964_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSSQEGTLAPVRPTYAYRPVQGNLQCPIKWRCIYT FAGYTGTATEPTKVLAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN RYDASKSYFYTQTSSSSHE >BtPa_GD2013_NA_AIA62345_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAHEGTLAPIRPTFAYRPVQGNLQCPIKWRCIYT FAGYTGTATEPTKALAKQEAARKVCLRLQDDGRLDGFELRLRYSTAFQRN RYDASKSYFYTKTPSSPEE >TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN RYDASKSYFYTETSSSSDE >TT07f_NS3b_ABN10904_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN RYDASKSYFYTETSSSSDE >TT06f_NS3b_ABN10895_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGNLQCPIKWRCIYT FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN RYDASKSYFYTETSSSSDE >YD13403_orf4a_AWH65934_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 MDYVSLLNQVWQKQVNSAQEGTLAPIRPTYAYRPVQGTLQYPIKWRCIYT FAGYTGTATEPTKALAKQEAARKVCLRLQEYGRLDGFGLRLRYSTAFEHN RYDASKSYFYTETSSSSDE
Reading sequence file /data//pss_subsets/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/fasta/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1
Found 9 sequences of length 357
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 5.1%
Found 29 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 6
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 32 polymorphic sites
**p-Value(s)**
----------
NSS: 0.00e+00 (1000 permutations)
Max Chi^2: 2.39e-01 (1000 permutations)
PHI (Permutation): 1.10e-02 (1000 permutations)
PHI (Normal): 6.34e-03
#NEXUS
[ID: 4282605921]
begin taxa;
dimensions ntax=9;
taxlabels
BY140535_orf4a_AWH65912_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
BY140562_orf4a_AWH65923_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
LMH03f_NS3b_ABN10877_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
HKU5_1_LMH03f_NS3b_YP_001039964_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
BtPa_GD2013_NA_AIA62345_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5
TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
TT07f_NS3b_ABN10904_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
TT06f_NS3b_ABN10895_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
YD13403_orf4a_AWH65934_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
;
end;
begin trees;
translate
1 BY140535_orf4a_AWH65912_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5,
2 BY140562_orf4a_AWH65923_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5,
3 LMH03f_NS3b_ABN10877_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
4 HKU5_1_LMH03f_NS3b_YP_001039964_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
5 BtPa_GD2013_NA_AIA62345_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
6 TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
7 TT07f_NS3b_ABN10904_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
8 TT06f_NS3b_ABN10895_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
9 YD13403_orf4a_AWH65934_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:4.529301e-02,2:2.900218e-02,(((3:2.114405e-03,4:2.045229e-03)1.000:3.187905e-02,(6:2.181885e-03,7:2.205907e-03,8:2.181961e-03)0.995:1.793829e-02,9:3.840078e-02)1.000:4.046919e-02,5:4.478693e-02)0.816:1.597721e-02);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:4.529301e-02,2:2.900218e-02,(((3:2.114405e-03,4:2.045229e-03):3.187905e-02,(6:2.181885e-03,7:2.205907e-03,8:2.181961e-03):1.793829e-02,9:3.840078e-02):4.046919e-02,5:4.478693e-02):1.597721e-02);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -839.16 -851.97
2 -838.68 -851.79
--------------------------------------
TOTAL -838.89 -851.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.304420 0.004249 0.192208 0.436590 0.295201 867.53 937.34 1.000
r(A<->C){all} 0.087069 0.001616 0.013860 0.160857 0.082410 553.39 620.23 1.000
r(A<->G){all} 0.157403 0.002704 0.069745 0.263839 0.151584 497.65 528.29 1.001
r(A<->T){all} 0.100707 0.001639 0.026705 0.177595 0.096963 349.86 400.34 1.002
r(C<->G){all} 0.053979 0.001010 0.003957 0.117868 0.048972 525.66 679.42 1.001
r(C<->T){all} 0.542941 0.006004 0.404741 0.705339 0.542053 440.86 467.87 1.001
r(G<->T){all} 0.057900 0.001009 0.005587 0.120305 0.052467 398.34 539.83 1.000
pi(A){all} 0.267532 0.000490 0.223611 0.308719 0.267272 1089.42 1190.71 1.001
pi(C){all} 0.260152 0.000492 0.217138 0.303646 0.259480 1168.94 1334.97 1.001
pi(G){all} 0.227061 0.000475 0.186221 0.271200 0.226350 1137.35 1178.08 1.000
pi(T){all} 0.245256 0.000473 0.201398 0.286221 0.245012 1236.80 1282.96 1.000
alpha{1,2} 0.120502 0.011230 0.000061 0.294930 0.100671 1067.70 1113.04 1.000
alpha{3} 2.309624 1.642257 0.473627 4.929037 2.024246 1259.95 1319.39 1.000
pinvar{all} 0.472338 0.013584 0.237283 0.681523 0.479801 1168.29 1183.77 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C2,(((C3,C4),(C6,C7,C8),C9),C5))` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **9** sequences, **119** codons, and **1** partitions from `/data//pss_subsets/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3b_ABN10886_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -849.66, AIC-c = 1741.61 (21 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.188 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 2.815 * non-synonymous rate = 0.571 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results | Codon | Partition | alpha | beta |Posterior prob for positive selection| |:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:| | 112 | 1 | 1.521 | 11.711 | Pos. posterior = 0.9321 | | 118 | 1 | 1.418 | 10.740 | Pos. posterior = 0.9419 | ---- ## FUBAR inferred 2 sites subject to diversifying positive selection at posterior probability >= 0.9 Of these, 0.13 are expected to be false positives (95% confidence interval of 0-1 )
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
