--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1121.56 -1135.80
2 -1121.45 -1133.99
--------------------------------------
TOTAL -1121.50 -1135.26
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.117353 0.006241 0.043531 0.245350 0.095259 831.94 904.05 1.000
r(A<->C){all} 0.123667 0.006230 0.000080 0.264937 0.111246 425.97 456.84 1.005
r(A<->G){all} 0.215900 0.008603 0.057097 0.406817 0.204199 259.26 343.31 1.003
r(A<->T){all} 0.132885 0.004251 0.018440 0.264007 0.124749 337.94 456.11 1.000
r(C<->G){all} 0.159537 0.007472 0.000076 0.314987 0.151502 330.47 349.26 1.000
r(C<->T){all} 0.311981 0.010091 0.128282 0.506673 0.305723 313.63 400.78 1.000
r(G<->T){all} 0.056031 0.002479 0.000001 0.151141 0.042673 435.72 512.61 1.001
pi(A){all} 0.254124 0.000280 0.221769 0.286241 0.254072 1193.90 1297.02 1.000
pi(C){all} 0.196467 0.000212 0.167954 0.225557 0.196283 1212.03 1226.62 1.000
pi(G){all} 0.224095 0.000258 0.194614 0.256626 0.223527 1221.07 1361.03 1.000
pi(T){all} 0.325314 0.000302 0.288408 0.356671 0.325352 1376.11 1380.29 1.000
alpha{1,2} 0.359537 0.349821 0.000019 1.434888 0.157803 1154.07 1199.22 1.000
alpha{3} 1.632693 1.262954 0.001975 3.797113 1.357660 1204.69 1345.28 1.000
pinvar{all} 0.593164 0.050434 0.102322 0.877076 0.669460 347.61 525.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
-- Starting log on Wed Nov 02 20:10:34 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=229
C1 MSSTTSAPQTVYQWTADVAVRFLKEWNFLLGIILLFITIILQFGYTSRSM
C2 MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSM
C3 MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSM
C4 MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSM
*****.**:.******* **:******* *********************
C1 FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVMWIM
C2 FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIM
C3 FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIM
C4 FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIM
**********************************************:***
C1 YFVNSIRLFIRTGSWWSFNPETNNLMCIDVKGTVYVRPIIEDYHTLTATN
C2 YFVNSIRLFIRTGSWWSFNPETNNLMCIDMKGTVYVRPIIEDYHTLTATI
C3 YFVNSIRLFIRTGSWWSFNPETNNLMCIDMKGTVYVRPIIEDYHTLTATI
C4 YFVNSIRLFIRTGSWWSFNPETNNLMCIDMKGTVYVRPIIEDYHTLTATI
*****************************:*******************
C1 VRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVRRVLGG
C2 IRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGV-SG
C3 IRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGV-SG
C4 IRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGV-SG
:******************************************* * .*
C1 FAVYVKSKVGNYRLPSNKPSGADTALLRI
C2 FAVYVKSKVGNYRLPSNKPSGADTALLRT
C3 FAVYVKSKVGNYRLPSNKPSGADTALLRT
C4 FAVYVKSKVGNYRLPSNKPSGADTALLRT
****************************
-- Starting log on Wed Nov 02 20:12:21 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=996, Nseq=4, Len=229
C1 MSSTTSAPQTVYQWTADVAVRFLKEWNFLLGIILLFITIILQFGYTSRSM
C2 MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSM
C3 MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSM
C4 MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSM
*****.**:.******* **:******* *********************
C1 FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVMWIM
C2 FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIM
C3 FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIM
C4 FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIM
**********************************************:***
C1 YFVNSIRLFIRTGSWWSFNPETNNLMCIDVKGTVYVRPIIEDYHTLTATN
C2 YFVNSIRLFIRTGSWWSFNPETNNLMCIDMKGTVYVRPIIEDYHTLTATI
C3 YFVNSIRLFIRTGSWWSFNPETNNLMCIDMKGTVYVRPIIEDYHTLTATI
C4 YFVNSIRLFIRTGSWWSFNPETNNLMCIDMKGTVYVRPIIEDYHTLTATI
*****************************:*******************
C1 VRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVRRVLGG
C2 IRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGV-SG
C3 IRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGV-SG
C4 IRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGV-SG
:******************************************* * .*
C1 FAVYVKSKVGNYRLPSNKPSGADTALLRI
C2 FAVYVKSKVGNYRLPSNKPSGADTALLRT
C3 FAVYVKSKVGNYRLPSNKPSGADTALLRT
C4 FAVYVKSKVGNYRLPSNKPSGADTALLRT
****************************
-- Starting log on Wed Nov 02 20:10:34 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=229
C1 MSSTTSAPQTVYQWTADVAVRFLKEWNFLLGIILLFITIILQFGYTSRSM
C2 MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSM
C3 MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSM
C4 MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSM
*****.**:.******* **:******* *********************
C1 FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVMWIM
C2 FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIM
C3 FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIM
C4 FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIM
**********************************************:***
C1 YFVNSIRLFIRTGSWWSFNPETNNLMCIDVKGTVYVRPIIEDYHTLTATN
C2 YFVNSIRLFIRTGSWWSFNPETNNLMCIDMKGTVYVRPIIEDYHTLTATI
C3 YFVNSIRLFIRTGSWWSFNPETNNLMCIDMKGTVYVRPIIEDYHTLTATI
C4 YFVNSIRLFIRTGSWWSFNPETNNLMCIDMKGTVYVRPIIEDYHTLTATI
*****************************:*******************
C1 VRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVRRVLGG
C2 IRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGV-SG
C3 IRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGV-SG
C4 IRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGV-SG
:******************************************* * .*
C1 FAVYVKSKVGNYRLPSNKPSGADTALLRI
C2 FAVYVKSKVGNYRLPSNKPSGADTALLRT
C3 FAVYVKSKVGNYRLPSNKPSGADTALLRT
C4 FAVYVKSKVGNYRLPSNKPSGADTALLRT
****************************
-- Starting log on Wed Nov 02 21:01:09 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result/gapped_alignment/fubar,A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 687 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1667422871
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 474968653
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8367500220
Seed = 1294750825
Swapseed = 1667422871
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.00 % Dirichlet(Revmat{all})
1.00 % Slider(Revmat{all})
1.00 % Dirichlet(Pi{all})
1.00 % Slider(Pi{all})
2.00 % Multiplier(Alpha{1,2})
2.00 % Multiplier(Alpha{3})
2.00 % Slider(Pinvar{all})
10.00 % ExtSPR(Tau{all},V{all})
10.00 % NNI(Tau{all},V{all})
10.00 % ParsSPR(Tau{all},V{all})
40.00 % Multiplier(V{all})
14.00 % Nodeslider(V{all})
6.00 % TLMultiplier(V{all})
Division 1 has 9 unique site patterns
Division 2 has 10 unique site patterns
Division 3 has 15 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1206.123359 -- 13.556448
Chain 2 -- -1206.123359 -- 13.556448
Chain 3 -- -1206.123359 -- 13.556448
Chain 4 -- -1206.123359 -- 13.556448
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1206.123359 -- 13.556448
Chain 2 -- -1206.123359 -- 13.556448
Chain 3 -- -1206.123359 -- 13.556448
Chain 4 -- -1206.123359 -- 13.556448
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1206.123] (-1206.123) (-1206.123) (-1206.123) * [-1206.123] (-1206.123) (-1206.123) (-1206.123)
1000 -- (-1129.732) (-1130.331) [-1126.232] (-1131.140) * (-1130.504) (-1129.922) (-1136.764) [-1126.077] -- 0:00:00
2000 -- (-1132.068) (-1125.793) (-1132.717) [-1129.150] * [-1126.950] (-1130.286) (-1132.590) (-1128.787) -- 0:00:00
3000 -- (-1129.968) [-1127.367] (-1128.290) (-1133.902) * [-1124.865] (-1125.057) (-1129.274) (-1127.253) -- 0:00:00
4000 -- [-1127.758] (-1128.522) (-1134.382) (-1128.213) * (-1121.456) [-1124.593] (-1130.287) (-1132.153) -- 0:04:09
5000 -- (-1136.492) (-1125.057) (-1126.068) [-1131.689] * [-1125.550] (-1129.131) (-1130.819) (-1125.889) -- 0:03:19
Average standard deviation of split frequencies: 0.052378
6000 -- [-1127.981] (-1122.311) (-1128.249) (-1129.983) * (-1123.832) (-1125.169) [-1131.777] (-1130.052) -- 0:02:45
7000 -- (-1126.787) (-1121.562) (-1131.320) [-1131.135] * (-1123.270) (-1125.380) (-1124.842) [-1124.337] -- 0:02:21
8000 -- (-1135.146) [-1125.397] (-1127.377) (-1129.048) * (-1133.895) (-1124.803) (-1123.774) [-1125.484] -- 0:02:04
9000 -- (-1130.747) (-1122.153) (-1125.454) [-1126.233] * (-1125.889) (-1126.932) (-1123.245) [-1131.805] -- 0:01:50
10000 -- (-1124.869) (-1121.685) (-1123.576) [-1126.377] * (-1126.623) (-1127.787) [-1122.780] (-1124.841) -- 0:01:39
Average standard deviation of split frequencies: 0.088388
11000 -- (-1121.964) [-1126.451] (-1134.302) (-1131.259) * (-1129.557) (-1132.868) (-1130.627) [-1126.074] -- 0:01:29
12000 -- (-1130.462) [-1122.420] (-1126.371) (-1138.025) * [-1128.950] (-1126.973) (-1129.471) (-1123.304) -- 0:01:22
13000 -- (-1124.032) [-1123.043] (-1127.070) (-1131.802) * (-1130.541) [-1125.901] (-1127.255) (-1125.475) -- 0:02:31
14000 -- (-1122.419) [-1124.203] (-1131.065) (-1130.064) * (-1121.730) (-1123.726) [-1123.851] (-1134.730) -- 0:02:20
15000 -- (-1130.036) (-1124.828) [-1124.895] (-1127.535) * (-1125.084) (-1126.466) [-1122.191] (-1127.744) -- 0:02:11
Average standard deviation of split frequencies: 0.019642
16000 -- (-1129.738) [-1118.989] (-1129.519) (-1127.807) * (-1134.016) (-1127.159) (-1123.987) [-1125.165] -- 0:02:03
17000 -- [-1123.703] (-1126.502) (-1136.589) (-1126.075) * (-1129.975) (-1129.795) (-1128.589) [-1123.916] -- 0:01:55
18000 -- (-1131.434) [-1118.974] (-1130.859) (-1125.870) * (-1126.438) [-1119.621] (-1125.330) (-1127.053) -- 0:01:49
19000 -- (-1126.224) (-1123.694) (-1131.319) [-1126.663] * [-1129.817] (-1125.019) (-1121.381) (-1124.809) -- 0:01:43
20000 -- (-1126.602) (-1127.803) (-1135.533) [-1130.365] * (-1133.337) (-1121.210) [-1123.926] (-1128.117) -- 0:01:38
Average standard deviation of split frequencies: 0.015207
21000 -- (-1126.124) (-1122.059) [-1128.021] (-1127.561) * (-1131.647) (-1124.042) [-1118.903] (-1128.900) -- 0:01:33
22000 -- [-1125.525] (-1126.411) (-1127.033) (-1127.746) * [-1119.920] (-1121.965) (-1123.580) (-1131.683) -- 0:02:13
23000 -- [-1123.626] (-1128.794) (-1135.452) (-1127.843) * (-1123.775) (-1126.600) (-1128.151) [-1122.413] -- 0:02:07
24000 -- (-1126.978) (-1126.064) [-1127.863] (-1127.727) * (-1122.676) (-1123.201) [-1121.262] (-1124.476) -- 0:02:02
25000 -- [-1123.149] (-1126.714) (-1134.500) (-1125.563) * (-1125.349) [-1127.737] (-1121.392) (-1123.049) -- 0:01:57
Average standard deviation of split frequencies: 0.036262
26000 -- (-1128.162) (-1125.920) (-1135.828) [-1129.119] * (-1127.639) [-1125.098] (-1128.623) (-1127.751) -- 0:01:52
27000 -- [-1126.681] (-1124.628) (-1126.952) (-1125.176) * (-1126.828) (-1122.940) (-1119.950) [-1121.907] -- 0:01:48
28000 -- (-1124.476) (-1123.770) [-1125.073] (-1126.807) * (-1122.150) (-1124.042) (-1125.753) [-1124.688] -- 0:01:44
29000 -- (-1128.247) (-1129.278) (-1127.845) [-1128.724] * (-1126.554) (-1124.265) (-1123.473) [-1119.262] -- 0:01:40
30000 -- [-1119.757] (-1131.232) (-1128.332) (-1125.080) * [-1122.420] (-1120.326) (-1126.622) (-1123.017) -- 0:01:37
Average standard deviation of split frequencies: 0.061488
31000 -- (-1122.244) [-1124.630] (-1123.540) (-1125.776) * (-1129.687) [-1121.876] (-1128.273) (-1127.344) -- 0:02:05
32000 -- [-1120.796] (-1124.102) (-1122.112) (-1122.155) * (-1129.738) [-1123.415] (-1129.175) (-1125.496) -- 0:02:01
33000 -- (-1125.285) (-1132.716) (-1124.438) [-1121.856] * [-1123.340] (-1120.978) (-1131.217) (-1126.591) -- 0:01:57
34000 -- (-1130.880) (-1129.981) (-1121.190) [-1123.649] * (-1122.005) [-1123.287] (-1130.850) (-1124.302) -- 0:01:53
35000 -- (-1127.589) (-1121.642) (-1122.178) [-1123.255] * (-1124.557) [-1123.600] (-1126.215) (-1122.634) -- 0:01:50
Average standard deviation of split frequencies: 0.078567
36000 -- (-1133.399) [-1125.803] (-1127.843) (-1123.420) * [-1121.728] (-1126.903) (-1122.962) (-1124.987) -- 0:01:47
37000 -- (-1119.997) (-1126.466) (-1121.981) [-1122.226] * (-1122.552) (-1127.438) (-1124.404) [-1132.820] -- 0:01:44
38000 -- (-1124.361) (-1124.660) (-1124.864) [-1125.543] * (-1128.308) (-1124.810) (-1120.133) [-1123.864] -- 0:01:41
39000 -- (-1129.027) (-1128.182) [-1125.043] (-1124.825) * [-1128.479] (-1125.970) (-1123.003) (-1125.139) -- 0:01:38
40000 -- (-1124.956) (-1131.691) (-1123.567) [-1129.396] * (-1128.917) (-1125.182) (-1125.808) [-1122.964] -- 0:02:00
Average standard deviation of split frequencies: 0.077279
41000 -- (-1120.249) [-1124.509] (-1126.253) (-1128.942) * (-1124.317) (-1125.343) [-1123.865] (-1121.405) -- 0:01:56
42000 -- [-1124.499] (-1126.226) (-1122.391) (-1125.303) * (-1124.989) (-1132.436) (-1130.950) [-1125.341] -- 0:01:54
43000 -- (-1125.979) (-1125.211) (-1124.923) [-1124.232] * [-1122.986] (-1129.506) (-1125.674) (-1123.852) -- 0:01:51
44000 -- (-1121.290) (-1124.338) (-1128.818) [-1124.718] * [-1125.490] (-1124.009) (-1124.894) (-1124.785) -- 0:01:48
45000 -- (-1121.310) (-1126.993) (-1125.212) [-1123.174] * (-1127.303) (-1129.233) (-1129.040) [-1125.678] -- 0:01:46
Average standard deviation of split frequencies: 0.075151
46000 -- [-1124.579] (-1123.054) (-1122.022) (-1123.601) * (-1122.637) [-1123.279] (-1124.161) (-1122.313) -- 0:01:43
47000 -- (-1126.117) (-1122.376) [-1121.687] (-1120.291) * [-1120.460] (-1127.279) (-1122.442) (-1123.302) -- 0:01:41
48000 -- (-1130.387) (-1125.685) (-1123.369) [-1126.813] * (-1118.868) (-1125.089) [-1122.027] (-1122.073) -- 0:01:59
49000 -- [-1124.034] (-1126.392) (-1119.462) (-1126.458) * (-1124.271) [-1126.243] (-1126.179) (-1128.519) -- 0:01:56
50000 -- (-1123.577) [-1123.891] (-1121.262) (-1125.993) * (-1125.886) (-1121.638) [-1121.202] (-1119.612) -- 0:01:54
Average standard deviation of split frequencies: 0.062027
51000 -- [-1125.842] (-1128.784) (-1124.654) (-1129.692) * (-1120.990) (-1128.830) [-1125.033] (-1121.197) -- 0:01:51
52000 -- (-1124.506) (-1124.516) [-1123.661] (-1127.757) * (-1121.506) (-1125.365) (-1125.093) [-1125.565] -- 0:01:49
53000 -- (-1126.041) (-1122.578) [-1122.374] (-1125.302) * (-1123.346) [-1127.950] (-1128.208) (-1123.406) -- 0:01:47
54000 -- (-1123.516) [-1124.051] (-1127.537) (-1126.905) * [-1124.233] (-1125.905) (-1121.975) (-1123.131) -- 0:01:45
55000 -- (-1127.701) (-1124.845) [-1122.308] (-1128.288) * (-1122.440) [-1120.106] (-1124.019) (-1119.084) -- 0:01:43
Average standard deviation of split frequencies: 0.061732
56000 -- (-1124.190) (-1127.980) [-1125.062] (-1124.972) * (-1124.470) (-1129.152) [-1121.389] (-1123.695) -- 0:01:41
57000 -- (-1130.607) (-1129.981) [-1129.181] (-1132.404) * (-1125.967) (-1130.445) [-1124.725] (-1130.490) -- 0:01:39
58000 -- (-1125.571) [-1126.549] (-1123.604) (-1127.882) * (-1126.389) [-1122.096] (-1133.190) (-1124.943) -- 0:01:53
59000 -- (-1132.658) (-1128.739) (-1127.685) [-1125.743] * (-1136.911) (-1121.725) (-1129.398) [-1122.383] -- 0:01:51
60000 -- (-1127.650) (-1130.089) [-1123.200] (-1123.990) * [-1128.952] (-1126.865) (-1129.272) (-1120.900) -- 0:01:49
Average standard deviation of split frequencies: 0.051803
61000 -- [-1125.571] (-1125.536) (-1126.454) (-1129.932) * (-1129.294) [-1126.153] (-1128.301) (-1122.986) -- 0:01:47
62000 -- [-1128.541] (-1131.988) (-1127.402) (-1124.681) * (-1126.847) (-1124.579) (-1122.431) [-1125.635] -- 0:01:45
63000 -- (-1126.597) (-1127.870) [-1127.640] (-1123.980) * (-1125.150) (-1122.678) [-1122.304] (-1121.469) -- 0:01:44
64000 -- (-1126.599) [-1121.349] (-1129.625) (-1129.069) * (-1128.511) (-1124.200) (-1121.256) [-1123.492] -- 0:01:42
65000 -- [-1129.882] (-1127.416) (-1124.777) (-1122.255) * (-1127.271) (-1122.985) [-1126.296] (-1123.373) -- 0:01:40
Average standard deviation of split frequencies: 0.052378
66000 -- (-1126.396) (-1125.721) (-1137.094) [-1123.019] * (-1128.115) (-1126.579) [-1121.575] (-1119.101) -- 0:01:39
67000 -- (-1124.467) (-1123.098) (-1123.188) [-1120.459] * [-1126.820] (-1126.326) (-1126.554) (-1122.727) -- 0:01:51
68000 -- (-1132.866) [-1121.713] (-1128.722) (-1125.094) * (-1124.910) [-1123.275] (-1133.528) (-1120.019) -- 0:01:49
69000 -- (-1126.232) [-1121.267] (-1125.465) (-1120.779) * [-1131.969] (-1126.593) (-1125.574) (-1119.461) -- 0:01:47
70000 -- (-1126.999) [-1125.057] (-1126.517) (-1122.125) * (-1123.987) (-1123.372) (-1122.182) [-1121.135] -- 0:01:46
Average standard deviation of split frequencies: 0.044472
71000 -- (-1129.891) (-1125.172) (-1123.759) [-1122.845] * (-1133.143) (-1121.298) (-1123.559) [-1126.550] -- 0:01:44
72000 -- [-1128.543] (-1125.611) (-1126.945) (-1127.288) * [-1125.099] (-1126.727) (-1126.665) (-1119.945) -- 0:01:43
73000 -- [-1123.894] (-1123.780) (-1124.346) (-1124.125) * [-1124.981] (-1124.226) (-1122.416) (-1127.569) -- 0:01:41
74000 -- (-1123.925) (-1127.435) [-1126.337] (-1124.994) * (-1130.439) (-1118.157) [-1120.230] (-1131.162) -- 0:01:40
75000 -- [-1128.671] (-1124.848) (-1120.830) (-1125.251) * (-1129.072) [-1122.108] (-1122.791) (-1131.120) -- 0:01:38
Average standard deviation of split frequencies: 0.041351
76000 -- (-1124.902) [-1124.096] (-1125.050) (-1127.768) * [-1128.235] (-1119.317) (-1129.443) (-1127.141) -- 0:01:49
77000 -- (-1126.652) [-1131.473] (-1122.468) (-1127.912) * (-1123.755) (-1122.237) [-1125.869] (-1126.630) -- 0:01:47
78000 -- (-1132.631) (-1130.118) (-1124.354) [-1124.438] * [-1123.898] (-1119.020) (-1127.244) (-1124.168) -- 0:01:46
79000 -- [-1124.074] (-1125.325) (-1131.158) (-1124.446) * (-1129.955) (-1121.038) (-1129.086) [-1120.729] -- 0:01:44
80000 -- (-1129.856) (-1140.241) (-1122.762) [-1124.253] * (-1126.314) (-1123.996) (-1129.571) [-1125.607] -- 0:01:43
Average standard deviation of split frequencies: 0.027271
81000 -- (-1126.936) [-1123.937] (-1124.741) (-1122.716) * (-1119.728) [-1122.624] (-1128.975) (-1125.909) -- 0:01:42
82000 -- (-1126.763) (-1126.087) [-1125.045] (-1129.258) * (-1125.097) (-1120.928) (-1125.372) [-1126.520] -- 0:01:40
83000 -- (-1131.494) (-1125.759) [-1122.044] (-1126.632) * (-1126.497) [-1122.324] (-1135.226) (-1124.743) -- 0:01:39
84000 -- [-1124.545] (-1126.194) (-1121.854) (-1124.737) * [-1124.133] (-1127.526) (-1126.271) (-1127.151) -- 0:01:38
85000 -- (-1129.298) (-1131.787) (-1126.444) [-1126.895] * [-1130.245] (-1117.597) (-1128.340) (-1128.997) -- 0:01:47
Average standard deviation of split frequencies: 0.036543
86000 -- (-1129.616) (-1125.247) (-1125.909) [-1125.766] * (-1127.520) (-1121.213) (-1125.925) [-1129.699] -- 0:01:46
87000 -- (-1124.679) (-1124.716) [-1127.437] (-1119.800) * (-1129.080) (-1125.391) [-1126.700] (-1122.472) -- 0:01:44
88000 -- [-1130.829] (-1133.139) (-1125.301) (-1121.938) * [-1124.918] (-1128.748) (-1124.716) (-1134.383) -- 0:01:43
89000 -- (-1130.102) [-1122.484] (-1125.436) (-1128.512) * (-1126.110) [-1122.343] (-1125.613) (-1123.566) -- 0:01:42
90000 -- (-1127.000) [-1124.610] (-1127.895) (-1121.187) * [-1124.725] (-1126.053) (-1124.636) (-1125.277) -- 0:01:41
Average standard deviation of split frequencies: 0.034662
91000 -- (-1125.933) (-1124.024) [-1123.632] (-1128.815) * [-1132.342] (-1123.965) (-1123.391) (-1122.584) -- 0:01:39
92000 -- (-1123.644) (-1124.204) [-1124.308] (-1123.411) * (-1129.105) (-1124.386) (-1127.827) [-1126.006] -- 0:01:38
93000 -- (-1126.394) [-1121.876] (-1124.317) (-1120.707) * (-1129.113) (-1124.793) (-1122.579) [-1128.145] -- 0:01:37
94000 -- [-1129.190] (-1127.663) (-1126.510) (-1125.017) * (-1128.479) (-1122.384) (-1122.863) [-1126.864] -- 0:01:46
95000 -- (-1133.486) (-1127.178) (-1125.731) [-1120.277] * (-1127.633) [-1125.970] (-1129.053) (-1124.182) -- 0:01:44
Average standard deviation of split frequencies: 0.036010
96000 -- (-1124.105) [-1128.832] (-1133.775) (-1124.190) * [-1125.330] (-1129.221) (-1132.161) (-1123.052) -- 0:01:43
97000 -- (-1128.151) (-1133.147) [-1122.447] (-1122.401) * (-1128.930) (-1130.816) [-1124.446] (-1125.840) -- 0:01:42
98000 -- (-1128.191) (-1134.396) [-1123.505] (-1125.420) * (-1131.984) (-1126.902) (-1131.174) [-1121.365] -- 0:01:41
99000 -- (-1128.084) [-1128.950] (-1123.869) (-1124.420) * (-1126.340) [-1127.122] (-1124.412) (-1125.997) -- 0:01:40
100000 -- (-1123.950) [-1126.043] (-1126.737) (-1129.794) * (-1126.287) (-1126.699) [-1124.364] (-1123.641) -- 0:01:39
Average standard deviation of split frequencies: 0.021853
101000 -- [-1127.873] (-1123.972) (-1126.157) (-1126.700) * (-1129.205) (-1132.642) [-1122.879] (-1124.335) -- 0:01:46
102000 -- (-1129.048) (-1128.957) [-1124.306] (-1122.246) * (-1135.342) [-1126.919] (-1121.048) (-1122.536) -- 0:01:45
103000 -- (-1127.383) (-1118.432) (-1124.153) [-1126.397] * [-1127.906] (-1126.237) (-1126.587) (-1126.979) -- 0:01:44
104000 -- [-1125.809] (-1120.944) (-1120.298) (-1127.706) * (-1129.063) [-1124.769] (-1127.717) (-1123.189) -- 0:01:43
105000 -- [-1121.207] (-1123.920) (-1128.320) (-1129.175) * (-1126.093) (-1124.166) [-1123.130] (-1129.100) -- 0:01:42
Average standard deviation of split frequencies: 0.020754
106000 -- [-1127.114] (-1126.710) (-1126.866) (-1122.823) * [-1123.415] (-1125.357) (-1125.886) (-1129.162) -- 0:01:41
107000 -- [-1124.096] (-1129.408) (-1126.222) (-1125.755) * (-1125.044) (-1131.468) [-1124.864] (-1129.393) -- 0:01:40
108000 -- (-1124.837) [-1129.545] (-1126.884) (-1123.521) * (-1131.135) (-1128.511) [-1124.321] (-1126.145) -- 0:01:39
109000 -- [-1119.999] (-1126.773) (-1127.377) (-1125.792) * (-1127.586) (-1129.365) [-1123.590] (-1130.819) -- 0:01:38
110000 -- (-1128.408) [-1129.409] (-1132.448) (-1132.676) * (-1134.950) (-1124.940) (-1123.122) [-1123.994] -- 0:01:45
Average standard deviation of split frequencies: 0.025558
111000 -- (-1137.588) (-1121.748) [-1127.759] (-1124.844) * (-1133.319) (-1126.891) (-1127.105) [-1121.208] -- 0:01:44
112000 -- (-1128.215) (-1125.528) [-1131.348] (-1134.571) * (-1126.071) [-1136.465] (-1125.787) (-1127.031) -- 0:01:43
113000 -- (-1126.721) [-1126.650] (-1124.913) (-1127.473) * (-1125.701) (-1127.667) (-1124.541) [-1127.712] -- 0:01:42
114000 -- (-1121.790) [-1124.831] (-1131.082) (-1129.633) * [-1125.616] (-1126.290) (-1128.535) (-1129.957) -- 0:01:41
115000 -- (-1126.615) (-1125.824) [-1127.190] (-1121.908) * (-1125.284) (-1126.992) [-1120.932] (-1120.894) -- 0:01:40
Average standard deviation of split frequencies: 0.021674
116000 -- (-1123.535) (-1125.438) [-1126.313] (-1119.530) * (-1126.921) [-1124.478] (-1127.652) (-1123.781) -- 0:01:39
117000 -- (-1122.420) [-1122.003] (-1124.703) (-1123.980) * (-1127.996) (-1130.737) [-1120.719] (-1124.202) -- 0:01:38
118000 -- (-1119.803) (-1125.424) [-1125.485] (-1130.251) * (-1132.096) (-1126.171) [-1122.448] (-1125.925) -- 0:01:37
119000 -- (-1130.628) (-1123.237) [-1129.261] (-1122.322) * (-1124.737) (-1123.339) [-1129.574] (-1128.534) -- 0:01:43
120000 -- [-1124.138] (-1125.317) (-1128.098) (-1121.694) * (-1125.770) [-1129.451] (-1127.502) (-1124.140) -- 0:01:42
Average standard deviation of split frequencies: 0.020836
121000 -- [-1129.754] (-1125.187) (-1124.269) (-1129.248) * (-1123.360) [-1126.196] (-1122.951) (-1125.296) -- 0:01:41
122000 -- (-1128.084) (-1128.167) [-1127.848] (-1123.895) * [-1124.402] (-1134.963) (-1129.214) (-1127.185) -- 0:01:40
123000 -- (-1124.816) [-1124.027] (-1126.515) (-1127.341) * (-1123.912) (-1122.325) (-1120.119) [-1123.676] -- 0:01:39
124000 -- (-1123.749) (-1134.123) [-1125.011] (-1121.461) * [-1126.734] (-1124.487) (-1128.284) (-1124.371) -- 0:01:38
125000 -- (-1129.283) (-1127.021) (-1125.673) [-1124.495] * (-1123.102) (-1129.565) [-1127.556] (-1122.187) -- 0:01:38
Average standard deviation of split frequencies: 0.017459
126000 -- [-1129.336] (-1125.362) (-1122.972) (-1126.981) * (-1126.277) [-1126.019] (-1119.247) (-1130.663) -- 0:01:37
127000 -- (-1130.628) (-1121.397) [-1122.063] (-1131.684) * [-1122.648] (-1120.504) (-1124.999) (-1127.420) -- 0:01:36
128000 -- [-1123.988] (-1129.105) (-1128.380) (-1128.886) * (-1122.487) (-1127.700) [-1126.053] (-1132.435) -- 0:01:42
129000 -- [-1123.809] (-1126.846) (-1123.797) (-1126.583) * [-1122.571] (-1128.081) (-1126.233) (-1120.582) -- 0:01:41
130000 -- [-1125.709] (-1125.415) (-1123.930) (-1119.604) * (-1121.419) (-1126.489) [-1122.742] (-1121.000) -- 0:01:40
Average standard deviation of split frequencies: 0.019241
131000 -- (-1125.200) (-1124.682) (-1125.343) [-1123.511] * [-1127.430] (-1127.793) (-1128.555) (-1122.277) -- 0:01:39
132000 -- (-1128.090) [-1119.791] (-1133.120) (-1123.186) * (-1124.470) (-1127.351) (-1121.882) [-1120.557] -- 0:01:38
133000 -- (-1127.265) (-1119.294) (-1131.762) [-1123.665] * (-1128.144) (-1122.316) (-1126.159) [-1121.201] -- 0:01:37
134000 -- (-1126.410) [-1124.625] (-1123.552) (-1134.205) * (-1129.151) (-1131.758) (-1125.328) [-1122.589] -- 0:01:36
135000 -- (-1123.690) (-1126.664) (-1126.212) [-1121.538] * (-1125.847) (-1131.730) [-1121.130] (-1124.741) -- 0:01:36
Average standard deviation of split frequencies: 0.020797
136000 -- (-1125.087) (-1122.914) (-1131.349) [-1122.297] * (-1123.254) (-1131.161) [-1121.815] (-1121.446) -- 0:01:35
137000 -- (-1127.646) (-1125.266) (-1124.213) [-1122.617] * (-1132.508) (-1120.562) [-1131.570] (-1121.828) -- 0:01:40
138000 -- (-1125.993) (-1127.913) (-1122.359) [-1123.114] * (-1126.168) (-1118.491) (-1120.616) [-1121.116] -- 0:01:39
139000 -- [-1127.297] (-1125.765) (-1126.329) (-1123.972) * (-1127.099) (-1124.494) [-1121.101] (-1130.444) -- 0:01:39
140000 -- (-1123.562) (-1127.480) [-1121.804] (-1129.076) * [-1123.541] (-1125.045) (-1118.874) (-1119.111) -- 0:01:38
Average standard deviation of split frequencies: 0.008937
141000 -- (-1128.567) (-1127.721) [-1122.824] (-1123.904) * [-1129.743] (-1133.225) (-1125.148) (-1120.072) -- 0:01:37
142000 -- (-1125.435) (-1130.657) (-1126.798) [-1121.532] * [-1122.195] (-1129.018) (-1124.691) (-1122.836) -- 0:01:36
143000 -- [-1122.393] (-1129.063) (-1124.040) (-1126.238) * [-1121.654] (-1126.459) (-1121.225) (-1121.826) -- 0:01:35
144000 -- (-1127.311) (-1122.885) (-1129.122) [-1125.140] * [-1120.360] (-1129.839) (-1121.054) (-1120.378) -- 0:01:35
145000 -- (-1121.861) (-1125.036) (-1123.305) [-1120.998] * (-1121.951) (-1127.596) (-1127.065) [-1120.383] -- 0:01:34
Average standard deviation of split frequencies: 0.002153
146000 -- (-1126.772) (-1123.431) (-1121.459) [-1125.390] * (-1127.553) [-1134.067] (-1125.551) (-1122.941) -- 0:01:39
147000 -- (-1126.198) (-1121.782) (-1128.499) [-1124.736] * (-1120.830) (-1126.825) (-1128.399) [-1120.129] -- 0:01:38
148000 -- (-1127.866) (-1122.801) [-1127.041] (-1123.851) * (-1123.837) (-1125.772) [-1126.433] (-1125.012) -- 0:01:37
149000 -- [-1124.939] (-1125.072) (-1122.830) (-1124.606) * [-1120.913] (-1128.232) (-1128.687) (-1129.842) -- 0:01:37
150000 -- (-1129.513) [-1126.669] (-1125.761) (-1131.478) * [-1118.871] (-1128.050) (-1125.168) (-1127.247) -- 0:01:36
Average standard deviation of split frequencies: 0.002086
151000 -- (-1126.822) (-1123.854) (-1130.073) [-1127.092] * (-1122.563) (-1127.530) [-1121.228] (-1124.495) -- 0:01:35
152000 -- [-1126.583] (-1124.655) (-1128.824) (-1129.862) * [-1120.483] (-1124.407) (-1128.876) (-1130.236) -- 0:01:34
153000 -- (-1123.595) (-1125.813) [-1132.602] (-1126.176) * [-1120.850] (-1131.361) (-1121.685) (-1122.095) -- 0:01:34
154000 -- (-1128.010) (-1119.002) (-1135.938) [-1126.685] * (-1130.110) (-1126.759) (-1120.375) [-1125.385] -- 0:01:33
155000 -- (-1125.087) (-1126.814) (-1124.946) [-1121.220] * (-1124.691) (-1124.754) (-1127.047) [-1124.597] -- 0:01:38
Average standard deviation of split frequencies: 0.004029
156000 -- (-1125.467) (-1121.116) (-1128.603) [-1122.867] * (-1128.587) [-1128.176] (-1127.130) (-1124.534) -- 0:01:37
157000 -- (-1130.665) [-1124.193] (-1122.604) (-1127.648) * (-1121.589) [-1126.050] (-1123.449) (-1120.984) -- 0:01:36
158000 -- (-1135.519) (-1128.038) (-1127.000) [-1126.414] * (-1136.979) [-1126.010] (-1121.789) (-1131.200) -- 0:01:35
159000 -- [-1129.898] (-1122.291) (-1124.636) (-1127.170) * (-1134.169) (-1129.530) [-1128.909] (-1133.003) -- 0:01:35
160000 -- (-1131.517) [-1124.536] (-1124.167) (-1127.939) * (-1129.567) (-1127.502) [-1121.468] (-1122.579) -- 0:01:34
Average standard deviation of split frequencies: 0.007824
161000 -- (-1130.071) [-1121.649] (-1124.490) (-1122.984) * (-1131.421) (-1129.895) (-1126.235) [-1123.496] -- 0:01:33
162000 -- [-1131.915] (-1125.469) (-1125.058) (-1132.722) * (-1125.315) [-1127.841] (-1123.377) (-1125.916) -- 0:01:33
163000 -- (-1126.985) (-1122.327) [-1123.487] (-1126.346) * (-1127.282) (-1122.837) (-1128.609) [-1127.324] -- 0:01:32
164000 -- [-1123.871] (-1121.186) (-1126.368) (-1122.638) * (-1122.941) (-1127.834) [-1128.955] (-1125.653) -- 0:01:36
165000 -- [-1119.456] (-1122.582) (-1123.008) (-1125.193) * (-1125.194) (-1123.168) (-1119.224) [-1125.164] -- 0:01:36
Average standard deviation of split frequencies: 0.009466
166000 -- [-1123.636] (-1128.346) (-1131.482) (-1124.855) * (-1122.419) (-1130.280) [-1119.745] (-1128.240) -- 0:01:35
167000 -- [-1120.894] (-1122.837) (-1124.388) (-1120.643) * (-1127.842) [-1128.899] (-1123.596) (-1117.961) -- 0:01:34
168000 -- [-1122.475] (-1128.008) (-1127.245) (-1126.316) * (-1124.492) (-1125.330) [-1120.857] (-1121.742) -- 0:01:34
169000 -- (-1122.121) (-1132.600) (-1126.623) [-1121.060] * (-1131.906) (-1123.778) (-1122.506) [-1126.668] -- 0:01:33
170000 -- (-1123.582) (-1123.286) (-1125.326) [-1123.896] * (-1128.337) (-1124.208) [-1122.370] (-1122.570) -- 0:01:32
Average standard deviation of split frequencies: 0.016573
171000 -- (-1123.808) (-1126.147) [-1127.086] (-1126.968) * (-1130.614) [-1122.897] (-1122.168) (-1119.593) -- 0:01:32
172000 -- (-1128.207) (-1123.249) (-1121.600) [-1127.765] * (-1134.486) (-1124.994) [-1127.243] (-1126.471) -- 0:01:31
173000 -- [-1121.833] (-1131.526) (-1126.501) (-1123.979) * (-1125.813) [-1128.843] (-1129.521) (-1123.428) -- 0:01:35
174000 -- (-1125.718) (-1124.635) [-1121.376] (-1125.174) * (-1126.910) [-1124.890] (-1122.794) (-1121.944) -- 0:01:34
175000 -- [-1124.406] (-1128.238) (-1129.000) (-1123.932) * (-1129.394) (-1127.738) [-1125.163] (-1122.075) -- 0:01:34
Average standard deviation of split frequencies: 0.008928
176000 -- [-1122.825] (-1128.882) (-1119.499) (-1120.918) * (-1126.426) (-1124.215) (-1123.961) [-1121.697] -- 0:01:33
177000 -- (-1130.753) [-1125.105] (-1119.780) (-1127.145) * (-1128.099) (-1127.681) (-1124.666) [-1123.282] -- 0:01:32
178000 -- (-1129.022) (-1123.350) (-1122.255) [-1119.182] * [-1125.873] (-1126.707) (-1126.545) (-1123.910) -- 0:01:32
179000 -- (-1128.052) (-1126.594) (-1125.015) [-1122.281] * (-1124.432) (-1128.011) [-1122.886] (-1127.553) -- 0:01:31
180000 -- (-1121.847) (-1125.052) (-1128.392) [-1121.849] * [-1121.691] (-1123.719) (-1119.471) (-1125.995) -- 0:01:31
Average standard deviation of split frequencies: 0.008698
181000 -- [-1121.714] (-1124.177) (-1127.589) (-1129.535) * (-1131.817) (-1136.129) [-1125.137] (-1121.140) -- 0:01:35
182000 -- (-1126.913) [-1123.812] (-1128.120) (-1123.820) * (-1121.785) (-1121.361) [-1123.877] (-1126.284) -- 0:01:34
183000 -- [-1127.527] (-1129.072) (-1133.730) (-1122.578) * (-1130.051) (-1128.478) [-1123.883] (-1126.176) -- 0:01:33
184000 -- (-1127.269) (-1121.102) [-1125.397] (-1120.645) * (-1127.503) [-1121.792] (-1121.494) (-1120.650) -- 0:01:33
185000 -- (-1127.279) [-1120.563] (-1125.210) (-1120.240) * (-1124.061) (-1126.458) (-1120.791) [-1122.959] -- 0:01:32
Average standard deviation of split frequencies: 0.006758
186000 -- [-1127.412] (-1121.403) (-1125.127) (-1126.561) * (-1119.290) (-1129.442) [-1127.564] (-1125.082) -- 0:01:31
187000 -- (-1122.281) [-1122.710] (-1134.248) (-1124.310) * (-1126.160) [-1122.680] (-1129.946) (-1125.468) -- 0:01:31
188000 -- (-1122.196) (-1127.021) (-1124.615) [-1122.486] * (-1122.221) [-1121.888] (-1119.276) (-1130.732) -- 0:01:30
189000 -- (-1122.218) [-1130.379] (-1123.096) (-1124.928) * [-1124.592] (-1120.516) (-1125.358) (-1126.652) -- 0:01:30
190000 -- (-1121.312) (-1119.814) [-1125.781] (-1126.265) * [-1130.778] (-1125.329) (-1122.212) (-1124.120) -- 0:01:33
Average standard deviation of split frequencies: 0.006593
191000 -- [-1124.652] (-1124.728) (-1126.399) (-1123.389) * (-1127.035) [-1119.644] (-1124.641) (-1124.470) -- 0:01:33
192000 -- (-1126.199) (-1126.509) (-1123.473) [-1125.550] * (-1123.471) (-1119.319) (-1125.230) [-1121.614] -- 0:01:32
193000 -- (-1128.241) [-1122.233] (-1124.313) (-1125.947) * [-1126.403] (-1124.059) (-1124.229) (-1123.465) -- 0:01:31
194000 -- (-1119.899) (-1133.872) [-1125.859] (-1125.363) * (-1127.782) (-1130.303) [-1120.916] (-1123.919) -- 0:01:31
195000 -- [-1120.353] (-1126.165) (-1124.541) (-1128.631) * [-1126.780] (-1131.259) (-1123.637) (-1124.512) -- 0:01:30
Average standard deviation of split frequencies: 0.008017
196000 -- (-1125.090) [-1124.049] (-1123.428) (-1131.121) * (-1128.604) (-1123.234) [-1121.627] (-1128.638) -- 0:01:30
197000 -- (-1123.357) (-1131.954) (-1121.987) [-1125.111] * (-1134.270) (-1127.094) (-1123.264) [-1129.742] -- 0:01:29
198000 -- (-1122.514) (-1121.418) [-1127.140] (-1120.562) * (-1131.133) (-1126.145) (-1121.467) [-1120.686] -- 0:01:29
199000 -- [-1120.046] (-1124.532) (-1129.816) (-1121.348) * (-1125.034) (-1123.254) [-1122.535] (-1122.770) -- 0:01:32
200000 -- (-1125.508) [-1129.854] (-1123.394) (-1120.159) * (-1132.982) [-1124.525] (-1125.841) (-1124.102) -- 0:01:32
Average standard deviation of split frequencies: 0.009397
201000 -- (-1122.002) [-1124.776] (-1125.070) (-1121.963) * (-1130.387) (-1127.160) [-1122.667] (-1123.937) -- 0:01:31
202000 -- (-1130.033) [-1131.689] (-1127.130) (-1125.580) * [-1129.288] (-1125.999) (-1131.460) (-1125.188) -- 0:01:30
203000 -- (-1131.011) (-1125.376) (-1123.264) [-1123.390] * [-1129.296] (-1122.458) (-1132.709) (-1128.595) -- 0:01:30
204000 -- [-1124.652] (-1125.596) (-1121.919) (-1125.433) * (-1124.503) (-1123.233) [-1123.417] (-1125.413) -- 0:01:29
205000 -- (-1126.766) (-1125.304) [-1125.863] (-1132.815) * (-1126.173) [-1124.169] (-1129.765) (-1123.386) -- 0:01:29
Average standard deviation of split frequencies: 0.012205
206000 -- (-1129.960) (-1125.816) [-1123.189] (-1129.510) * (-1121.453) (-1125.045) (-1125.894) [-1126.317] -- 0:01:28
207000 -- (-1122.702) (-1121.834) [-1123.338] (-1131.151) * (-1129.567) [-1125.560] (-1126.048) (-1123.285) -- 0:01:28
208000 -- [-1124.909] (-1125.715) (-1129.761) (-1128.568) * (-1124.598) (-1121.180) [-1124.208] (-1128.664) -- 0:01:31
209000 -- (-1124.189) [-1120.362] (-1126.492) (-1124.428) * [-1123.397] (-1123.720) (-1124.426) (-1125.805) -- 0:01:30
210000 -- [-1126.720] (-1129.297) (-1131.533) (-1127.909) * (-1125.354) (-1124.738) (-1125.966) [-1122.287] -- 0:01:30
Average standard deviation of split frequencies: 0.007459
211000 -- (-1126.856) (-1124.101) (-1125.236) [-1128.134] * (-1124.777) (-1122.308) [-1120.682] (-1123.118) -- 0:01:29
212000 -- (-1123.696) (-1123.120) [-1131.195] (-1128.207) * [-1124.598] (-1124.932) (-1125.964) (-1124.032) -- 0:01:29
213000 -- (-1130.301) [-1129.369] (-1135.654) (-1134.420) * (-1124.356) (-1122.723) [-1122.760] (-1130.389) -- 0:01:28
214000 -- (-1121.027) (-1124.956) (-1131.504) [-1126.332] * (-1122.075) (-1124.752) [-1125.319] (-1126.359) -- 0:01:28
215000 -- [-1125.985] (-1123.769) (-1124.441) (-1120.242) * [-1120.770] (-1124.485) (-1123.533) (-1122.398) -- 0:01:27
Average standard deviation of split frequencies: 0.005820
216000 -- (-1123.798) (-1125.155) [-1125.222] (-1126.759) * [-1124.732] (-1130.108) (-1121.623) (-1127.864) -- 0:01:30
217000 -- (-1125.294) (-1123.261) [-1128.654] (-1123.759) * (-1127.504) [-1126.801] (-1127.890) (-1131.083) -- 0:01:30
218000 -- (-1122.909) (-1123.750) [-1125.607] (-1127.155) * (-1122.031) (-1125.880) [-1118.075] (-1127.445) -- 0:01:29
219000 -- (-1122.603) (-1126.562) (-1126.525) [-1121.903] * (-1127.735) [-1121.412] (-1121.585) (-1126.488) -- 0:01:29
220000 -- (-1121.883) (-1125.920) [-1129.161] (-1120.714) * (-1131.906) [-1125.065] (-1121.170) (-1128.727) -- 0:01:28
Average standard deviation of split frequencies: 0.001424
221000 -- [-1123.722] (-1127.070) (-1131.471) (-1118.515) * [-1126.762] (-1127.366) (-1124.116) (-1125.892) -- 0:01:28
222000 -- (-1125.056) [-1126.000] (-1126.925) (-1127.982) * [-1130.911] (-1123.895) (-1126.048) (-1136.854) -- 0:01:27
223000 -- (-1125.033) (-1134.478) (-1124.985) [-1121.225] * [-1130.810] (-1124.753) (-1124.029) (-1129.685) -- 0:01:27
224000 -- [-1122.471] (-1125.940) (-1126.765) (-1125.211) * (-1128.079) (-1117.282) (-1127.872) [-1129.751] -- 0:01:26
225000 -- (-1124.615) [-1126.309] (-1122.654) (-1122.463) * [-1117.938] (-1121.143) (-1122.015) (-1126.729) -- 0:01:29
Average standard deviation of split frequencies: 0.006953
226000 -- [-1125.706] (-1127.569) (-1124.823) (-1120.877) * (-1121.293) (-1128.809) [-1125.086] (-1127.264) -- 0:01:29
227000 -- [-1119.776] (-1123.253) (-1129.119) (-1126.808) * [-1122.991] (-1127.193) (-1123.549) (-1125.718) -- 0:01:28
228000 -- (-1122.307) (-1121.594) [-1126.583] (-1132.779) * [-1127.413] (-1128.762) (-1119.281) (-1125.113) -- 0:01:28
229000 -- (-1122.333) [-1126.843] (-1124.684) (-1128.193) * [-1128.078] (-1122.298) (-1120.839) (-1124.254) -- 0:01:27
230000 -- (-1124.965) [-1125.677] (-1121.986) (-1123.290) * (-1126.494) [-1120.497] (-1122.877) (-1129.218) -- 0:01:27
Average standard deviation of split frequencies: 0.012262
231000 -- [-1119.734] (-1123.374) (-1126.320) (-1129.741) * (-1122.046) [-1125.083] (-1122.168) (-1124.862) -- 0:01:26
232000 -- [-1120.183] (-1123.867) (-1125.750) (-1125.356) * (-1123.119) (-1123.551) [-1121.431] (-1126.474) -- 0:01:26
233000 -- [-1122.308] (-1122.396) (-1131.086) (-1122.947) * (-1130.944) (-1123.377) [-1125.575] (-1122.142) -- 0:01:25
234000 -- [-1123.839] (-1121.214) (-1128.440) (-1123.590) * [-1126.755] (-1122.722) (-1123.786) (-1124.528) -- 0:01:28
235000 -- (-1123.657) [-1125.526] (-1122.636) (-1127.198) * [-1125.692] (-1124.134) (-1130.511) (-1126.156) -- 0:01:27
Average standard deviation of split frequencies: 0.014648
236000 -- (-1127.907) (-1128.264) [-1128.955] (-1123.418) * [-1124.028] (-1124.028) (-1128.438) (-1128.264) -- 0:01:27
237000 -- [-1119.777] (-1124.437) (-1130.516) (-1120.553) * (-1120.680) [-1125.140] (-1136.318) (-1121.696) -- 0:01:26
238000 -- (-1134.058) (-1127.932) (-1132.146) [-1124.890] * (-1128.935) [-1124.231] (-1129.262) (-1124.826) -- 0:01:26
239000 -- (-1128.254) [-1123.020] (-1133.646) (-1134.218) * (-1120.712) (-1125.296) [-1124.131] (-1125.211) -- 0:01:25
240000 -- (-1123.033) [-1124.568] (-1128.165) (-1125.467) * [-1119.177] (-1124.835) (-1127.273) (-1124.337) -- 0:01:25
Average standard deviation of split frequencies: 0.015670
241000 -- [-1126.768] (-1123.918) (-1128.877) (-1125.643) * (-1121.270) (-1126.035) (-1123.118) [-1121.168] -- 0:01:25
242000 -- (-1128.786) [-1125.073] (-1129.224) (-1125.642) * (-1125.487) [-1130.189] (-1120.843) (-1126.856) -- 0:01:24
243000 -- (-1126.372) (-1121.978) (-1133.448) [-1134.246] * (-1126.200) (-1124.581) (-1126.302) [-1122.358] -- 0:01:27
244000 -- [-1124.254] (-1124.666) (-1130.988) (-1130.022) * (-1122.526) [-1127.278] (-1130.822) (-1124.291) -- 0:01:26
245000 -- (-1125.846) [-1126.637] (-1134.738) (-1120.822) * [-1122.772] (-1122.751) (-1131.049) (-1124.011) -- 0:01:26
Average standard deviation of split frequencies: 0.017885
246000 -- (-1123.821) (-1128.816) [-1124.560] (-1123.138) * (-1120.280) (-1125.426) [-1124.196] (-1125.347) -- 0:01:25
247000 -- [-1125.826] (-1129.183) (-1130.920) (-1120.067) * [-1125.537] (-1127.205) (-1127.152) (-1121.994) -- 0:01:25
248000 -- (-1128.640) (-1128.197) (-1125.424) [-1121.650] * (-1124.785) (-1131.000) [-1127.192] (-1126.212) -- 0:01:24
249000 -- (-1122.049) [-1122.052] (-1127.045) (-1126.088) * (-1124.347) [-1130.423] (-1131.475) (-1130.167) -- 0:01:24
250000 -- [-1122.605] (-1124.723) (-1121.895) (-1128.599) * (-1126.115) (-1133.656) [-1124.873] (-1125.807) -- 0:01:24
Average standard deviation of split frequencies: 0.021314
251000 -- (-1121.440) (-1125.888) [-1119.141] (-1128.520) * [-1127.126] (-1125.165) (-1121.912) (-1128.456) -- 0:01:26
252000 -- (-1128.374) (-1122.671) (-1126.181) [-1123.704] * (-1128.477) (-1126.141) (-1124.106) [-1127.402] -- 0:01:26
253000 -- (-1121.045) (-1126.208) [-1122.889] (-1126.871) * (-1126.678) (-1127.754) [-1124.999] (-1121.910) -- 0:01:25
254000 -- (-1124.925) [-1121.706] (-1121.459) (-1127.255) * (-1131.663) (-1125.587) (-1128.718) [-1123.136] -- 0:01:25
255000 -- (-1124.683) [-1123.885] (-1131.170) (-1127.118) * (-1127.763) [-1122.038] (-1124.178) (-1127.231) -- 0:01:24
Average standard deviation of split frequencies: 0.019642
256000 -- (-1130.908) (-1126.376) [-1128.576] (-1122.172) * [-1124.228] (-1125.030) (-1125.606) (-1126.270) -- 0:01:24
257000 -- (-1129.322) (-1128.686) (-1124.277) [-1124.229] * [-1126.919] (-1126.609) (-1121.614) (-1128.408) -- 0:01:23
258000 -- (-1127.042) (-1119.024) (-1126.528) [-1123.144] * (-1120.495) [-1123.576] (-1127.750) (-1138.816) -- 0:01:23
259000 -- (-1128.321) [-1118.607] (-1128.097) (-1128.976) * (-1124.725) [-1126.148] (-1121.637) (-1129.380) -- 0:01:22
260000 -- (-1120.750) (-1123.951) [-1125.719] (-1131.438) * [-1121.803] (-1126.268) (-1126.523) (-1130.173) -- 0:01:25
Average standard deviation of split frequencies: 0.015673
261000 -- (-1121.165) [-1121.048] (-1127.715) (-1123.962) * (-1125.992) [-1122.302] (-1123.548) (-1125.007) -- 0:01:24
262000 -- (-1128.519) (-1121.925) (-1127.335) [-1121.832] * (-1122.547) [-1126.755] (-1126.347) (-1121.374) -- 0:01:24
263000 -- [-1121.951] (-1123.636) (-1129.105) (-1125.786) * (-1128.877) [-1125.721] (-1129.772) (-1131.825) -- 0:01:24
264000 -- [-1129.103] (-1124.574) (-1121.600) (-1124.862) * [-1123.067] (-1128.266) (-1127.408) (-1126.069) -- 0:01:23
265000 -- (-1126.768) [-1130.001] (-1122.269) (-1128.708) * (-1124.247) [-1123.070] (-1128.040) (-1127.773) -- 0:01:23
Average standard deviation of split frequencies: 0.016541
266000 -- (-1124.899) [-1124.452] (-1124.015) (-1127.281) * [-1127.195] (-1122.263) (-1128.063) (-1125.761) -- 0:01:22
267000 -- (-1125.779) (-1127.390) [-1123.951] (-1128.671) * (-1121.815) (-1128.931) [-1128.428] (-1128.522) -- 0:01:22
268000 -- (-1125.781) (-1127.992) [-1128.587] (-1127.522) * [-1121.430] (-1124.634) (-1121.715) (-1126.654) -- 0:01:24
269000 -- (-1123.042) (-1124.125) [-1122.505] (-1130.010) * [-1124.271] (-1130.616) (-1127.028) (-1124.666) -- 0:01:24
270000 -- (-1128.110) [-1124.074] (-1120.730) (-1127.876) * (-1126.478) [-1128.193] (-1126.279) (-1130.140) -- 0:01:23
Average standard deviation of split frequencies: 0.015094
271000 -- [-1124.168] (-1122.721) (-1124.879) (-1122.512) * (-1120.217) (-1128.262) (-1127.915) [-1131.422] -- 0:01:23
272000 -- (-1122.934) (-1122.684) [-1124.423] (-1123.449) * (-1124.769) (-1130.883) [-1122.832] (-1127.936) -- 0:01:22
273000 -- (-1127.898) [-1121.144] (-1122.822) (-1129.551) * (-1124.849) (-1128.599) [-1125.604] (-1130.950) -- 0:01:22
274000 -- (-1123.120) (-1118.280) (-1128.472) [-1124.432] * (-1125.173) (-1127.588) (-1125.091) [-1128.387] -- 0:01:22
275000 -- (-1123.116) (-1129.511) [-1127.944] (-1132.970) * (-1126.078) (-1125.276) (-1122.916) [-1127.738] -- 0:01:21
Average standard deviation of split frequencies: 0.015941
276000 -- (-1127.996) (-1135.033) [-1124.293] (-1126.055) * [-1122.655] (-1127.114) (-1130.998) (-1129.684) -- 0:01:21
277000 -- (-1126.054) [-1121.726] (-1132.285) (-1120.599) * (-1124.815) (-1129.906) (-1122.944) [-1125.136] -- 0:01:23
278000 -- (-1126.035) [-1131.831] (-1123.410) (-1126.470) * [-1123.628] (-1121.557) (-1125.919) (-1125.627) -- 0:01:23
279000 -- [-1119.613] (-1130.358) (-1122.460) (-1130.018) * [-1122.723] (-1126.167) (-1125.900) (-1125.776) -- 0:01:22
280000 -- (-1122.400) [-1123.889] (-1127.547) (-1127.550) * (-1126.387) (-1126.444) [-1123.562] (-1127.462) -- 0:01:22
Average standard deviation of split frequencies: 0.010078
281000 -- (-1125.643) (-1124.048) (-1122.288) [-1119.492] * [-1120.063] (-1123.327) (-1126.369) (-1124.926) -- 0:01:21
282000 -- (-1127.605) (-1134.984) (-1123.428) [-1124.696] * [-1122.907] (-1128.508) (-1129.155) (-1126.821) -- 0:01:21
283000 -- (-1128.498) (-1122.692) (-1124.877) [-1122.481] * (-1122.595) (-1129.468) [-1124.687] (-1132.781) -- 0:01:21
284000 -- (-1123.011) (-1133.308) [-1123.804] (-1126.646) * (-1126.605) [-1122.532] (-1128.963) (-1130.151) -- 0:01:20
285000 -- [-1118.120] (-1128.100) (-1122.969) (-1131.019) * [-1123.438] (-1125.119) (-1124.810) (-1126.063) -- 0:01:20
Average standard deviation of split frequencies: 0.006593
286000 -- [-1123.678] (-1130.143) (-1123.290) (-1132.772) * (-1122.359) (-1119.452) (-1127.264) [-1122.784] -- 0:01:19
287000 -- [-1125.732] (-1127.046) (-1118.683) (-1126.302) * (-1127.200) (-1120.990) (-1129.792) [-1119.918] -- 0:01:21
288000 -- (-1129.957) [-1125.819] (-1123.829) (-1122.336) * (-1122.362) (-1123.242) [-1125.617] (-1119.539) -- 0:01:21
289000 -- (-1127.714) (-1128.434) [-1123.214] (-1130.580) * [-1126.154] (-1125.558) (-1129.865) (-1123.592) -- 0:01:21
290000 -- (-1131.715) (-1125.604) (-1128.802) [-1122.483] * (-1120.685) (-1130.902) (-1127.183) [-1123.039] -- 0:01:20
Average standard deviation of split frequencies: 0.008650
291000 -- (-1134.148) (-1132.300) (-1125.507) [-1121.474] * (-1123.858) [-1119.644] (-1125.425) (-1122.860) -- 0:01:20
292000 -- (-1128.360) (-1132.565) [-1127.072] (-1131.387) * [-1120.510] (-1123.459) (-1127.840) (-1122.535) -- 0:01:20
293000 -- (-1131.093) [-1125.828] (-1125.062) (-1126.727) * (-1121.617) (-1123.044) (-1130.380) [-1122.323] -- 0:01:19
294000 -- (-1123.140) [-1119.196] (-1126.831) (-1127.237) * (-1127.101) [-1121.458] (-1124.792) (-1122.917) -- 0:01:19
295000 -- (-1120.941) [-1124.393] (-1127.133) (-1121.729) * (-1128.659) (-1127.141) [-1121.933] (-1124.398) -- 0:01:21
Average standard deviation of split frequencies: 0.007432
296000 -- (-1125.995) [-1119.687] (-1127.658) (-1120.945) * (-1120.809) (-1126.822) (-1124.913) [-1123.098] -- 0:01:20
297000 -- (-1123.104) (-1122.767) (-1131.403) [-1120.406] * (-1118.980) [-1127.970] (-1124.749) (-1119.888) -- 0:01:20
298000 -- (-1126.980) [-1123.240] (-1125.751) (-1124.378) * (-1123.599) (-1130.552) [-1127.705] (-1119.418) -- 0:01:20
299000 -- [-1126.861] (-1124.357) (-1127.992) (-1119.676) * (-1127.302) (-1125.601) (-1127.449) [-1126.632] -- 0:01:19
300000 -- (-1131.211) (-1127.768) (-1123.494) [-1124.571] * [-1121.792] (-1124.233) (-1130.089) (-1121.168) -- 0:01:19
Average standard deviation of split frequencies: 0.004181
301000 -- (-1123.809) (-1126.088) (-1121.728) [-1121.446] * (-1123.561) (-1121.683) [-1124.801] (-1127.744) -- 0:01:18
302000 -- (-1124.544) (-1129.023) [-1122.785] (-1121.417) * (-1128.966) (-1125.626) (-1127.443) [-1131.365] -- 0:01:18
303000 -- (-1129.361) (-1124.122) [-1124.127] (-1126.559) * [-1119.913] (-1122.446) (-1123.472) (-1130.012) -- 0:01:18
304000 -- (-1129.811) (-1125.287) (-1124.420) [-1120.733] * (-1122.736) (-1121.985) (-1126.398) [-1129.871] -- 0:01:20
305000 -- (-1127.650) [-1128.280] (-1122.478) (-1127.122) * (-1122.716) [-1125.248] (-1127.306) (-1122.996) -- 0:01:19
Average standard deviation of split frequencies: 0.008216
306000 -- [-1122.510] (-1130.140) (-1120.798) (-1126.616) * [-1128.049] (-1129.725) (-1127.876) (-1121.362) -- 0:01:19
307000 -- (-1132.897) (-1122.684) (-1125.007) [-1127.573] * (-1124.078) (-1127.852) [-1120.298] (-1124.301) -- 0:01:19
308000 -- (-1127.204) (-1128.352) [-1125.134] (-1127.113) * [-1125.369] (-1122.882) (-1122.241) (-1125.002) -- 0:01:18
309000 -- (-1129.267) (-1124.521) (-1140.139) [-1124.361] * (-1122.447) (-1124.119) [-1130.170] (-1120.364) -- 0:01:18
310000 -- [-1122.380] (-1133.191) (-1128.117) (-1128.678) * [-1128.494] (-1122.932) (-1129.184) (-1121.848) -- 0:01:17
Average standard deviation of split frequencies: 0.008093
311000 -- [-1125.059] (-1132.119) (-1127.827) (-1124.432) * (-1119.170) [-1127.515] (-1124.147) (-1127.496) -- 0:01:17
312000 -- (-1125.674) (-1127.284) (-1126.330) [-1122.794] * (-1124.928) [-1128.183] (-1126.900) (-1128.314) -- 0:01:17
313000 -- [-1128.925] (-1126.383) (-1130.694) (-1122.349) * (-1128.395) (-1126.679) (-1121.844) [-1130.012] -- 0:01:19
314000 -- (-1126.032) (-1130.975) [-1125.532] (-1123.683) * (-1121.940) (-1121.348) [-1121.413] (-1126.826) -- 0:01:18
315000 -- (-1126.715) (-1124.367) [-1122.518] (-1132.442) * (-1124.660) [-1123.465] (-1126.350) (-1127.357) -- 0:01:18
Average standard deviation of split frequencies: 0.007956
316000 -- (-1122.903) (-1127.522) [-1124.153] (-1124.262) * (-1132.015) [-1121.589] (-1123.657) (-1123.442) -- 0:01:17
317000 -- [-1125.217] (-1131.421) (-1132.439) (-1125.361) * [-1124.094] (-1124.979) (-1125.231) (-1124.332) -- 0:01:17
318000 -- [-1121.712] (-1130.177) (-1124.491) (-1123.050) * [-1123.567] (-1120.458) (-1126.702) (-1130.446) -- 0:01:17
319000 -- (-1124.618) (-1121.308) [-1123.273] (-1126.244) * (-1126.042) (-1132.788) [-1122.559] (-1128.529) -- 0:01:16
320000 -- [-1121.904] (-1126.809) (-1122.456) (-1127.972) * (-1128.981) (-1124.865) [-1120.533] (-1135.334) -- 0:01:16
Average standard deviation of split frequencies: 0.010781
321000 -- (-1125.942) [-1124.011] (-1124.402) (-1125.109) * (-1123.179) [-1126.731] (-1122.674) (-1131.248) -- 0:01:16
322000 -- (-1126.308) [-1125.535] (-1126.568) (-1122.403) * (-1124.247) [-1122.016] (-1131.993) (-1123.965) -- 0:01:17
323000 -- (-1127.529) (-1121.808) (-1127.913) [-1119.910] * (-1125.983) [-1126.786] (-1129.397) (-1122.195) -- 0:01:17
324000 -- (-1126.513) [-1125.326] (-1128.539) (-1120.775) * (-1118.620) (-1125.116) [-1122.563] (-1128.062) -- 0:01:17
325000 -- [-1122.605] (-1125.902) (-1123.938) (-1126.869) * [-1130.979] (-1123.124) (-1126.689) (-1126.985) -- 0:01:16
Average standard deviation of split frequencies: 0.013496
326000 -- (-1120.337) [-1120.396] (-1122.430) (-1122.164) * (-1127.906) (-1123.285) (-1124.016) [-1123.181] -- 0:01:16
327000 -- [-1120.027] (-1123.939) (-1121.920) (-1125.766) * (-1127.740) [-1120.250] (-1123.484) (-1122.288) -- 0:01:16
328000 -- [-1121.514] (-1127.136) (-1125.990) (-1121.292) * (-1120.777) [-1123.386] (-1132.337) (-1128.395) -- 0:01:15
329000 -- (-1120.301) [-1121.077] (-1125.003) (-1122.416) * (-1121.552) (-1123.339) (-1120.150) [-1123.604] -- 0:01:15
330000 -- [-1122.202] (-1124.082) (-1124.346) (-1126.308) * (-1129.092) (-1127.935) [-1122.130] (-1122.800) -- 0:01:15
Average standard deviation of split frequencies: 0.018058
331000 -- [-1123.413] (-1123.341) (-1124.612) (-1125.800) * [-1127.640] (-1126.090) (-1130.465) (-1126.705) -- 0:01:16
332000 -- [-1122.700] (-1121.720) (-1132.496) (-1127.908) * [-1123.841] (-1130.510) (-1122.360) (-1127.162) -- 0:01:16
333000 -- [-1121.151] (-1130.263) (-1124.217) (-1129.047) * [-1127.724] (-1129.937) (-1124.424) (-1130.060) -- 0:01:16
334000 -- [-1123.879] (-1121.341) (-1127.005) (-1123.435) * [-1121.983] (-1129.546) (-1129.651) (-1125.054) -- 0:01:15
335000 -- (-1127.047) (-1122.809) [-1123.796] (-1127.739) * (-1129.063) [-1128.869] (-1126.991) (-1123.884) -- 0:01:15
Average standard deviation of split frequencies: 0.018707
336000 -- (-1132.803) [-1126.492] (-1124.269) (-1125.606) * (-1137.904) (-1126.563) [-1123.802] (-1122.021) -- 0:01:15
337000 -- [-1126.839] (-1134.963) (-1125.198) (-1133.360) * (-1127.220) (-1128.984) [-1123.044] (-1130.833) -- 0:01:14
338000 -- [-1121.982] (-1125.793) (-1130.848) (-1124.735) * (-1134.169) (-1133.421) (-1125.592) [-1121.776] -- 0:01:14
339000 -- (-1126.729) (-1129.738) (-1131.322) [-1122.528] * (-1130.684) (-1130.525) (-1130.239) [-1124.991] -- 0:01:14
340000 -- (-1122.668) (-1130.188) (-1126.072) [-1126.856] * [-1125.843] (-1120.239) (-1128.568) (-1124.361) -- 0:01:15
Average standard deviation of split frequencies: 0.016605
341000 -- (-1122.899) (-1128.302) (-1123.963) [-1125.308] * (-1129.743) (-1123.914) (-1125.127) [-1122.625] -- 0:01:15
342000 -- (-1127.671) (-1129.580) (-1122.588) [-1123.747] * (-1124.035) (-1130.677) (-1125.344) [-1128.873] -- 0:01:15
343000 -- (-1128.129) (-1125.737) (-1121.055) [-1130.887] * (-1122.851) (-1138.139) [-1125.546] (-1123.305) -- 0:01:14
344000 -- [-1124.556] (-1128.924) (-1129.809) (-1133.739) * (-1123.615) (-1125.873) [-1123.399] (-1128.670) -- 0:01:14
345000 -- (-1131.542) [-1123.345] (-1127.481) (-1124.120) * [-1122.498] (-1121.766) (-1131.066) (-1127.247) -- 0:01:14
Average standard deviation of split frequencies: 0.016349
346000 -- (-1125.044) (-1124.317) [-1121.620] (-1134.882) * [-1120.038] (-1126.992) (-1126.765) (-1127.081) -- 0:01:13
347000 -- (-1122.698) (-1121.691) (-1123.575) [-1127.077] * [-1129.690] (-1128.446) (-1130.787) (-1127.290) -- 0:01:13
348000 -- (-1119.013) (-1123.266) [-1122.603] (-1124.606) * (-1131.075) [-1125.698] (-1130.392) (-1132.023) -- 0:01:13
349000 -- (-1122.490) [-1119.596] (-1127.377) (-1126.149) * (-1131.240) (-1130.748) (-1129.090) [-1127.042] -- 0:01:14
350000 -- (-1126.781) (-1128.996) (-1127.483) [-1126.744] * (-1129.939) (-1128.563) [-1127.403] (-1127.604) -- 0:01:14
Average standard deviation of split frequencies: 0.014339
351000 -- (-1130.680) (-1128.663) (-1129.118) [-1128.259] * (-1130.855) [-1121.457] (-1126.275) (-1127.641) -- 0:01:13
352000 -- [-1126.239] (-1123.067) (-1129.685) (-1135.240) * (-1128.017) [-1125.133] (-1126.845) (-1133.302) -- 0:01:13
353000 -- (-1123.495) (-1127.764) (-1130.101) [-1125.895] * (-1124.050) (-1125.316) [-1122.859] (-1125.769) -- 0:01:13
354000 -- (-1125.062) (-1126.636) (-1128.339) [-1125.147] * (-1124.355) (-1129.356) [-1125.894] (-1128.226) -- 0:01:12
355000 -- [-1126.375] (-1122.888) (-1118.414) (-1124.903) * (-1129.890) (-1122.179) [-1124.484] (-1128.861) -- 0:01:12
Average standard deviation of split frequencies: 0.016773
356000 -- [-1121.849] (-1123.107) (-1128.806) (-1125.627) * (-1127.359) [-1126.697] (-1130.981) (-1125.349) -- 0:01:12
357000 -- (-1134.221) (-1123.870) [-1125.044] (-1127.310) * [-1131.827] (-1125.656) (-1132.440) (-1127.423) -- 0:01:13
358000 -- (-1126.167) [-1124.496] (-1129.275) (-1130.324) * [-1123.109] (-1118.826) (-1132.749) (-1130.067) -- 0:01:13
359000 -- [-1123.094] (-1126.616) (-1122.906) (-1131.769) * (-1127.363) [-1125.839] (-1132.330) (-1128.491) -- 0:01:13
360000 -- (-1130.451) (-1127.185) [-1122.849] (-1128.777) * (-1124.075) [-1129.081] (-1132.613) (-1125.693) -- 0:01:12
Average standard deviation of split frequencies: 0.014813
361000 -- (-1127.874) (-1130.625) (-1122.139) [-1121.342] * [-1124.179] (-1123.864) (-1130.470) (-1127.669) -- 0:01:12
362000 -- (-1131.659) (-1131.183) [-1127.657] (-1125.855) * (-1126.331) [-1127.219] (-1130.581) (-1133.568) -- 0:01:12
363000 -- [-1123.854] (-1134.452) (-1122.415) (-1129.899) * (-1131.559) (-1130.293) [-1122.542] (-1123.410) -- 0:01:11
364000 -- (-1123.633) (-1125.780) [-1121.368] (-1120.918) * (-1129.649) [-1121.292] (-1122.473) (-1123.833) -- 0:01:11
365000 -- (-1120.953) (-1129.571) (-1127.508) [-1124.752] * (-1133.863) (-1120.373) [-1122.214] (-1128.519) -- 0:01:11
Average standard deviation of split frequencies: 0.012880
366000 -- [-1124.048] (-1132.197) (-1123.486) (-1119.938) * (-1122.966) (-1124.378) [-1123.832] (-1126.985) -- 0:01:12
367000 -- (-1125.011) (-1125.520) (-1122.472) [-1125.517] * (-1125.271) (-1120.037) [-1124.922] (-1125.642) -- 0:01:12
368000 -- [-1121.857] (-1127.698) (-1122.523) (-1125.688) * (-1127.557) (-1123.808) [-1122.376] (-1121.580) -- 0:01:12
369000 -- (-1130.839) [-1124.127] (-1121.258) (-1129.858) * [-1123.841] (-1126.464) (-1126.435) (-1125.510) -- 0:01:11
370000 -- (-1125.117) [-1125.037] (-1120.010) (-1130.990) * [-1121.978] (-1124.293) (-1127.064) (-1122.869) -- 0:01:11
Average standard deviation of split frequencies: 0.011870
371000 -- (-1127.718) [-1123.750] (-1124.996) (-1132.806) * [-1123.003] (-1128.579) (-1129.178) (-1127.999) -- 0:01:11
372000 -- (-1130.763) (-1127.325) [-1126.841] (-1131.558) * (-1125.545) (-1126.709) (-1124.659) [-1126.628] -- 0:01:10
373000 -- (-1125.857) (-1126.894) [-1125.574] (-1126.435) * [-1126.459] (-1124.768) (-1118.607) (-1128.194) -- 0:01:10
374000 -- (-1125.486) (-1127.152) [-1125.624] (-1123.881) * [-1127.157] (-1127.112) (-1125.874) (-1130.139) -- 0:01:10
375000 -- (-1127.679) (-1122.400) (-1124.939) [-1123.272] * [-1126.594] (-1123.559) (-1124.072) (-1133.232) -- 0:01:11
Average standard deviation of split frequencies: 0.010866
376000 -- (-1127.539) (-1122.259) [-1126.626] (-1132.320) * (-1132.129) [-1123.186] (-1128.116) (-1126.841) -- 0:01:11
377000 -- (-1128.554) (-1127.393) (-1128.673) [-1121.670] * (-1132.513) (-1127.966) [-1120.835] (-1127.790) -- 0:01:11
378000 -- [-1127.463] (-1127.288) (-1128.789) (-1124.857) * (-1128.407) (-1121.831) [-1121.373] (-1129.634) -- 0:01:10
379000 -- (-1125.331) [-1128.776] (-1129.110) (-1127.367) * (-1133.491) (-1127.776) [-1120.760] (-1128.660) -- 0:01:10
380000 -- (-1125.134) [-1122.788] (-1128.153) (-1122.308) * (-1126.583) (-1122.715) [-1123.326] (-1124.797) -- 0:01:10
Average standard deviation of split frequencies: 0.015686
381000 -- (-1123.420) (-1126.481) (-1131.460) [-1123.033] * (-1126.014) (-1125.807) [-1124.723] (-1127.192) -- 0:01:09
382000 -- (-1122.095) (-1125.908) [-1125.501] (-1119.937) * (-1128.298) (-1127.358) (-1123.409) [-1122.930] -- 0:01:09
383000 -- [-1119.362] (-1127.009) (-1130.556) (-1119.927) * [-1127.756] (-1145.884) (-1126.357) (-1123.417) -- 0:01:09
384000 -- (-1127.426) (-1129.117) (-1130.292) [-1127.569] * (-1129.303) [-1127.429] (-1129.759) (-1133.648) -- 0:01:10
385000 -- (-1129.219) (-1128.716) [-1127.492] (-1121.618) * (-1122.659) [-1127.379] (-1129.607) (-1128.952) -- 0:01:10
Average standard deviation of split frequencies: 0.017912
386000 -- [-1124.093] (-1121.914) (-1130.314) (-1127.665) * (-1132.766) (-1128.331) (-1123.452) [-1131.094] -- 0:01:09
387000 -- [-1122.888] (-1128.400) (-1124.909) (-1128.270) * (-1126.179) [-1123.712] (-1128.115) (-1129.391) -- 0:01:09
388000 -- [-1124.409] (-1134.919) (-1128.388) (-1128.188) * (-1128.699) (-1125.794) [-1128.382] (-1128.822) -- 0:01:09
389000 -- (-1124.311) (-1126.386) (-1129.078) [-1123.425] * [-1130.119] (-1126.363) (-1131.325) (-1124.176) -- 0:01:09
390000 -- (-1123.411) (-1135.884) [-1123.736] (-1124.385) * (-1124.116) [-1123.414] (-1135.970) (-1124.145) -- 0:01:08
Average standard deviation of split frequencies: 0.016089
391000 -- (-1127.256) [-1122.570] (-1126.806) (-1126.357) * (-1118.734) (-1125.397) (-1139.016) [-1123.538] -- 0:01:08
392000 -- (-1123.358) (-1127.257) (-1126.015) [-1123.968] * [-1122.932] (-1124.256) (-1131.689) (-1120.519) -- 0:01:08
393000 -- (-1126.577) (-1123.045) (-1125.443) [-1124.656] * [-1127.514] (-1125.495) (-1129.732) (-1122.389) -- 0:01:09
394000 -- [-1126.591] (-1130.296) (-1128.162) (-1126.660) * [-1121.150] (-1126.939) (-1129.446) (-1126.488) -- 0:01:09
395000 -- (-1132.518) (-1125.977) [-1124.071] (-1128.912) * (-1128.005) [-1122.189] (-1122.209) (-1130.695) -- 0:01:08
Average standard deviation of split frequencies: 0.017459
396000 -- (-1128.361) (-1124.902) [-1124.001] (-1126.318) * [-1125.067] (-1122.233) (-1121.862) (-1120.898) -- 0:01:08
397000 -- (-1125.094) (-1130.257) (-1122.148) [-1123.733] * (-1123.834) [-1120.804] (-1123.832) (-1121.769) -- 0:01:08
398000 -- (-1126.171) [-1125.268] (-1124.824) (-1122.913) * [-1127.415] (-1125.356) (-1127.272) (-1120.494) -- 0:01:08
399000 -- [-1126.851] (-1126.155) (-1129.630) (-1126.132) * (-1123.872) (-1124.736) (-1123.277) [-1122.006] -- 0:01:07
400000 -- (-1131.553) (-1123.748) [-1123.529] (-1121.287) * [-1125.322] (-1122.020) (-1132.243) (-1125.076) -- 0:01:07
Average standard deviation of split frequencies: 0.014903
401000 -- (-1129.012) [-1122.470] (-1127.479) (-1126.900) * (-1124.098) (-1118.154) [-1127.622] (-1125.712) -- 0:01:08
402000 -- (-1126.890) [-1126.121] (-1120.857) (-1124.482) * (-1127.816) (-1120.031) (-1125.659) [-1122.005] -- 0:01:08
403000 -- [-1124.454] (-1120.516) (-1128.735) (-1120.935) * (-1121.637) [-1124.552] (-1122.572) (-1120.948) -- 0:01:08
404000 -- [-1123.871] (-1125.387) (-1124.139) (-1128.957) * (-1124.260) (-1130.709) [-1124.608] (-1124.004) -- 0:01:07
405000 -- (-1128.323) (-1123.435) (-1126.694) [-1125.568] * (-1128.367) (-1131.391) (-1123.291) [-1128.606] -- 0:01:07
Average standard deviation of split frequencies: 0.013933
406000 -- (-1123.126) (-1120.252) (-1127.593) [-1120.338] * (-1134.684) [-1122.914] (-1124.890) (-1129.410) -- 0:01:07
407000 -- (-1123.743) (-1127.831) [-1130.174] (-1129.080) * [-1123.069] (-1122.123) (-1122.149) (-1120.711) -- 0:01:07
408000 -- (-1124.484) (-1121.356) (-1126.258) [-1125.159] * (-1125.878) [-1126.879] (-1121.863) (-1133.748) -- 0:01:06
409000 -- [-1122.266] (-1118.723) (-1126.707) (-1128.628) * (-1125.777) [-1125.228] (-1129.397) (-1130.607) -- 0:01:06
410000 -- (-1133.146) (-1122.760) [-1124.333] (-1121.399) * (-1127.028) (-1124.028) (-1129.147) [-1124.220] -- 0:01:07
Average standard deviation of split frequencies: 0.016836
411000 -- [-1130.351] (-1120.856) (-1131.251) (-1123.798) * (-1126.847) (-1123.825) [-1121.783] (-1123.414) -- 0:01:07
412000 -- (-1126.229) [-1121.945] (-1125.593) (-1124.704) * [-1124.367] (-1125.208) (-1122.393) (-1134.016) -- 0:01:07
413000 -- (-1128.289) (-1122.494) [-1123.315] (-1125.586) * [-1122.504] (-1127.203) (-1124.587) (-1130.963) -- 0:01:06
414000 -- (-1126.258) (-1122.302) [-1127.042] (-1122.739) * (-1131.235) (-1124.816) (-1118.602) [-1127.349] -- 0:01:06
415000 -- [-1124.030] (-1132.727) (-1123.186) (-1124.822) * (-1129.169) (-1126.295) (-1121.971) [-1121.902] -- 0:01:06
Average standard deviation of split frequencies: 0.014354
416000 -- (-1132.871) [-1122.415] (-1121.955) (-1124.016) * (-1123.733) (-1126.435) [-1123.293] (-1124.654) -- 0:01:05
417000 -- (-1124.255) (-1121.817) (-1129.744) [-1123.375] * (-1123.347) (-1127.074) (-1123.702) [-1124.437] -- 0:01:05
418000 -- (-1136.936) [-1121.520] (-1130.040) (-1126.747) * [-1119.906] (-1125.016) (-1121.575) (-1122.955) -- 0:01:05
419000 -- (-1126.980) (-1124.797) [-1121.723] (-1120.545) * (-1120.337) (-1128.752) [-1126.196] (-1127.548) -- 0:01:06
420000 -- (-1121.767) [-1123.053] (-1124.359) (-1123.114) * (-1126.783) (-1121.556) (-1128.578) [-1126.159] -- 0:01:06
Average standard deviation of split frequencies: 0.016436
421000 -- (-1127.483) [-1123.465] (-1129.479) (-1129.127) * [-1121.545] (-1129.376) (-1132.399) (-1122.117) -- 0:01:06
422000 -- (-1126.708) (-1123.493) (-1128.820) [-1125.891] * (-1122.897) [-1125.809] (-1127.613) (-1124.085) -- 0:01:05
423000 -- [-1127.656] (-1125.250) (-1127.137) (-1130.354) * [-1121.413] (-1126.720) (-1126.464) (-1127.550) -- 0:01:05
424000 -- (-1125.983) [-1124.074] (-1131.495) (-1127.660) * (-1124.655) (-1131.840) [-1122.040] (-1126.582) -- 0:01:05
425000 -- [-1125.300] (-1125.052) (-1126.023) (-1128.226) * (-1127.710) (-1128.230) (-1127.322) [-1124.121] -- 0:01:04
Average standard deviation of split frequencies: 0.014754
426000 -- (-1126.756) [-1124.656] (-1118.140) (-1120.406) * [-1124.111] (-1121.064) (-1125.846) (-1122.577) -- 0:01:04
427000 -- [-1122.052] (-1126.447) (-1126.374) (-1120.145) * (-1128.883) (-1122.055) [-1131.875] (-1119.441) -- 0:01:04
428000 -- (-1128.062) (-1123.597) (-1122.380) [-1122.998] * (-1126.339) (-1121.945) [-1124.739] (-1123.294) -- 0:01:05
429000 -- (-1125.787) [-1127.468] (-1120.091) (-1127.901) * (-1127.353) (-1125.736) [-1127.550] (-1128.787) -- 0:01:05
430000 -- (-1136.940) [-1130.011] (-1122.294) (-1125.408) * (-1123.458) [-1124.963] (-1127.041) (-1124.141) -- 0:01:04
Average standard deviation of split frequencies: 0.014595
431000 -- (-1124.045) (-1128.295) [-1124.087] (-1127.516) * (-1126.731) [-1122.109] (-1120.682) (-1124.962) -- 0:01:04
432000 -- [-1125.005] (-1122.467) (-1127.874) (-1124.077) * (-1128.352) [-1123.757] (-1129.102) (-1124.558) -- 0:01:04
433000 -- (-1131.738) (-1122.306) [-1124.319] (-1123.112) * (-1126.198) (-1123.230) (-1124.711) [-1123.747] -- 0:01:04
434000 -- (-1128.759) (-1123.092) (-1125.049) [-1124.709] * (-1125.259) (-1125.844) [-1124.943] (-1128.468) -- 0:01:03
435000 -- (-1126.140) [-1122.186] (-1129.006) (-1125.902) * [-1123.428] (-1124.274) (-1123.029) (-1124.489) -- 0:01:03
Average standard deviation of split frequencies: 0.017299
436000 -- (-1121.365) (-1129.675) [-1122.765] (-1127.408) * (-1126.694) (-1127.220) (-1125.809) [-1122.091] -- 0:01:03
437000 -- (-1124.441) [-1118.536] (-1121.189) (-1121.162) * (-1121.246) (-1130.067) [-1124.718] (-1127.798) -- 0:01:04
438000 -- (-1124.064) (-1127.918) (-1120.038) [-1122.064] * (-1124.112) (-1120.775) [-1121.768] (-1128.543) -- 0:01:04
439000 -- [-1124.364] (-1123.609) (-1124.878) (-1127.624) * (-1123.788) (-1122.953) (-1126.360) [-1121.792] -- 0:01:03
440000 -- (-1124.459) (-1124.796) (-1125.788) [-1125.198] * (-1136.349) [-1127.489] (-1126.707) (-1126.963) -- 0:01:03
Average standard deviation of split frequencies: 0.017116
441000 -- (-1127.333) [-1125.123] (-1126.783) (-1128.125) * (-1118.960) [-1135.139] (-1129.129) (-1126.298) -- 0:01:03
442000 -- [-1121.805] (-1129.966) (-1129.149) (-1124.890) * (-1128.049) [-1130.147] (-1138.131) (-1118.786) -- 0:01:03
443000 -- (-1120.711) (-1128.222) (-1128.222) [-1126.109] * (-1128.097) [-1126.379] (-1122.592) (-1120.118) -- 0:01:02
444000 -- (-1119.810) [-1127.402] (-1124.854) (-1127.245) * (-1127.465) (-1130.720) [-1125.483] (-1121.694) -- 0:01:03
445000 -- (-1129.080) (-1126.902) [-1118.628] (-1125.552) * (-1125.983) (-1125.094) [-1123.413] (-1129.602) -- 0:01:03
Average standard deviation of split frequencies: 0.016207
446000 -- (-1122.971) [-1127.060] (-1125.066) (-1131.615) * (-1123.994) (-1130.619) [-1124.354] (-1121.747) -- 0:01:03
447000 -- (-1124.724) (-1122.995) (-1132.856) [-1121.149] * (-1129.903) (-1129.796) [-1124.982] (-1123.466) -- 0:01:03
448000 -- (-1124.596) (-1126.320) (-1128.002) [-1122.230] * (-1128.369) (-1126.253) [-1126.492] (-1122.565) -- 0:01:02
449000 -- (-1126.575) (-1121.651) [-1123.251] (-1122.742) * (-1123.075) [-1122.221] (-1127.051) (-1125.344) -- 0:01:02
450000 -- (-1128.679) (-1118.782) [-1125.357] (-1123.902) * (-1122.316) (-1125.022) [-1125.705] (-1128.891) -- 0:01:02
Average standard deviation of split frequencies: 0.018131
451000 -- (-1124.723) (-1127.907) (-1125.711) [-1119.380] * [-1126.620] (-1125.775) (-1125.109) (-1130.965) -- 0:01:02
452000 -- [-1117.597] (-1124.301) (-1131.644) (-1123.049) * (-1124.514) (-1125.252) (-1124.947) [-1123.699] -- 0:01:01
453000 -- (-1126.955) (-1124.808) (-1124.985) [-1120.718] * (-1125.430) [-1124.651] (-1129.408) (-1122.118) -- 0:01:02
454000 -- (-1124.244) [-1125.744] (-1122.871) (-1126.411) * (-1123.041) (-1125.010) [-1124.970] (-1123.331) -- 0:01:02
455000 -- (-1124.654) (-1123.533) [-1124.338] (-1130.205) * (-1129.050) (-1125.431) (-1124.057) [-1128.525] -- 0:01:02
Average standard deviation of split frequencies: 0.016541
456000 -- (-1132.472) (-1131.731) [-1122.172] (-1127.619) * [-1123.904] (-1124.363) (-1126.711) (-1129.733) -- 0:01:02
457000 -- (-1126.526) [-1125.115] (-1127.451) (-1128.801) * (-1128.661) (-1121.120) [-1123.878] (-1128.185) -- 0:01:01
458000 -- (-1121.619) (-1127.672) (-1125.993) [-1116.946] * (-1123.620) (-1129.681) [-1124.970] (-1135.124) -- 0:01:01
459000 -- (-1124.789) (-1127.727) [-1124.020] (-1127.647) * [-1123.532] (-1122.245) (-1123.574) (-1124.791) -- 0:01:01
460000 -- (-1129.799) [-1123.296] (-1125.586) (-1123.712) * (-1133.414) (-1129.958) [-1132.769] (-1126.702) -- 0:01:01
Average standard deviation of split frequencies: 0.018420
461000 -- [-1127.132] (-1123.022) (-1131.388) (-1121.898) * (-1123.672) [-1122.739] (-1125.260) (-1129.427) -- 0:01:00
462000 -- (-1129.408) (-1125.937) (-1122.358) [-1121.369] * [-1126.531] (-1128.542) (-1124.207) (-1126.938) -- 0:01:01
463000 -- (-1126.776) [-1121.943] (-1127.567) (-1122.670) * [-1124.758] (-1127.936) (-1122.609) (-1124.549) -- 0:01:01
464000 -- [-1121.982] (-1120.403) (-1127.968) (-1123.265) * (-1125.966) (-1122.962) [-1124.828] (-1124.977) -- 0:01:01
465000 -- [-1120.653] (-1123.588) (-1127.702) (-1123.516) * [-1120.536] (-1129.177) (-1125.246) (-1125.005) -- 0:01:00
Average standard deviation of split frequencies: 0.018883
466000 -- [-1122.597] (-1122.286) (-1119.846) (-1123.510) * (-1131.117) (-1126.086) (-1123.921) [-1120.909] -- 0:01:00
467000 -- (-1124.390) [-1130.759] (-1123.658) (-1123.891) * (-1123.515) [-1124.113] (-1125.529) (-1121.865) -- 0:01:00
468000 -- (-1121.659) (-1129.321) (-1122.458) [-1123.906] * [-1125.005] (-1129.074) (-1131.378) (-1125.290) -- 0:01:00
469000 -- (-1121.903) (-1120.303) [-1125.119] (-1125.584) * [-1123.100] (-1122.013) (-1126.966) (-1127.015) -- 0:01:00
470000 -- (-1124.357) [-1120.880] (-1129.962) (-1131.302) * [-1129.263] (-1125.259) (-1125.171) (-1119.100) -- 0:00:59
Average standard deviation of split frequencies: 0.017361
471000 -- (-1125.128) (-1125.571) [-1131.530] (-1132.229) * (-1124.719) (-1126.605) [-1126.349] (-1123.337) -- 0:01:00
472000 -- (-1130.586) (-1121.449) [-1124.377] (-1125.862) * (-1129.280) (-1127.322) (-1128.297) [-1128.237] -- 0:01:00
473000 -- [-1124.575] (-1125.054) (-1131.687) (-1123.030) * [-1124.864] (-1124.736) (-1124.183) (-1129.329) -- 0:01:00
474000 -- (-1128.146) [-1123.151] (-1128.037) (-1126.608) * (-1124.139) (-1123.739) [-1122.879] (-1124.605) -- 0:00:59
475000 -- [-1127.668] (-1128.633) (-1124.997) (-1126.869) * (-1129.521) (-1124.194) [-1125.617] (-1125.721) -- 0:00:59
Average standard deviation of split frequencies: 0.017826
476000 -- (-1126.516) (-1135.810) (-1125.002) [-1126.695] * (-1125.831) (-1128.512) (-1130.091) [-1123.481] -- 0:00:59
477000 -- (-1128.762) (-1130.995) (-1124.206) [-1125.026] * (-1125.467) [-1126.770] (-1125.208) (-1123.966) -- 0:00:59
478000 -- [-1125.315] (-1126.414) (-1128.273) (-1123.612) * [-1123.059] (-1120.590) (-1124.608) (-1123.648) -- 0:00:58
479000 -- (-1124.321) [-1123.929] (-1130.996) (-1122.928) * (-1124.143) (-1125.432) (-1130.420) [-1121.496] -- 0:00:58
480000 -- (-1121.981) (-1121.283) [-1125.526] (-1126.588) * [-1128.151] (-1126.856) (-1130.772) (-1126.300) -- 0:00:59
Average standard deviation of split frequencies: 0.016999
481000 -- (-1121.561) (-1122.429) (-1126.021) [-1124.200] * [-1127.704] (-1129.219) (-1126.485) (-1126.485) -- 0:00:59
482000 -- [-1124.729] (-1123.154) (-1128.859) (-1130.682) * (-1125.192) (-1127.160) (-1130.056) [-1125.031] -- 0:00:59
483000 -- (-1131.384) (-1125.377) (-1128.884) [-1128.131] * (-1124.194) [-1121.908] (-1132.442) (-1124.927) -- 0:00:58
484000 -- (-1123.668) [-1125.405] (-1129.941) (-1126.735) * (-1127.363) (-1131.113) (-1126.173) [-1125.164] -- 0:00:58
485000 -- [-1119.790] (-1124.529) (-1121.152) (-1126.755) * [-1123.773] (-1125.980) (-1131.549) (-1127.843) -- 0:00:58
Average standard deviation of split frequencies: 0.018106
486000 -- (-1128.648) (-1124.673) [-1128.651] (-1127.381) * (-1122.894) (-1128.393) [-1123.002] (-1130.423) -- 0:00:58
487000 -- (-1123.275) (-1119.660) (-1124.397) [-1120.591] * (-1119.283) (-1129.451) [-1125.080] (-1125.930) -- 0:00:57
488000 -- (-1123.204) (-1130.577) [-1125.900] (-1132.880) * (-1126.524) (-1129.295) (-1132.250) [-1129.179] -- 0:00:57
489000 -- [-1123.675] (-1129.009) (-1128.403) (-1129.771) * [-1125.526] (-1129.395) (-1124.910) (-1118.683) -- 0:00:58
490000 -- (-1134.462) (-1124.293) (-1121.604) [-1124.157] * [-1121.476] (-1125.560) (-1122.327) (-1123.948) -- 0:00:58
Average standard deviation of split frequencies: 0.017934
491000 -- [-1125.402] (-1121.586) (-1123.075) (-1125.574) * (-1123.407) (-1120.750) (-1132.189) [-1126.301] -- 0:00:58
492000 -- (-1128.420) (-1128.891) (-1129.070) [-1122.957] * [-1124.299] (-1122.583) (-1129.533) (-1136.761) -- 0:00:57
493000 -- (-1126.815) (-1123.904) (-1127.928) [-1123.839] * (-1126.255) (-1122.558) [-1130.336] (-1126.673) -- 0:00:57
494000 -- (-1124.673) (-1125.254) (-1133.072) [-1119.442] * (-1121.879) (-1128.500) [-1125.654] (-1130.115) -- 0:00:57
495000 -- (-1120.631) (-1123.577) (-1126.287) [-1126.841] * (-1120.164) (-1128.464) (-1130.123) [-1121.953] -- 0:00:57
Average standard deviation of split frequencies: 0.018375
496000 -- (-1125.736) [-1126.018] (-1123.866) (-1128.761) * (-1124.181) [-1124.679] (-1128.946) (-1126.143) -- 0:00:56
497000 -- (-1131.756) [-1125.484] (-1130.573) (-1126.966) * (-1126.076) [-1125.115] (-1122.867) (-1127.456) -- 0:00:57
498000 -- (-1133.405) [-1121.126] (-1142.879) (-1128.405) * [-1126.843] (-1130.691) (-1123.828) (-1127.990) -- 0:00:57
499000 -- (-1126.745) [-1121.897] (-1128.709) (-1121.418) * (-1121.100) (-1121.011) (-1121.812) [-1123.818] -- 0:00:57
500000 -- [-1120.663] (-1125.349) (-1123.837) (-1122.575) * (-1130.092) (-1126.262) (-1131.480) [-1136.707] -- 0:00:57
Average standard deviation of split frequencies: 0.016948
501000 -- [-1125.623] (-1125.993) (-1124.784) (-1131.814) * (-1123.234) (-1129.868) (-1122.361) [-1124.797] -- 0:00:56
502000 -- [-1126.250] (-1126.030) (-1128.371) (-1122.908) * (-1120.866) [-1126.032] (-1124.136) (-1131.514) -- 0:00:56
503000 -- (-1130.529) (-1127.533) [-1127.117] (-1122.268) * (-1123.908) (-1125.038) (-1124.420) [-1129.454] -- 0:00:56
504000 -- (-1131.252) (-1126.165) (-1128.387) [-1126.249] * (-1131.020) (-1123.228) [-1126.451] (-1124.470) -- 0:00:56
505000 -- (-1123.432) [-1122.553] (-1123.060) (-1135.203) * (-1126.033) [-1122.051] (-1123.045) (-1125.002) -- 0:00:55
Average standard deviation of split frequencies: 0.016769
506000 -- (-1128.156) [-1124.329] (-1130.747) (-1136.275) * (-1126.500) [-1123.978] (-1127.606) (-1124.264) -- 0:00:56
507000 -- [-1125.605] (-1127.225) (-1134.655) (-1128.967) * [-1123.150] (-1134.787) (-1125.475) (-1125.805) -- 0:00:56
508000 -- [-1122.901] (-1125.160) (-1128.555) (-1134.669) * (-1122.484) (-1124.170) (-1130.909) [-1130.765] -- 0:00:56
509000 -- [-1128.848] (-1121.357) (-1132.079) (-1132.826) * (-1129.244) (-1121.909) (-1123.233) [-1123.050] -- 0:00:55
510000 -- [-1126.497] (-1123.241) (-1127.042) (-1127.655) * (-1133.819) [-1127.348] (-1124.836) (-1124.898) -- 0:00:55
Average standard deviation of split frequencies: 0.016616
511000 -- [-1123.994] (-1120.701) (-1125.580) (-1131.541) * [-1127.256] (-1122.577) (-1126.330) (-1123.386) -- 0:00:55
512000 -- (-1130.711) (-1124.891) [-1127.152] (-1120.804) * (-1127.505) [-1126.700] (-1132.185) (-1117.661) -- 0:00:55
513000 -- (-1131.575) (-1131.419) (-1124.160) [-1123.681] * (-1129.144) (-1120.406) (-1124.015) [-1120.088] -- 0:00:55
514000 -- (-1123.979) (-1130.294) [-1121.461] (-1119.543) * (-1122.028) [-1123.031] (-1127.653) (-1128.054) -- 0:00:54
515000 -- (-1119.549) (-1128.247) (-1122.927) [-1126.823] * (-1128.267) (-1127.726) [-1129.100] (-1122.557) -- 0:00:55
Average standard deviation of split frequencies: 0.017053
516000 -- (-1123.328) (-1127.285) (-1126.270) [-1124.726] * (-1125.360) (-1127.614) [-1121.294] (-1120.335) -- 0:00:55
517000 -- (-1126.009) [-1123.515] (-1128.353) (-1121.944) * (-1126.250) [-1126.104] (-1119.559) (-1129.817) -- 0:00:55
518000 -- [-1121.166] (-1130.115) (-1121.842) (-1125.567) * [-1128.162] (-1126.597) (-1129.043) (-1118.361) -- 0:00:54
519000 -- (-1125.285) (-1125.930) (-1120.399) [-1125.910] * [-1122.101] (-1123.288) (-1124.698) (-1132.400) -- 0:00:54
520000 -- (-1131.687) (-1122.362) (-1121.698) [-1123.530] * (-1123.955) (-1125.740) [-1125.169] (-1124.589) -- 0:00:54
Average standard deviation of split frequencies: 0.016297
521000 -- (-1126.728) (-1122.814) [-1122.765] (-1126.236) * [-1127.472] (-1126.277) (-1122.795) (-1126.866) -- 0:00:54
522000 -- [-1119.378] (-1122.010) (-1126.304) (-1127.787) * (-1123.107) (-1124.919) (-1131.975) [-1124.816] -- 0:00:54
523000 -- (-1121.484) (-1123.217) (-1125.915) [-1122.874] * (-1132.195) (-1127.295) (-1124.660) [-1120.853] -- 0:00:53
524000 -- (-1124.760) (-1127.484) (-1127.242) [-1123.039] * [-1119.046] (-1122.467) (-1125.082) (-1123.957) -- 0:00:54
525000 -- (-1130.015) (-1128.844) [-1123.704] (-1122.477) * (-1131.452) (-1129.425) (-1123.793) [-1125.888] -- 0:00:54
Average standard deviation of split frequencies: 0.015534
526000 -- [-1124.065] (-1129.232) (-1123.937) (-1119.019) * [-1123.175] (-1119.602) (-1129.917) (-1125.774) -- 0:00:54
527000 -- (-1122.906) (-1122.598) [-1122.732] (-1127.869) * (-1121.910) (-1123.926) (-1125.818) [-1125.653] -- 0:00:53
528000 -- [-1123.721] (-1123.408) (-1120.535) (-1129.584) * [-1123.542] (-1127.986) (-1130.625) (-1125.711) -- 0:00:53
529000 -- (-1122.435) [-1124.281] (-1131.000) (-1125.534) * [-1121.525] (-1122.454) (-1128.287) (-1131.694) -- 0:00:53
530000 -- (-1122.605) (-1131.812) (-1126.279) [-1122.303] * (-1121.339) [-1126.262] (-1123.047) (-1126.175) -- 0:00:53
Average standard deviation of split frequencies: 0.013621
531000 -- (-1127.226) [-1126.286] (-1130.133) (-1130.166) * [-1116.954] (-1122.907) (-1126.756) (-1123.956) -- 0:00:52
532000 -- (-1132.354) [-1123.089] (-1123.793) (-1130.691) * (-1123.370) (-1124.517) [-1123.442] (-1119.508) -- 0:00:52
533000 -- (-1124.018) (-1123.275) [-1129.034] (-1126.110) * (-1120.257) [-1123.863] (-1123.886) (-1120.281) -- 0:00:53
534000 -- (-1130.911) (-1130.342) (-1134.580) [-1126.492] * (-1119.146) [-1123.041] (-1123.594) (-1119.974) -- 0:00:53
535000 -- (-1130.412) (-1127.805) (-1124.285) [-1122.518] * [-1132.136] (-1128.127) (-1129.866) (-1121.885) -- 0:00:53
Average standard deviation of split frequencies: 0.012899
536000 -- (-1126.146) (-1121.871) (-1127.394) [-1125.039] * (-1123.602) (-1136.450) (-1118.086) [-1123.953] -- 0:00:52
537000 -- (-1132.225) (-1122.905) [-1123.457] (-1123.974) * (-1123.402) (-1125.590) (-1127.049) [-1125.195] -- 0:00:52
538000 -- (-1121.743) (-1124.073) [-1130.486] (-1120.148) * (-1120.098) (-1127.738) [-1124.134] (-1122.710) -- 0:00:52
539000 -- [-1122.856] (-1125.955) (-1125.850) (-1126.497) * (-1127.231) [-1122.884] (-1127.123) (-1123.420) -- 0:00:52
540000 -- (-1127.305) [-1129.620] (-1121.646) (-1126.025) * [-1127.750] (-1127.797) (-1124.972) (-1127.733) -- 0:00:51
Average standard deviation of split frequencies: 0.016275
541000 -- [-1128.541] (-1122.067) (-1122.065) (-1123.410) * (-1128.562) (-1127.217) [-1121.077] (-1127.277) -- 0:00:51
542000 -- [-1119.426] (-1129.824) (-1122.734) (-1120.948) * (-1128.026) [-1123.418] (-1122.541) (-1134.821) -- 0:00:52
543000 -- (-1130.308) (-1124.313) [-1130.372] (-1124.930) * (-1122.119) (-1129.186) [-1127.518] (-1132.810) -- 0:00:52
544000 -- (-1128.613) (-1125.213) [-1125.279] (-1130.628) * [-1125.588] (-1125.670) (-1126.623) (-1125.055) -- 0:00:51
545000 -- (-1129.529) [-1119.047] (-1128.535) (-1129.887) * (-1126.060) (-1125.209) [-1122.564] (-1130.677) -- 0:00:51
Average standard deviation of split frequencies: 0.015541
546000 -- (-1123.138) [-1126.596] (-1120.906) (-1126.547) * (-1127.229) (-1128.159) [-1125.891] (-1124.916) -- 0:00:51
547000 -- (-1123.589) (-1129.754) [-1127.969] (-1127.035) * (-1124.827) [-1124.871] (-1121.924) (-1125.789) -- 0:00:51
548000 -- (-1129.000) (-1131.435) (-1130.001) [-1124.571] * (-1121.888) [-1124.555] (-1122.967) (-1130.066) -- 0:00:51
549000 -- [-1123.156] (-1121.702) (-1123.707) (-1127.404) * (-1123.983) (-1124.926) (-1123.090) [-1124.609] -- 0:00:50
550000 -- [-1120.894] (-1126.850) (-1133.268) (-1127.396) * (-1127.867) (-1131.829) [-1124.759] (-1123.307) -- 0:00:50
Average standard deviation of split frequencies: 0.013126
551000 -- [-1124.396] (-1124.698) (-1130.198) (-1122.672) * (-1121.405) [-1123.354] (-1119.563) (-1123.097) -- 0:00:51
552000 -- (-1124.687) [-1126.096] (-1126.740) (-1135.731) * (-1121.940) (-1125.250) (-1134.822) [-1119.775] -- 0:00:51
553000 -- [-1126.178] (-1120.752) (-1125.942) (-1125.178) * (-1124.078) (-1127.520) (-1119.224) [-1119.837] -- 0:00:50
554000 -- (-1122.045) (-1124.277) (-1128.245) [-1131.467] * [-1123.223] (-1124.101) (-1130.377) (-1128.471) -- 0:00:50
555000 -- (-1121.420) (-1128.431) (-1129.577) [-1126.526] * (-1123.720) (-1126.325) [-1124.921] (-1119.716) -- 0:00:50
Average standard deviation of split frequencies: 0.012435
556000 -- (-1127.162) [-1121.114] (-1129.154) (-1121.310) * (-1124.488) (-1128.145) (-1126.346) [-1130.799] -- 0:00:50
557000 -- (-1135.693) (-1133.665) (-1125.396) [-1122.739] * (-1126.442) [-1125.457] (-1136.741) (-1126.546) -- 0:00:50
558000 -- [-1126.001] (-1126.196) (-1122.895) (-1134.774) * (-1119.023) (-1128.937) [-1128.463] (-1130.963) -- 0:00:49
559000 -- [-1127.921] (-1123.330) (-1123.222) (-1120.511) * (-1135.418) (-1134.975) (-1122.207) [-1121.420] -- 0:00:49
560000 -- (-1122.773) [-1132.596] (-1126.964) (-1133.752) * (-1124.263) (-1136.300) (-1123.031) [-1120.677] -- 0:00:49
Average standard deviation of split frequencies: 0.014013
561000 -- (-1120.771) (-1127.886) (-1124.795) [-1125.328] * (-1122.440) (-1130.668) [-1121.116] (-1122.869) -- 0:00:50
562000 -- (-1123.159) (-1129.023) [-1124.988] (-1124.156) * (-1136.698) (-1120.836) [-1121.806] (-1120.969) -- 0:00:49
563000 -- (-1124.107) (-1121.798) (-1125.751) [-1127.388] * (-1129.382) [-1123.668] (-1124.347) (-1120.101) -- 0:00:49
564000 -- (-1127.496) (-1126.322) [-1123.106] (-1125.071) * (-1130.711) (-1127.065) (-1121.940) [-1127.635] -- 0:00:49
565000 -- (-1127.965) [-1122.286] (-1126.317) (-1124.979) * [-1129.186] (-1124.128) (-1127.055) (-1120.698) -- 0:00:49
Average standard deviation of split frequencies: 0.014992
566000 -- (-1124.540) [-1126.413] (-1129.162) (-1127.509) * (-1127.294) (-1125.587) [-1125.797] (-1118.172) -- 0:00:49
567000 -- (-1128.271) (-1121.710) [-1127.271] (-1132.018) * (-1126.165) (-1122.794) [-1127.357] (-1123.169) -- 0:00:48
568000 -- [-1121.795] (-1128.009) (-1126.245) (-1122.465) * [-1127.373] (-1121.919) (-1127.190) (-1126.926) -- 0:00:48
569000 -- [-1127.098] (-1123.254) (-1131.768) (-1125.682) * (-1123.800) (-1127.920) (-1122.535) [-1124.254] -- 0:00:48
570000 -- (-1127.487) (-1128.113) [-1124.057] (-1129.858) * (-1128.555) [-1124.344] (-1125.553) (-1125.846) -- 0:00:49
Average standard deviation of split frequencies: 0.014318
571000 -- (-1120.822) (-1126.372) [-1125.798] (-1125.861) * (-1126.831) [-1125.586] (-1126.364) (-1127.197) -- 0:00:48
572000 -- (-1128.637) [-1128.533] (-1123.647) (-1127.187) * (-1137.832) (-1130.943) [-1130.054] (-1132.577) -- 0:00:48
573000 -- (-1123.853) (-1125.115) (-1125.514) [-1127.480] * [-1128.203] (-1124.727) (-1120.650) (-1125.596) -- 0:00:48
574000 -- (-1134.679) [-1120.566] (-1124.967) (-1126.486) * (-1117.953) (-1122.125) [-1126.253] (-1128.721) -- 0:00:48
575000 -- [-1127.857] (-1129.910) (-1123.756) (-1127.087) * (-1120.538) (-1120.545) [-1124.693] (-1124.510) -- 0:00:48
Average standard deviation of split frequencies: 0.014186
576000 -- (-1125.397) (-1125.590) [-1125.637] (-1121.560) * [-1128.088] (-1122.765) (-1120.775) (-1125.321) -- 0:00:47
577000 -- (-1135.060) [-1122.083] (-1119.677) (-1131.698) * (-1130.103) (-1123.847) (-1123.095) [-1126.022] -- 0:00:47
578000 -- (-1127.412) (-1125.545) [-1125.102] (-1123.736) * (-1123.878) [-1121.762] (-1127.722) (-1126.023) -- 0:00:48
579000 -- (-1124.377) (-1123.640) (-1122.570) [-1122.531] * (-1128.228) (-1121.378) (-1126.080) [-1123.555] -- 0:00:47
580000 -- (-1127.617) (-1123.572) [-1123.624] (-1124.178) * (-1130.456) (-1125.207) [-1126.645] (-1128.488) -- 0:00:47
Average standard deviation of split frequencies: 0.014613
581000 -- [-1123.151] (-1124.027) (-1132.321) (-1135.760) * (-1131.503) (-1123.518) (-1131.895) [-1126.187] -- 0:00:47
582000 -- [-1124.847] (-1122.089) (-1127.767) (-1127.600) * [-1122.830] (-1123.632) (-1128.833) (-1126.374) -- 0:00:47
583000 -- (-1121.012) (-1127.074) (-1123.518) [-1126.645] * (-1132.099) (-1124.968) (-1128.492) [-1120.865] -- 0:00:47
584000 -- (-1125.743) [-1126.492] (-1130.511) (-1123.864) * (-1122.354) (-1124.085) [-1124.335] (-1122.604) -- 0:00:47
585000 -- [-1129.957] (-1127.181) (-1123.377) (-1124.050) * (-1120.371) (-1129.170) (-1125.110) [-1127.969] -- 0:00:46
Average standard deviation of split frequencies: 0.015016
586000 -- (-1130.981) (-1126.814) [-1124.908] (-1123.122) * (-1121.734) [-1122.874] (-1122.910) (-1126.270) -- 0:00:46
587000 -- (-1129.022) [-1123.926] (-1128.117) (-1120.118) * [-1125.508] (-1120.653) (-1125.012) (-1129.117) -- 0:00:46
588000 -- (-1129.006) (-1122.667) (-1132.788) [-1126.098] * (-1122.632) [-1125.855] (-1128.001) (-1127.894) -- 0:00:46
589000 -- (-1126.359) (-1124.201) (-1124.271) [-1122.598] * (-1123.792) (-1125.387) [-1121.543] (-1129.391) -- 0:00:46
590000 -- (-1124.321) (-1120.690) (-1122.807) [-1125.444] * [-1120.885] (-1132.418) (-1128.360) (-1127.760) -- 0:00:46
Average standard deviation of split frequencies: 0.012769
591000 -- (-1126.278) (-1125.753) [-1124.751] (-1124.943) * (-1122.985) [-1120.521] (-1129.691) (-1138.829) -- 0:00:46
592000 -- (-1127.558) (-1131.853) [-1127.619] (-1118.254) * (-1133.751) [-1123.656] (-1121.989) (-1134.102) -- 0:00:46
593000 -- [-1133.136] (-1121.970) (-1127.240) (-1125.593) * [-1126.952] (-1123.424) (-1118.297) (-1139.100) -- 0:00:45
594000 -- (-1127.989) (-1132.256) (-1129.293) [-1126.158] * (-1129.754) (-1119.196) (-1125.230) [-1127.477] -- 0:00:45
595000 -- (-1119.414) (-1125.795) [-1125.190] (-1127.656) * (-1127.325) [-1124.568] (-1129.333) (-1133.479) -- 0:00:45
Average standard deviation of split frequencies: 0.013710
596000 -- (-1124.504) [-1127.203] (-1126.324) (-1127.945) * (-1124.023) (-1130.304) [-1121.857] (-1129.548) -- 0:00:46
597000 -- (-1127.379) (-1126.479) (-1130.033) [-1121.565] * (-1120.205) (-1129.014) [-1123.513] (-1124.687) -- 0:00:45
598000 -- (-1121.520) (-1126.622) (-1126.591) [-1126.383] * (-1120.991) [-1127.667] (-1128.600) (-1119.692) -- 0:00:45
599000 -- (-1125.638) (-1124.039) [-1124.884] (-1128.359) * (-1123.706) (-1127.500) (-1124.935) [-1130.491] -- 0:00:45
600000 -- (-1126.433) (-1130.385) [-1122.549] (-1128.189) * (-1127.231) (-1126.819) [-1123.351] (-1118.755) -- 0:00:45
Average standard deviation of split frequencies: 0.013603
601000 -- [-1128.561] (-1129.027) (-1131.843) (-1127.195) * (-1126.964) (-1127.453) [-1122.291] (-1125.744) -- 0:00:45
602000 -- (-1124.139) (-1129.161) (-1126.745) [-1124.238] * (-1124.873) [-1126.057] (-1127.076) (-1127.956) -- 0:00:44
603000 -- (-1123.787) (-1125.543) (-1124.017) [-1125.763] * (-1129.677) [-1121.569] (-1125.273) (-1118.395) -- 0:00:44
604000 -- (-1126.224) (-1125.401) (-1127.805) [-1122.953] * (-1118.754) [-1119.788] (-1122.132) (-1122.433) -- 0:00:44
605000 -- (-1126.317) (-1131.784) [-1121.842] (-1125.750) * [-1128.069] (-1123.555) (-1128.980) (-1124.938) -- 0:00:45
Average standard deviation of split frequencies: 0.015558
606000 -- (-1129.146) (-1121.725) [-1127.499] (-1120.658) * (-1127.439) (-1130.459) (-1126.954) [-1129.950] -- 0:00:44
607000 -- [-1128.333] (-1122.803) (-1124.776) (-1125.198) * (-1126.375) [-1127.183] (-1131.037) (-1121.687) -- 0:00:44
608000 -- (-1131.503) (-1127.785) [-1124.734] (-1123.296) * [-1132.533] (-1125.394) (-1128.368) (-1120.425) -- 0:00:44
609000 -- (-1135.812) (-1127.780) (-1126.259) [-1122.493] * (-1128.882) (-1126.689) [-1126.070] (-1123.872) -- 0:00:44
610000 -- (-1129.344) (-1126.912) (-1125.106) [-1123.843] * [-1127.410] (-1132.567) (-1128.851) (-1122.998) -- 0:00:44
Average standard deviation of split frequencies: 0.013380
611000 -- (-1126.173) (-1133.267) [-1124.375] (-1124.612) * (-1129.714) (-1127.137) [-1127.214] (-1128.248) -- 0:00:43
612000 -- [-1125.594] (-1126.758) (-1126.601) (-1129.003) * [-1123.463] (-1129.905) (-1129.007) (-1126.266) -- 0:00:43
613000 -- (-1120.542) [-1123.755] (-1125.923) (-1125.365) * [-1122.418] (-1131.525) (-1124.902) (-1127.974) -- 0:00:43
614000 -- [-1122.227] (-1123.293) (-1122.648) (-1131.263) * (-1127.734) (-1129.445) (-1120.297) [-1124.043] -- 0:00:44
615000 -- (-1130.303) (-1124.931) [-1125.488] (-1129.160) * [-1121.258] (-1124.712) (-1131.948) (-1128.898) -- 0:00:43
Average standard deviation of split frequencies: 0.013265
616000 -- [-1120.084] (-1129.085) (-1128.620) (-1130.683) * (-1126.885) [-1122.671] (-1124.603) (-1123.150) -- 0:00:43
617000 -- (-1130.191) (-1127.796) [-1125.454] (-1126.620) * [-1124.416] (-1121.264) (-1119.925) (-1121.980) -- 0:00:43
618000 -- (-1120.495) (-1129.522) (-1128.555) [-1123.784] * [-1125.867] (-1128.937) (-1124.482) (-1132.862) -- 0:00:43
619000 -- (-1127.385) (-1131.001) [-1130.085] (-1126.326) * (-1129.730) [-1119.523] (-1122.485) (-1126.654) -- 0:00:43
620000 -- (-1122.633) [-1124.530] (-1121.698) (-1123.915) * (-1128.018) [-1121.844] (-1121.681) (-1123.481) -- 0:00:42
Average standard deviation of split frequencies: 0.013165
621000 -- (-1120.689) (-1123.403) [-1119.468] (-1126.352) * (-1121.525) [-1121.624] (-1126.781) (-1127.350) -- 0:00:42
622000 -- (-1125.597) (-1122.606) (-1124.497) [-1136.319] * (-1123.786) [-1128.629] (-1123.502) (-1127.687) -- 0:00:43
623000 -- (-1128.668) (-1122.736) [-1123.142] (-1121.268) * (-1121.930) [-1126.577] (-1123.758) (-1123.707) -- 0:00:42
624000 -- (-1120.421) (-1126.154) [-1123.148] (-1123.108) * (-1127.630) (-1134.580) (-1121.245) [-1125.652] -- 0:00:42
625000 -- [-1126.934] (-1124.256) (-1125.547) (-1125.592) * [-1128.426] (-1121.273) (-1130.599) (-1133.725) -- 0:00:42
Average standard deviation of split frequencies: 0.012551
626000 -- (-1125.479) (-1119.657) [-1120.074] (-1123.394) * [-1125.567] (-1124.470) (-1125.601) (-1127.184) -- 0:00:42
627000 -- [-1124.731] (-1130.123) (-1122.538) (-1124.347) * (-1125.607) (-1126.765) (-1127.792) [-1126.132] -- 0:00:42
628000 -- (-1130.941) [-1125.829] (-1122.272) (-1128.188) * (-1123.185) (-1125.962) (-1125.610) [-1122.633] -- 0:00:42
629000 -- [-1124.925] (-1127.128) (-1129.002) (-1126.783) * (-1125.282) [-1123.775] (-1124.596) (-1127.970) -- 0:00:41
630000 -- (-1124.087) [-1121.238] (-1124.981) (-1123.472) * (-1126.666) (-1126.276) (-1134.512) [-1123.146] -- 0:00:41
Average standard deviation of split frequencies: 0.014949
631000 -- (-1127.183) [-1120.505] (-1127.106) (-1124.132) * [-1124.976] (-1119.576) (-1126.177) (-1122.618) -- 0:00:42
632000 -- [-1127.451] (-1126.899) (-1124.122) (-1126.816) * (-1123.393) (-1129.552) (-1135.257) [-1128.113] -- 0:00:41
633000 -- (-1127.176) (-1121.713) (-1129.237) [-1125.872] * (-1134.088) [-1122.793] (-1132.069) (-1123.532) -- 0:00:41
634000 -- (-1129.187) (-1121.406) (-1120.804) [-1124.374] * (-1130.272) (-1125.991) (-1125.201) [-1121.962] -- 0:00:41
635000 -- (-1123.698) (-1124.042) (-1121.404) [-1128.956] * (-1123.464) (-1129.938) [-1125.072] (-1133.683) -- 0:00:41
Average standard deviation of split frequencies: 0.014824
636000 -- (-1128.144) [-1127.484] (-1126.513) (-1123.536) * (-1126.974) (-1126.387) [-1123.385] (-1130.466) -- 0:00:41
637000 -- (-1127.845) (-1123.832) (-1136.753) [-1120.349] * (-1123.832) (-1130.422) [-1123.959] (-1131.395) -- 0:00:41
638000 -- [-1124.462] (-1128.263) (-1123.779) (-1122.281) * (-1124.895) (-1125.719) (-1118.996) [-1121.928] -- 0:00:40
639000 -- (-1130.022) (-1130.013) [-1121.495] (-1126.866) * (-1124.368) (-1124.702) (-1123.147) [-1124.896] -- 0:00:40
640000 -- (-1122.358) [-1123.852] (-1122.048) (-1132.027) * (-1127.872) (-1124.399) [-1124.724] (-1123.637) -- 0:00:41
Average standard deviation of split frequencies: 0.015207
641000 -- (-1134.073) [-1124.686] (-1121.413) (-1125.174) * (-1122.057) [-1120.909] (-1136.456) (-1131.473) -- 0:00:40
642000 -- (-1122.631) (-1127.891) [-1120.139] (-1121.781) * (-1127.295) (-1133.769) (-1126.607) [-1124.263] -- 0:00:40
643000 -- (-1127.731) [-1124.413] (-1124.475) (-1125.012) * [-1126.858] (-1131.108) (-1123.556) (-1127.824) -- 0:00:40
644000 -- (-1125.933) [-1126.659] (-1122.576) (-1128.772) * [-1122.130] (-1125.838) (-1122.754) (-1124.371) -- 0:00:40
645000 -- [-1122.429] (-1127.617) (-1121.277) (-1124.684) * (-1124.414) (-1128.924) [-1124.917] (-1125.046) -- 0:00:40
Average standard deviation of split frequencies: 0.017513
646000 -- (-1122.697) (-1124.734) [-1121.892] (-1133.034) * (-1127.191) [-1123.716] (-1130.063) (-1125.166) -- 0:00:40
647000 -- [-1122.488] (-1122.243) (-1124.499) (-1125.522) * (-1121.403) (-1125.476) (-1129.082) [-1120.842] -- 0:00:39
648000 -- (-1121.570) (-1118.380) (-1128.729) [-1119.789] * (-1121.918) [-1124.679] (-1127.471) (-1128.220) -- 0:00:39
649000 -- (-1136.562) (-1119.736) (-1130.096) [-1127.785] * [-1128.325] (-1129.504) (-1127.401) (-1130.891) -- 0:00:40
650000 -- [-1135.137] (-1122.123) (-1133.021) (-1119.127) * [-1126.168] (-1126.995) (-1122.503) (-1121.693) -- 0:00:39
Average standard deviation of split frequencies: 0.018837
651000 -- [-1123.577] (-1123.162) (-1127.658) (-1125.551) * (-1126.080) [-1123.399] (-1128.080) (-1122.595) -- 0:00:39
652000 -- [-1126.878] (-1124.222) (-1127.939) (-1122.780) * (-1128.037) (-1134.268) [-1126.458] (-1123.780) -- 0:00:39
653000 -- (-1128.029) [-1128.516] (-1119.424) (-1134.779) * (-1124.938) (-1126.977) [-1123.713] (-1126.153) -- 0:00:39
654000 -- (-1125.406) [-1127.787] (-1121.587) (-1119.005) * [-1120.056] (-1127.732) (-1125.771) (-1128.217) -- 0:00:39
655000 -- (-1128.008) (-1129.308) (-1121.277) [-1129.840] * (-1132.238) [-1124.358] (-1133.840) (-1129.870) -- 0:00:38
Average standard deviation of split frequencies: 0.018684
656000 -- [-1121.588] (-1124.969) (-1125.229) (-1122.072) * (-1133.083) (-1124.973) (-1137.641) [-1121.199] -- 0:00:38
657000 -- (-1122.209) (-1131.494) [-1124.236] (-1122.589) * (-1128.870) (-1127.622) (-1127.857) [-1121.585] -- 0:00:38
658000 -- (-1125.575) [-1126.484] (-1123.499) (-1134.065) * [-1125.074] (-1127.259) (-1126.161) (-1129.647) -- 0:00:38
659000 -- (-1125.126) (-1126.159) (-1120.610) [-1126.650] * [-1127.493] (-1127.465) (-1131.383) (-1124.815) -- 0:00:38
660000 -- (-1127.071) (-1124.123) [-1121.954] (-1127.435) * [-1127.239] (-1125.597) (-1135.254) (-1128.265) -- 0:00:38
Average standard deviation of split frequencies: 0.018076
661000 -- [-1121.361] (-1121.433) (-1124.996) (-1124.730) * (-1123.281) (-1132.857) [-1125.086] (-1128.722) -- 0:00:38
662000 -- (-1122.427) (-1125.033) (-1137.011) [-1128.054] * [-1126.764] (-1129.368) (-1124.809) (-1125.589) -- 0:00:38
663000 -- (-1126.471) [-1128.342] (-1130.161) (-1128.760) * [-1122.303] (-1125.795) (-1125.708) (-1125.410) -- 0:00:38
664000 -- [-1122.620] (-1131.805) (-1127.375) (-1125.337) * (-1123.914) (-1125.425) (-1122.795) [-1125.115] -- 0:00:37
665000 -- (-1125.091) (-1126.948) (-1126.324) [-1129.688] * (-1122.953) (-1131.565) [-1125.285] (-1126.830) -- 0:00:37
Average standard deviation of split frequencies: 0.018403
666000 -- [-1124.177] (-1126.064) (-1127.815) (-1129.930) * (-1121.253) (-1131.908) [-1123.795] (-1126.086) -- 0:00:38
667000 -- (-1126.138) (-1122.671) (-1123.094) [-1123.209] * (-1120.256) (-1129.866) [-1124.392] (-1122.263) -- 0:00:37
668000 -- (-1119.400) [-1130.362] (-1123.170) (-1119.913) * (-1124.919) (-1122.374) (-1127.132) [-1126.858] -- 0:00:37
669000 -- (-1128.011) (-1133.610) [-1122.097] (-1126.222) * (-1127.020) [-1129.803] (-1126.580) (-1123.246) -- 0:00:37
670000 -- (-1121.369) (-1130.844) [-1123.289] (-1119.800) * (-1122.569) (-1125.544) [-1126.798] (-1129.769) -- 0:00:37
Average standard deviation of split frequencies: 0.016869
671000 -- (-1125.986) (-1123.515) [-1128.549] (-1120.924) * [-1120.180] (-1128.596) (-1125.812) (-1127.632) -- 0:00:37
672000 -- [-1119.846] (-1124.200) (-1118.856) (-1122.214) * (-1127.705) [-1125.590] (-1131.307) (-1122.426) -- 0:00:37
673000 -- (-1123.178) (-1130.371) [-1123.248] (-1123.426) * (-1126.546) (-1129.362) (-1126.186) [-1124.672] -- 0:00:36
674000 -- (-1121.705) (-1128.628) (-1126.709) [-1127.128] * (-1119.580) (-1129.252) [-1124.448] (-1124.911) -- 0:00:36
675000 -- (-1121.717) (-1129.762) [-1124.826] (-1125.191) * [-1121.472] (-1123.628) (-1131.223) (-1130.354) -- 0:00:37
Average standard deviation of split frequencies: 0.018131
676000 -- (-1128.264) (-1122.198) (-1120.291) [-1127.240] * [-1123.542] (-1130.552) (-1124.274) (-1124.424) -- 0:00:36
677000 -- [-1128.407] (-1124.196) (-1123.367) (-1125.871) * (-1128.982) (-1137.310) (-1125.295) [-1123.581] -- 0:00:36
678000 -- (-1125.301) [-1124.695] (-1123.811) (-1124.067) * (-1132.101) (-1131.686) (-1128.590) [-1131.857] -- 0:00:36
679000 -- (-1125.028) (-1130.531) [-1126.363] (-1124.655) * (-1129.046) (-1128.410) (-1122.872) [-1126.102] -- 0:00:36
680000 -- (-1125.695) [-1124.758] (-1121.787) (-1127.796) * (-1129.796) (-1130.495) (-1128.788) [-1125.274] -- 0:00:36
Average standard deviation of split frequencies: 0.019392
681000 -- [-1123.339] (-1122.453) (-1121.379) (-1124.394) * (-1130.461) (-1122.969) (-1132.054) [-1126.078] -- 0:00:36
682000 -- [-1124.643] (-1127.325) (-1132.178) (-1128.416) * (-1124.110) [-1120.621] (-1123.966) (-1124.238) -- 0:00:35
683000 -- (-1126.283) [-1125.042] (-1124.709) (-1127.022) * (-1123.867) [-1122.212] (-1125.189) (-1131.184) -- 0:00:35
684000 -- (-1134.257) (-1130.112) (-1122.459) [-1130.722] * (-1120.631) (-1127.010) (-1124.689) [-1121.729] -- 0:00:36
685000 -- (-1132.997) (-1126.677) [-1123.039] (-1125.625) * (-1119.361) (-1128.510) (-1123.068) [-1124.332] -- 0:00:35
Average standard deviation of split frequencies: 0.019699
686000 -- (-1122.822) (-1130.907) (-1125.389) [-1124.926] * (-1122.117) (-1127.381) (-1123.639) [-1127.140] -- 0:00:35
687000 -- [-1127.759] (-1134.279) (-1128.850) (-1123.059) * [-1125.229] (-1124.387) (-1127.531) (-1128.034) -- 0:00:35
688000 -- (-1132.176) (-1129.478) [-1125.689] (-1122.707) * [-1124.323] (-1130.056) (-1126.335) (-1133.106) -- 0:00:35
689000 -- [-1128.218] (-1127.543) (-1126.346) (-1123.332) * [-1124.079] (-1127.503) (-1131.681) (-1130.940) -- 0:00:35
690000 -- [-1125.914] (-1126.339) (-1125.779) (-1129.214) * (-1124.501) (-1139.383) [-1121.071] (-1121.736) -- 0:00:35
Average standard deviation of split frequencies: 0.019566
691000 -- (-1124.527) (-1119.952) (-1120.931) [-1127.078] * (-1130.083) (-1132.443) (-1130.796) [-1121.164] -- 0:00:35
692000 -- (-1124.494) [-1120.317] (-1123.695) (-1123.248) * (-1125.493) [-1128.910] (-1132.549) (-1125.135) -- 0:00:35
693000 -- (-1125.677) [-1122.424] (-1122.614) (-1121.661) * (-1125.742) (-1121.759) (-1123.159) [-1125.126] -- 0:00:34
694000 -- (-1128.106) (-1121.884) (-1126.406) [-1123.421] * (-1126.385) (-1130.778) (-1122.718) [-1125.707] -- 0:00:34
695000 -- (-1133.610) (-1131.050) [-1121.427] (-1122.053) * (-1128.059) [-1132.050] (-1129.604) (-1129.067) -- 0:00:34
Average standard deviation of split frequencies: 0.019416
696000 -- (-1124.133) (-1127.798) (-1119.928) [-1123.855] * (-1122.960) (-1122.386) [-1129.543] (-1125.563) -- 0:00:34
697000 -- [-1123.973] (-1134.207) (-1125.278) (-1122.997) * [-1124.606] (-1121.216) (-1126.490) (-1123.207) -- 0:00:34
698000 -- (-1123.628) (-1120.965) [-1129.485] (-1124.595) * (-1122.863) (-1129.654) [-1122.636] (-1131.647) -- 0:00:34
699000 -- (-1121.491) (-1125.750) [-1130.570] (-1122.744) * [-1122.374] (-1126.840) (-1120.100) (-1125.359) -- 0:00:34
700000 -- (-1123.994) (-1124.804) (-1121.237) [-1126.710] * [-1123.280] (-1130.266) (-1121.750) (-1128.705) -- 0:00:34
Average standard deviation of split frequencies: 0.017493
701000 -- (-1125.945) (-1131.407) [-1121.443] (-1120.320) * [-1125.682] (-1126.168) (-1124.563) (-1126.012) -- 0:00:34
702000 -- (-1128.019) (-1128.948) [-1125.227] (-1125.362) * (-1128.161) (-1119.756) [-1121.036] (-1124.681) -- 0:00:33
703000 -- [-1125.065] (-1120.829) (-1124.129) (-1125.161) * [-1127.279] (-1123.352) (-1120.648) (-1120.917) -- 0:00:33
704000 -- (-1127.721) (-1131.331) (-1131.089) [-1124.000] * (-1126.666) (-1124.369) (-1121.409) [-1125.331] -- 0:00:33
705000 -- (-1128.565) (-1125.698) (-1125.797) [-1121.576] * [-1126.274] (-1124.027) (-1125.943) (-1121.939) -- 0:00:33
Average standard deviation of split frequencies: 0.016915
706000 -- (-1129.809) (-1129.823) (-1122.703) [-1126.845] * (-1131.712) (-1141.507) (-1129.046) [-1122.756] -- 0:00:33
707000 -- (-1126.809) (-1128.219) [-1119.682] (-1132.945) * [-1126.666] (-1125.655) (-1124.085) (-1124.166) -- 0:00:33
708000 -- (-1126.151) (-1121.324) [-1127.539] (-1131.157) * [-1129.457] (-1123.593) (-1126.536) (-1126.182) -- 0:00:32
709000 -- (-1125.606) (-1128.444) (-1127.535) [-1125.883] * (-1120.377) (-1124.067) (-1125.643) [-1121.625] -- 0:00:33
710000 -- (-1126.151) (-1127.437) [-1125.509] (-1124.752) * (-1122.771) (-1125.580) (-1130.601) [-1120.665] -- 0:00:33
Average standard deviation of split frequencies: 0.016362
711000 -- (-1126.280) (-1123.362) (-1126.564) [-1127.950] * (-1123.253) (-1130.430) (-1131.762) [-1122.201] -- 0:00:32
712000 -- (-1125.148) (-1121.561) (-1128.651) [-1130.393] * (-1125.391) (-1127.119) (-1135.422) [-1125.470] -- 0:00:32
713000 -- [-1122.151] (-1120.941) (-1128.337) (-1124.970) * (-1131.223) (-1130.696) (-1127.236) [-1126.234] -- 0:00:32
714000 -- (-1121.579) [-1128.125] (-1132.466) (-1129.770) * (-1127.267) (-1128.483) [-1121.779] (-1121.310) -- 0:00:32
715000 -- [-1124.269] (-1125.571) (-1130.441) (-1128.738) * (-1123.943) (-1124.950) [-1125.140] (-1123.056) -- 0:00:32
Average standard deviation of split frequencies: 0.017118
716000 -- (-1122.227) (-1125.507) [-1130.331] (-1133.362) * (-1127.150) (-1125.021) [-1119.416] (-1126.081) -- 0:00:32
717000 -- (-1121.619) [-1123.121] (-1121.860) (-1136.659) * (-1124.258) [-1128.514] (-1121.895) (-1130.903) -- 0:00:32
718000 -- [-1125.235] (-1120.984) (-1123.523) (-1126.119) * [-1128.612] (-1128.154) (-1126.200) (-1128.935) -- 0:00:32
719000 -- [-1121.722] (-1131.489) (-1124.166) (-1119.915) * (-1130.373) (-1124.082) [-1121.208] (-1127.869) -- 0:00:32
720000 -- (-1124.232) [-1127.856] (-1121.995) (-1128.028) * (-1128.362) [-1122.849] (-1127.597) (-1123.661) -- 0:00:31
Average standard deviation of split frequencies: 0.019188
721000 -- (-1122.822) (-1128.477) [-1128.218] (-1122.581) * (-1124.963) (-1124.964) (-1127.281) [-1130.900] -- 0:00:31
722000 -- (-1127.779) [-1123.792] (-1127.028) (-1122.420) * [-1130.718] (-1131.904) (-1127.457) (-1120.239) -- 0:00:31
723000 -- [-1122.152] (-1132.974) (-1133.960) (-1125.641) * [-1127.056] (-1124.662) (-1124.830) (-1121.872) -- 0:00:31
724000 -- (-1129.321) [-1124.562] (-1129.687) (-1123.488) * (-1132.783) (-1125.614) (-1123.537) [-1126.852] -- 0:00:31
725000 -- (-1125.543) (-1124.816) (-1131.690) [-1128.892] * (-1123.487) (-1124.371) (-1129.378) [-1122.858] -- 0:00:31
Average standard deviation of split frequencies: 0.018614
726000 -- (-1126.404) (-1123.568) (-1130.912) [-1118.934] * [-1133.022] (-1123.380) (-1128.843) (-1122.607) -- 0:00:31
727000 -- (-1128.400) [-1126.032] (-1129.992) (-1124.256) * [-1125.736] (-1130.602) (-1130.902) (-1130.555) -- 0:00:31
728000 -- (-1130.639) [-1127.880] (-1124.022) (-1127.704) * (-1131.693) (-1127.145) (-1126.269) [-1125.698] -- 0:00:31
729000 -- [-1119.278] (-1122.900) (-1130.609) (-1121.559) * (-1123.160) [-1127.772] (-1126.651) (-1128.465) -- 0:00:30
730000 -- (-1129.299) (-1127.379) (-1120.179) [-1121.498] * (-1124.251) (-1121.758) [-1123.944] (-1128.533) -- 0:00:30
Average standard deviation of split frequencies: 0.019355
731000 -- (-1131.160) (-1128.148) [-1122.726] (-1126.755) * [-1125.172] (-1124.698) (-1124.643) (-1125.496) -- 0:00:30
732000 -- [-1119.760] (-1129.431) (-1124.940) (-1126.680) * [-1123.687] (-1129.025) (-1122.731) (-1127.985) -- 0:00:30
733000 -- (-1122.364) (-1128.926) [-1123.172] (-1135.236) * (-1132.747) (-1122.477) (-1130.486) [-1120.785] -- 0:00:30
734000 -- (-1125.577) (-1126.635) (-1120.717) [-1128.352] * (-1126.106) (-1128.947) [-1122.504] (-1129.008) -- 0:00:30
735000 -- [-1121.432] (-1122.800) (-1127.970) (-1134.468) * [-1122.162] (-1126.769) (-1128.539) (-1131.794) -- 0:00:30
Average standard deviation of split frequencies: 0.020069
736000 -- (-1130.944) [-1123.883] (-1127.135) (-1125.170) * [-1123.662] (-1128.341) (-1123.271) (-1124.647) -- 0:00:30
737000 -- (-1125.879) (-1129.567) (-1125.695) [-1126.747] * (-1121.201) [-1122.660] (-1121.457) (-1123.850) -- 0:00:29
738000 -- (-1135.487) (-1122.732) [-1125.424] (-1128.545) * (-1123.840) (-1126.538) [-1125.163] (-1123.245) -- 0:00:29
739000 -- (-1125.053) [-1121.395] (-1127.814) (-1124.199) * (-1133.602) (-1122.524) [-1119.372] (-1131.188) -- 0:00:29
740000 -- [-1126.477] (-1125.139) (-1127.031) (-1129.322) * (-1128.559) [-1127.241] (-1122.432) (-1129.692) -- 0:00:29
Average standard deviation of split frequencies: 0.020367
741000 -- (-1122.663) (-1120.683) [-1121.782] (-1127.752) * (-1124.437) [-1126.495] (-1125.734) (-1126.403) -- 0:00:29
742000 -- (-1122.762) (-1128.445) [-1126.542] (-1124.869) * (-1128.023) (-1128.587) (-1127.726) [-1126.579] -- 0:00:29
743000 -- (-1126.454) (-1130.961) (-1121.471) [-1121.491] * [-1124.729] (-1126.476) (-1123.207) (-1127.044) -- 0:00:29
744000 -- [-1123.560] (-1126.184) (-1127.083) (-1122.570) * [-1121.529] (-1127.517) (-1127.158) (-1126.978) -- 0:00:29
745000 -- (-1129.431) (-1135.961) [-1120.863] (-1132.239) * (-1127.703) (-1127.857) [-1127.911] (-1127.189) -- 0:00:29
Average standard deviation of split frequencies: 0.019379
746000 -- (-1126.854) (-1122.240) [-1125.432] (-1119.817) * (-1125.264) (-1128.985) [-1118.836] (-1129.847) -- 0:00:28
747000 -- [-1124.769] (-1126.833) (-1124.617) (-1127.424) * (-1122.485) (-1128.222) (-1125.333) [-1122.786] -- 0:00:28
748000 -- (-1126.472) [-1129.032] (-1126.332) (-1126.630) * (-1124.548) (-1128.368) (-1131.499) [-1124.835] -- 0:00:28
749000 -- [-1122.881] (-1129.708) (-1125.386) (-1122.918) * (-1126.607) [-1123.922] (-1125.338) (-1130.294) -- 0:00:28
750000 -- (-1129.609) (-1131.157) (-1124.319) [-1122.414] * [-1132.659] (-1124.679) (-1119.285) (-1125.329) -- 0:00:28
Average standard deviation of split frequencies: 0.019258
751000 -- (-1127.692) (-1127.335) [-1122.140] (-1131.138) * (-1129.504) (-1122.685) (-1127.539) [-1127.244] -- 0:00:28
752000 -- (-1125.890) [-1128.243] (-1129.141) (-1130.161) * (-1133.768) (-1119.672) [-1126.563] (-1124.755) -- 0:00:28
753000 -- (-1123.619) (-1130.111) [-1126.018] (-1124.745) * (-1124.097) [-1122.333] (-1127.516) (-1130.134) -- 0:00:28
754000 -- (-1131.510) [-1124.534] (-1130.073) (-1122.901) * (-1123.355) (-1120.830) [-1124.974] (-1125.508) -- 0:00:28
755000 -- (-1121.937) [-1128.574] (-1123.545) (-1124.366) * (-1123.327) [-1121.096] (-1125.775) (-1124.161) -- 0:00:27
Average standard deviation of split frequencies: 0.020369
756000 -- [-1127.443] (-1126.801) (-1118.868) (-1126.175) * [-1132.534] (-1130.983) (-1127.824) (-1128.096) -- 0:00:27
757000 -- [-1124.632] (-1128.546) (-1120.696) (-1125.311) * (-1128.369) (-1125.125) [-1125.013] (-1129.193) -- 0:00:27
758000 -- (-1122.174) (-1130.757) (-1124.455) [-1120.965] * (-1138.458) (-1141.128) [-1121.697] (-1128.596) -- 0:00:27
759000 -- (-1121.254) [-1124.679] (-1129.407) (-1125.044) * (-1124.076) (-1129.211) (-1124.531) [-1130.206] -- 0:00:27
760000 -- [-1122.821] (-1122.756) (-1127.449) (-1129.535) * (-1128.278) [-1129.037] (-1121.578) (-1127.037) -- 0:00:27
Average standard deviation of split frequencies: 0.019418
761000 -- (-1124.139) (-1121.650) (-1127.732) [-1120.458] * (-1121.108) (-1128.740) [-1121.864] (-1124.720) -- 0:00:27
762000 -- (-1125.591) (-1126.279) (-1122.169) [-1132.592] * [-1127.979] (-1122.930) (-1131.289) (-1125.626) -- 0:00:27
763000 -- (-1130.116) (-1122.981) (-1123.421) [-1124.114] * (-1126.212) [-1120.565] (-1123.633) (-1120.842) -- 0:00:27
764000 -- (-1127.926) (-1129.199) (-1125.054) [-1127.534] * (-1123.130) (-1120.348) [-1124.492] (-1123.729) -- 0:00:26
765000 -- (-1129.523) (-1121.924) (-1124.939) [-1125.321] * (-1129.585) (-1121.374) (-1128.375) [-1129.080] -- 0:00:26
Average standard deviation of split frequencies: 0.017231
766000 -- (-1133.154) (-1125.098) (-1126.070) [-1121.122] * [-1122.827] (-1124.729) (-1125.973) (-1126.231) -- 0:00:26
767000 -- (-1126.231) (-1123.467) [-1130.058] (-1125.284) * (-1121.534) (-1125.169) (-1126.314) [-1123.195] -- 0:00:26
768000 -- (-1126.109) (-1120.763) (-1130.291) [-1125.144] * (-1123.094) (-1127.538) (-1123.241) [-1122.467] -- 0:00:26
769000 -- (-1131.165) [-1125.114] (-1119.389) (-1126.314) * (-1126.235) [-1126.004] (-1124.743) (-1129.959) -- 0:00:26
770000 -- (-1125.145) (-1123.752) [-1127.591] (-1124.306) * (-1122.891) (-1127.119) [-1127.105] (-1132.604) -- 0:00:26
Average standard deviation of split frequencies: 0.015904
771000 -- (-1125.744) [-1123.233] (-1120.218) (-1129.236) * (-1122.040) [-1123.584] (-1125.300) (-1122.435) -- 0:00:26
772000 -- (-1133.334) (-1123.555) [-1121.193] (-1127.594) * (-1127.021) [-1128.991] (-1127.519) (-1125.351) -- 0:00:25
773000 -- [-1123.390] (-1120.393) (-1122.047) (-1125.311) * (-1123.996) (-1127.815) (-1128.705) [-1124.802] -- 0:00:25
774000 -- (-1126.557) (-1121.989) (-1124.097) [-1121.401] * (-1128.399) [-1125.903] (-1124.344) (-1125.620) -- 0:00:25
775000 -- (-1130.069) [-1123.223] (-1132.183) (-1125.334) * (-1126.741) (-1123.384) [-1125.857] (-1125.099) -- 0:00:25
Average standard deviation of split frequencies: 0.016199
776000 -- [-1127.753] (-1121.144) (-1133.345) (-1123.809) * (-1125.581) [-1121.490] (-1120.534) (-1132.198) -- 0:00:25
777000 -- (-1120.632) [-1125.432] (-1129.029) (-1128.797) * [-1124.416] (-1128.014) (-1124.969) (-1121.550) -- 0:00:25
778000 -- (-1122.723) (-1122.532) [-1124.033] (-1130.173) * (-1124.895) [-1129.851] (-1125.045) (-1127.006) -- 0:00:25
779000 -- (-1127.482) (-1126.911) (-1127.552) [-1127.479] * (-1123.002) (-1122.363) (-1120.660) [-1122.339] -- 0:00:25
780000 -- (-1121.364) (-1123.212) [-1122.039] (-1125.154) * (-1124.225) [-1124.531] (-1122.411) (-1119.854) -- 0:00:25
Average standard deviation of split frequencies: 0.016505
781000 -- [-1123.363] (-1131.479) (-1123.197) (-1123.567) * (-1123.715) (-1125.848) (-1132.953) [-1126.812] -- 0:00:24
782000 -- (-1123.205) (-1121.261) (-1128.962) [-1122.127] * (-1127.791) [-1124.761] (-1122.356) (-1122.496) -- 0:00:24
783000 -- (-1127.050) (-1125.836) [-1125.111] (-1123.802) * (-1127.104) [-1126.758] (-1131.373) (-1121.651) -- 0:00:24
784000 -- (-1125.335) (-1129.824) (-1129.658) [-1124.737] * [-1124.241] (-1126.816) (-1128.510) (-1129.183) -- 0:00:24
785000 -- [-1121.257] (-1126.682) (-1127.749) (-1120.787) * (-1122.313) (-1127.947) (-1125.551) [-1124.803] -- 0:00:24
Average standard deviation of split frequencies: 0.017193
786000 -- (-1129.196) (-1126.155) (-1124.428) [-1121.367] * (-1125.928) (-1133.060) [-1122.481] (-1134.158) -- 0:00:24
787000 -- (-1124.629) (-1125.257) [-1117.742] (-1120.917) * (-1121.907) (-1129.090) (-1123.665) [-1125.713] -- 0:00:24
788000 -- (-1122.396) (-1119.307) [-1127.205] (-1127.123) * (-1128.135) [-1127.255] (-1128.524) (-1129.033) -- 0:00:24
789000 -- [-1122.417] (-1123.240) (-1124.608) (-1133.200) * (-1129.007) (-1128.414) (-1124.240) [-1129.887] -- 0:00:24
790000 -- (-1130.438) [-1123.917] (-1129.281) (-1127.752) * [-1125.326] (-1128.965) (-1126.565) (-1121.070) -- 0:00:23
Average standard deviation of split frequencies: 0.017886
791000 -- (-1125.173) [-1122.388] (-1128.858) (-1123.105) * [-1123.447] (-1127.945) (-1122.186) (-1124.077) -- 0:00:23
792000 -- (-1122.652) [-1126.731] (-1130.953) (-1124.273) * (-1125.588) (-1126.270) (-1123.155) [-1127.937] -- 0:00:23
793000 -- (-1125.487) [-1122.971] (-1127.475) (-1126.668) * [-1121.455] (-1122.118) (-1128.411) (-1121.162) -- 0:00:23
794000 -- (-1124.823) [-1126.332] (-1124.416) (-1130.833) * (-1126.466) (-1124.744) [-1122.887] (-1121.423) -- 0:00:23
795000 -- (-1123.488) [-1121.929] (-1127.720) (-1131.675) * (-1127.311) (-1129.850) (-1122.933) [-1120.182] -- 0:00:23
Average standard deviation of split frequencies: 0.018161
796000 -- (-1123.477) (-1122.335) [-1133.148] (-1128.044) * [-1123.562] (-1129.008) (-1124.120) (-1126.377) -- 0:00:23
797000 -- (-1121.291) [-1125.435] (-1122.030) (-1122.255) * (-1123.713) (-1129.691) [-1125.255] (-1127.972) -- 0:00:23
798000 -- (-1131.684) (-1122.586) (-1130.409) [-1122.447] * (-1122.398) (-1121.501) (-1126.591) [-1122.477] -- 0:00:23
799000 -- (-1122.598) (-1121.978) [-1128.379] (-1119.031) * (-1122.645) (-1127.268) (-1129.194) [-1125.711] -- 0:00:22
800000 -- (-1120.251) (-1122.843) [-1131.443] (-1125.607) * (-1124.379) (-1129.139) (-1129.434) [-1124.564] -- 0:00:22
Average standard deviation of split frequencies: 0.016485
801000 -- (-1125.367) [-1127.094] (-1127.140) (-1130.440) * (-1129.981) [-1119.801] (-1126.486) (-1127.189) -- 0:00:22
802000 -- [-1125.411] (-1123.477) (-1125.763) (-1125.097) * [-1123.864] (-1122.120) (-1125.270) (-1129.621) -- 0:00:22
803000 -- (-1123.737) (-1126.311) (-1128.509) [-1128.087] * (-1121.266) [-1120.644] (-1131.177) (-1127.021) -- 0:00:22
804000 -- (-1130.615) (-1121.758) [-1126.335] (-1122.823) * (-1122.305) [-1124.650] (-1133.963) (-1127.414) -- 0:00:22
805000 -- (-1124.766) (-1120.872) (-1126.635) [-1120.893] * (-1124.163) (-1125.852) (-1129.141) [-1121.461] -- 0:00:22
Average standard deviation of split frequencies: 0.017156
806000 -- [-1130.811] (-1122.198) (-1129.240) (-1132.890) * (-1128.844) (-1125.371) (-1122.646) [-1120.779] -- 0:00:22
807000 -- (-1126.810) (-1123.215) [-1129.032] (-1123.567) * (-1126.006) (-1120.923) (-1126.904) [-1129.426] -- 0:00:22
808000 -- (-1127.959) [-1121.035] (-1128.675) (-1125.849) * (-1130.275) (-1122.398) (-1133.948) [-1125.734] -- 0:00:21
809000 -- (-1127.413) [-1126.452] (-1124.669) (-1125.660) * [-1125.078] (-1126.880) (-1127.423) (-1127.213) -- 0:00:21
810000 -- (-1124.524) (-1127.395) [-1120.840] (-1125.075) * (-1123.946) (-1123.235) (-1124.575) [-1128.512] -- 0:00:21
Average standard deviation of split frequencies: 0.016282
811000 -- (-1126.113) (-1131.253) [-1125.192] (-1125.967) * [-1121.242] (-1123.763) (-1135.487) (-1124.707) -- 0:00:21
812000 -- (-1127.878) (-1124.332) [-1124.834] (-1129.410) * (-1125.919) (-1125.173) [-1127.109] (-1129.756) -- 0:00:21
813000 -- (-1127.443) [-1123.491] (-1124.839) (-1131.355) * (-1119.656) [-1124.019] (-1126.512) (-1133.831) -- 0:00:21
814000 -- [-1131.455] (-1128.496) (-1134.296) (-1127.814) * (-1131.086) [-1120.216] (-1123.589) (-1129.612) -- 0:00:21
815000 -- (-1131.901) (-1127.632) (-1123.722) [-1126.920] * (-1124.384) (-1123.504) [-1123.684] (-1123.527) -- 0:00:21
Average standard deviation of split frequencies: 0.016176
816000 -- (-1122.488) (-1125.041) [-1125.073] (-1125.189) * (-1121.581) (-1134.379) [-1122.144] (-1121.843) -- 0:00:20
817000 -- (-1122.585) (-1130.908) (-1123.164) [-1123.382] * (-1122.485) (-1125.582) (-1127.689) [-1121.201] -- 0:00:20
818000 -- (-1123.464) [-1124.976] (-1140.250) (-1122.983) * (-1123.964) [-1127.223] (-1122.661) (-1119.973) -- 0:00:20
819000 -- (-1126.299) [-1123.614] (-1125.826) (-1125.126) * (-1127.376) [-1124.420] (-1129.976) (-1131.284) -- 0:00:20
820000 -- [-1123.748] (-1124.252) (-1127.004) (-1124.995) * (-1120.893) [-1124.035] (-1120.313) (-1129.425) -- 0:00:20
Average standard deviation of split frequencies: 0.016850
821000 -- [-1119.085] (-1133.607) (-1125.754) (-1125.956) * (-1125.849) [-1129.203] (-1123.467) (-1132.061) -- 0:00:20
822000 -- (-1130.585) (-1132.109) (-1124.397) [-1123.417] * [-1124.978] (-1124.775) (-1126.263) (-1123.104) -- 0:00:20
823000 -- (-1123.437) (-1123.764) [-1122.099] (-1122.377) * [-1123.167] (-1128.631) (-1128.819) (-1126.859) -- 0:00:20
824000 -- [-1124.833] (-1127.924) (-1129.839) (-1126.255) * (-1123.691) (-1131.453) (-1123.253) [-1127.594] -- 0:00:20
825000 -- (-1125.278) (-1124.548) (-1122.819) [-1131.136] * (-1126.573) (-1125.524) [-1123.145] (-1129.020) -- 0:00:19
Average standard deviation of split frequencies: 0.017502
826000 -- (-1126.437) (-1126.026) [-1123.331] (-1124.677) * (-1132.099) [-1125.250] (-1128.816) (-1125.574) -- 0:00:19
827000 -- (-1126.815) (-1120.602) [-1123.297] (-1127.371) * (-1126.207) (-1129.362) (-1132.636) [-1128.236] -- 0:00:19
828000 -- (-1125.389) (-1122.400) (-1124.528) [-1122.797] * (-1123.419) [-1121.654] (-1136.454) (-1123.376) -- 0:00:19
829000 -- (-1132.475) [-1123.484] (-1126.967) (-1128.370) * [-1123.053] (-1120.812) (-1128.588) (-1124.669) -- 0:00:19
830000 -- (-1120.858) (-1128.356) [-1122.725] (-1122.850) * (-1126.305) (-1124.708) (-1127.039) [-1126.126] -- 0:00:19
Average standard deviation of split frequencies: 0.017025
831000 -- (-1128.210) (-1120.922) [-1123.328] (-1122.892) * (-1133.840) (-1123.241) [-1126.470] (-1134.605) -- 0:00:19
832000 -- [-1126.590] (-1124.673) (-1122.608) (-1124.966) * (-1127.730) [-1123.811] (-1127.686) (-1123.002) -- 0:00:19
833000 -- [-1124.023] (-1126.629) (-1130.666) (-1128.667) * (-1129.487) (-1130.188) [-1124.719] (-1126.481) -- 0:00:19
834000 -- (-1127.294) (-1125.445) [-1128.328] (-1121.430) * (-1122.293) [-1127.715] (-1127.629) (-1130.947) -- 0:00:18
835000 -- (-1134.385) [-1123.833] (-1123.734) (-1125.170) * (-1126.163) (-1131.999) (-1124.302) [-1120.644] -- 0:00:18
Average standard deviation of split frequencies: 0.017668
836000 -- (-1125.211) (-1119.141) (-1125.990) [-1121.221] * (-1126.617) [-1125.538] (-1126.436) (-1125.339) -- 0:00:18
837000 -- (-1128.745) [-1123.365] (-1122.941) (-1123.137) * [-1125.840] (-1123.599) (-1123.108) (-1131.642) -- 0:00:18
838000 -- (-1134.381) (-1120.501) (-1117.727) [-1123.719] * (-1122.600) (-1131.664) (-1127.766) [-1120.971] -- 0:00:18
839000 -- (-1125.392) (-1126.093) (-1121.353) [-1124.205] * (-1136.867) (-1131.142) (-1125.197) [-1124.642] -- 0:00:18
840000 -- (-1129.243) (-1126.254) (-1122.551) [-1126.031] * (-1124.942) (-1126.455) [-1124.560] (-1130.459) -- 0:00:18
Average standard deviation of split frequencies: 0.016823
841000 -- [-1120.133] (-1124.854) (-1126.443) (-1128.659) * (-1136.240) (-1128.836) (-1125.330) [-1127.149] -- 0:00:18
842000 -- (-1133.216) (-1123.889) [-1125.835] (-1129.190) * (-1124.739) [-1123.016] (-1128.516) (-1128.780) -- 0:00:18
843000 -- (-1127.437) (-1123.128) (-1129.945) [-1127.044] * (-1129.620) (-1127.102) [-1124.589] (-1125.098) -- 0:00:17
844000 -- (-1123.412) (-1126.459) (-1128.282) [-1127.162] * (-1124.206) (-1124.150) (-1120.158) [-1125.694] -- 0:00:17
845000 -- (-1126.104) [-1122.242] (-1125.017) (-1131.311) * (-1130.888) [-1122.440] (-1123.367) (-1124.572) -- 0:00:17
Average standard deviation of split frequencies: 0.017831
846000 -- (-1125.956) (-1119.058) (-1127.191) [-1125.481] * (-1134.309) [-1130.257] (-1124.046) (-1122.008) -- 0:00:17
847000 -- (-1123.525) [-1124.622] (-1130.249) (-1125.765) * [-1129.495] (-1121.661) (-1126.602) (-1121.117) -- 0:00:17
848000 -- (-1121.740) (-1122.141) (-1126.066) [-1126.286] * (-1124.545) (-1121.640) (-1127.371) [-1127.200] -- 0:00:17
849000 -- (-1123.484) (-1124.504) (-1136.586) [-1121.698] * (-1125.573) (-1131.068) [-1127.042] (-1129.646) -- 0:00:17
850000 -- (-1122.606) (-1122.070) [-1128.178] (-1123.963) * (-1127.138) (-1124.383) [-1126.752] (-1124.566) -- 0:00:17
Average standard deviation of split frequencies: 0.019211
851000 -- (-1125.851) (-1130.746) (-1128.838) [-1124.648] * (-1127.654) [-1120.601] (-1126.009) (-1123.981) -- 0:00:16
852000 -- (-1125.430) [-1124.503] (-1126.730) (-1123.220) * (-1127.141) (-1122.220) (-1123.875) [-1129.810] -- 0:00:16
853000 -- (-1131.829) (-1128.981) (-1131.514) [-1128.764] * (-1136.180) [-1126.321] (-1131.159) (-1127.192) -- 0:00:16
854000 -- (-1127.322) (-1134.196) [-1125.856] (-1122.985) * [-1121.157] (-1126.060) (-1121.310) (-1120.404) -- 0:00:16
855000 -- (-1123.138) (-1125.585) [-1131.008] (-1127.129) * [-1125.104] (-1126.194) (-1123.645) (-1123.726) -- 0:00:16
Average standard deviation of split frequencies: 0.018357
856000 -- (-1124.574) [-1125.179] (-1123.253) (-1126.774) * [-1123.437] (-1122.639) (-1125.195) (-1121.435) -- 0:00:16
857000 -- [-1127.936] (-1129.650) (-1125.220) (-1127.344) * (-1122.790) (-1130.937) [-1118.829] (-1129.076) -- 0:00:16
858000 -- (-1129.022) (-1126.184) (-1129.331) [-1123.238] * [-1125.347] (-1124.520) (-1120.962) (-1123.685) -- 0:00:16
859000 -- (-1134.879) [-1126.199] (-1124.520) (-1122.629) * [-1121.013] (-1125.411) (-1122.721) (-1125.055) -- 0:00:16
860000 -- [-1122.125] (-1130.257) (-1122.569) (-1128.144) * (-1123.452) (-1120.824) (-1131.271) [-1124.460] -- 0:00:15
Average standard deviation of split frequencies: 0.016432
861000 -- (-1126.663) (-1130.819) [-1120.490] (-1126.326) * [-1126.765] (-1130.076) (-1119.519) (-1129.684) -- 0:00:15
862000 -- (-1124.784) (-1128.643) (-1121.724) [-1122.007] * (-1122.562) (-1127.184) (-1127.115) [-1123.860] -- 0:00:15
863000 -- (-1138.334) (-1126.409) (-1120.553) [-1126.557] * (-1119.586) [-1122.212] (-1137.148) (-1130.349) -- 0:00:15
864000 -- [-1126.325] (-1132.216) (-1131.344) (-1124.773) * (-1123.802) (-1129.952) (-1127.313) [-1122.205] -- 0:00:15
865000 -- (-1124.260) [-1121.859] (-1120.390) (-1131.855) * (-1120.437) (-1124.572) [-1120.949] (-1126.163) -- 0:00:15
Average standard deviation of split frequencies: 0.016693
866000 -- (-1126.976) (-1125.498) [-1125.264] (-1123.036) * [-1121.144] (-1121.811) (-1122.312) (-1121.676) -- 0:00:15
867000 -- [-1133.200] (-1126.374) (-1127.515) (-1125.917) * [-1121.911] (-1127.451) (-1125.314) (-1122.546) -- 0:00:15
868000 -- [-1125.460] (-1126.770) (-1135.591) (-1126.977) * (-1126.870) (-1130.438) [-1123.249] (-1128.578) -- 0:00:15
869000 -- (-1128.840) [-1130.756] (-1124.859) (-1130.855) * (-1124.780) (-1123.302) (-1122.566) [-1124.462] -- 0:00:14
870000 -- (-1123.395) (-1127.277) (-1126.700) [-1120.543] * (-1123.806) (-1121.005) (-1126.975) [-1119.590] -- 0:00:14
Average standard deviation of split frequencies: 0.017326
871000 -- (-1124.990) [-1131.919] (-1124.658) (-1124.555) * (-1132.429) [-1122.373] (-1129.204) (-1122.014) -- 0:00:14
872000 -- (-1125.713) (-1131.078) (-1124.523) [-1130.703] * (-1125.871) (-1126.766) (-1124.560) [-1123.769] -- 0:00:14
873000 -- (-1134.342) [-1126.702] (-1129.163) (-1123.915) * [-1121.988] (-1124.695) (-1122.517) (-1121.030) -- 0:00:14
874000 -- (-1125.954) (-1126.350) [-1121.632] (-1125.523) * (-1125.157) (-1123.793) (-1121.656) [-1125.735] -- 0:00:14
875000 -- (-1130.692) (-1129.198) (-1126.917) [-1123.862] * [-1122.351] (-1125.979) (-1123.184) (-1127.929) -- 0:00:14
Average standard deviation of split frequencies: 0.017938
876000 -- [-1126.759] (-1128.772) (-1125.831) (-1127.952) * (-1128.966) (-1126.505) [-1121.782] (-1124.901) -- 0:00:14
877000 -- (-1126.159) [-1122.175] (-1127.426) (-1119.999) * (-1126.776) [-1122.459] (-1125.565) (-1124.986) -- 0:00:14
878000 -- [-1123.540] (-1127.651) (-1122.024) (-1122.041) * (-1123.537) (-1119.915) (-1124.888) [-1126.905] -- 0:00:13
879000 -- (-1128.101) [-1121.219] (-1122.306) (-1123.565) * (-1125.334) [-1122.789] (-1122.173) (-1130.666) -- 0:00:13
880000 -- [-1123.682] (-1124.647) (-1124.830) (-1116.800) * (-1129.678) [-1125.873] (-1122.731) (-1125.223) -- 0:00:13
Average standard deviation of split frequencies: 0.019270
881000 -- [-1125.395] (-1125.383) (-1123.626) (-1125.593) * (-1123.068) [-1124.091] (-1128.251) (-1127.219) -- 0:00:13
882000 -- [-1122.959] (-1122.661) (-1126.249) (-1131.428) * [-1122.612] (-1125.382) (-1126.831) (-1124.681) -- 0:00:13
883000 -- (-1127.423) (-1123.741) (-1123.101) [-1123.422] * [-1121.926] (-1128.462) (-1122.690) (-1125.088) -- 0:00:13
884000 -- [-1126.988] (-1123.088) (-1125.795) (-1129.328) * [-1123.383] (-1129.421) (-1125.562) (-1127.033) -- 0:00:13
885000 -- [-1128.540] (-1125.986) (-1129.582) (-1132.832) * (-1122.141) (-1125.382) (-1124.436) [-1122.535] -- 0:00:13
Average standard deviation of split frequencies: 0.019154
886000 -- (-1124.881) (-1130.255) [-1128.036] (-1123.866) * [-1123.314] (-1126.426) (-1122.197) (-1121.785) -- 0:00:12
887000 -- (-1120.427) (-1124.488) (-1124.250) [-1124.910] * (-1127.514) (-1121.368) (-1128.353) [-1122.997] -- 0:00:12
888000 -- (-1121.965) (-1131.301) (-1125.197) [-1126.558] * (-1126.024) (-1123.761) [-1126.347] (-1124.569) -- 0:00:12
889000 -- [-1123.168] (-1124.418) (-1124.224) (-1132.900) * (-1126.302) [-1128.049] (-1125.832) (-1124.170) -- 0:00:12
890000 -- (-1122.921) [-1122.097] (-1123.156) (-1127.550) * (-1121.838) (-1124.659) [-1121.142] (-1123.513) -- 0:00:12
Average standard deviation of split frequencies: 0.020112
891000 -- (-1125.803) (-1123.588) (-1122.755) [-1121.652] * (-1121.070) (-1120.905) (-1121.481) [-1124.590] -- 0:00:12
892000 -- (-1130.603) (-1129.022) (-1125.431) [-1123.335] * (-1122.234) [-1125.588] (-1125.582) (-1124.327) -- 0:00:12
893000 -- [-1124.939] (-1125.471) (-1124.134) (-1128.345) * [-1124.180] (-1120.834) (-1121.050) (-1122.105) -- 0:00:12
894000 -- (-1125.937) [-1123.354] (-1121.575) (-1129.993) * (-1122.058) (-1125.927) [-1120.150] (-1129.812) -- 0:00:12
895000 -- (-1124.152) (-1123.626) [-1123.216] (-1129.765) * (-1136.124) (-1130.540) (-1129.428) [-1123.433] -- 0:00:11
Average standard deviation of split frequencies: 0.021045
896000 -- (-1128.915) [-1122.064] (-1127.630) (-1126.883) * (-1125.612) (-1127.088) [-1127.595] (-1126.867) -- 0:00:11
897000 -- (-1126.743) (-1132.120) [-1128.557] (-1122.275) * [-1125.306] (-1121.720) (-1130.325) (-1125.858) -- 0:00:11
898000 -- [-1120.036] (-1124.294) (-1124.808) (-1120.481) * (-1126.045) (-1127.364) [-1124.429] (-1124.087) -- 0:00:11
899000 -- [-1127.151] (-1130.204) (-1122.345) (-1126.058) * (-1134.058) (-1121.123) (-1131.991) [-1127.600] -- 0:00:11
900000 -- (-1127.563) (-1121.020) (-1126.938) [-1124.852] * (-1141.785) (-1129.382) [-1122.766] (-1130.757) -- 0:00:11
Average standard deviation of split frequencies: 0.021285
901000 -- (-1125.178) (-1125.223) [-1120.880] (-1130.839) * (-1133.986) [-1128.093] (-1130.190) (-1126.974) -- 0:00:11
902000 -- (-1129.036) (-1128.602) [-1123.223] (-1121.790) * [-1123.587] (-1127.705) (-1129.158) (-1129.439) -- 0:00:11
903000 -- (-1123.888) (-1133.960) (-1128.874) [-1124.694] * [-1122.959] (-1129.946) (-1132.652) (-1126.926) -- 0:00:11
904000 -- (-1124.765) [-1123.790] (-1129.377) (-1123.420) * [-1122.628] (-1128.354) (-1124.166) (-1129.121) -- 0:00:10
905000 -- (-1124.424) [-1127.815] (-1125.126) (-1124.276) * (-1120.171) [-1121.462] (-1126.431) (-1127.533) -- 0:00:10
Average standard deviation of split frequencies: 0.020813
906000 -- [-1123.419] (-1126.029) (-1128.708) (-1121.770) * (-1123.022) (-1126.749) [-1127.018] (-1124.467) -- 0:00:10
907000 -- (-1126.982) (-1130.176) [-1125.465] (-1127.186) * (-1128.032) (-1122.390) (-1132.375) [-1123.329] -- 0:00:10
908000 -- (-1121.944) (-1124.697) (-1121.485) [-1125.655] * (-1125.419) (-1128.693) [-1127.189] (-1123.037) -- 0:00:10
909000 -- (-1129.993) (-1122.940) [-1121.247] (-1134.414) * (-1128.629) [-1126.586] (-1122.041) (-1124.809) -- 0:00:10
910000 -- (-1126.371) [-1124.252] (-1132.859) (-1123.670) * (-1128.554) [-1121.940] (-1132.026) (-1121.815) -- 0:00:10
Average standard deviation of split frequencies: 0.020361
911000 -- [-1124.343] (-1120.198) (-1123.318) (-1121.524) * (-1130.564) (-1124.458) (-1121.448) [-1127.573] -- 0:00:10
912000 -- [-1127.192] (-1126.220) (-1130.349) (-1124.693) * (-1126.306) (-1128.179) (-1122.678) [-1119.029] -- 0:00:10
913000 -- (-1121.488) [-1124.055] (-1125.734) (-1130.954) * [-1122.782] (-1121.394) (-1127.972) (-1124.001) -- 0:00:09
914000 -- (-1122.745) (-1122.611) [-1125.528] (-1125.891) * [-1125.135] (-1125.246) (-1126.580) (-1123.421) -- 0:00:09
915000 -- (-1126.554) (-1121.693) [-1122.206] (-1125.810) * [-1124.277] (-1127.775) (-1124.281) (-1124.107) -- 0:00:09
Average standard deviation of split frequencies: 0.019556
916000 -- (-1128.774) (-1132.268) [-1122.938] (-1125.022) * [-1121.990] (-1122.124) (-1119.489) (-1124.846) -- 0:00:09
917000 -- (-1122.865) [-1124.533] (-1131.566) (-1131.833) * (-1123.424) (-1127.397) (-1123.753) [-1126.592] -- 0:00:09
918000 -- (-1126.134) [-1125.155] (-1131.614) (-1127.037) * (-1124.842) (-1120.901) [-1123.045] (-1123.722) -- 0:00:09
919000 -- [-1123.362] (-1123.832) (-1120.766) (-1132.657) * (-1127.710) [-1128.975] (-1130.062) (-1126.190) -- 0:00:09
920000 -- (-1128.293) [-1122.378] (-1128.580) (-1136.211) * (-1120.197) (-1123.446) [-1128.020] (-1121.585) -- 0:00:09
Average standard deviation of split frequencies: 0.019798
921000 -- (-1126.139) (-1124.102) [-1124.369] (-1128.920) * [-1123.017] (-1128.449) (-1130.353) (-1127.726) -- 0:00:09
922000 -- (-1120.619) [-1123.555] (-1130.348) (-1135.343) * (-1127.087) [-1127.458] (-1124.270) (-1140.117) -- 0:00:08
923000 -- (-1125.303) [-1121.422] (-1130.005) (-1130.524) * (-1124.685) [-1122.736] (-1122.824) (-1130.430) -- 0:00:08
924000 -- [-1121.591] (-1124.746) (-1126.049) (-1128.051) * [-1123.122] (-1122.622) (-1122.827) (-1126.072) -- 0:00:08
925000 -- [-1123.783] (-1123.773) (-1125.024) (-1124.553) * [-1127.818] (-1125.801) (-1121.664) (-1130.495) -- 0:00:08
Average standard deviation of split frequencies: 0.019006
926000 -- (-1128.622) (-1128.932) [-1124.927] (-1125.358) * [-1123.070] (-1120.527) (-1127.215) (-1124.213) -- 0:00:08
927000 -- (-1127.143) (-1126.784) [-1123.498] (-1130.839) * (-1122.835) (-1130.181) [-1121.930] (-1125.866) -- 0:00:08
928000 -- (-1134.163) [-1124.066] (-1128.333) (-1127.962) * (-1129.616) (-1126.711) [-1121.643] (-1128.251) -- 0:00:08
929000 -- (-1128.807) (-1124.799) (-1126.074) [-1127.009] * (-1130.309) (-1130.064) [-1117.069] (-1120.665) -- 0:00:08
930000 -- (-1140.255) [-1123.599] (-1120.541) (-1122.699) * (-1122.627) [-1125.663] (-1124.469) (-1127.100) -- 0:00:07
Average standard deviation of split frequencies: 0.018573
931000 -- [-1131.220] (-1126.940) (-1129.719) (-1124.693) * (-1125.797) [-1129.303] (-1120.914) (-1126.697) -- 0:00:07
932000 -- [-1130.396] (-1125.174) (-1124.894) (-1128.187) * (-1127.268) (-1121.431) [-1122.830] (-1126.731) -- 0:00:07
933000 -- (-1124.813) (-1120.111) [-1124.557] (-1123.156) * (-1130.032) [-1124.813] (-1127.022) (-1124.137) -- 0:00:07
934000 -- [-1123.114] (-1127.771) (-1118.153) (-1125.667) * (-1125.781) (-1122.912) [-1122.494] (-1125.279) -- 0:00:07
935000 -- (-1125.779) (-1123.000) (-1128.494) [-1126.064] * (-1128.003) [-1130.581] (-1120.267) (-1120.849) -- 0:00:07
Average standard deviation of split frequencies: 0.018131
936000 -- (-1133.496) (-1127.313) [-1127.564] (-1124.912) * (-1125.405) (-1125.578) [-1122.944] (-1122.460) -- 0:00:07
937000 -- [-1129.400] (-1126.998) (-1122.934) (-1125.251) * [-1121.159] (-1127.121) (-1125.295) (-1126.384) -- 0:00:07
938000 -- (-1123.209) (-1121.806) (-1124.462) [-1125.760] * [-1122.812] (-1122.562) (-1125.137) (-1135.055) -- 0:00:07
939000 -- (-1133.879) [-1117.965] (-1131.486) (-1124.317) * (-1127.793) (-1125.038) (-1118.026) [-1125.205] -- 0:00:06
940000 -- (-1133.351) (-1125.002) [-1123.776] (-1127.055) * [-1118.133] (-1124.215) (-1127.899) (-1127.836) -- 0:00:06
Average standard deviation of split frequencies: 0.018709
941000 -- (-1127.913) [-1125.512] (-1121.227) (-1126.817) * [-1124.950] (-1122.859) (-1122.786) (-1123.735) -- 0:00:06
942000 -- [-1121.572] (-1120.786) (-1124.900) (-1120.952) * (-1125.090) (-1129.671) (-1122.305) [-1130.472] -- 0:00:06
943000 -- (-1122.843) (-1127.814) [-1128.959] (-1125.844) * (-1122.450) [-1131.506] (-1125.770) (-1124.241) -- 0:00:06
944000 -- (-1122.928) (-1124.366) (-1132.979) [-1124.824] * (-1132.917) [-1126.971] (-1123.975) (-1125.069) -- 0:00:06
945000 -- (-1127.392) (-1119.679) [-1121.632] (-1128.188) * (-1122.735) (-1127.546) (-1121.686) [-1123.907] -- 0:00:06
Average standard deviation of split frequencies: 0.017939
946000 -- (-1121.645) [-1131.829] (-1127.713) (-1126.598) * (-1131.804) [-1122.457] (-1132.728) (-1123.754) -- 0:00:06
947000 -- (-1130.393) (-1132.387) (-1128.542) [-1120.792] * (-1124.527) (-1120.550) [-1119.736] (-1127.202) -- 0:00:06
948000 -- (-1120.353) (-1126.820) [-1125.647] (-1128.926) * (-1120.328) [-1126.464] (-1125.577) (-1132.545) -- 0:00:05
949000 -- (-1117.480) (-1124.925) [-1125.364] (-1126.000) * (-1122.252) (-1121.054) (-1137.302) [-1121.573] -- 0:00:05
950000 -- (-1120.381) [-1124.968] (-1121.689) (-1129.593) * (-1120.778) [-1122.087] (-1118.849) (-1124.194) -- 0:00:05
Average standard deviation of split frequencies: 0.018512
951000 -- [-1123.400] (-1133.495) (-1124.064) (-1124.406) * [-1126.920] (-1129.517) (-1122.282) (-1127.186) -- 0:00:05
952000 -- [-1122.798] (-1121.502) (-1128.689) (-1124.416) * (-1129.740) (-1121.121) [-1124.206] (-1127.916) -- 0:00:05
953000 -- (-1124.377) (-1127.605) [-1122.326] (-1124.039) * [-1129.165] (-1127.281) (-1124.454) (-1125.727) -- 0:00:05
954000 -- (-1122.352) (-1128.694) [-1128.115] (-1128.845) * (-1126.034) (-1122.709) [-1124.779] (-1128.085) -- 0:00:05
955000 -- [-1121.872] (-1128.297) (-1131.627) (-1127.165) * (-1123.785) [-1129.593] (-1122.780) (-1127.837) -- 0:00:05
Average standard deviation of split frequencies: 0.016765
956000 -- (-1127.083) (-1124.538) (-1123.917) [-1128.582] * [-1127.253] (-1125.626) (-1124.369) (-1127.256) -- 0:00:05
957000 -- (-1119.810) (-1124.172) (-1136.592) [-1129.381] * (-1132.975) (-1123.709) [-1122.750] (-1127.684) -- 0:00:04
958000 -- [-1119.159] (-1137.008) (-1127.261) (-1123.398) * (-1130.287) (-1133.101) [-1124.237] (-1128.215) -- 0:00:04
959000 -- (-1119.629) (-1130.502) (-1123.444) [-1126.680] * (-1126.873) (-1132.977) (-1122.029) [-1131.085] -- 0:00:04
960000 -- (-1122.636) [-1124.452] (-1124.765) (-1126.112) * [-1124.703] (-1125.815) (-1127.997) (-1126.642) -- 0:00:04
Average standard deviation of split frequencies: 0.017011
961000 -- [-1123.557] (-1125.628) (-1130.174) (-1127.900) * (-1123.196) [-1129.906] (-1124.550) (-1125.916) -- 0:00:04
962000 -- (-1123.709) (-1128.679) (-1125.685) [-1124.320] * (-1120.817) (-1130.657) [-1123.983] (-1128.897) -- 0:00:04
963000 -- (-1123.088) [-1128.497] (-1127.491) (-1131.828) * [-1124.384] (-1121.355) (-1128.657) (-1129.996) -- 0:00:04
964000 -- [-1126.960] (-1137.448) (-1126.360) (-1131.347) * [-1120.851] (-1123.304) (-1124.610) (-1123.519) -- 0:00:04
965000 -- (-1126.202) (-1130.098) [-1127.431] (-1130.329) * [-1124.589] (-1121.850) (-1132.268) (-1125.467) -- 0:00:03
Average standard deviation of split frequencies: 0.016267
966000 -- (-1127.309) [-1126.581] (-1132.910) (-1129.156) * [-1119.411] (-1124.595) (-1124.862) (-1126.008) -- 0:00:03
967000 -- (-1123.753) [-1128.356] (-1126.622) (-1124.907) * (-1127.953) (-1121.244) [-1123.165] (-1130.473) -- 0:00:03
968000 -- (-1124.913) (-1126.811) (-1126.002) [-1125.278] * (-1126.650) (-1121.135) [-1127.164] (-1130.627) -- 0:00:03
969000 -- (-1127.572) (-1124.463) [-1124.002] (-1126.727) * (-1126.307) (-1124.509) (-1125.079) [-1123.718] -- 0:00:03
970000 -- (-1129.505) [-1126.623] (-1120.787) (-1122.108) * (-1134.149) (-1126.709) (-1130.960) [-1124.736] -- 0:00:03
Average standard deviation of split frequencies: 0.016836
971000 -- (-1125.129) (-1124.914) [-1128.066] (-1133.472) * (-1131.758) [-1126.209] (-1127.333) (-1126.343) -- 0:00:03
972000 -- (-1124.556) (-1129.539) [-1121.071] (-1124.036) * (-1124.943) (-1124.710) [-1124.180] (-1132.933) -- 0:00:03
973000 -- (-1121.620) (-1125.863) (-1123.136) [-1126.971] * (-1130.695) (-1118.979) (-1122.830) [-1122.579] -- 0:00:03
974000 -- (-1128.960) (-1125.060) (-1126.546) [-1131.549] * (-1122.286) [-1120.246] (-1122.290) (-1126.467) -- 0:00:02
975000 -- (-1127.992) (-1123.971) [-1126.970] (-1127.770) * (-1129.895) [-1122.001] (-1126.860) (-1122.836) -- 0:00:02
Average standard deviation of split frequencies: 0.016744
976000 -- (-1132.058) [-1128.007] (-1122.554) (-1127.608) * (-1125.753) [-1123.834] (-1123.454) (-1123.270) -- 0:00:02
977000 -- (-1125.142) (-1129.310) [-1124.026] (-1127.391) * (-1129.892) [-1123.400] (-1135.585) (-1125.643) -- 0:00:02
978000 -- [-1122.946] (-1122.570) (-1125.788) (-1128.308) * [-1118.289] (-1123.860) (-1130.267) (-1128.746) -- 0:00:02
979000 -- (-1129.125) [-1122.807] (-1128.846) (-1125.464) * (-1131.000) (-1125.184) (-1129.387) [-1121.365] -- 0:00:02
980000 -- [-1119.620] (-1124.819) (-1126.511) (-1127.248) * (-1132.773) [-1121.711] (-1133.046) (-1126.046) -- 0:00:02
Average standard deviation of split frequencies: 0.016664
981000 -- (-1122.809) (-1125.998) [-1127.086] (-1125.162) * (-1129.820) (-1126.260) (-1122.032) [-1119.721] -- 0:00:02
982000 -- (-1126.516) (-1125.461) (-1119.088) [-1123.820] * (-1120.056) (-1129.676) [-1126.863] (-1118.866) -- 0:00:02
983000 -- [-1124.436] (-1123.795) (-1127.622) (-1127.970) * (-1118.674) (-1122.491) (-1124.337) [-1119.342] -- 0:00:01
984000 -- (-1129.098) (-1124.807) [-1120.626] (-1125.055) * (-1123.502) [-1122.959] (-1118.603) (-1122.999) -- 0:00:01
985000 -- [-1128.703] (-1123.772) (-1119.614) (-1126.679) * (-1129.189) (-1122.325) [-1122.616] (-1121.853) -- 0:00:01
Average standard deviation of split frequencies: 0.015618
986000 -- (-1121.824) [-1124.288] (-1128.722) (-1127.593) * (-1124.674) [-1125.138] (-1128.973) (-1123.741) -- 0:00:01
987000 -- (-1126.258) (-1133.582) (-1119.230) [-1125.271] * (-1126.011) (-1126.162) (-1119.232) [-1124.909] -- 0:00:01
988000 -- (-1127.639) [-1124.204] (-1122.349) (-1128.731) * (-1120.721) (-1126.959) [-1124.374] (-1132.162) -- 0:00:01
989000 -- [-1125.265] (-1126.703) (-1127.652) (-1121.631) * [-1121.852] (-1126.875) (-1125.713) (-1130.884) -- 0:00:01
990000 -- (-1123.452) [-1125.048] (-1123.426) (-1120.647) * [-1124.570] (-1132.484) (-1128.457) (-1123.507) -- 0:00:01
Average standard deviation of split frequencies: 0.015544
991000 -- [-1129.756] (-1127.160) (-1123.903) (-1127.399) * (-1127.062) (-1121.252) (-1129.441) [-1129.517] -- 0:00:01
992000 -- [-1125.101] (-1126.869) (-1126.411) (-1132.826) * (-1124.710) (-1127.457) (-1122.302) [-1124.566] -- 0:00:00
993000 -- (-1121.505) (-1120.591) [-1129.156] (-1131.880) * (-1121.779) [-1121.168] (-1126.437) (-1132.031) -- 0:00:00
994000 -- (-1122.512) (-1121.404) (-1131.107) [-1127.797] * (-1134.703) (-1130.197) (-1127.289) [-1120.284] -- 0:00:00
995000 -- (-1123.859) [-1127.132] (-1130.231) (-1125.944) * [-1124.627] (-1123.158) (-1127.069) (-1124.617) -- 0:00:00
Average standard deviation of split frequencies: 0.015461
996000 -- (-1126.152) [-1132.000] (-1123.508) (-1125.500) * (-1125.505) (-1127.414) (-1139.231) [-1124.426] -- 0:00:00
997000 -- (-1130.291) (-1127.623) (-1129.118) [-1127.504] * (-1120.597) [-1122.956] (-1130.654) (-1127.231) -- 0:00:00
998000 -- [-1128.455] (-1130.266) (-1124.233) (-1129.880) * (-1127.117) (-1127.147) [-1123.584] (-1126.339) -- 0:00:00
999000 -- (-1123.546) (-1126.011) (-1131.904) [-1130.231] * (-1121.399) [-1123.443] (-1123.888) (-1127.835) -- 0:00:00
1000000 -- (-1125.316) [-1124.320] (-1122.654) (-1121.868) * (-1126.014) (-1127.845) (-1127.951) [-1130.104] -- 0:00:00
Average standard deviation of split frequencies: 0.016017
Analysis completed in 1 mins 53 seconds
Analysis used 112.99 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1115.79
Likelihood of best state for "cold" chain of run 2 was -1115.79
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
71.0 % ( 68 %) Dirichlet(Revmat{all})
87.3 % ( 83 %) Slider(Revmat{all})
27.6 % ( 22 %) Dirichlet(Pi{all})
29.5 % ( 23 %) Slider(Pi{all})
75.6 % ( 53 %) Multiplier(Alpha{1,2})
67.7 % ( 34 %) Multiplier(Alpha{3})
72.8 % ( 49 %) Slider(Pinvar{all})
97.9 % ( 95 %) ExtSPR(Tau{all},V{all})
99.7 % (100 %) NNI(Tau{all},V{all})
72.5 % ( 78 %) ParsSPR(Tau{all},V{all})
27.2 % ( 27 %) Multiplier(V{all})
49.7 % ( 48 %) Nodeslider(V{all})
27.5 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
70.7 % ( 62 %) Dirichlet(Revmat{all})
86.7 % ( 82 %) Slider(Revmat{all})
28.5 % ( 33 %) Dirichlet(Pi{all})
29.0 % ( 28 %) Slider(Pi{all})
75.6 % ( 57 %) Multiplier(Alpha{1,2})
67.4 % ( 43 %) Multiplier(Alpha{3})
72.1 % ( 52 %) Slider(Pinvar{all})
97.9 % ( 97 %) ExtSPR(Tau{all},V{all})
99.7 % (100 %) NNI(Tau{all},V{all})
72.4 % ( 77 %) ParsSPR(Tau{all},V{all})
27.2 % ( 18 %) Multiplier(V{all})
49.9 % ( 51 %) Nodeslider(V{all})
27.6 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.55
2 | 166259 0.84 0.70
3 | 166237 166585 0.86
4 | 167376 167107 166436
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.55
2 | 166191 0.84 0.70
3 | 166834 167066 0.85
4 | 166660 166755 166494
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1123.17
|1 1 2 2 |
| 1 2 |
| 1 1 2 2 2 2|
| 21 1 1 2 1 1 11 * |
| 21 * 1 11 2 2 *2 1 1 2 21 |
| 212 1 2 12 2 121 1 1 |
| 2 2 2 1 1 2 2 1 1 1 2 |
| 21 2 1 1 * 2 2 2 22 |
| 1 1 2 2 2 2 1 1 |
| 2 2 122 112 1212112 2 |
|2 2 1 2 * 1 |
| 1 2 2 1 2 2 |
| 1 1 |
| 1 1 |
| 2 1 1|
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1126.41
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1121.55 -1131.69
2 -1121.47 -1138.95
--------------------------------------
TOTAL -1121.51 -1138.26
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.115769 0.005814 0.040505 0.247244 0.093070 632.70 643.26 1.000
r(A<->C){all} 0.120678 0.005858 0.000125 0.262552 0.111222 508.58 586.78 1.000
r(A<->G){all} 0.217521 0.008108 0.049804 0.395544 0.209253 492.77 500.19 1.000
r(A<->T){all} 0.141324 0.005097 0.020345 0.289135 0.131102 472.25 484.35 1.000
r(C<->G){all} 0.153815 0.006728 0.008950 0.311760 0.146535 396.83 401.49 1.000
r(C<->T){all} 0.312204 0.010097 0.134789 0.520555 0.304257 439.20 448.16 1.001
r(G<->T){all} 0.054458 0.002209 0.000122 0.142813 0.043792 304.75 505.75 1.002
pi(A){all} 0.252561 0.000261 0.222771 0.285548 0.252180 1163.73 1252.02 1.000
pi(C){all} 0.197448 0.000221 0.167693 0.225280 0.196982 1245.05 1273.85 1.000
pi(G){all} 0.224333 0.000237 0.192615 0.252237 0.224162 1257.00 1315.83 1.000
pi(T){all} 0.325657 0.000291 0.293585 0.359808 0.325463 1306.92 1403.96 1.001
alpha{1,2} 0.359999 0.344294 0.000191 1.441373 0.152993 885.78 988.32 1.000
alpha{3} 1.596573 1.357626 0.008234 3.819726 1.303115 1181.10 1325.67 1.000
pinvar{all} 0.578763 0.054179 0.085074 0.884828 0.656513 356.61 487.19 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .*.*
6 -- ..**
7 -- .**.
----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 1043 0.347435 0.018373 0.334444 0.360426 2
6 1007 0.335443 0.024026 0.318454 0.352432 2
7 952 0.317122 0.005653 0.313125 0.321119 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.109843 0.005743 0.037591 0.243073 0.087574 1.000 2
length{all}[2] 0.001469 0.000002 0.000000 0.004478 0.001006 1.000 2
length{all}[3] 0.001473 0.000002 0.000000 0.004303 0.001044 1.000 2
length{all}[4] 0.001511 0.000002 0.000001 0.004619 0.001061 1.000 2
length{all}[5] 0.001520 0.000002 0.000001 0.004518 0.001004 1.000 2
length{all}[6] 0.001491 0.000002 0.000001 0.004429 0.000995 1.000 2
length{all}[7] 0.001404 0.000002 0.000000 0.004352 0.000960 0.999 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.016017
Maximum standard deviation of split frequencies = 0.024026
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\------------------------------------------------------------------------ C4 (4)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|- C2 (2)
+
|- C3 (3)
|
\- C4 (4)
|-------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
Running FUBAR...
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\
***************** TYPES OF STANDARD ANALYSES *****************
(1) Selection Analyses
(2) Evolutionary Hypothesis Testing
(3) Relative evolutionary rate inference
(4) Coevolutionary analysis
(5) Basic Analyses
(6) Codon Selection Analyses
(7) Compartmentalization
(8) Data File Tools
(9) Miscellaneous
(10) Model Comparison
(11) Kernel Analysis Tools
(12) Molecular Clock
(13) Phylogeny Reconstruction
(14) Positive Selection
(15) Recombination
(16) Selection/Recombination
(17) Relative Rate
(18) Relative Ratio
(19) Substitution Rates
Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' *****************
(1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution).
(2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood).
(3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting).
(4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection).
(5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification).
(6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood).
(7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation).
Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types):
Analysis Description
--------------------
Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a
coding sequence alignment to determine whether some sites have been
subject to pervasive purifying or diversifying selection. v2.1
introduces two more methods for estimating the posterior distribution of
grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation
Bayes approximation (fastest). Please note that a FUBAR analysis
generates a cache and a results JSON file in the same directory as
directory as the original alignment. HyPhy needs to have write
privileges to this directory. For example if the original file is in
/home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there
will also exist FUBAR-generated files
/home/sergei/FUBAR/data/pol.nex.FUBAR.json,
/home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide
checkpointing so that a partially completed analysis can be restarted.
- __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree
(one per partition)
- __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring
selection (2013), Mol Biol Evol. 30(5):1196-205
- __Written by__: Sergei L Kosakovsky Pond
- __Contact Information__: spond@temple.edu
- __Analysis Version__: 2.1
####Choose Genetic Code
1. [**Universal**] Universal code. (Genebank transl_table=1).
2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2).
3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3).
4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4).
5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5).
6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6).
7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9).
8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10).
9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12).
10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13).
11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14).
12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15).
13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16).
14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21).
15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22).
16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23).
17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24).
18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25).
19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26).
>Please choose an option (or press q to cancel selection):
>Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`)
>A tree was found in the data file: `(C1,C2,C3,C4)`
>Would you like to use it (y/n)?
>Loaded a multiple sequence alignment with **4** sequences, **229** codons, and **1** partitions from `/data//pss_subsets/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result/original_alignment/fubar/results/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result.1/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result.1.fna`
> FUBAR will write cache and result files to _/data//pss_subsets/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result/original_alignment/fubar/results/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result.1/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result/original_alignment/fubar/results/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result.1/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result.1.fna.FUBAR.json_, respectively
> Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer):
####Posterior estimation method
1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation)
2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed)
3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default)
>Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5):
### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model
* Log(L) = -1122.20, AIC-c = 2268.52 (12 estimated parameters)
* Tree length (expected substitutions/site) for partition 1 : 0.058
### Computing the phylogenetic likelihood function on the grid
* Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid
* Best scaling achieved for
* synonymous rate = 2.815
* non-synonymous rate = 0.571
* Computing conditional site likelihoods on a 20 x 20 rate grid
### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights
* Using the following settings
* Dirichlet alpha : 0.5
### Tabulating site-level results
----
## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=229
8190_NA_AFG25764_1_NA_NA_Rat_Murine_coronavirus MSSTTSAPQTVYQWTADVAVRFLKEWNFLLGIILLFITIILQFGYTSRSM
A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSM
MHV_BHKR_lab_USA_infA59_H126A_2012_M_AGT17720_1_2012_10_25_USA_Mouse_Murine_coronavirus MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSM
inf_MHV_A59_NA_ACN89755_1_NA_USA_Mouse_Murine_coronavirus MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSM
*****.**:.******* **:******* *********************
8190_NA_AFG25764_1_NA_NA_Rat_Murine_coronavirus FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVMWIM
A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIM
MHV_BHKR_lab_USA_infA59_H126A_2012_M_AGT17720_1_2012_10_25_USA_Mouse_Murine_coronavirus FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIM
inf_MHV_A59_NA_ACN89755_1_NA_USA_Mouse_Murine_coronavirus FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIM
**********************************************:***
8190_NA_AFG25764_1_NA_NA_Rat_Murine_coronavirus YFVNSIRLFIRTGSWWSFNPETNNLMCIDVKGTVYVRPIIEDYHTLTATN
A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus YFVNSIRLFIRTGSWWSFNPETNNLMCIDMKGTVYVRPIIEDYHTLTATI
MHV_BHKR_lab_USA_infA59_H126A_2012_M_AGT17720_1_2012_10_25_USA_Mouse_Murine_coronavirus YFVNSIRLFIRTGSWWSFNPETNNLMCIDMKGTVYVRPIIEDYHTLTATI
inf_MHV_A59_NA_ACN89755_1_NA_USA_Mouse_Murine_coronavirus YFVNSIRLFIRTGSWWSFNPETNNLMCIDMKGTVYVRPIIEDYHTLTATI
*****************************:*******************
8190_NA_AFG25764_1_NA_NA_Rat_Murine_coronavirus VRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVRRVLGG
A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus IRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGV-SG
MHV_BHKR_lab_USA_infA59_H126A_2012_M_AGT17720_1_2012_10_25_USA_Mouse_Murine_coronavirus IRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGV-SG
inf_MHV_A59_NA_ACN89755_1_NA_USA_Mouse_Murine_coronavirus IRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGV-SG
:******************************************* * .*
8190_NA_AFG25764_1_NA_NA_Rat_Murine_coronavirus FAVYVKSKVGNYRLPSNKPSGADTALLRI
A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus FAVYVKSKVGNYRLPSNKPSGADTALLRT
MHV_BHKR_lab_USA_infA59_H126A_2012_M_AGT17720_1_2012_10_25_USA_Mouse_Murine_coronavirus FAVYVKSKVGNYRLPSNKPSGADTALLRT
inf_MHV_A59_NA_ACN89755_1_NA_USA_Mouse_Murine_coronavirus FAVYVKSKVGNYRLPSNKPSGADTALLRT
****************************
>8190_NA_AFG25764_1_NA_NA_Rat_Murine_coronavirus ATGAGTAGTACCACTTCAGCCCCCCAGACTGTCTATCAATGGACGGCCGATGTGGCAGTTCGATTCCTTAAGGAATGGAACTTCTTGTTGGGCATTATACTACTCTTTATTACTATCATACTACAGTTCGGTTACACGAGCCGTAGCATGTTTATATATGTTGTGAAAATGATAATCTTGTGGTTAATGTGGCCACTGACTATTGTTTTGTGTATTTTTAATTGCGTGTATGCGCTAAATAATGTGTATCTTGGATTTTCTATAGTGTTTACTATAGTGTCCATTGTAATGTGGATTATGTATTTTGTTAATAGCATAAGGTTGTTTATCAGGACTGGTAGCTGGTGGAGCTTCAACCCCGAAACAAACAACCTAATGTGTATAGATGTGAAAGGTACTGTGTATGTTAGACCCATTATTGAAGATTACCATACACTAACAGCCACAAATGTACGTGGCCACCTCTATATGCAAGGTGTTAAGCTAGGCACTGGCTTCTCTTTGTCTGATTTGCCCGCTTATGTTACAGTTGCTAAGGTGTCGCACCTTTGCACTTATAAGCGCGCATTCTTAGACAAGGTTCGACGGGTGTTAGGCGGTTTTGCTGTTTATGTGAAGTCCAAGGTCGGAAATTACCGACTGCCCTCAAACAAACCGAGTGGCGCGGACACCGCATTGTTGAGAATC >A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus ATGAGTAGTACTACTCAGGCCCCAGAGCCCGTCTATCAATGGACCGCCGACGAGGCAGTTCAATTCCTTAAGGAATGGAACTTCTCGTTGGGCATTATACTACTCTTTATTACTATCATACTACAGTTCGGTTACACGAGCCGTAGCATGTTTATTTATGTTGTGAAAATGATAATCTTGTGGTTAATGTGGCCACTGACTATTGTTTTGTGTATTTTCAATTGCGTGTATGCGCTAAATAATGTGTATCTTGGATTTTCTATAGTGTTTACTATAGTGTCCATTGTAATCTGGATTATGTATTTTGTTAATAGCATAAGGTTGTTTATCAGGACTGGTAGCTGGTGGAGCTTCAACCCCGAAACAAACAACCTTATGTGTATAGATATGAAAGGTACCGTGTATGTTAGACCCATTATTGAGGATTACCATACACTAACAGCCACTATTATTCGTGGCCACCTCTACATGCAAGGTGTTAAGCTAGGCACCGGTTTCTCTTTGTCTGACTTGCCCGCTTATGTTACAGTTGCTAAGGTGTCACACCTTTGCACTTATAAGCGCGCATTCTTAGACAAGGTAGACGGTGTT---AGCGGTTTTGCTGTTTATGTGAAGTCCAAGGTCGGAAATTACCGACTGCCCTCAAACAAACCGAGTGGCGCGGACACCGCATTGTTGAGAACC >MHV_BHKR_lab_USA_infA59_H126A_2012_M_AGT17720_1_2012_10_25_USA_Mouse_Murine_coronavirus ATGAGTAGTACTACTCAGGCCCCAGAGCCCGTCTATCAATGGACCGCCGACGAGGCAGTTCAATTCCTTAAGGAATGGAACTTCTCGTTGGGCATTATACTACTCTTTATTACTATCATACTACAGTTCGGTTACACGAGCCGTAGCATGTTTATTTATGTTGTGAAAATGATAATCTTGTGGTTAATGTGGCCACTGACTATTGTTTTGTGTATTTTCAATTGCGTGTATGCGCTAAATAATGTGTATCTTGGATTTTCTATAGTGTTTACTATAGTGTCCATTGTAATCTGGATTATGTATTTTGTTAATAGCATAAGGTTGTTTATCAGGACTGGTAGCTGGTGGAGCTTCAACCCCGAAACAAACAACCTTATGTGTATAGATATGAAAGGTACCGTGTATGTTAGACCCATTATTGAGGATTACCATACACTAACAGCCACTATTATTCGTGGCCACCTCTACATGCAAGGTGTTAAGCTAGGCACCGGTTTCTCTTTGTCTGACTTGCCCGCTTATGTTACAGTTGCTAAGGTGTCACACCTTTGCACTTATAAGCGCGCATTCTTAGACAAGGTAGACGGTGTT---AGCGGTTTTGCTGTTTATGTGAAGTCCAAGGTCGGAAATTACCGACTGCCCTCAAACAAACCGAGTGGCGCGGACACCGCATTGTTGAGAACC >inf_MHV_A59_NA_ACN89755_1_NA_USA_Mouse_Murine_coronavirus ATGAGTAGTACTACTCAGGCCCCAGAGCCCGTCTATCAATGGACCGCCGACGAGGCAGTTCAATTCCTTAAGGAATGGAACTTCTCGTTGGGCATTATACTACTCTTTATTACTATCATACTACAGTTCGGTTACACGAGCCGTAGCATGTTTATTTATGTTGTGAAAATGATAATCTTGTGGTTAATGTGGCCACTGACTATTGTTTTGTGTATTTTCAATTGCGTGTATGCGCTAAATAATGTGTATCTTGGATTTTCTATAGTGTTTACTATAGTGTCCATTGTAATCTGGATTATGTATTTTGTTAATAGCATAAGGTTGTTTATCAGGACTGGTAGCTGGTGGAGCTTCAACCCCGAAACAAACAACCTTATGTGTATAGATATGAAAGGTACCGTGTATGTTAGACCCATTATTGAGGATTACCATACACTAACAGCCACTATTATTCGTGGCCACCTCTACATGCAAGGTGTTAAGCTAGGCACCGGTTTCTCTTTGTCTGACTTGCCCGCTTATGTTACAGTTGCTAAGGTGTCACACCTTTGCACTTATAAGCGCGCATTCTTAGACAAGGTAGACGGTGTT---AGCGGTTTTGCTGTTTATGTGAAGTCCAAGGTCGGAAATTACCGACTGCCCTCAAACAAACCGAGTGGCGCGGACACCGCATTGTTGAGAACC
>8190_NA_AFG25764_1_NA_NA_Rat_Murine_coronavirus MSSTTSAPQTVYQWTADVAVRFLKEWNFLLGIILLFITIILQFGYTSRSM FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVMWIM YFVNSIRLFIRTGSWWSFNPETNNLMCIDVKGTVYVRPIIEDYHTLTATN VRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVRRVLGG FAVYVKSKVGNYRLPSNKPSGADTALLRI >A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSM FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIM YFVNSIRLFIRTGSWWSFNPETNNLMCIDMKGTVYVRPIIEDYHTLTATI IRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGV-SG FAVYVKSKVGNYRLPSNKPSGADTALLRT >MHV_BHKR_lab_USA_infA59_H126A_2012_M_AGT17720_1_2012_10_25_USA_Mouse_Murine_coronavirus MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSM FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIM YFVNSIRLFIRTGSWWSFNPETNNLMCIDMKGTVYVRPIIEDYHTLTATI IRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGV-SG FAVYVKSKVGNYRLPSNKPSGADTALLRT >inf_MHV_A59_NA_ACN89755_1_NA_USA_Mouse_Murine_coronavirus MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSM FIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIM YFVNSIRLFIRTGSWWSFNPETNNLMCIDMKGTVYVRPIIEDYHTLTATI IRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGV-SG FAVYVKSKVGNYRLPSNKPSGADTALLRT
Reading sequence file /data//pss_subsets/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result/original_alignment/fubar/fasta/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result.1 Found 4 sequences of length 687 Alignment looks like a valid DNA alignment. Estimated diversity is (pairwise deletion - ignoring missing/ambig): 2.8% Found 0 informative sites. Writing alignment of informative sites to: Phi.inf.sites Writing list of informative sites to: Phi.inf.list Calculating all pairwise incompatibilities... 100.0% Using a window size of 80 with k as 1 Too few informative sites to use normal approximation. Try doing a permutation test or increasing alignment length Can also try decreasing windowsize.
#NEXUS
[ID: 8367500220]
begin taxa;
dimensions ntax=4;
taxlabels
8190_NA_AFG25764_1_NA_NA_Rat_Murine_coronavirus
A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus
MHV_BHKR_lab_USA_infA59_H126A_2012_M_AGT17720_1_2012_10_25_USA_Mouse_Murine_coronavirus
inf_MHV_A59_NA_ACN89755_1_NA_USA_Mouse_Murine_coronavirus
;
end;
begin trees;
translate
1 8190_NA_AFG25764_1_NA_NA_Rat_Murine_coronavirus,
2 A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus,
3 MHV_BHKR_lab_USA_infA59_H126A_2012_M_AGT17720_1_2012_10_25_USA_Mouse_Murine_coronavirus,
4 inf_MHV_A59_NA_ACN89755_1_NA_USA_Mouse_Murine_coronavirus
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:8.757390e-02,2:1.006013e-03,3:1.044271e-03,4:1.060540e-03);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:8.757390e-02,2:1.006013e-03,3:1.044271e-03,4:1.060540e-03);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1121.56 -1135.80
2 -1121.45 -1133.99
--------------------------------------
TOTAL -1121.50 -1135.26
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.117353 0.006241 0.043531 0.245350 0.095259 831.94 904.05 1.000
r(A<->C){all} 0.123667 0.006230 0.000080 0.264937 0.111246 425.97 456.84 1.005
r(A<->G){all} 0.215900 0.008603 0.057097 0.406817 0.204199 259.26 343.31 1.003
r(A<->T){all} 0.132885 0.004251 0.018440 0.264007 0.124749 337.94 456.11 1.000
r(C<->G){all} 0.159537 0.007472 0.000076 0.314987 0.151502 330.47 349.26 1.000
r(C<->T){all} 0.311981 0.010091 0.128282 0.506673 0.305723 313.63 400.78 1.000
r(G<->T){all} 0.056031 0.002479 0.000001 0.151141 0.042673 435.72 512.61 1.001
pi(A){all} 0.254124 0.000280 0.221769 0.286241 0.254072 1193.90 1297.02 1.000
pi(C){all} 0.196467 0.000212 0.167954 0.225557 0.196283 1212.03 1226.62 1.000
pi(G){all} 0.224095 0.000258 0.194614 0.256626 0.223527 1221.07 1361.03 1.000
pi(T){all} 0.325314 0.000302 0.288408 0.356671 0.325352 1376.11 1380.29 1.000
alpha{1,2} 0.359537 0.349821 0.000019 1.434888 0.157803 1154.07 1199.22 1.000
alpha{3} 1.632693 1.262954 0.001975 3.797113 1.357660 1204.69 1345.28 1.000
pinvar{all} 0.593164 0.050434 0.102322 0.877076 0.669460 347.61 525.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C2,C3,C4)` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **4** sequences, **229** codons, and **1** partitions from `/data//pss_subsets/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result/original_alignment/fubar/results/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result.1/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result/original_alignment/fubar/results/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result.1/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result/original_alignment/fubar/results/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result.1/A59_M_YP_009824986_1_NA_USA_Unknown_Murine_coronavirus.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -1122.20, AIC-c = 2268.52 (12 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.058 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 2.815 * non-synonymous rate = 0.571 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results ---- ## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
