--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -617.48 -634.77
2 -617.23 -636.92
--------------------------------------
TOTAL -617.34 -636.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.178313 0.001050 0.116801 0.239773 0.175271 1303.08 1402.04 1.000
r(A<->C){all} 0.079048 0.002041 0.009457 0.170477 0.071840 467.36 537.39 1.000
r(A<->G){all} 0.225054 0.004421 0.103278 0.355008 0.219789 438.36 505.03 1.001
r(A<->T){all} 0.064725 0.000963 0.013930 0.127309 0.059625 648.09 709.40 1.000
r(C<->G){all} 0.065099 0.002079 0.000015 0.154581 0.055015 502.87 512.51 1.000
r(C<->T){all} 0.439084 0.006526 0.281725 0.595534 0.437984 455.10 550.56 1.001
r(G<->T){all} 0.126991 0.002040 0.042310 0.209926 0.121780 811.66 890.80 1.000
pi(A){all} 0.261889 0.000657 0.210931 0.310406 0.261649 1003.58 1032.23 1.002
pi(C){all} 0.155242 0.000433 0.116419 0.196806 0.154836 1096.47 1124.74 1.000
pi(G){all} 0.209123 0.000563 0.163449 0.255496 0.209300 1063.42 1092.50 1.000
pi(T){all} 0.373746 0.000812 0.319034 0.431979 0.373304 1090.53 1183.59 1.001
alpha{1,2} 1.185373 0.943523 0.003009 3.161392 0.895914 1261.56 1381.28 1.001
alpha{3} 1.318890 0.943571 0.001626 3.242017 1.073839 1117.90 1195.80 1.000
pinvar{all} 0.236886 0.024629 0.000053 0.515873 0.222638 724.47 828.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
-- Starting log on Wed Nov 02 20:10:57 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=17, Len=88
C1 MFNLFLIDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C2 MFNLFLTDTVWYVGQIIFIFAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C3 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C4 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C5 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C6 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C7 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C8 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C9 MFNVLSTDTVWYVGQIIFIVAVCLMVTIVVVAFLASIKLCIQLCGLCNTL
C10 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C11 MFNLFLIDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C12 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C13 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C14 MFNLFLTDTVWYVGQIIFIVAVCLMVTITVVAFLASIKLCIQLCGLCNTL
C15 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C16 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C17 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
***:: ************.******** ********* ***********
C1 LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C2 VLSPSIYLYDRSKQLYKYYNEEMRMPLLEVDDI-----
C3 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C4 LLSPSIYVYNGSKQLYKYYNEEVRPPPLEVDDKIIQTL
C5 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C6 LLSPSICVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C7 LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C8 LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C9 LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C10 LLSPSICVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C11 LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C12 LLSPSICVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C13 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C14 VLSPSIYLYDRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C15 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C16 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C17 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
:***** :*: ***********:* * *****
-- Starting log on Wed Nov 02 20:13:36 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.08 sec, SCORE=999, Nseq=17, Len=88
C1 MFNLFLIDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C2 MFNLFLTDTVWYVGQIIFIFAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C3 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C4 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C5 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C6 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C7 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C8 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C9 MFNVLSTDTVWYVGQIIFIVAVCLMVTIVVVAFLASIKLCIQLCGLCNTL
C10 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C11 MFNLFLIDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C12 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C13 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C14 MFNLFLTDTVWYVGQIIFIVAVCLMVTITVVAFLASIKLCIQLCGLCNTL
C15 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C16 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C17 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
***:: ************.******** ********* ***********
C1 LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C2 VLSPSIYLYDRSKQLYKYYNEEMRMPLLEVDDI-----
C3 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C4 LLSPSIYVYNGSKQLYKYYNEEVRPPPLEVDDKIIQTL
C5 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C6 LLSPSICVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C7 LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C8 LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C9 LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C10 LLSPSICVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C11 LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C12 LLSPSICVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C13 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C14 VLSPSIYLYDRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C15 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C16 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C17 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
:***** :*: ***********:* * *****
-- Starting log on Wed Nov 02 20:10:57 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=17, Len=88
C1 MFNLFLIDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C2 MFNLFLTDTVWYVGQIIFIFAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C3 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C4 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C5 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C6 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C7 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C8 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C9 MFNVLSTDTVWYVGQIIFIVAVCLMVTIVVVAFLASIKLCIQLCGLCNTL
C10 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C11 MFNLFLIDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C12 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
C13 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C14 MFNLFLTDTVWYVGQIIFIVAVCLMVTITVVAFLASIKLCIQLCGLCNTL
C15 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C16 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
C17 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
***:: ************.******** ********* ***********
C1 LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C2 VLSPSIYLYDRSKQLYKYYNEEMRMPLLEVDDI-----
C3 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C4 LLSPSIYVYNGSKQLYKYYNEEVRPPPLEVDDKIIQTL
C5 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C6 LLSPSICVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C7 LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C8 LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C9 LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C10 LLSPSICVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C11 LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C12 LLSPSICVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C13 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C14 VLSPSIYLYDRSKQLYKYYNEEVRPPPLEVDDIIIQTL
C15 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C16 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
C17 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
:***** :*: ***********:* * *****
-- Starting log on Wed Nov 02 21:23:17 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result/gapped_alignment/fubar,A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 17 taxa and 264 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C10
Taxon 3 -> C11
Taxon 4 -> C12
Taxon 5 -> C13
Taxon 6 -> C14
Taxon 7 -> C15
Taxon 8 -> C16
Taxon 9 -> C17
Taxon 10 -> C2
Taxon 11 -> C3
Taxon 12 -> C4
Taxon 13 -> C5
Taxon 14 -> C6
Taxon 15 -> C7
Taxon 16 -> C8
Taxon 17 -> C9
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1667424199
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 132237691
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8018085733
Seed = 1849877312
Swapseed = 1667424199
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 18 unique site patterns
Division 2 has 14 unique site patterns
Division 3 has 23 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -887.305235 -- 54.852219
Chain 2 -- -949.027175 -- 54.852219
Chain 3 -- -948.885224 -- 54.852219
Chain 4 -- -893.239859 -- 54.852219
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -887.447185 -- 54.852219
Chain 2 -- -898.111055 -- 54.852219
Chain 3 -- -902.944346 -- 54.852219
Chain 4 -- -836.294307 -- 54.852219
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-887.305] (-949.027) (-948.885) (-893.240) * [-887.447] (-898.111) (-902.944) (-836.294)
1000 -- [-643.436] (-629.948) (-634.349) (-676.490) * [-629.773] (-632.653) (-652.564) (-653.777) -- 0:00:00
2000 -- (-629.104) (-634.180) [-630.519] (-627.120) * (-623.939) [-626.199] (-633.263) (-639.244) -- 0:00:00
3000 -- (-646.317) (-618.440) [-631.959] (-623.714) * (-643.228) [-624.283] (-631.858) (-637.101) -- 0:05:32
4000 -- (-632.495) [-622.663] (-624.094) (-634.035) * (-636.982) (-622.383) [-622.528] (-634.772) -- 0:04:09
5000 -- (-626.174) (-627.353) [-619.068] (-636.790) * (-632.699) (-631.591) (-622.861) [-623.086] -- 0:03:19
Average standard deviation of split frequencies: 0.106446
6000 -- (-624.365) (-633.243) [-617.978] (-638.123) * (-634.532) [-627.327] (-638.541) (-636.187) -- 0:05:31
7000 -- (-627.627) (-634.417) (-627.908) [-625.221] * (-633.388) [-624.525] (-645.806) (-633.189) -- 0:04:43
8000 -- [-626.283] (-630.438) (-625.913) (-620.848) * (-635.198) [-623.748] (-638.104) (-629.528) -- 0:06:12
9000 -- (-637.505) (-622.958) [-629.198] (-630.671) * (-636.038) [-621.915] (-638.111) (-638.647) -- 0:05:30
10000 -- [-625.379] (-629.977) (-626.764) (-623.521) * (-644.203) (-632.732) (-633.892) [-616.528] -- 0:04:57
Average standard deviation of split frequencies: 0.075224
11000 -- (-631.436) (-634.732) [-625.201] (-634.626) * [-623.770] (-626.164) (-638.277) (-624.556) -- 0:05:59
12000 -- (-625.317) (-634.963) [-625.616] (-625.454) * [-624.210] (-627.054) (-634.690) (-620.648) -- 0:05:29
13000 -- (-619.349) (-632.516) (-628.424) [-617.965] * [-629.866] (-628.514) (-631.809) (-632.551) -- 0:06:19
14000 -- (-626.181) [-627.229] (-615.910) (-629.043) * (-623.136) [-619.189] (-624.025) (-626.824) -- 0:05:52
15000 -- (-628.998) (-624.286) (-633.985) [-621.840] * (-627.056) [-624.777] (-631.166) (-626.111) -- 0:05:28
Average standard deviation of split frequencies: 0.061604
16000 -- [-619.628] (-633.446) (-635.759) (-628.698) * (-622.316) [-628.988] (-626.148) (-634.145) -- 0:06:09
17000 -- (-631.464) (-634.046) (-620.393) [-616.830] * [-627.626] (-642.591) (-628.060) (-622.969) -- 0:05:46
18000 -- (-621.261) [-624.614] (-635.679) (-623.468) * (-625.429) [-628.937] (-624.205) (-626.256) -- 0:06:21
19000 -- (-623.309) (-624.126) (-630.591) [-619.266] * (-618.950) (-626.575) (-627.662) [-626.442] -- 0:06:01
20000 -- (-631.385) [-622.730] (-623.972) (-627.083) * (-626.123) [-628.168] (-629.908) (-624.574) -- 0:05:43
Average standard deviation of split frequencies: 0.061227
21000 -- (-633.989) (-629.581) [-621.505] (-622.048) * (-618.912) (-630.111) (-629.314) [-620.183] -- 0:06:12
22000 -- (-627.517) (-629.359) (-622.431) [-617.323] * (-625.268) (-647.111) [-618.088] (-619.272) -- 0:05:55
23000 -- [-629.566] (-626.844) (-622.747) (-623.886) * (-622.504) (-632.202) [-620.380] (-631.267) -- 0:05:39
24000 -- [-625.701] (-630.247) (-627.591) (-614.925) * (-640.047) (-623.283) [-619.234] (-631.871) -- 0:06:06
25000 -- (-643.945) (-628.787) (-629.064) [-624.039] * [-622.652] (-631.562) (-625.226) (-630.643) -- 0:05:51
Average standard deviation of split frequencies: 0.049105
26000 -- (-639.643) (-624.555) [-627.854] (-616.965) * (-619.906) [-621.722] (-620.847) (-619.316) -- 0:06:14
27000 -- [-614.128] (-640.949) (-625.038) (-626.811) * [-618.704] (-633.304) (-628.667) (-625.847) -- 0:06:00
28000 -- (-633.306) (-626.307) (-628.599) [-628.463] * (-620.330) (-630.579) [-620.619] (-626.335) -- 0:05:47
29000 -- [-616.867] (-616.199) (-616.713) (-626.991) * (-623.826) (-632.887) (-618.179) [-627.693] -- 0:06:08
30000 -- (-625.058) (-634.671) (-618.996) [-621.246] * (-626.126) [-617.115] (-619.129) (-628.458) -- 0:05:55
Average standard deviation of split frequencies: 0.043689
31000 -- (-640.757) (-630.198) (-615.937) [-624.196] * (-627.519) (-620.766) (-623.336) [-624.841] -- 0:06:15
32000 -- (-640.678) (-640.429) [-622.936] (-631.477) * (-623.847) (-630.526) [-618.572] (-614.994) -- 0:06:03
33000 -- (-636.928) (-626.067) [-624.510] (-629.302) * (-640.010) [-614.709] (-627.276) (-620.298) -- 0:05:51
34000 -- (-620.936) (-634.058) (-631.433) [-626.730] * (-626.790) (-628.971) (-631.965) [-617.299] -- 0:06:09
35000 -- (-623.757) [-623.419] (-630.472) (-628.945) * (-630.588) (-630.247) [-620.959] (-617.915) -- 0:05:58
Average standard deviation of split frequencies: 0.040824
36000 -- (-640.584) (-624.158) (-631.503) [-624.410] * [-632.342] (-631.226) (-620.001) (-619.924) -- 0:06:14
37000 -- [-627.855] (-621.939) (-621.469) (-639.771) * (-632.854) (-621.327) (-633.796) [-620.160] -- 0:06:04
38000 -- (-623.840) (-624.909) [-633.823] (-638.305) * (-636.852) (-627.462) [-615.252] (-635.318) -- 0:05:54
39000 -- [-626.133] (-634.401) (-621.793) (-624.577) * (-634.842) (-623.521) [-619.073] (-631.605) -- 0:06:09
40000 -- (-634.139) (-629.003) [-619.084] (-629.629) * (-640.071) [-622.682] (-631.443) (-646.492) -- 0:06:00
Average standard deviation of split frequencies: 0.034776
41000 -- [-620.424] (-625.379) (-624.202) (-649.990) * (-624.588) (-628.309) (-622.663) [-618.631] -- 0:06:14
42000 -- (-622.982) [-625.705] (-626.847) (-631.912) * (-628.571) (-626.263) (-623.597) [-628.321] -- 0:06:04
43000 -- [-619.371] (-630.618) (-627.280) (-640.037) * (-628.107) [-624.061] (-619.105) (-622.958) -- 0:05:56
44000 -- (-621.870) [-619.231] (-630.235) (-637.633) * (-631.946) (-624.554) (-632.045) [-625.663] -- 0:06:09
45000 -- (-627.326) (-620.841) [-622.180] (-636.007) * (-624.360) [-623.008] (-635.350) (-636.658) -- 0:06:00
Average standard deviation of split frequencies: 0.029076
46000 -- (-621.968) [-631.946] (-631.178) (-629.428) * (-629.328) (-631.968) (-636.689) [-618.794] -- 0:06:13
47000 -- (-625.464) (-630.258) (-627.705) [-636.899] * (-633.866) (-624.376) (-626.422) [-627.551] -- 0:06:04
48000 -- [-616.808] (-630.817) (-626.069) (-627.038) * (-635.686) (-626.696) (-626.685) [-617.830] -- 0:05:57
49000 -- (-616.989) (-627.978) [-618.805] (-623.317) * (-632.030) (-628.640) (-633.399) [-630.220] -- 0:06:08
50000 -- (-627.740) (-629.996) [-626.765] (-631.836) * (-634.493) (-627.619) [-622.047] (-633.566) -- 0:06:01
Average standard deviation of split frequencies: 0.030006
51000 -- (-625.469) [-621.746] (-634.773) (-618.894) * (-640.546) (-632.669) [-615.688] (-625.904) -- 0:05:53
52000 -- (-623.648) (-634.986) (-627.613) [-627.186] * (-627.521) (-636.287) [-621.608] (-623.732) -- 0:06:04
53000 -- (-629.219) (-623.247) (-642.439) [-622.030] * (-630.219) (-627.061) [-630.676] (-648.535) -- 0:05:57
54000 -- (-637.391) [-625.923] (-621.431) (-620.433) * (-633.463) (-633.233) [-628.539] (-631.822) -- 0:06:07
55000 -- (-643.559) (-628.329) (-617.631) [-618.385] * (-636.603) [-619.056] (-622.515) (-621.447) -- 0:06:00
Average standard deviation of split frequencies: 0.028798
56000 -- (-637.302) (-632.756) [-622.118] (-624.976) * (-631.473) [-618.999] (-625.612) (-636.978) -- 0:05:54
57000 -- (-633.262) (-629.969) [-625.908] (-626.867) * [-616.361] (-633.416) (-624.851) (-626.784) -- 0:06:03
58000 -- (-624.506) (-620.285) (-621.413) [-620.372] * (-627.961) (-622.036) (-629.540) [-622.302] -- 0:05:57
59000 -- (-631.863) (-625.678) [-625.832] (-627.480) * (-633.053) (-632.941) (-624.599) [-623.567] -- 0:06:06
60000 -- [-620.746] (-628.168) (-630.016) (-631.301) * (-625.178) (-627.501) [-633.151] (-626.722) -- 0:06:00
Average standard deviation of split frequencies: 0.027196
61000 -- (-619.267) (-643.750) (-621.625) [-625.568] * (-628.871) [-627.106] (-627.343) (-637.740) -- 0:05:54
62000 -- (-621.530) (-638.018) (-623.937) [-635.416] * (-624.611) [-623.754] (-640.200) (-628.107) -- 0:06:03
63000 -- (-631.175) (-634.414) [-619.078] (-630.387) * (-643.266) [-615.545] (-622.833) (-631.089) -- 0:05:56
64000 -- (-624.134) (-634.080) (-624.455) [-613.935] * (-631.642) (-620.331) [-623.177] (-626.096) -- 0:06:05
65000 -- (-627.162) (-649.332) [-626.390] (-623.954) * (-619.548) (-628.436) [-626.748] (-633.027) -- 0:05:59
Average standard deviation of split frequencies: 0.026253
66000 -- [-628.534] (-645.109) (-634.405) (-626.212) * (-622.914) [-621.663] (-624.509) (-633.977) -- 0:05:53
67000 -- (-623.719) (-632.660) (-618.818) [-622.551] * (-620.631) (-620.793) [-627.676] (-627.117) -- 0:06:02
68000 -- [-622.729] (-627.142) (-624.598) (-633.375) * (-624.459) (-631.882) (-624.996) [-622.033] -- 0:05:56
69000 -- (-625.953) [-628.651] (-626.413) (-622.216) * (-623.771) (-625.169) (-622.385) [-627.273] -- 0:05:50
70000 -- [-618.291] (-623.943) (-618.600) (-629.560) * (-643.556) (-628.626) (-622.162) [-618.568] -- 0:05:58
Average standard deviation of split frequencies: 0.022300
71000 -- (-629.910) [-625.762] (-617.781) (-621.129) * (-631.941) [-618.896] (-618.578) (-631.304) -- 0:05:53
72000 -- [-624.654] (-628.752) (-621.992) (-627.481) * (-642.436) (-617.987) [-622.284] (-627.393) -- 0:06:00
73000 -- (-645.090) (-623.591) [-619.782] (-628.583) * [-621.300] (-621.138) (-621.165) (-628.411) -- 0:05:55
74000 -- [-630.653] (-626.423) (-632.035) (-627.870) * (-633.199) (-620.830) [-620.321] (-638.597) -- 0:06:02
75000 -- (-622.315) (-634.757) [-618.037] (-631.026) * (-626.033) (-627.863) (-624.333) [-630.029] -- 0:05:57
Average standard deviation of split frequencies: 0.020159
76000 -- [-636.769] (-621.460) (-630.227) (-623.845) * [-624.599] (-628.154) (-629.472) (-637.526) -- 0:05:52
77000 -- (-648.465) [-620.150] (-633.519) (-626.953) * (-628.950) (-623.172) [-624.764] (-631.129) -- 0:05:59
78000 -- (-628.406) [-616.361] (-632.610) (-626.531) * (-630.616) [-620.469] (-624.515) (-625.051) -- 0:05:54
79000 -- (-630.319) (-634.728) (-622.307) [-616.647] * [-631.504] (-631.052) (-622.490) (-617.963) -- 0:05:49
80000 -- (-643.146) (-618.282) [-620.550] (-621.692) * [-621.139] (-621.846) (-631.723) (-623.814) -- 0:05:56
Average standard deviation of split frequencies: 0.016984
81000 -- (-639.241) (-644.465) (-631.926) [-621.724] * (-629.384) (-624.955) (-633.936) [-628.591] -- 0:05:51
82000 -- (-624.724) [-619.460] (-627.814) (-635.903) * (-638.325) (-626.484) [-625.675] (-624.109) -- 0:05:58
83000 -- [-626.864] (-615.858) (-631.347) (-627.277) * (-634.125) (-622.823) (-625.512) [-622.751] -- 0:05:53
84000 -- [-614.530] (-630.561) (-632.189) (-626.000) * (-627.936) [-621.076] (-635.714) (-629.969) -- 0:05:48
85000 -- (-622.637) (-628.738) [-625.636] (-622.801) * [-618.849] (-621.000) (-632.913) (-636.581) -- 0:05:55
Average standard deviation of split frequencies: 0.015531
86000 -- (-628.461) (-622.704) [-627.605] (-630.038) * (-624.385) (-638.741) [-624.370] (-638.269) -- 0:05:50
87000 -- (-637.291) (-624.640) [-617.211] (-624.548) * (-623.360) [-629.005] (-636.159) (-627.804) -- 0:05:56
88000 -- (-631.241) (-628.959) [-621.490] (-623.642) * (-644.014) (-623.325) [-624.729] (-630.678) -- 0:05:52
89000 -- (-630.833) (-627.503) (-625.068) [-624.645] * (-635.711) (-626.265) (-616.983) [-625.723] -- 0:05:48
90000 -- [-622.004] (-641.257) (-626.889) (-627.769) * (-624.073) (-623.198) [-625.795] (-630.261) -- 0:05:53
Average standard deviation of split frequencies: 0.016609
91000 -- (-625.940) (-629.092) (-622.610) [-624.198] * (-617.927) (-627.044) [-622.927] (-626.092) -- 0:05:49
92000 -- (-627.603) (-627.872) [-620.628] (-634.420) * (-621.136) [-623.547] (-623.807) (-625.934) -- 0:05:55
93000 -- (-627.361) (-629.907) [-619.429] (-625.399) * (-635.081) (-627.038) [-631.629] (-626.072) -- 0:05:51
94000 -- (-629.110) (-641.520) [-622.979] (-633.175) * [-625.292] (-633.112) (-633.163) (-623.625) -- 0:05:46
95000 -- (-627.666) (-640.499) [-620.955] (-637.638) * [-617.835] (-625.085) (-634.325) (-622.845) -- 0:05:52
Average standard deviation of split frequencies: 0.015327
96000 -- [-623.628] (-624.954) (-621.125) (-628.233) * (-624.568) (-624.107) [-623.352] (-630.420) -- 0:05:48
97000 -- (-625.343) (-634.545) (-630.091) [-617.941] * (-635.084) [-619.045] (-632.656) (-627.310) -- 0:05:44
98000 -- (-625.888) (-622.694) (-635.251) [-620.998] * (-617.938) [-620.016] (-620.876) (-633.655) -- 0:05:49
99000 -- [-623.306] (-627.565) (-645.473) (-625.699) * (-622.219) [-613.963] (-628.188) (-633.604) -- 0:05:45
100000 -- (-628.617) (-630.708) [-631.157] (-625.424) * (-625.674) [-630.965] (-627.716) (-641.827) -- 0:05:51
Average standard deviation of split frequencies: 0.015219
101000 -- (-618.776) (-622.990) [-625.557] (-620.025) * [-619.303] (-621.370) (-630.868) (-629.558) -- 0:05:47
102000 -- (-619.368) (-631.383) [-620.266] (-622.488) * [-626.097] (-628.866) (-628.515) (-625.419) -- 0:05:43
103000 -- (-620.018) (-628.553) (-632.714) [-617.915] * (-640.749) (-630.898) (-627.032) [-621.698] -- 0:05:48
104000 -- (-615.796) [-629.488] (-637.677) (-617.901) * (-632.949) [-625.579] (-628.162) (-630.133) -- 0:05:44
105000 -- [-614.610] (-630.051) (-636.498) (-635.339) * (-618.945) (-629.083) [-626.973] (-623.291) -- 0:05:49
Average standard deviation of split frequencies: 0.016183
106000 -- (-625.571) (-633.482) (-622.935) [-623.082] * (-621.828) (-637.015) [-622.775] (-628.128) -- 0:05:45
107000 -- (-624.177) (-642.637) (-624.302) [-620.857] * (-623.090) [-621.968] (-627.495) (-623.501) -- 0:05:42
108000 -- (-623.511) (-631.271) [-620.004] (-621.525) * (-632.699) (-633.872) (-630.319) [-624.996] -- 0:05:46
109000 -- (-625.605) (-622.985) (-621.602) [-626.133] * (-634.703) (-627.180) [-622.305] (-619.777) -- 0:05:43
110000 -- [-621.533] (-620.432) (-619.435) (-635.121) * (-626.857) (-625.013) [-620.402] (-621.852) -- 0:05:47
Average standard deviation of split frequencies: 0.015737
111000 -- [-623.288] (-617.781) (-634.203) (-623.291) * [-619.463] (-631.871) (-629.744) (-630.514) -- 0:05:44
112000 -- [-629.938] (-628.963) (-622.773) (-632.169) * [-619.296] (-631.203) (-627.523) (-625.439) -- 0:05:40
113000 -- [-629.465] (-629.898) (-629.022) (-623.258) * (-624.821) [-623.753] (-632.882) (-625.158) -- 0:05:45
114000 -- (-625.500) [-632.004] (-630.140) (-640.402) * (-626.323) (-627.172) (-631.960) [-623.052] -- 0:05:41
115000 -- (-631.722) (-640.276) (-633.919) [-624.475] * (-623.079) [-619.938] (-633.510) (-640.347) -- 0:05:46
Average standard deviation of split frequencies: 0.013585
116000 -- (-624.938) (-629.324) (-633.556) [-631.679] * [-623.638] (-628.981) (-626.388) (-642.037) -- 0:05:42
117000 -- [-624.301] (-637.697) (-631.498) (-624.441) * (-621.332) (-633.982) (-628.099) [-617.520] -- 0:05:39
118000 -- (-623.802) [-617.656] (-634.453) (-621.095) * [-617.411] (-631.195) (-636.202) (-628.012) -- 0:05:43
119000 -- (-629.700) (-621.451) (-623.222) [-629.287] * (-619.742) [-625.144] (-625.444) (-631.202) -- 0:05:40
120000 -- [-622.133] (-633.202) (-619.726) (-633.778) * (-628.298) (-629.644) (-633.658) [-622.210] -- 0:05:44
Average standard deviation of split frequencies: 0.014622
121000 -- [-623.835] (-624.473) (-628.449) (-627.632) * (-626.162) [-635.490] (-621.935) (-634.371) -- 0:05:41
122000 -- (-631.882) (-636.955) [-627.209] (-638.857) * (-626.092) (-646.249) (-622.499) [-629.648] -- 0:05:38
123000 -- (-625.305) (-629.106) [-623.837] (-623.147) * (-627.009) (-629.420) (-628.681) [-621.027] -- 0:05:42
124000 -- (-637.057) (-623.947) [-623.198] (-624.535) * [-621.308] (-631.626) (-638.337) (-633.851) -- 0:05:39
125000 -- (-633.440) (-630.697) [-620.132] (-628.253) * (-621.242) [-625.511] (-633.822) (-629.132) -- 0:05:36
Average standard deviation of split frequencies: 0.015774
126000 -- (-631.347) (-625.294) [-622.927] (-622.120) * [-625.996] (-631.857) (-629.033) (-621.506) -- 0:05:39
127000 -- (-618.306) (-625.627) [-624.388] (-633.140) * (-625.400) [-620.134] (-633.778) (-642.458) -- 0:05:36
128000 -- (-630.494) [-618.660] (-628.262) (-628.918) * (-630.385) (-628.324) (-632.498) [-618.916] -- 0:05:40
129000 -- [-623.253] (-639.354) (-628.999) (-624.867) * (-624.127) (-631.096) (-633.427) [-623.995] -- 0:05:37
130000 -- [-624.103] (-628.960) (-624.883) (-627.592) * [-618.557] (-629.932) (-627.242) (-627.717) -- 0:05:41
Average standard deviation of split frequencies: 0.014130
131000 -- (-623.655) (-641.414) (-627.214) [-624.287] * (-619.739) (-639.737) [-625.426] (-619.297) -- 0:05:38
132000 -- (-618.994) (-634.969) (-629.984) [-626.140] * [-629.914] (-625.225) (-617.172) (-637.717) -- 0:05:35
133000 -- (-624.913) [-635.945] (-631.446) (-622.678) * (-628.690) [-617.002] (-627.693) (-639.128) -- 0:05:38
134000 -- (-618.802) (-617.910) (-622.383) [-626.408] * (-626.727) (-632.350) (-628.466) [-623.009] -- 0:05:36
135000 -- (-635.754) (-619.523) [-631.900] (-623.255) * (-628.476) (-620.893) (-635.792) [-615.148] -- 0:05:33
Average standard deviation of split frequencies: 0.013961
136000 -- (-645.312) (-622.307) (-629.779) [-626.387] * (-633.994) [-621.481] (-640.874) (-621.056) -- 0:05:36
137000 -- (-631.385) (-627.960) (-632.212) [-624.179] * [-623.049] (-621.041) (-632.009) (-621.635) -- 0:05:33
138000 -- (-636.466) [-616.795] (-626.290) (-625.049) * [-623.653] (-627.511) (-627.496) (-624.119) -- 0:05:37
139000 -- (-626.001) [-630.095] (-629.957) (-635.187) * (-620.223) [-625.079] (-630.294) (-631.202) -- 0:05:34
140000 -- (-626.805) [-617.467] (-627.284) (-637.636) * [-619.572] (-629.950) (-634.080) (-618.327) -- 0:05:31
Average standard deviation of split frequencies: 0.012912
141000 -- (-632.324) [-622.324] (-629.347) (-632.874) * [-630.043] (-626.387) (-628.868) (-617.668) -- 0:05:35
142000 -- (-636.767) (-632.756) [-621.953] (-628.008) * (-631.110) (-637.353) (-624.741) [-616.524] -- 0:05:32
143000 -- [-616.530] (-629.755) (-621.522) (-634.517) * (-620.371) [-618.894] (-633.895) (-627.870) -- 0:05:35
144000 -- [-628.062] (-618.490) (-622.014) (-631.387) * (-624.002) (-626.545) (-628.715) [-624.101] -- 0:05:32
145000 -- (-634.214) (-628.332) (-620.588) [-627.126] * (-620.406) [-623.419] (-621.254) (-620.056) -- 0:05:30
Average standard deviation of split frequencies: 0.011966
146000 -- (-631.564) (-635.140) [-627.862] (-630.565) * (-620.590) [-618.056] (-626.306) (-630.937) -- 0:05:33
147000 -- [-616.486] (-625.041) (-634.599) (-625.225) * (-634.475) (-628.633) [-619.646] (-624.997) -- 0:05:30
148000 -- (-624.404) (-622.691) [-628.931] (-628.790) * (-621.917) (-635.224) [-619.399] (-622.666) -- 0:05:28
149000 -- (-633.071) (-641.544) [-623.302] (-627.759) * (-630.411) (-616.144) [-624.685] (-625.215) -- 0:05:31
150000 -- (-629.918) (-635.684) [-615.308] (-634.731) * (-623.676) (-623.874) [-627.992] (-630.297) -- 0:05:28
Average standard deviation of split frequencies: 0.012791
151000 -- (-634.908) (-626.730) (-629.120) [-620.466] * (-627.537) (-635.331) [-625.807] (-637.578) -- 0:05:31
152000 -- (-633.906) (-628.491) (-619.895) [-625.622] * (-629.366) (-621.357) [-624.290] (-621.557) -- 0:05:29
153000 -- (-634.777) (-627.261) [-617.648] (-626.663) * (-633.821) (-620.929) [-625.529] (-634.220) -- 0:05:26
154000 -- (-630.207) (-620.532) (-617.022) [-623.312] * (-629.704) (-621.606) (-621.212) [-626.113] -- 0:05:29
155000 -- (-630.015) (-630.211) [-625.075] (-629.388) * (-617.249) [-621.109] (-623.799) (-629.756) -- 0:05:27
Average standard deviation of split frequencies: 0.011538
156000 -- (-625.580) (-648.517) [-624.147] (-626.340) * (-639.261) [-619.168] (-636.218) (-628.964) -- 0:05:30
157000 -- (-619.682) (-625.451) (-618.801) [-621.130] * (-634.656) (-628.026) (-638.010) [-620.387] -- 0:05:27
158000 -- (-630.563) (-628.098) [-629.690] (-624.187) * (-630.089) (-627.216) (-643.619) [-627.777] -- 0:05:25
159000 -- (-624.258) [-621.304] (-623.331) (-625.373) * (-629.974) (-621.694) (-624.586) [-628.630] -- 0:05:27
160000 -- [-626.623] (-623.050) (-624.404) (-630.972) * (-636.971) (-635.486) [-617.062] (-626.243) -- 0:05:25
Average standard deviation of split frequencies: 0.011828
161000 -- (-619.827) (-625.518) [-631.643] (-624.033) * [-635.197] (-631.780) (-624.263) (-617.831) -- 0:05:23
162000 -- (-629.510) [-624.966] (-632.186) (-623.831) * (-627.407) (-625.894) [-622.294] (-624.791) -- 0:05:25
163000 -- (-622.233) (-632.654) [-625.270] (-623.088) * (-627.091) [-630.410] (-627.748) (-630.680) -- 0:05:23
164000 -- (-626.505) [-621.558] (-622.585) (-629.333) * (-623.473) (-625.936) (-628.007) [-633.855] -- 0:05:26
165000 -- (-618.327) [-623.087] (-628.038) (-626.986) * (-624.584) (-629.986) (-620.809) [-626.948] -- 0:05:23
Average standard deviation of split frequencies: 0.013781
166000 -- (-623.332) (-634.695) (-631.101) [-617.983] * (-620.525) [-627.863] (-628.520) (-639.174) -- 0:05:21
167000 -- [-618.123] (-626.032) (-626.532) (-621.510) * [-625.986] (-626.440) (-626.549) (-626.671) -- 0:05:24
168000 -- (-649.083) (-629.115) (-637.899) [-621.261] * (-625.727) (-623.616) (-622.906) [-613.356] -- 0:05:21
169000 -- (-626.767) [-620.536] (-633.535) (-622.525) * [-623.420] (-631.602) (-640.836) (-623.196) -- 0:05:24
170000 -- (-627.028) [-617.170] (-629.640) (-616.828) * (-620.255) [-619.029] (-626.768) (-620.278) -- 0:05:22
Average standard deviation of split frequencies: 0.013643
171000 -- (-640.613) (-623.919) (-627.436) [-614.837] * (-623.166) (-625.642) (-637.294) [-620.322] -- 0:05:19
172000 -- (-629.333) (-625.538) [-621.983] (-634.266) * [-626.932] (-630.456) (-643.838) (-636.051) -- 0:05:22
173000 -- (-629.392) [-624.757] (-624.147) (-625.054) * (-631.498) [-620.556] (-634.532) (-616.766) -- 0:05:20
174000 -- (-633.023) (-635.879) [-617.521] (-633.372) * (-622.361) (-622.782) (-630.617) [-628.784] -- 0:05:18
175000 -- [-623.289] (-634.860) (-634.501) (-626.405) * (-628.881) (-631.875) [-617.549] (-635.515) -- 0:05:20
Average standard deviation of split frequencies: 0.011738
176000 -- (-625.037) [-628.434] (-632.689) (-619.779) * (-624.292) [-630.415] (-628.081) (-625.144) -- 0:05:18
177000 -- [-617.712] (-620.417) (-635.170) (-619.896) * (-622.951) (-638.702) [-623.050] (-625.565) -- 0:05:20
178000 -- (-623.391) (-627.488) (-622.232) [-620.709] * [-623.667] (-632.659) (-630.732) (-620.090) -- 0:05:18
179000 -- (-627.844) (-638.086) (-631.516) [-622.584] * [-617.389] (-628.687) (-630.935) (-624.161) -- 0:05:16
180000 -- [-619.764] (-638.571) (-627.491) (-621.161) * (-622.298) [-620.419] (-627.712) (-625.226) -- 0:05:18
Average standard deviation of split frequencies: 0.012205
181000 -- [-623.658] (-623.897) (-618.346) (-640.545) * (-626.167) [-623.561] (-625.577) (-636.304) -- 0:05:16
182000 -- (-626.301) (-627.880) [-624.075] (-619.219) * (-626.858) (-625.773) [-621.932] (-615.094) -- 0:05:19
183000 -- [-635.647] (-636.180) (-644.954) (-633.031) * (-634.131) [-617.921] (-633.117) (-622.311) -- 0:05:16
184000 -- (-625.202) (-626.512) [-630.945] (-638.880) * (-629.875) [-624.543] (-626.049) (-621.414) -- 0:05:14
185000 -- (-623.347) [-618.490] (-627.651) (-614.794) * (-630.194) [-626.605] (-635.431) (-614.336) -- 0:05:17
Average standard deviation of split frequencies: 0.012449
186000 -- (-619.226) (-635.601) (-622.606) [-628.776] * (-622.992) [-615.902] (-632.905) (-627.174) -- 0:05:15
187000 -- (-633.138) [-617.876] (-627.216) (-642.737) * [-628.971] (-633.992) (-628.470) (-628.413) -- 0:05:13
188000 -- (-617.806) [-616.869] (-621.167) (-629.788) * (-626.554) [-623.415] (-634.124) (-629.364) -- 0:05:15
189000 -- (-630.682) (-621.955) (-634.637) [-625.725] * (-637.858) [-620.260] (-633.654) (-626.644) -- 0:05:13
190000 -- (-624.887) [-620.261] (-629.765) (-639.428) * (-629.599) (-631.758) [-622.603] (-621.450) -- 0:05:15
Average standard deviation of split frequencies: 0.013036
191000 -- [-622.726] (-632.006) (-625.002) (-623.955) * (-623.041) (-619.377) [-619.369] (-624.856) -- 0:05:13
192000 -- (-626.893) [-624.765] (-629.858) (-621.593) * (-634.036) (-619.297) [-622.801] (-625.720) -- 0:05:11
193000 -- (-626.714) (-628.939) (-632.853) [-623.300] * (-624.135) (-627.496) [-627.541] (-630.398) -- 0:05:13
194000 -- [-622.930] (-640.816) (-624.711) (-625.385) * (-624.459) (-622.749) [-616.485] (-632.477) -- 0:05:11
195000 -- (-624.572) [-627.560] (-629.654) (-626.708) * (-626.021) [-624.691] (-634.763) (-619.499) -- 0:05:13
Average standard deviation of split frequencies: 0.013469
196000 -- [-630.839] (-621.135) (-625.289) (-631.901) * [-623.496] (-633.777) (-629.132) (-633.222) -- 0:05:11
197000 -- [-620.330] (-637.859) (-638.652) (-634.317) * (-626.809) (-638.008) [-621.233] (-628.302) -- 0:05:09
198000 -- (-628.896) (-631.015) [-628.096] (-624.736) * (-623.374) (-624.900) (-621.920) [-621.080] -- 0:05:11
199000 -- [-630.136] (-624.663) (-627.627) (-636.299) * [-620.332] (-620.450) (-624.669) (-621.176) -- 0:05:09
200000 -- [-621.958] (-626.232) (-632.550) (-628.647) * (-627.058) (-626.463) [-621.060] (-626.835) -- 0:05:12
Average standard deviation of split frequencies: 0.012956
201000 -- [-619.108] (-623.618) (-628.234) (-629.512) * (-626.073) (-626.439) (-631.839) [-624.133] -- 0:05:10
202000 -- (-625.151) [-620.544] (-627.773) (-633.607) * (-622.607) (-634.296) [-626.920] (-629.118) -- 0:05:08
203000 -- (-627.967) (-624.741) [-626.761] (-625.156) * (-625.306) (-629.902) (-625.034) [-626.561] -- 0:05:10
204000 -- (-622.482) [-620.466] (-635.936) (-625.463) * [-626.275] (-619.840) (-626.054) (-625.493) -- 0:05:08
205000 -- (-624.949) (-626.635) [-620.915] (-635.539) * (-627.481) [-619.512] (-627.544) (-631.706) -- 0:05:10
Average standard deviation of split frequencies: 0.013476
206000 -- (-636.023) [-627.477] (-627.522) (-635.601) * (-617.718) (-633.021) [-625.634] (-625.206) -- 0:05:08
207000 -- (-621.547) (-626.598) [-624.906] (-634.195) * (-630.077) (-629.309) (-626.704) [-620.747] -- 0:05:06
208000 -- (-625.131) (-634.323) [-633.148] (-637.107) * [-618.735] (-629.580) (-620.390) (-626.413) -- 0:05:08
209000 -- (-629.399) (-629.327) [-625.785] (-626.499) * (-637.977) (-635.643) (-620.263) [-622.743] -- 0:05:06
210000 -- (-634.216) [-614.591] (-629.038) (-623.341) * (-633.057) (-627.482) (-625.965) [-617.707] -- 0:05:08
Average standard deviation of split frequencies: 0.013426
211000 -- (-629.221) (-630.243) (-627.602) [-617.625] * [-623.488] (-637.279) (-619.970) (-624.306) -- 0:05:06
212000 -- (-627.920) (-627.439) (-631.547) [-628.320] * [-626.119] (-619.574) (-624.833) (-628.857) -- 0:05:04
213000 -- (-627.241) (-631.853) [-624.626] (-632.472) * (-625.416) (-618.134) [-619.461] (-629.294) -- 0:05:06
214000 -- (-628.781) [-623.703] (-627.504) (-630.971) * [-630.382] (-634.352) (-622.786) (-624.040) -- 0:05:04
215000 -- [-618.225] (-637.181) (-627.180) (-637.051) * (-624.580) [-621.482] (-622.937) (-622.155) -- 0:05:06
Average standard deviation of split frequencies: 0.013640
216000 -- (-630.348) (-642.418) [-615.515] (-626.451) * (-629.551) (-629.285) (-618.992) [-619.915] -- 0:05:04
217000 -- (-626.696) [-622.175] (-624.786) (-640.250) * (-625.931) (-625.109) [-623.100] (-623.347) -- 0:05:03
218000 -- [-618.339] (-627.386) (-624.651) (-634.895) * (-628.305) [-618.936] (-623.914) (-623.917) -- 0:05:04
219000 -- (-639.117) (-628.969) (-631.588) [-626.660] * (-632.281) (-618.094) (-628.885) [-622.338] -- 0:05:03
220000 -- [-629.718] (-623.515) (-635.371) (-635.128) * (-641.884) (-622.319) (-620.940) [-622.851] -- 0:05:04
Average standard deviation of split frequencies: 0.013489
221000 -- (-631.650) [-619.300] (-629.977) (-646.205) * (-637.167) (-624.375) [-622.093] (-625.433) -- 0:05:03
222000 -- (-638.919) (-637.956) [-629.161] (-634.273) * (-637.400) [-626.051] (-626.859) (-632.191) -- 0:05:01
223000 -- (-620.884) (-625.906) (-628.411) [-635.539] * (-635.937) (-621.513) [-619.406] (-624.289) -- 0:05:03
224000 -- (-631.763) [-623.625] (-628.114) (-630.252) * (-640.535) [-622.420] (-623.742) (-624.929) -- 0:05:01
225000 -- [-623.314] (-626.669) (-633.033) (-639.046) * [-629.053] (-625.555) (-628.224) (-631.500) -- 0:05:03
Average standard deviation of split frequencies: 0.012863
226000 -- [-615.629] (-631.479) (-631.310) (-631.752) * [-633.957] (-634.280) (-620.056) (-628.500) -- 0:05:01
227000 -- [-616.656] (-629.189) (-626.893) (-628.105) * (-630.960) (-632.046) (-621.965) [-619.582] -- 0:04:59
228000 -- (-640.764) (-636.673) (-618.788) [-632.467] * (-630.647) (-625.561) (-625.055) [-624.588] -- 0:05:01
229000 -- (-633.626) (-644.590) [-614.713] (-625.936) * (-635.699) (-626.138) [-626.090] (-624.525) -- 0:04:59
230000 -- (-637.422) (-627.961) (-622.778) [-628.477] * (-627.873) (-615.849) (-637.326) [-622.707] -- 0:04:57
Average standard deviation of split frequencies: 0.013000
231000 -- (-618.645) (-624.144) [-630.275] (-626.531) * (-626.806) (-622.559) [-622.547] (-621.909) -- 0:04:59
232000 -- [-623.547] (-634.106) (-628.767) (-629.719) * (-632.243) (-619.671) (-646.214) [-620.643] -- 0:04:57
233000 -- (-624.120) (-619.537) [-616.823] (-622.090) * (-641.072) (-619.802) [-633.037] (-626.229) -- 0:04:59
234000 -- [-621.608] (-628.150) (-619.270) (-617.878) * (-622.184) [-621.063] (-634.353) (-631.990) -- 0:04:57
235000 -- [-622.143] (-623.462) (-625.579) (-628.805) * (-626.922) (-622.647) (-636.808) [-622.534] -- 0:04:56
Average standard deviation of split frequencies: 0.014553
236000 -- (-619.816) (-633.637) [-618.407] (-626.822) * (-627.168) [-620.089] (-621.192) (-625.221) -- 0:04:57
237000 -- (-626.887) [-620.763] (-632.296) (-635.728) * (-624.846) (-625.373) [-623.696] (-632.717) -- 0:04:56
238000 -- (-626.585) [-624.439] (-626.104) (-627.890) * (-629.730) (-625.812) (-627.907) [-618.329] -- 0:04:57
239000 -- [-629.479] (-641.937) (-624.074) (-624.929) * (-636.352) [-626.069] (-619.012) (-615.259) -- 0:04:56
240000 -- (-632.188) (-632.601) [-618.773] (-627.414) * (-633.571) (-623.416) (-627.115) [-617.687] -- 0:04:54
Average standard deviation of split frequencies: 0.014691
241000 -- (-639.323) [-625.027] (-625.739) (-630.829) * [-623.383] (-626.731) (-630.596) (-627.167) -- 0:04:56
242000 -- (-629.503) [-625.845] (-622.382) (-622.299) * (-620.885) [-627.117] (-637.852) (-620.895) -- 0:04:54
243000 -- (-623.003) [-624.139] (-624.502) (-630.049) * (-625.175) (-632.622) [-625.676] (-628.436) -- 0:04:52
244000 -- [-618.235] (-629.809) (-625.015) (-624.216) * (-646.893) [-636.936] (-628.628) (-628.281) -- 0:04:54
245000 -- (-625.506) (-621.037) (-622.920) [-618.968] * [-624.077] (-633.561) (-618.237) (-634.533) -- 0:04:52
Average standard deviation of split frequencies: 0.014798
246000 -- (-635.620) (-624.368) [-622.163] (-623.146) * (-621.826) (-641.657) (-627.836) [-624.520] -- 0:04:54
247000 -- (-621.416) (-628.121) [-621.523] (-635.171) * [-622.603] (-639.910) (-630.270) (-622.392) -- 0:04:52
248000 -- [-617.156] (-627.689) (-619.952) (-630.015) * [-616.725] (-628.652) (-614.045) (-638.349) -- 0:04:51
249000 -- [-623.005] (-629.395) (-624.274) (-633.809) * (-631.340) (-636.800) [-627.459] (-627.189) -- 0:04:52
250000 -- (-622.900) [-617.685] (-633.435) (-626.733) * (-628.707) [-628.011] (-629.094) (-626.864) -- 0:04:51
Average standard deviation of split frequencies: 0.014784
251000 -- (-620.730) [-622.857] (-630.714) (-633.975) * (-622.982) [-625.401] (-633.453) (-628.910) -- 0:04:52
252000 -- [-618.756] (-633.360) (-626.845) (-616.500) * (-636.647) (-627.303) [-634.365] (-622.297) -- 0:04:50
253000 -- (-623.801) (-630.113) [-620.701] (-628.532) * (-640.223) (-634.604) (-623.364) [-624.531] -- 0:04:49
254000 -- (-623.824) (-623.966) (-626.060) [-625.739] * (-630.753) [-623.016] (-634.001) (-632.392) -- 0:04:50
255000 -- [-623.699] (-625.032) (-628.210) (-627.125) * (-625.828) [-633.335] (-621.306) (-640.248) -- 0:04:49
Average standard deviation of split frequencies: 0.014169
256000 -- (-625.723) (-624.622) (-630.069) [-614.472] * (-639.197) (-635.186) [-628.724] (-623.621) -- 0:04:50
257000 -- (-623.619) (-638.398) [-623.414] (-623.026) * (-633.378) (-620.335) (-614.874) [-619.184] -- 0:04:49
258000 -- (-619.803) [-626.540] (-625.376) (-624.279) * (-621.143) [-625.094] (-626.602) (-625.126) -- 0:04:47
259000 -- [-623.436] (-634.315) (-623.233) (-615.882) * [-612.533] (-631.418) (-624.157) (-622.448) -- 0:04:48
260000 -- (-628.638) (-618.582) [-624.705] (-622.254) * (-623.819) (-620.666) (-630.565) [-628.753] -- 0:04:47
Average standard deviation of split frequencies: 0.013614
261000 -- (-623.222) (-630.162) [-624.807] (-630.242) * (-618.917) (-624.384) (-626.609) [-626.282] -- 0:04:48
262000 -- (-624.150) [-621.921] (-622.880) (-631.033) * (-636.531) [-624.864] (-633.556) (-618.607) -- 0:04:47
263000 -- (-625.673) (-621.638) [-632.023] (-633.712) * [-623.814] (-620.396) (-630.292) (-622.174) -- 0:04:45
264000 -- (-640.307) [-627.879] (-633.381) (-636.316) * [-626.604] (-640.641) (-633.478) (-636.516) -- 0:04:47
265000 -- (-618.704) (-620.066) (-626.794) [-624.584] * (-622.217) (-621.177) [-629.925] (-631.943) -- 0:04:45
Average standard deviation of split frequencies: 0.013685
266000 -- (-619.364) (-618.130) [-625.616] (-626.836) * [-617.839] (-636.696) (-637.575) (-626.433) -- 0:04:46
267000 -- (-622.530) (-633.671) (-624.787) [-623.435] * (-625.556) (-635.588) (-632.088) [-622.010] -- 0:04:45
268000 -- [-624.761] (-620.176) (-628.814) (-619.121) * (-622.594) [-624.562] (-629.588) (-629.505) -- 0:04:44
269000 -- (-627.849) (-623.076) (-632.056) [-626.749] * (-627.577) (-620.394) [-630.546] (-634.426) -- 0:04:45
270000 -- (-624.318) (-646.163) (-618.344) [-622.475] * (-621.144) (-627.204) (-626.985) [-627.983] -- 0:04:43
Average standard deviation of split frequencies: 0.013207
271000 -- [-622.597] (-625.427) (-615.961) (-632.966) * (-630.653) (-631.014) (-628.009) [-623.186] -- 0:04:45
272000 -- (-626.611) (-631.362) (-634.369) [-625.296] * (-637.766) (-627.092) (-625.541) [-623.262] -- 0:04:43
273000 -- (-617.787) [-618.507] (-622.402) (-635.107) * (-638.016) (-627.089) (-632.379) [-619.634] -- 0:04:42
274000 -- [-629.808] (-633.978) (-627.497) (-621.456) * (-638.011) (-644.260) [-619.162] (-620.147) -- 0:04:43
275000 -- (-633.410) (-627.717) [-627.602] (-629.950) * [-625.274] (-629.061) (-631.360) (-620.702) -- 0:04:42
Average standard deviation of split frequencies: 0.013759
276000 -- (-636.714) (-634.817) (-631.034) [-620.151] * (-629.807) (-623.020) (-637.986) [-619.850] -- 0:04:40
277000 -- (-625.905) [-622.658] (-621.543) (-620.545) * (-633.112) (-630.894) (-627.265) [-625.007] -- 0:04:41
278000 -- (-632.844) (-619.312) (-636.573) [-626.060] * (-623.855) [-630.493] (-627.340) (-631.496) -- 0:04:40
279000 -- (-627.572) [-623.014] (-626.897) (-637.791) * [-618.974] (-630.214) (-640.885) (-622.205) -- 0:04:41
280000 -- (-628.466) [-622.797] (-620.482) (-623.095) * [-622.177] (-622.724) (-628.133) (-627.672) -- 0:04:40
Average standard deviation of split frequencies: 0.013343
281000 -- (-627.157) (-620.755) (-632.209) [-618.300] * [-620.575] (-625.851) (-637.676) (-621.191) -- 0:04:41
282000 -- (-633.256) (-622.606) (-625.667) [-616.592] * (-627.749) (-626.303) (-628.268) [-622.025] -- 0:04:40
283000 -- (-628.690) (-632.193) (-621.797) [-628.367] * (-621.949) (-623.422) (-635.976) [-618.680] -- 0:04:41
284000 -- [-629.576] (-619.441) (-621.571) (-622.661) * (-643.514) (-626.812) (-636.610) [-617.630] -- 0:04:39
285000 -- [-619.480] (-626.490) (-628.099) (-627.443) * (-626.861) (-632.880) (-630.590) [-618.974] -- 0:04:38
Average standard deviation of split frequencies: 0.014056
286000 -- [-621.955] (-638.405) (-629.074) (-635.813) * [-624.105] (-633.084) (-622.654) (-625.386) -- 0:04:39
287000 -- (-624.963) (-632.989) (-622.545) [-619.145] * [-625.025] (-632.132) (-623.440) (-642.430) -- 0:04:38
288000 -- (-620.380) (-629.060) (-625.803) [-628.566] * [-620.215] (-626.068) (-626.177) (-629.045) -- 0:04:39
289000 -- [-621.848] (-626.606) (-632.101) (-627.538) * (-629.871) [-623.467] (-635.709) (-623.385) -- 0:04:38
290000 -- (-624.437) (-624.090) [-624.097] (-615.402) * (-628.623) (-635.667) [-621.197] (-629.673) -- 0:04:36
Average standard deviation of split frequencies: 0.014411
291000 -- (-629.819) (-622.073) (-628.420) [-624.859] * (-614.485) (-630.849) [-621.148] (-633.137) -- 0:04:37
292000 -- (-632.784) [-622.422] (-623.950) (-621.006) * (-626.341) (-622.926) (-625.561) [-628.554] -- 0:04:36
293000 -- [-625.491] (-625.531) (-627.519) (-625.753) * [-614.524] (-625.059) (-630.078) (-627.742) -- 0:04:35
294000 -- [-624.115] (-630.183) (-637.015) (-632.801) * [-621.532] (-625.038) (-619.436) (-624.637) -- 0:04:36
295000 -- [-624.984] (-633.407) (-638.326) (-643.315) * [-620.583] (-623.243) (-631.833) (-622.100) -- 0:04:34
Average standard deviation of split frequencies: 0.013316
296000 -- [-614.971] (-634.050) (-623.294) (-627.387) * (-619.792) (-631.082) (-633.316) [-619.809] -- 0:04:35
297000 -- [-625.490] (-626.047) (-624.982) (-624.517) * [-618.920] (-637.945) (-623.429) (-631.030) -- 0:04:34
298000 -- (-625.415) (-630.828) (-626.409) [-626.386] * [-621.226] (-633.406) (-624.687) (-622.982) -- 0:04:33
299000 -- (-628.438) (-631.087) (-628.330) [-619.343] * (-626.674) (-618.826) [-623.784] (-629.186) -- 0:04:34
300000 -- (-632.654) (-621.966) [-624.972] (-625.792) * [-619.604] (-622.787) (-630.450) (-629.458) -- 0:04:33
Average standard deviation of split frequencies: 0.013327
301000 -- [-630.625] (-635.307) (-623.595) (-634.527) * (-626.715) (-626.251) [-627.000] (-622.796) -- 0:04:34
302000 -- [-628.954] (-627.692) (-630.148) (-637.664) * [-623.851] (-635.260) (-621.950) (-631.997) -- 0:04:32
303000 -- [-624.893] (-631.857) (-637.685) (-644.634) * (-629.599) (-635.716) [-627.231] (-619.489) -- 0:04:31
304000 -- (-622.414) [-626.624] (-625.402) (-646.067) * (-623.909) (-627.509) [-615.971] (-639.767) -- 0:04:32
305000 -- (-624.366) (-639.243) (-627.915) [-619.042] * (-632.708) [-622.965] (-626.843) (-635.486) -- 0:04:31
Average standard deviation of split frequencies: 0.013779
306000 -- (-624.691) [-622.574] (-631.548) (-624.060) * (-630.620) (-629.700) (-636.158) [-626.862] -- 0:04:32
307000 -- [-621.921] (-630.878) (-637.835) (-630.077) * (-637.366) (-627.608) (-636.995) [-625.646] -- 0:04:30
308000 -- (-620.224) [-614.669] (-625.243) (-620.739) * (-632.852) (-628.903) (-630.367) [-620.419] -- 0:04:29
309000 -- (-627.741) [-626.828] (-633.078) (-623.923) * (-627.812) [-624.842] (-637.126) (-632.299) -- 0:04:30
310000 -- (-628.683) [-626.159] (-625.973) (-632.831) * [-626.753] (-637.619) (-633.215) (-619.180) -- 0:04:29
Average standard deviation of split frequencies: 0.013614
311000 -- (-632.105) (-627.647) [-630.722] (-628.664) * (-619.015) (-634.158) [-617.341] (-621.001) -- 0:04:30
312000 -- (-634.543) [-624.351] (-630.938) (-636.096) * [-626.282] (-633.751) (-621.515) (-623.534) -- 0:04:29
313000 -- [-621.381] (-625.914) (-643.310) (-625.594) * (-632.038) (-644.513) (-630.622) [-623.116] -- 0:04:27
314000 -- (-618.373) (-625.682) [-617.178] (-631.011) * (-629.476) [-627.687] (-627.035) (-620.932) -- 0:04:28
315000 -- [-616.326] (-622.590) (-630.879) (-640.476) * (-621.831) (-628.727) [-625.775] (-626.276) -- 0:04:27
Average standard deviation of split frequencies: 0.013053
316000 -- [-618.240] (-621.279) (-621.593) (-638.987) * (-631.788) (-651.784) [-622.534] (-620.092) -- 0:04:26
317000 -- [-620.369] (-628.837) (-626.163) (-640.440) * (-623.295) (-623.727) (-641.747) [-618.234] -- 0:04:27
318000 -- (-621.565) [-623.195] (-631.431) (-628.392) * (-629.642) (-632.366) [-627.271] (-626.547) -- 0:04:25
319000 -- [-620.697] (-633.900) (-624.217) (-630.606) * (-620.982) (-629.992) [-615.835] (-640.226) -- 0:04:26
320000 -- (-622.918) (-624.970) [-625.752] (-632.500) * [-618.256] (-628.507) (-627.732) (-635.761) -- 0:04:25
Average standard deviation of split frequencies: 0.013231
321000 -- (-628.955) (-628.119) (-625.068) [-635.717] * (-631.801) (-627.764) (-631.527) [-620.475] -- 0:04:24
322000 -- [-622.220] (-632.476) (-623.138) (-630.188) * (-622.014) (-632.333) (-632.742) [-622.066] -- 0:04:25
323000 -- [-622.436] (-625.113) (-627.947) (-637.066) * (-621.045) [-626.405] (-619.196) (-622.789) -- 0:04:24
324000 -- [-621.316] (-636.880) (-624.782) (-632.644) * (-635.618) (-623.691) (-629.088) [-618.646] -- 0:04:24
325000 -- (-631.825) [-623.801] (-628.588) (-622.161) * (-636.541) [-625.631] (-624.601) (-619.047) -- 0:04:23
Average standard deviation of split frequencies: 0.013336
326000 -- (-630.819) (-634.198) [-626.133] (-628.265) * (-626.947) [-627.121] (-620.967) (-631.804) -- 0:04:22
327000 -- (-620.268) (-637.310) (-626.593) [-629.953] * [-621.375] (-623.834) (-618.452) (-628.780) -- 0:04:23
328000 -- (-619.279) [-623.752] (-632.959) (-633.938) * (-621.727) (-618.608) (-618.426) [-623.804] -- 0:04:22
329000 -- (-621.056) (-633.121) [-621.662] (-642.258) * (-620.404) (-625.461) (-635.793) [-621.277] -- 0:04:23
330000 -- (-635.733) (-639.128) [-619.040] (-619.285) * [-612.105] (-619.402) (-623.872) (-614.540) -- 0:04:21
Average standard deviation of split frequencies: 0.013425
331000 -- (-616.924) (-628.950) (-631.356) [-622.903] * (-623.299) (-644.820) (-628.203) [-623.338] -- 0:04:20
332000 -- (-620.691) (-625.739) (-624.847) [-618.693] * (-630.383) [-619.954] (-629.305) (-623.157) -- 0:04:21
333000 -- (-629.241) (-628.996) [-626.906] (-628.330) * (-623.533) (-623.958) (-618.036) [-624.729] -- 0:04:20
334000 -- (-626.182) [-614.064] (-620.162) (-637.581) * [-628.836] (-623.590) (-625.871) (-629.393) -- 0:04:21
335000 -- [-618.139] (-621.082) (-629.068) (-629.372) * (-614.843) (-631.784) (-626.057) [-615.858] -- 0:04:20
Average standard deviation of split frequencies: 0.013173
336000 -- (-642.401) (-631.631) [-621.567] (-632.367) * (-631.713) (-631.089) [-625.114] (-627.463) -- 0:04:18
337000 -- [-628.247] (-618.832) (-622.140) (-632.137) * [-626.273] (-627.404) (-628.964) (-629.564) -- 0:04:19
338000 -- (-616.795) [-631.604] (-627.238) (-624.917) * [-613.631] (-628.413) (-629.667) (-628.935) -- 0:04:18
339000 -- (-630.238) (-622.077) [-627.458] (-635.853) * (-626.929) (-632.456) [-625.173] (-631.769) -- 0:04:19
340000 -- (-619.037) [-625.025] (-630.508) (-620.133) * (-619.751) (-624.500) (-635.463) [-620.991] -- 0:04:18
Average standard deviation of split frequencies: 0.013300
341000 -- (-618.001) (-629.528) [-629.367] (-625.456) * (-628.348) [-623.088] (-632.164) (-625.607) -- 0:04:17
342000 -- (-633.524) (-627.819) (-620.871) [-622.811] * (-623.373) (-623.550) [-621.231] (-626.614) -- 0:04:17
343000 -- (-639.688) [-639.486] (-630.895) (-624.532) * (-626.854) [-625.197] (-627.798) (-629.396) -- 0:04:16
344000 -- [-622.756] (-626.835) (-629.794) (-629.510) * [-628.122] (-626.193) (-639.581) (-635.155) -- 0:04:17
345000 -- (-626.479) [-616.563] (-620.873) (-628.288) * [-628.560] (-623.416) (-633.071) (-635.869) -- 0:04:16
Average standard deviation of split frequencies: 0.013473
346000 -- (-628.162) [-619.249] (-627.596) (-620.942) * (-625.607) [-619.514] (-628.270) (-630.601) -- 0:04:15
347000 -- [-619.857] (-624.496) (-628.386) (-627.219) * (-625.790) [-632.966] (-629.422) (-631.852) -- 0:04:15
348000 -- (-625.665) (-627.001) [-626.234] (-621.207) * (-639.263) (-629.898) [-618.978] (-630.684) -- 0:04:14
349000 -- (-635.816) (-628.389) (-622.997) [-618.991] * (-634.913) (-631.145) [-616.676] (-623.417) -- 0:04:15
350000 -- [-622.304] (-623.188) (-627.638) (-623.821) * (-624.383) (-627.127) (-622.825) [-625.361] -- 0:04:14
Average standard deviation of split frequencies: 0.013256
351000 -- (-630.207) (-635.306) (-616.489) [-619.976] * (-630.299) [-626.654] (-644.405) (-628.190) -- 0:04:13
352000 -- (-621.425) [-628.513] (-625.610) (-629.528) * (-629.574) [-617.463] (-635.348) (-629.067) -- 0:04:14
353000 -- (-629.969) [-629.509] (-630.689) (-632.379) * (-642.338) (-624.869) [-633.114] (-635.503) -- 0:04:12
354000 -- (-621.612) (-626.020) (-630.022) [-619.967] * (-626.541) [-621.473] (-619.427) (-636.230) -- 0:04:13
355000 -- (-630.541) [-619.674] (-622.630) (-626.585) * (-620.144) [-621.063] (-628.153) (-626.746) -- 0:04:12
Average standard deviation of split frequencies: 0.013278
356000 -- [-628.146] (-623.497) (-622.959) (-635.036) * (-624.517) [-620.104] (-625.821) (-624.954) -- 0:04:11
357000 -- (-631.167) [-629.203] (-628.269) (-617.522) * (-637.328) (-649.982) [-629.554] (-628.906) -- 0:04:12
358000 -- (-617.132) (-625.563) [-618.693] (-622.288) * (-620.525) [-621.365] (-632.031) (-628.783) -- 0:04:11
359000 -- (-623.971) [-626.157] (-634.596) (-629.988) * [-620.445] (-625.188) (-628.657) (-636.653) -- 0:04:09
360000 -- (-633.212) (-627.913) (-630.139) [-623.223] * (-627.626) (-633.174) [-622.115] (-633.131) -- 0:04:10
Average standard deviation of split frequencies: 0.012780
361000 -- [-625.594] (-619.569) (-629.937) (-630.371) * [-617.659] (-636.220) (-633.595) (-623.420) -- 0:04:09
362000 -- (-626.666) [-619.535] (-621.415) (-634.484) * (-637.091) (-625.996) [-624.502] (-631.903) -- 0:04:10
363000 -- (-627.394) (-632.515) [-630.058] (-619.310) * [-624.891] (-637.696) (-627.193) (-610.740) -- 0:04:09
364000 -- (-626.128) (-643.008) (-619.145) [-624.175] * (-635.960) (-623.738) (-623.519) [-621.582] -- 0:04:08
365000 -- [-621.338] (-627.859) (-622.016) (-624.082) * [-617.009] (-637.124) (-627.590) (-629.541) -- 0:04:08
Average standard deviation of split frequencies: 0.012451
366000 -- (-628.162) (-629.589) [-626.619] (-635.120) * (-636.941) (-626.748) (-619.356) [-616.592] -- 0:04:07
367000 -- (-623.045) (-624.829) (-629.017) [-624.645] * (-621.920) (-623.567) [-614.372] (-622.715) -- 0:04:08
368000 -- (-626.308) (-636.089) (-627.260) [-625.310] * (-618.884) [-624.028] (-631.548) (-621.526) -- 0:04:07
369000 -- (-622.635) [-622.376] (-620.821) (-633.898) * [-621.839] (-636.916) (-624.470) (-620.912) -- 0:04:06
370000 -- (-626.023) (-619.055) (-623.526) [-627.763] * (-623.497) [-616.980] (-632.444) (-620.982) -- 0:04:06
Average standard deviation of split frequencies: 0.013354
371000 -- (-625.029) (-630.366) (-628.968) [-619.023] * (-628.976) [-623.355] (-623.514) (-631.461) -- 0:04:05
372000 -- (-626.549) [-629.742] (-631.003) (-628.206) * (-623.934) (-621.511) (-618.365) [-619.457] -- 0:04:04
373000 -- (-627.770) (-628.413) [-618.927] (-622.542) * (-625.536) [-624.447] (-641.038) (-624.901) -- 0:04:05
374000 -- (-623.628) (-633.623) [-619.985] (-626.888) * (-628.349) (-621.536) (-631.195) [-628.103] -- 0:04:04
375000 -- [-618.395] (-630.243) (-632.782) (-626.946) * [-622.015] (-620.675) (-625.796) (-618.967) -- 0:04:05
Average standard deviation of split frequencies: 0.012955
376000 -- (-624.045) [-624.465] (-630.164) (-626.299) * (-617.949) (-632.397) (-626.653) [-623.546] -- 0:04:03
377000 -- (-627.302) (-636.910) (-637.887) [-629.112] * (-630.773) [-623.716] (-625.302) (-624.660) -- 0:04:02
378000 -- (-623.092) (-625.552) (-622.270) [-621.514] * [-626.133] (-615.682) (-626.620) (-623.902) -- 0:04:03
379000 -- [-630.850] (-636.287) (-631.130) (-632.666) * [-623.022] (-643.578) (-632.479) (-624.209) -- 0:04:02
380000 -- (-618.745) (-626.902) (-632.258) [-621.157] * [-614.217] (-627.863) (-629.788) (-629.854) -- 0:04:03
Average standard deviation of split frequencies: 0.013003
381000 -- (-632.626) [-624.739] (-631.418) (-632.151) * (-627.536) (-634.953) [-628.540] (-619.305) -- 0:04:02
382000 -- (-618.605) [-627.411] (-620.039) (-624.671) * (-633.891) (-629.490) (-630.614) [-621.133] -- 0:04:01
383000 -- (-650.080) [-625.200] (-647.143) (-622.600) * (-631.628) (-630.671) [-622.510] (-634.822) -- 0:04:01
384000 -- (-622.095) [-616.840] (-630.755) (-636.594) * (-623.502) (-620.612) (-621.874) [-620.021] -- 0:04:00
385000 -- (-632.383) (-617.304) [-615.202] (-621.701) * (-618.648) (-632.087) (-626.048) [-625.668] -- 0:04:01
Average standard deviation of split frequencies: 0.012586
386000 -- (-629.532) (-622.006) (-631.699) [-623.773] * (-623.051) [-628.652] (-637.944) (-633.794) -- 0:04:00
387000 -- [-633.789] (-623.979) (-623.823) (-628.217) * (-628.733) (-625.461) (-629.007) [-623.918] -- 0:03:59
388000 -- (-629.071) (-624.472) [-624.247] (-624.653) * [-620.276] (-626.689) (-622.147) (-630.590) -- 0:03:59
389000 -- (-633.807) (-633.934) [-625.037] (-626.941) * (-624.613) [-621.910] (-637.165) (-626.754) -- 0:03:58
390000 -- [-618.882] (-639.932) (-633.123) (-635.220) * (-632.092) (-622.033) (-623.322) [-625.191] -- 0:03:59
Average standard deviation of split frequencies: 0.012134
391000 -- (-623.376) (-633.365) (-623.428) [-622.050] * (-614.727) [-618.902] (-623.061) (-633.592) -- 0:03:58
392000 -- (-635.318) (-626.409) (-630.547) [-624.655] * (-625.685) (-628.689) [-627.213] (-626.630) -- 0:03:57
393000 -- (-624.495) [-618.880] (-628.759) (-641.827) * [-623.796] (-631.246) (-626.857) (-618.103) -- 0:03:57
394000 -- [-619.933] (-625.740) (-629.836) (-625.412) * (-633.772) [-629.745] (-635.332) (-628.051) -- 0:03:56
395000 -- (-633.468) [-621.378] (-639.287) (-631.136) * [-620.026] (-621.789) (-627.719) (-625.935) -- 0:03:55
Average standard deviation of split frequencies: 0.012176
396000 -- [-620.102] (-628.033) (-628.922) (-634.976) * (-623.425) (-624.493) (-634.798) [-619.693] -- 0:03:56
397000 -- (-627.055) (-628.096) (-626.147) [-623.030] * (-620.427) (-625.227) (-623.408) [-627.078] -- 0:03:55
398000 -- (-633.429) (-639.569) [-622.090] (-618.838) * [-634.729] (-614.839) (-630.185) (-642.787) -- 0:03:55
399000 -- [-626.341] (-630.198) (-629.251) (-617.923) * (-631.933) [-620.490] (-625.663) (-624.198) -- 0:03:54
400000 -- (-630.771) [-619.088] (-627.423) (-624.191) * (-623.704) (-643.877) [-631.731] (-625.405) -- 0:03:54
Average standard deviation of split frequencies: 0.012236
401000 -- (-642.376) (-621.524) [-617.233] (-626.010) * (-623.309) (-626.833) [-622.495] (-620.098) -- 0:03:54
402000 -- (-632.539) (-629.781) (-637.868) [-620.317] * (-627.990) (-628.047) (-631.065) [-630.693] -- 0:03:53
403000 -- [-625.099] (-627.919) (-624.909) (-627.288) * (-621.627) (-631.383) (-619.118) [-625.439] -- 0:03:54
404000 -- (-623.432) [-624.977] (-620.522) (-635.588) * (-616.593) (-631.355) [-618.376] (-626.747) -- 0:03:53
405000 -- [-623.909] (-621.918) (-627.290) (-623.644) * [-621.683] (-621.550) (-637.050) (-634.604) -- 0:03:52
Average standard deviation of split frequencies: 0.011876
406000 -- (-623.656) (-637.424) (-633.262) [-621.185] * (-622.191) [-627.185] (-633.610) (-617.565) -- 0:03:52
407000 -- [-618.723] (-625.365) (-637.757) (-622.498) * (-640.419) [-635.177] (-626.961) (-615.191) -- 0:03:51
408000 -- [-629.567] (-630.527) (-627.666) (-630.741) * (-628.668) (-628.412) (-627.098) [-622.286] -- 0:03:50
409000 -- (-625.958) (-635.261) [-617.020] (-631.465) * [-621.423] (-624.085) (-642.605) (-628.810) -- 0:03:51
410000 -- (-627.136) (-640.105) (-637.579) [-623.522] * (-627.641) [-617.156] (-633.461) (-623.176) -- 0:03:50
Average standard deviation of split frequencies: 0.011643
411000 -- [-618.015] (-637.166) (-622.418) (-621.707) * (-626.272) (-639.542) (-621.711) [-620.052] -- 0:03:50
412000 -- [-634.224] (-644.515) (-630.289) (-624.864) * [-616.188] (-634.716) (-629.371) (-635.549) -- 0:03:49
413000 -- (-629.662) (-629.485) [-623.975] (-618.632) * (-633.042) (-626.480) [-620.353] (-629.519) -- 0:03:48
414000 -- (-628.093) [-625.886] (-623.132) (-632.476) * (-632.351) (-640.284) (-630.634) [-635.365] -- 0:03:49
415000 -- (-622.308) (-622.555) [-615.466] (-621.437) * (-637.105) [-620.124] (-624.711) (-627.222) -- 0:03:48
Average standard deviation of split frequencies: 0.011656
416000 -- (-624.033) [-618.636] (-637.068) (-626.141) * (-634.699) (-630.454) (-626.765) [-623.104] -- 0:03:48
417000 -- (-624.161) (-632.041) (-633.841) [-621.082] * (-636.355) (-622.507) [-622.122] (-620.265) -- 0:03:47
418000 -- (-624.652) (-624.416) [-620.599] (-628.003) * (-634.459) [-622.916] (-622.753) (-623.621) -- 0:03:46
419000 -- (-630.180) [-631.599] (-628.265) (-631.648) * [-615.371] (-629.781) (-644.602) (-630.954) -- 0:03:47
420000 -- (-626.383) (-629.998) (-621.836) [-623.970] * [-621.848] (-618.012) (-629.458) (-626.746) -- 0:03:46
Average standard deviation of split frequencies: 0.011686
421000 -- [-625.501] (-622.733) (-629.846) (-617.813) * (-629.765) (-632.251) (-628.238) [-617.677] -- 0:03:46
422000 -- (-626.550) [-621.474] (-622.943) (-620.322) * (-636.737) (-624.584) [-619.059] (-630.567) -- 0:03:45
423000 -- [-618.970] (-629.450) (-628.717) (-626.746) * [-622.689] (-643.949) (-620.837) (-620.351) -- 0:03:45
424000 -- [-622.584] (-637.640) (-627.551) (-630.959) * (-646.990) (-627.353) (-635.820) [-623.433] -- 0:03:45
425000 -- (-629.015) (-630.439) (-643.345) [-626.406] * (-620.395) [-623.069] (-626.322) (-628.347) -- 0:03:44
Average standard deviation of split frequencies: 0.012141
426000 -- (-617.503) [-629.078] (-634.174) (-624.189) * (-621.396) (-631.818) [-628.899] (-621.184) -- 0:03:45
427000 -- (-637.800) (-626.115) (-626.975) [-628.916] * (-617.800) (-628.233) [-622.673] (-625.646) -- 0:03:44
428000 -- (-620.167) [-620.935] (-631.722) (-628.681) * (-630.154) (-627.685) (-626.577) [-631.727] -- 0:03:43
429000 -- (-625.336) [-633.090] (-629.664) (-628.266) * (-623.328) [-618.458] (-631.251) (-616.336) -- 0:03:43
430000 -- (-628.226) (-642.222) (-629.874) [-617.898] * (-628.648) (-626.589) [-623.973] (-638.612) -- 0:03:42
Average standard deviation of split frequencies: 0.011415
431000 -- (-635.805) [-617.686] (-616.920) (-624.892) * (-622.708) [-619.160] (-631.059) (-639.587) -- 0:03:41
432000 -- (-624.143) (-623.132) (-627.680) [-625.910] * [-629.706] (-635.249) (-630.570) (-630.923) -- 0:03:42
433000 -- (-634.674) [-619.950] (-625.913) (-621.614) * (-626.165) (-635.012) (-631.151) [-616.494] -- 0:03:41
434000 -- [-618.885] (-635.883) (-618.090) (-631.693) * [-622.281] (-623.693) (-622.114) (-620.114) -- 0:03:41
435000 -- (-627.778) [-625.816] (-641.297) (-628.784) * (-632.176) [-616.394] (-628.984) (-629.221) -- 0:03:40
Average standard deviation of split frequencies: 0.011677
436000 -- (-624.986) (-632.579) [-622.905] (-634.728) * (-625.903) (-627.079) (-627.026) [-619.859] -- 0:03:39
437000 -- (-635.457) (-628.621) [-620.043] (-619.399) * [-623.652] (-631.917) (-627.854) (-625.650) -- 0:03:40
438000 -- (-632.510) (-622.968) [-618.395] (-632.039) * (-627.471) (-630.710) [-629.102] (-620.178) -- 0:03:39
439000 -- (-644.638) [-613.351] (-622.039) (-628.671) * [-619.740] (-627.918) (-633.128) (-621.259) -- 0:03:39
440000 -- (-618.702) [-621.315] (-632.180) (-619.083) * (-631.830) (-629.049) (-626.592) [-621.758] -- 0:03:38
Average standard deviation of split frequencies: 0.011187
441000 -- [-620.107] (-619.425) (-622.397) (-628.350) * (-630.087) (-644.890) [-614.212] (-628.363) -- 0:03:38
442000 -- (-630.814) (-646.857) (-627.295) [-627.193] * [-625.435] (-621.418) (-621.996) (-625.691) -- 0:03:38
443000 -- (-633.075) [-628.140] (-619.611) (-628.259) * (-628.788) (-620.803) (-620.622) [-624.753] -- 0:03:37
444000 -- (-617.390) [-628.528] (-625.449) (-626.318) * (-622.978) [-629.613] (-640.545) (-623.203) -- 0:03:36
445000 -- (-625.573) (-628.334) [-622.908] (-621.781) * (-634.633) (-623.331) [-623.340] (-621.857) -- 0:03:37
Average standard deviation of split frequencies: 0.010962
446000 -- (-636.075) (-628.947) [-612.560] (-622.592) * [-621.070] (-619.033) (-632.760) (-630.543) -- 0:03:36
447000 -- [-627.196] (-617.238) (-630.932) (-624.499) * [-625.731] (-630.243) (-626.227) (-633.392) -- 0:03:36
448000 -- (-622.654) (-640.641) [-617.350] (-621.153) * (-619.036) (-622.267) [-616.267] (-619.336) -- 0:03:35
449000 -- (-621.819) (-629.010) [-618.728] (-628.314) * (-632.721) [-623.945] (-616.564) (-623.124) -- 0:03:34
450000 -- (-615.897) [-629.399] (-619.036) (-622.954) * (-629.980) (-623.390) [-615.916] (-633.971) -- 0:03:35
Average standard deviation of split frequencies: 0.011387
451000 -- (-618.037) (-635.204) (-629.650) [-618.809] * [-622.870] (-639.774) (-624.038) (-625.897) -- 0:03:34
452000 -- (-630.274) (-630.445) [-633.754] (-622.289) * [-616.936] (-628.348) (-636.135) (-626.146) -- 0:03:34
453000 -- (-625.348) (-630.915) [-621.271] (-630.242) * (-628.782) (-626.164) (-627.252) [-636.568] -- 0:03:33
454000 -- [-619.994] (-631.826) (-635.574) (-634.466) * (-636.760) (-619.259) (-633.665) [-624.138] -- 0:03:32
455000 -- (-633.707) (-632.042) (-639.028) [-627.909] * (-644.529) (-623.102) [-621.020] (-632.976) -- 0:03:33
Average standard deviation of split frequencies: 0.011017
456000 -- (-624.081) (-630.660) (-633.452) [-622.265] * [-619.954] (-618.451) (-629.192) (-621.923) -- 0:03:32
457000 -- (-632.627) [-619.883] (-624.853) (-621.693) * [-628.288] (-628.613) (-623.848) (-624.955) -- 0:03:32
458000 -- (-613.354) [-621.478] (-642.821) (-616.818) * [-627.257] (-635.717) (-621.883) (-633.477) -- 0:03:31
459000 -- (-628.785) (-627.677) (-621.783) [-621.836] * [-621.807] (-625.760) (-618.529) (-628.873) -- 0:03:30
460000 -- (-633.787) (-619.188) [-619.682] (-624.451) * (-620.685) (-617.471) (-630.661) [-620.737] -- 0:03:31
Average standard deviation of split frequencies: 0.011497
461000 -- (-626.448) (-619.142) (-623.023) [-615.011] * (-634.145) (-636.181) [-620.663] (-621.166) -- 0:03:30
462000 -- [-631.981] (-626.477) (-624.005) (-624.652) * (-625.640) [-619.966] (-622.533) (-633.734) -- 0:03:30
463000 -- (-621.373) (-635.261) (-641.908) [-614.242] * (-627.956) [-615.602] (-627.173) (-624.399) -- 0:03:29
464000 -- (-631.689) [-624.171] (-634.338) (-625.271) * (-633.144) [-620.891] (-624.632) (-632.621) -- 0:03:29
465000 -- (-618.038) (-633.196) (-626.367) [-622.627] * [-618.612] (-622.592) (-621.498) (-623.466) -- 0:03:29
Average standard deviation of split frequencies: 0.011247
466000 -- (-628.566) [-618.912] (-631.037) (-622.069) * (-625.949) [-625.497] (-622.435) (-627.974) -- 0:03:28
467000 -- (-621.245) [-617.607] (-640.157) (-626.361) * [-615.649] (-627.774) (-622.529) (-639.054) -- 0:03:28
468000 -- [-622.783] (-624.865) (-625.119) (-630.709) * (-622.225) [-619.010] (-621.340) (-626.253) -- 0:03:28
469000 -- (-615.395) (-631.997) (-628.527) [-627.766] * (-640.949) (-634.661) [-633.445] (-622.402) -- 0:03:27
470000 -- (-633.384) (-625.851) (-618.210) [-626.156] * (-624.325) (-627.980) (-624.690) [-630.691] -- 0:03:27
Average standard deviation of split frequencies: 0.011577
471000 -- (-625.855) (-626.238) [-613.884] (-624.605) * [-620.784] (-638.233) (-618.263) (-624.578) -- 0:03:26
472000 -- [-624.617] (-625.903) (-627.263) (-631.065) * (-629.099) (-627.783) (-626.729) [-618.021] -- 0:03:26
473000 -- (-626.810) (-633.613) [-623.399] (-630.880) * [-630.064] (-633.296) (-626.912) (-626.547) -- 0:03:26
474000 -- (-618.874) (-631.999) [-623.034] (-623.606) * (-626.639) (-644.104) (-626.546) [-627.086] -- 0:03:25
475000 -- (-621.495) (-627.881) [-621.102] (-620.206) * (-646.624) (-622.520) [-616.506] (-628.688) -- 0:03:25
Average standard deviation of split frequencies: 0.011709
476000 -- (-617.222) (-625.186) [-626.359] (-625.651) * (-635.489) (-625.308) [-621.953] (-633.047) -- 0:03:24
477000 -- [-615.528] (-633.117) (-633.083) (-629.206) * (-632.105) (-626.319) [-626.461] (-623.100) -- 0:03:23
478000 -- [-618.612] (-633.833) (-624.996) (-626.504) * [-616.655] (-627.834) (-633.425) (-629.478) -- 0:03:24
479000 -- (-627.354) (-637.652) (-623.951) [-623.016] * (-631.171) (-624.268) [-615.152] (-626.974) -- 0:03:23
480000 -- (-628.889) (-628.755) [-624.559] (-619.669) * (-632.243) (-630.038) (-632.124) [-635.996] -- 0:03:23
Average standard deviation of split frequencies: 0.011040
481000 -- [-622.358] (-623.001) (-625.246) (-648.938) * [-623.768] (-619.501) (-625.122) (-628.237) -- 0:03:22
482000 -- [-619.236] (-622.129) (-634.099) (-622.476) * (-642.023) [-631.668] (-618.905) (-620.309) -- 0:03:22
483000 -- (-626.018) (-627.368) (-633.874) [-616.948] * [-624.893] (-616.602) (-630.682) (-630.368) -- 0:03:22
484000 -- (-628.069) (-634.639) (-642.979) [-622.617] * (-624.432) (-633.054) (-627.356) [-622.331] -- 0:03:21
485000 -- (-620.919) (-625.011) (-629.271) [-625.064] * (-631.151) [-619.693] (-630.241) (-627.485) -- 0:03:20
Average standard deviation of split frequencies: 0.010836
486000 -- [-623.777] (-630.118) (-628.535) (-623.618) * (-628.465) (-643.344) (-630.763) [-622.445] -- 0:03:20
487000 -- (-623.135) (-626.361) [-620.157] (-629.836) * (-635.968) (-621.393) (-629.267) [-635.326] -- 0:03:20
488000 -- [-624.844] (-625.108) (-634.308) (-617.990) * (-639.284) (-619.481) [-623.691] (-631.748) -- 0:03:20
489000 -- (-625.567) [-619.464] (-627.927) (-623.627) * (-624.989) [-623.512] (-629.692) (-632.061) -- 0:03:19
490000 -- (-632.628) (-623.520) [-626.365] (-633.709) * (-630.406) (-629.579) [-631.635] (-626.905) -- 0:03:18
Average standard deviation of split frequencies: 0.010733
491000 -- (-625.345) (-628.590) [-615.582] (-627.168) * (-624.375) (-618.152) (-634.546) [-626.882] -- 0:03:19
492000 -- (-620.581) [-630.849] (-624.803) (-637.682) * (-641.691) (-630.560) (-632.706) [-624.481] -- 0:03:18
493000 -- (-625.971) (-628.131) [-625.987] (-633.514) * (-633.193) (-622.386) (-631.790) [-621.123] -- 0:03:18
494000 -- (-636.218) [-622.400] (-622.250) (-639.337) * [-619.041] (-625.018) (-630.870) (-640.407) -- 0:03:17
495000 -- (-628.449) (-635.391) [-618.758] (-621.546) * [-623.536] (-618.770) (-631.357) (-625.699) -- 0:03:16
Average standard deviation of split frequencies: 0.011242
496000 -- [-628.800] (-627.556) (-640.120) (-633.858) * (-625.738) [-624.881] (-620.499) (-630.305) -- 0:03:17
497000 -- (-623.490) (-630.772) [-627.219] (-627.925) * (-633.344) [-633.079] (-622.785) (-630.911) -- 0:03:16
498000 -- (-641.138) [-622.694] (-632.371) (-625.245) * [-616.713] (-633.191) (-627.303) (-627.865) -- 0:03:15
499000 -- [-621.629] (-625.548) (-640.515) (-630.976) * (-623.920) (-620.315) [-620.734] (-630.721) -- 0:03:15
500000 -- [-623.766] (-627.935) (-630.239) (-641.621) * (-634.024) [-621.165] (-625.292) (-622.066) -- 0:03:15
Average standard deviation of split frequencies: 0.011354
501000 -- [-633.759] (-640.230) (-632.072) (-626.902) * [-620.830] (-631.475) (-633.255) (-621.689) -- 0:03:15
502000 -- [-625.011] (-640.667) (-624.791) (-629.583) * [-616.809] (-637.864) (-627.719) (-623.692) -- 0:03:14
503000 -- [-623.695] (-632.705) (-628.682) (-639.395) * (-635.674) (-638.557) (-631.724) [-624.536] -- 0:03:13
504000 -- (-623.231) (-642.764) (-622.862) [-619.322] * (-624.145) (-630.035) [-629.189] (-628.253) -- 0:03:13
505000 -- (-629.124) (-625.007) [-622.613] (-621.092) * (-629.894) (-626.751) [-628.361] (-631.602) -- 0:03:13
Average standard deviation of split frequencies: 0.011073
506000 -- (-634.783) (-625.538) (-628.284) [-620.516] * (-635.813) (-619.380) [-619.954] (-634.257) -- 0:03:13
507000 -- (-634.920) [-620.380] (-633.882) (-617.921) * (-620.277) (-635.332) [-623.968] (-625.845) -- 0:03:12
508000 -- (-622.656) (-637.147) [-627.891] (-625.450) * (-631.350) [-627.380] (-623.385) (-631.496) -- 0:03:11
509000 -- [-623.704] (-626.463) (-616.826) (-623.632) * (-627.293) (-633.489) [-619.747] (-621.265) -- 0:03:11
510000 -- (-629.979) [-619.606] (-623.675) (-624.269) * [-630.259] (-629.651) (-621.619) (-626.092) -- 0:03:11
Average standard deviation of split frequencies: 0.011157
511000 -- (-622.822) [-624.762] (-629.257) (-629.709) * (-625.375) (-639.141) (-619.343) [-622.047] -- 0:03:10
512000 -- (-619.612) (-619.932) [-621.780] (-627.136) * (-624.155) (-625.799) [-629.968] (-629.441) -- 0:03:10
513000 -- (-626.373) (-626.117) (-621.785) [-632.902] * (-625.997) (-631.001) (-626.320) [-630.902] -- 0:03:09
514000 -- (-619.615) (-623.367) [-622.281] (-628.882) * (-627.997) (-623.303) [-624.836] (-629.642) -- 0:03:10
515000 -- [-620.263] (-627.584) (-617.850) (-635.831) * [-623.721] (-625.857) (-623.617) (-622.562) -- 0:03:09
Average standard deviation of split frequencies: 0.011608
516000 -- (-625.450) [-618.297] (-628.201) (-628.556) * (-621.575) (-630.331) [-631.997] (-627.117) -- 0:03:08
517000 -- (-623.931) (-627.168) [-620.788] (-624.804) * [-628.914] (-627.480) (-619.134) (-627.445) -- 0:03:08
518000 -- (-651.315) (-637.330) (-626.677) [-619.362] * [-619.004] (-635.150) (-625.331) (-633.208) -- 0:03:07
519000 -- (-635.749) (-623.339) [-615.660] (-629.325) * [-620.700] (-622.825) (-632.047) (-635.126) -- 0:03:08
520000 -- (-628.815) (-625.387) (-621.300) [-627.162] * [-621.065] (-631.365) (-622.036) (-633.632) -- 0:03:07
Average standard deviation of split frequencies: 0.011797
521000 -- (-632.046) (-631.725) (-620.453) [-636.629] * (-641.859) [-618.912] (-624.608) (-627.759) -- 0:03:06
522000 -- (-642.413) (-619.733) [-626.761] (-627.482) * (-632.104) (-623.444) (-634.571) [-623.322] -- 0:03:06
523000 -- [-625.958] (-617.127) (-632.513) (-623.001) * [-620.181] (-625.511) (-627.894) (-621.815) -- 0:03:06
524000 -- (-620.631) (-616.280) (-624.054) [-622.617] * [-617.871] (-632.037) (-630.644) (-629.088) -- 0:03:06
525000 -- (-622.738) [-617.453] (-629.392) (-625.069) * (-626.892) [-624.243] (-621.285) (-623.979) -- 0:03:05
Average standard deviation of split frequencies: 0.011598
526000 -- (-621.145) (-628.795) (-637.320) [-618.722] * (-620.858) [-630.601] (-626.725) (-637.883) -- 0:03:04
527000 -- (-622.634) [-627.499] (-642.970) (-620.165) * [-621.029] (-624.043) (-643.098) (-623.221) -- 0:03:04
528000 -- [-620.243] (-632.687) (-639.399) (-622.273) * (-640.750) (-627.136) [-619.502] (-629.137) -- 0:03:04
529000 -- (-625.394) [-621.911] (-618.994) (-628.643) * (-627.815) [-622.606] (-628.660) (-622.059) -- 0:03:03
530000 -- (-628.898) (-642.495) [-618.265] (-622.893) * (-622.351) (-640.300) (-624.328) [-618.627] -- 0:03:03
Average standard deviation of split frequencies: 0.011313
531000 -- (-625.711) (-630.409) (-625.079) [-628.090] * (-626.793) (-630.179) [-619.144] (-624.005) -- 0:03:02
532000 -- (-625.489) [-627.267] (-619.362) (-620.099) * (-628.942) (-636.337) [-618.663] (-635.882) -- 0:03:02
533000 -- [-621.356] (-626.055) (-621.960) (-621.761) * (-636.413) (-640.170) [-626.291] (-629.560) -- 0:03:02
534000 -- (-627.288) (-636.237) (-622.199) [-620.198] * [-622.226] (-639.312) (-628.506) (-624.012) -- 0:03:01
535000 -- [-620.944] (-622.390) (-627.791) (-626.798) * (-624.555) [-628.596] (-622.326) (-623.664) -- 0:03:01
Average standard deviation of split frequencies: 0.011257
536000 -- (-626.729) (-620.962) (-619.459) [-619.475] * (-623.155) (-629.538) (-625.229) [-626.932] -- 0:03:00
537000 -- (-621.448) [-621.076] (-640.061) (-637.408) * (-627.935) (-629.191) [-627.582] (-626.876) -- 0:03:01
538000 -- [-620.664] (-635.388) (-621.121) (-626.551) * (-623.425) (-623.637) [-621.885] (-629.072) -- 0:03:00
539000 -- [-626.240] (-628.970) (-628.138) (-637.139) * (-629.225) [-619.549] (-628.673) (-628.986) -- 0:02:59
540000 -- (-626.001) (-631.471) (-631.299) [-630.289] * (-623.102) (-624.549) (-624.802) [-622.588] -- 0:02:59
Average standard deviation of split frequencies: 0.011617
541000 -- (-625.839) (-628.248) (-623.473) [-622.646] * (-643.998) (-634.217) (-631.644) [-626.830] -- 0:02:59
542000 -- [-618.664] (-623.997) (-621.371) (-627.447) * (-621.996) [-620.181] (-625.219) (-632.747) -- 0:02:59
543000 -- (-628.267) [-623.509] (-633.447) (-635.717) * (-617.297) [-638.665] (-619.220) (-625.976) -- 0:02:58
544000 -- (-618.272) (-630.205) [-627.089] (-630.389) * (-624.605) (-627.896) (-615.763) [-621.630] -- 0:02:57
545000 -- (-632.164) (-625.484) (-625.792) [-620.801] * (-623.138) (-620.976) [-618.626] (-627.328) -- 0:02:57
Average standard deviation of split frequencies: 0.011273
546000 -- (-622.301) (-633.127) (-618.574) [-621.243] * [-625.355] (-632.051) (-621.455) (-633.401) -- 0:02:57
547000 -- (-630.116) (-626.084) [-625.235] (-629.461) * (-626.876) (-628.204) (-626.120) [-630.820] -- 0:02:57
548000 -- [-631.397] (-629.351) (-634.418) (-625.270) * [-620.072] (-634.630) (-628.384) (-623.674) -- 0:02:56
549000 -- (-639.153) (-625.020) [-618.771] (-627.228) * (-638.157) [-629.112] (-632.388) (-630.421) -- 0:02:55
550000 -- (-627.385) (-631.838) (-627.166) [-620.533] * [-625.420] (-619.372) (-625.402) (-635.051) -- 0:02:55
Average standard deviation of split frequencies: 0.011202
551000 -- (-631.984) (-634.642) [-615.471] (-630.113) * (-619.217) (-631.765) [-623.096] (-624.067) -- 0:02:55
552000 -- (-636.392) [-628.866] (-625.385) (-622.520) * [-616.865] (-628.092) (-624.689) (-635.772) -- 0:02:55
553000 -- [-620.720] (-624.553) (-622.101) (-630.156) * (-630.788) (-635.281) (-628.941) [-626.740] -- 0:02:54
554000 -- [-621.641] (-619.298) (-626.225) (-626.933) * (-631.575) (-634.386) [-621.185] (-627.253) -- 0:02:53
555000 -- (-625.994) (-618.609) [-628.804] (-632.150) * (-620.120) (-636.653) (-628.047) [-621.703] -- 0:02:53
Average standard deviation of split frequencies: 0.011531
556000 -- (-627.275) [-624.360] (-640.171) (-625.152) * (-622.197) (-619.143) [-620.064] (-631.520) -- 0:02:53
557000 -- (-630.033) (-624.586) (-635.259) [-623.776] * (-634.469) [-619.466] (-633.120) (-625.115) -- 0:02:52
558000 -- [-615.924] (-630.681) (-620.498) (-624.473) * [-619.703] (-619.695) (-631.782) (-635.523) -- 0:02:52
559000 -- [-622.074] (-628.308) (-624.605) (-624.373) * [-617.353] (-635.142) (-629.606) (-626.466) -- 0:02:51
560000 -- [-622.029] (-624.437) (-637.597) (-621.320) * (-631.983) [-625.268] (-622.195) (-647.363) -- 0:02:52
Average standard deviation of split frequencies: 0.011459
561000 -- (-623.620) (-628.839) (-635.719) [-627.145] * [-619.762] (-631.948) (-623.463) (-625.158) -- 0:02:51
562000 -- (-633.516) [-623.993] (-627.858) (-632.189) * (-622.756) (-628.233) (-621.384) [-620.440] -- 0:02:50
563000 -- (-625.677) [-622.694] (-619.789) (-630.726) * (-627.109) [-623.587] (-624.142) (-623.642) -- 0:02:50
564000 -- (-636.560) (-622.033) [-619.802] (-632.028) * (-626.848) (-642.860) [-619.465] (-633.030) -- 0:02:50
565000 -- (-641.262) (-626.735) (-625.897) [-619.388] * (-633.310) (-628.818) (-639.964) [-622.181] -- 0:02:50
Average standard deviation of split frequencies: 0.011303
566000 -- (-630.851) [-626.643] (-633.868) (-622.851) * (-626.913) [-625.949] (-627.521) (-630.022) -- 0:02:49
567000 -- [-621.753] (-630.671) (-626.910) (-629.435) * (-633.307) (-619.497) (-624.131) [-622.821] -- 0:02:48
568000 -- [-622.114] (-620.605) (-626.468) (-623.938) * (-634.570) [-623.648] (-620.100) (-628.351) -- 0:02:48
569000 -- (-626.192) (-631.909) (-623.261) [-616.875] * (-634.972) [-631.447] (-626.729) (-621.224) -- 0:02:48
570000 -- (-623.049) (-622.376) (-628.298) [-625.981] * (-619.525) [-618.641] (-617.541) (-631.070) -- 0:02:47
Average standard deviation of split frequencies: 0.011140
571000 -- [-626.647] (-623.313) (-633.511) (-624.678) * (-630.333) (-634.644) [-617.911] (-620.334) -- 0:02:47
572000 -- (-620.125) [-629.636] (-617.544) (-623.924) * [-624.653] (-619.188) (-626.745) (-636.069) -- 0:02:46
573000 -- (-638.421) [-620.798] (-626.208) (-629.452) * (-623.809) (-619.882) [-626.392] (-624.470) -- 0:02:46
574000 -- (-623.095) (-622.167) [-620.068] (-631.476) * (-623.002) (-624.174) (-627.543) [-617.359] -- 0:02:46
575000 -- (-627.181) [-616.691] (-625.918) (-631.624) * [-621.206] (-625.121) (-628.033) (-636.399) -- 0:02:45
Average standard deviation of split frequencies: 0.010920
576000 -- (-625.649) (-626.814) (-613.480) [-626.778] * [-629.528] (-631.845) (-624.711) (-625.228) -- 0:02:45
577000 -- (-627.269) (-624.022) (-627.115) [-628.672] * (-632.951) [-623.029] (-637.059) (-630.972) -- 0:02:44
578000 -- [-617.039] (-623.892) (-625.844) (-633.005) * [-628.044] (-632.017) (-627.500) (-624.688) -- 0:02:45
579000 -- (-625.217) [-631.374] (-644.638) (-631.482) * (-635.037) (-628.900) [-626.117] (-627.125) -- 0:02:44
580000 -- (-621.309) (-630.492) [-621.992] (-629.483) * (-628.687) [-617.042] (-625.110) (-624.200) -- 0:02:43
Average standard deviation of split frequencies: 0.010345
581000 -- [-617.815] (-621.460) (-632.237) (-639.579) * (-638.444) [-623.015] (-619.619) (-624.911) -- 0:02:43
582000 -- [-622.040] (-626.243) (-629.083) (-629.918) * (-627.501) [-620.303] (-618.906) (-632.369) -- 0:02:43
583000 -- (-627.225) (-632.789) [-634.549] (-632.479) * [-623.744] (-627.832) (-636.995) (-629.477) -- 0:02:43
584000 -- (-632.041) (-625.038) [-619.896] (-635.108) * [-624.510] (-628.193) (-627.227) (-632.658) -- 0:02:42
585000 -- (-619.835) (-632.188) [-622.871] (-627.043) * (-627.941) (-628.819) (-628.447) [-626.793] -- 0:02:41
Average standard deviation of split frequencies: 0.010412
586000 -- (-626.117) [-623.368] (-618.550) (-637.318) * (-632.020) (-629.757) (-624.436) [-621.230] -- 0:02:41
587000 -- [-623.223] (-630.869) (-623.242) (-632.578) * (-624.229) (-626.717) [-616.899] (-625.991) -- 0:02:41
588000 -- (-631.179) (-636.040) [-621.491] (-630.051) * [-622.613] (-627.652) (-617.904) (-626.007) -- 0:02:40
589000 -- (-630.393) (-625.844) [-618.817] (-623.548) * [-618.284] (-613.647) (-630.555) (-630.355) -- 0:02:40
590000 -- [-622.501] (-636.396) (-629.719) (-626.283) * (-624.873) (-615.644) [-623.141] (-625.467) -- 0:02:39
Average standard deviation of split frequencies: 0.010580
591000 -- (-630.124) (-639.101) [-627.436] (-627.570) * (-618.215) (-625.859) (-629.030) [-621.159] -- 0:02:39
592000 -- [-618.060] (-632.574) (-621.021) (-622.315) * (-622.318) [-626.556] (-629.611) (-626.566) -- 0:02:39
593000 -- (-626.156) [-624.379] (-622.118) (-624.660) * (-617.438) (-633.582) [-616.511] (-638.202) -- 0:02:38
594000 -- (-638.089) (-616.767) [-622.820] (-626.878) * [-622.047] (-637.812) (-628.020) (-629.353) -- 0:02:38
595000 -- (-622.313) [-617.343] (-619.800) (-628.694) * [-621.051] (-634.769) (-628.508) (-628.066) -- 0:02:37
Average standard deviation of split frequencies: 0.010701
596000 -- (-635.199) (-627.068) [-624.364] (-633.995) * (-617.577) (-627.394) (-626.958) [-615.927] -- 0:02:37
597000 -- (-621.220) (-623.267) [-628.221] (-637.381) * (-626.958) [-623.275] (-633.154) (-632.417) -- 0:02:37
598000 -- [-618.189] (-616.587) (-623.484) (-631.527) * [-619.619] (-629.862) (-650.772) (-624.711) -- 0:02:36
599000 -- (-627.339) [-624.098] (-629.699) (-633.315) * (-634.855) (-628.268) (-631.374) [-631.249] -- 0:02:36
600000 -- (-636.566) [-621.714] (-629.871) (-630.501) * (-620.159) (-633.387) (-634.972) [-614.742] -- 0:02:36
Average standard deviation of split frequencies: 0.010875
601000 -- (-629.469) (-621.608) [-625.378] (-623.503) * (-627.569) [-625.443] (-624.240) (-619.768) -- 0:02:35
602000 -- [-626.268] (-631.404) (-627.720) (-621.299) * (-624.352) (-630.032) (-622.460) [-620.417] -- 0:02:35
603000 -- (-631.409) (-625.926) [-621.444] (-629.295) * (-622.790) (-635.519) [-632.300] (-618.197) -- 0:02:34
604000 -- (-622.592) [-632.955] (-629.003) (-638.894) * (-639.573) (-632.867) [-622.255] (-627.094) -- 0:02:34
605000 -- (-622.236) (-629.605) (-634.187) [-630.174] * (-632.012) (-644.205) (-623.577) [-621.877] -- 0:02:34
Average standard deviation of split frequencies: 0.010668
606000 -- [-620.873] (-623.984) (-621.433) (-624.413) * (-629.358) [-626.265] (-623.792) (-632.647) -- 0:02:33
607000 -- [-628.787] (-629.996) (-629.823) (-625.607) * (-639.651) [-618.847] (-626.216) (-636.185) -- 0:02:33
608000 -- [-618.612] (-639.913) (-623.566) (-628.329) * (-625.062) (-627.589) (-632.210) [-625.344] -- 0:02:32
609000 -- [-625.333] (-621.879) (-619.917) (-627.618) * (-629.399) (-629.960) [-620.256] (-629.580) -- 0:02:32
610000 -- [-619.706] (-635.197) (-628.822) (-626.345) * (-626.866) (-625.486) (-636.166) [-624.423] -- 0:02:32
Average standard deviation of split frequencies: 0.009925
611000 -- [-617.571] (-623.715) (-628.604) (-640.544) * (-631.251) (-623.317) [-623.718] (-626.211) -- 0:02:31
612000 -- (-629.663) (-620.766) (-626.110) [-629.475] * (-627.486) [-618.745] (-619.911) (-621.723) -- 0:02:31
613000 -- [-621.631] (-631.257) (-632.933) (-629.377) * (-623.813) [-618.807] (-628.617) (-635.326) -- 0:02:30
614000 -- (-627.466) [-622.967] (-619.327) (-626.886) * (-632.887) (-631.251) (-634.641) [-617.467] -- 0:02:30
615000 -- (-628.342) (-624.551) [-623.329] (-637.712) * (-622.235) (-624.571) (-631.019) [-624.488] -- 0:02:30
Average standard deviation of split frequencies: 0.009599
616000 -- (-622.401) (-634.971) [-627.655] (-629.588) * [-624.783] (-627.882) (-645.379) (-627.648) -- 0:02:29
617000 -- [-627.878] (-616.182) (-628.913) (-638.930) * (-628.972) [-624.768] (-641.511) (-626.579) -- 0:02:29
618000 -- (-629.057) [-617.050] (-623.895) (-632.374) * (-639.318) (-626.872) [-621.743] (-622.025) -- 0:02:28
619000 -- [-621.983] (-625.364) (-629.595) (-641.946) * [-629.997] (-617.454) (-625.839) (-627.909) -- 0:02:28
620000 -- (-639.142) [-621.521] (-628.741) (-628.864) * (-626.522) [-617.171] (-630.584) (-622.239) -- 0:02:28
Average standard deviation of split frequencies: 0.010097
621000 -- (-621.045) [-623.811] (-632.531) (-623.585) * (-629.506) (-623.045) (-629.138) [-619.016] -- 0:02:27
622000 -- (-619.995) [-618.350] (-627.647) (-629.295) * (-638.428) [-627.140] (-623.227) (-625.222) -- 0:02:27
623000 -- (-632.645) (-632.370) (-630.654) [-620.162] * (-631.610) [-618.174] (-622.157) (-633.982) -- 0:02:27
624000 -- (-629.730) (-627.739) [-627.531] (-626.254) * (-621.138) (-618.611) (-618.279) [-619.143] -- 0:02:26
625000 -- (-633.447) (-632.757) (-625.728) [-621.440] * (-640.360) (-620.135) [-623.118] (-619.519) -- 0:02:26
Average standard deviation of split frequencies: 0.009834
626000 -- (-646.499) (-633.193) [-633.690] (-623.855) * (-622.349) [-633.580] (-640.302) (-623.197) -- 0:02:25
627000 -- [-632.154] (-626.921) (-623.899) (-626.810) * (-625.340) [-626.692] (-627.248) (-627.505) -- 0:02:25
628000 -- (-628.706) (-623.611) [-631.355] (-639.924) * (-635.939) (-626.960) (-639.034) [-624.662] -- 0:02:25
629000 -- (-618.827) (-631.788) (-621.539) [-620.477] * (-626.801) [-620.828] (-626.634) (-633.463) -- 0:02:24
630000 -- (-622.819) (-637.497) [-618.254] (-623.747) * (-636.334) (-633.587) [-625.762] (-629.503) -- 0:02:24
Average standard deviation of split frequencies: 0.009783
631000 -- (-623.728) (-632.718) (-633.014) [-621.458] * (-632.552) [-633.642] (-632.116) (-619.968) -- 0:02:23
632000 -- (-622.401) (-625.955) [-623.420] (-632.830) * (-623.900) (-622.666) [-621.424] (-626.663) -- 0:02:23
633000 -- [-621.158] (-630.502) (-631.082) (-621.376) * (-626.322) [-621.369] (-619.793) (-630.344) -- 0:02:23
634000 -- (-634.285) [-623.635] (-629.659) (-636.535) * [-627.571] (-628.651) (-626.558) (-629.887) -- 0:02:22
635000 -- (-626.976) (-621.297) (-621.397) [-624.728] * (-620.051) [-624.091] (-623.751) (-621.459) -- 0:02:21
Average standard deviation of split frequencies: 0.009679
636000 -- (-627.529) (-631.167) (-624.633) [-621.809] * (-623.114) (-629.467) (-631.631) [-614.700] -- 0:02:21
637000 -- (-640.573) (-619.889) (-623.696) [-626.293] * (-640.905) [-626.824] (-623.454) (-620.673) -- 0:02:21
638000 -- [-618.986] (-635.909) (-633.447) (-631.251) * [-623.575] (-618.954) (-626.008) (-631.889) -- 0:02:21
639000 -- [-620.594] (-628.179) (-623.648) (-635.487) * [-620.566] (-620.454) (-622.670) (-633.642) -- 0:02:20
640000 -- (-628.690) [-623.635] (-627.777) (-626.561) * (-618.173) [-624.235] (-632.032) (-629.269) -- 0:02:20
Average standard deviation of split frequencies: 0.009609
641000 -- (-634.292) (-632.282) [-618.917] (-634.935) * (-625.548) (-614.853) [-618.745] (-630.338) -- 0:02:20
642000 -- (-628.892) (-627.191) [-626.116] (-643.449) * [-618.347] (-629.141) (-618.892) (-628.396) -- 0:02:19
643000 -- (-623.841) [-618.862] (-630.328) (-635.061) * (-624.563) (-619.880) (-636.192) [-620.656] -- 0:02:19
644000 -- (-635.271) (-626.146) (-627.498) [-622.871] * (-624.940) (-623.012) (-624.957) [-623.475] -- 0:02:18
645000 -- (-623.404) (-622.439) (-618.387) [-618.085] * [-631.271] (-635.017) (-626.718) (-636.842) -- 0:02:18
Average standard deviation of split frequencies: 0.009507
646000 -- (-637.907) (-636.379) (-619.289) [-627.133] * (-629.994) [-620.318] (-622.935) (-632.661) -- 0:02:18
647000 -- (-626.083) (-625.870) [-623.169] (-622.795) * [-627.209] (-623.266) (-629.198) (-634.823) -- 0:02:17
648000 -- (-629.804) (-631.675) (-628.330) [-624.507] * [-623.499] (-620.431) (-619.291) (-631.846) -- 0:02:16
649000 -- (-629.706) [-623.016] (-632.710) (-631.101) * [-620.833] (-630.253) (-645.579) (-631.180) -- 0:02:16
650000 -- [-621.801] (-622.543) (-620.569) (-625.886) * (-620.155) (-623.016) (-629.897) [-617.781] -- 0:02:16
Average standard deviation of split frequencies: 0.009481
651000 -- (-627.944) [-632.417] (-617.734) (-629.806) * (-620.674) [-621.347] (-633.397) (-622.174) -- 0:02:16
652000 -- [-619.757] (-631.314) (-629.357) (-633.841) * (-626.518) [-622.645] (-624.829) (-633.287) -- 0:02:15
653000 -- (-626.062) [-617.677] (-622.246) (-626.454) * (-631.742) (-627.884) (-629.661) [-626.233] -- 0:02:14
654000 -- (-627.118) [-621.361] (-626.496) (-635.861) * (-630.377) [-617.998] (-633.925) (-623.992) -- 0:02:14
655000 -- [-622.698] (-618.215) (-618.707) (-625.808) * (-636.785) (-625.031) (-629.313) [-624.119] -- 0:02:14
Average standard deviation of split frequencies: 0.009568
656000 -- (-622.081) [-626.247] (-623.277) (-621.341) * (-633.995) (-631.479) [-627.664] (-622.721) -- 0:02:14
657000 -- (-626.610) (-632.760) [-625.739] (-630.263) * (-630.029) (-619.764) [-625.586] (-622.677) -- 0:02:13
658000 -- (-625.635) (-636.952) [-622.891] (-641.353) * (-638.044) (-628.331) [-621.113] (-629.755) -- 0:02:13
659000 -- (-637.571) (-626.378) (-631.224) [-634.516] * [-625.622] (-623.109) (-626.986) (-625.908) -- 0:02:12
660000 -- [-622.605] (-625.613) (-628.853) (-629.978) * (-621.520) (-634.307) (-619.469) [-622.517] -- 0:02:12
Average standard deviation of split frequencies: 0.009255
661000 -- [-622.465] (-638.979) (-627.171) (-619.684) * (-619.748) [-615.872] (-643.264) (-629.934) -- 0:02:12
662000 -- [-633.512] (-627.844) (-628.567) (-630.362) * (-629.012) (-634.578) [-618.835] (-620.478) -- 0:02:11
663000 -- (-630.008) (-646.863) (-631.238) [-612.737] * (-620.523) [-620.670] (-628.808) (-625.879) -- 0:02:11
664000 -- (-635.425) (-626.140) (-622.936) [-621.504] * (-634.005) (-633.870) [-619.192] (-627.259) -- 0:02:11
665000 -- (-633.355) (-623.718) (-627.440) [-621.296] * (-627.516) (-635.433) (-641.174) [-621.946] -- 0:02:10
Average standard deviation of split frequencies: 0.008918
666000 -- (-625.466) [-620.593] (-620.563) (-627.392) * (-634.556) (-626.052) (-622.942) [-622.703] -- 0:02:10
667000 -- (-630.429) [-621.981] (-620.966) (-628.598) * (-623.072) (-633.897) [-626.729] (-629.153) -- 0:02:09
668000 -- (-632.538) [-618.307] (-627.251) (-622.025) * (-623.385) (-635.978) [-629.412] (-624.676) -- 0:02:09
669000 -- (-629.378) (-625.473) (-643.416) [-624.073] * (-615.943) [-627.816] (-626.571) (-623.605) -- 0:02:09
670000 -- (-631.987) (-632.847) (-628.734) [-617.865] * (-631.688) (-627.700) [-621.179] (-629.226) -- 0:02:08
Average standard deviation of split frequencies: 0.008736
671000 -- (-626.930) (-630.991) [-629.400] (-628.686) * [-626.085] (-626.291) (-638.889) (-626.064) -- 0:02:07
672000 -- [-626.032] (-628.333) (-633.425) (-627.455) * (-628.228) (-628.388) [-626.839] (-628.757) -- 0:02:07
673000 -- (-630.893) (-624.694) (-631.666) [-625.595] * [-623.831] (-623.155) (-620.304) (-626.492) -- 0:02:07
674000 -- [-620.759] (-622.761) (-628.493) (-632.890) * [-620.899] (-631.982) (-626.237) (-618.626) -- 0:02:07
675000 -- (-632.951) (-629.800) [-628.221] (-624.399) * (-626.825) [-620.846] (-625.821) (-626.325) -- 0:02:06
Average standard deviation of split frequencies: 0.009185
676000 -- (-632.475) (-621.863) (-623.103) [-618.575] * (-636.289) (-621.179) [-632.980] (-619.001) -- 0:02:06
677000 -- [-623.281] (-620.566) (-618.150) (-623.934) * (-628.979) [-617.247] (-632.786) (-623.113) -- 0:02:05
678000 -- [-622.652] (-620.628) (-620.085) (-624.547) * (-621.187) [-627.278] (-626.610) (-629.466) -- 0:02:05
679000 -- [-620.873] (-622.732) (-628.829) (-622.354) * (-641.751) (-639.550) (-628.523) [-615.881] -- 0:02:05
680000 -- (-625.283) [-624.233] (-621.465) (-630.034) * (-634.883) [-619.362] (-630.646) (-620.650) -- 0:02:04
Average standard deviation of split frequencies: 0.009142
681000 -- (-627.374) (-631.013) (-619.557) [-623.436] * (-622.222) (-622.295) (-630.338) [-632.041] -- 0:02:04
682000 -- (-624.143) (-624.639) (-627.546) [-628.113] * [-625.740] (-625.197) (-637.146) (-620.607) -- 0:02:04
683000 -- [-623.323] (-625.500) (-622.806) (-637.552) * (-624.570) [-615.113] (-620.652) (-629.830) -- 0:02:03
684000 -- [-625.512] (-625.418) (-627.672) (-635.555) * (-625.449) [-619.238] (-626.845) (-627.984) -- 0:02:03
685000 -- [-621.493] (-627.167) (-627.783) (-630.671) * (-624.160) (-627.644) [-619.135] (-630.825) -- 0:02:02
Average standard deviation of split frequencies: 0.009090
686000 -- (-625.062) (-623.339) [-626.227] (-636.487) * [-631.885] (-623.856) (-626.376) (-620.811) -- 0:02:02
687000 -- (-621.667) [-627.014] (-629.496) (-633.192) * (-627.486) (-628.135) [-619.415] (-626.241) -- 0:02:02
688000 -- [-623.513] (-630.652) (-629.622) (-628.160) * (-647.819) (-632.854) (-623.210) [-628.774] -- 0:02:01
689000 -- (-625.520) (-628.689) [-622.958] (-633.922) * (-627.307) (-628.830) [-620.466] (-630.676) -- 0:02:01
690000 -- (-625.548) [-616.389] (-619.456) (-632.947) * (-619.528) (-639.738) (-627.725) [-626.969] -- 0:02:00
Average standard deviation of split frequencies: 0.009126
691000 -- [-633.186] (-629.865) (-635.225) (-620.772) * (-622.035) (-630.513) [-617.578] (-622.324) -- 0:02:00
692000 -- (-627.907) (-642.916) (-624.914) [-623.311] * (-623.662) (-631.336) (-625.259) [-624.784] -- 0:02:00
693000 -- [-617.948] (-636.019) (-628.781) (-629.825) * [-624.746] (-631.162) (-624.028) (-632.374) -- 0:01:59
694000 -- [-617.331] (-622.689) (-626.707) (-623.864) * (-633.810) (-630.819) (-623.219) [-624.898] -- 0:01:59
695000 -- (-627.707) [-619.542] (-628.088) (-624.719) * (-631.402) [-628.009] (-627.074) (-627.965) -- 0:01:58
Average standard deviation of split frequencies: 0.008592
696000 -- [-621.988] (-629.226) (-645.159) (-624.446) * (-633.110) (-627.186) [-627.914] (-624.063) -- 0:01:58
697000 -- (-635.213) (-624.332) [-628.943] (-629.284) * (-629.067) (-634.320) [-620.841] (-641.618) -- 0:01:58
698000 -- (-631.983) [-626.338] (-634.109) (-623.583) * (-622.433) [-630.684] (-626.201) (-636.372) -- 0:01:57
699000 -- (-625.392) (-631.213) [-622.513] (-623.334) * (-622.825) (-641.508) (-619.370) [-616.995] -- 0:01:57
700000 -- [-622.040] (-653.736) (-622.401) (-628.752) * (-632.087) (-617.750) [-624.251] (-636.647) -- 0:01:57
Average standard deviation of split frequencies: 0.008593
701000 -- [-618.845] (-648.991) (-632.228) (-623.013) * (-630.104) (-623.685) [-621.802] (-626.243) -- 0:01:56
702000 -- [-619.332] (-642.877) (-629.537) (-635.443) * (-617.049) (-620.083) [-623.070] (-625.202) -- 0:01:56
703000 -- (-626.798) (-623.272) (-650.714) [-621.341] * (-620.545) (-636.262) [-621.634] (-625.567) -- 0:01:55
704000 -- (-631.621) (-623.230) [-627.785] (-637.673) * (-630.178) [-625.653] (-628.765) (-639.229) -- 0:01:55
705000 -- (-627.467) [-621.461] (-636.959) (-629.982) * (-632.969) (-625.008) [-620.251] (-627.118) -- 0:01:55
Average standard deviation of split frequencies: 0.008261
706000 -- (-630.195) [-620.854] (-620.152) (-628.303) * (-641.398) (-644.345) [-627.387] (-621.039) -- 0:01:54
707000 -- (-633.279) (-622.098) [-624.034] (-627.182) * [-614.660] (-640.963) (-630.309) (-645.937) -- 0:01:54
708000 -- (-622.451) [-628.631] (-624.888) (-618.684) * [-622.687] (-621.358) (-622.140) (-629.828) -- 0:01:53
709000 -- [-624.236] (-626.409) (-626.144) (-634.972) * (-628.937) (-625.818) [-612.339] (-634.402) -- 0:01:53
710000 -- (-637.694) (-625.942) (-631.195) [-629.453] * (-634.047) [-623.450] (-626.164) (-617.794) -- 0:01:53
Average standard deviation of split frequencies: 0.008074
711000 -- [-630.361] (-625.706) (-618.804) (-620.004) * (-624.565) (-628.367) (-621.097) [-628.858] -- 0:01:52
712000 -- [-620.002] (-629.133) (-622.976) (-627.472) * (-625.581) (-618.985) [-623.814] (-631.033) -- 0:01:52
713000 -- (-638.558) (-639.734) [-619.428] (-620.724) * (-629.291) [-624.485] (-629.116) (-622.992) -- 0:01:51
714000 -- (-633.382) (-626.020) [-620.733] (-626.265) * (-621.843) [-620.702] (-635.696) (-630.512) -- 0:01:51
715000 -- [-623.522] (-634.646) (-631.791) (-629.291) * (-621.463) [-621.606] (-625.105) (-632.741) -- 0:01:51
Average standard deviation of split frequencies: 0.007844
716000 -- (-619.920) [-629.948] (-618.234) (-625.966) * (-629.651) [-621.235] (-630.554) (-628.122) -- 0:01:50
717000 -- (-620.197) (-629.313) [-623.859] (-627.187) * [-622.647] (-635.965) (-621.072) (-629.478) -- 0:01:50
718000 -- [-619.767] (-623.564) (-620.058) (-624.615) * (-631.422) (-622.228) (-625.203) [-625.580] -- 0:01:49
719000 -- (-627.420) (-622.040) (-621.658) [-616.494] * (-631.158) (-620.716) [-617.157] (-623.600) -- 0:01:49
720000 -- (-629.982) [-623.324] (-630.945) (-635.220) * (-623.126) [-620.481] (-621.037) (-647.854) -- 0:01:49
Average standard deviation of split frequencies: 0.007607
721000 -- (-623.165) [-612.669] (-640.150) (-634.030) * (-623.791) [-620.593] (-635.904) (-622.977) -- 0:01:48
722000 -- (-625.617) (-627.994) (-622.496) [-625.722] * [-624.910] (-627.312) (-629.789) (-627.835) -- 0:01:48
723000 -- (-631.710) (-625.193) (-627.341) [-620.075] * [-625.045] (-629.236) (-631.259) (-622.469) -- 0:01:48
724000 -- [-626.095] (-629.696) (-636.644) (-617.907) * [-631.055] (-620.566) (-619.100) (-624.493) -- 0:01:47
725000 -- (-657.051) [-622.480] (-626.843) (-622.205) * [-621.072] (-626.655) (-633.040) (-625.495) -- 0:01:47
Average standard deviation of split frequencies: 0.007588
726000 -- (-632.404) (-635.438) (-632.648) [-618.980] * [-626.794] (-638.252) (-621.805) (-624.880) -- 0:01:46
727000 -- [-624.432] (-632.151) (-634.857) (-620.088) * (-622.783) [-624.583] (-621.293) (-619.970) -- 0:01:46
728000 -- (-629.949) (-622.899) [-622.055] (-628.433) * [-615.687] (-632.861) (-641.262) (-626.943) -- 0:01:46
729000 -- (-630.172) [-623.782] (-629.865) (-622.804) * (-637.857) (-623.220) (-628.844) [-619.183] -- 0:01:45
730000 -- [-627.965] (-622.546) (-630.257) (-619.862) * (-633.881) [-623.317] (-629.289) (-627.219) -- 0:01:45
Average standard deviation of split frequencies: 0.007502
731000 -- (-621.119) (-624.157) [-617.999] (-630.942) * (-630.295) (-624.963) (-617.279) [-617.075] -- 0:01:44
732000 -- (-623.393) (-629.395) (-624.300) [-620.382] * (-626.932) (-638.435) [-621.105] (-624.161) -- 0:01:44
733000 -- [-627.068] (-628.539) (-628.916) (-630.748) * (-630.065) [-625.982] (-628.970) (-626.029) -- 0:01:44
734000 -- (-631.397) [-627.298] (-627.657) (-623.501) * [-624.458] (-633.408) (-628.221) (-627.523) -- 0:01:43
735000 -- (-635.619) [-631.637] (-633.615) (-636.282) * (-624.468) (-630.715) (-633.696) [-618.996] -- 0:01:43
Average standard deviation of split frequencies: 0.007393
736000 -- (-626.889) (-629.106) (-623.169) [-620.213] * (-624.413) [-628.199] (-625.621) (-626.244) -- 0:01:42
737000 -- (-631.504) [-621.254] (-627.649) (-631.357) * (-624.591) [-620.147] (-625.100) (-624.090) -- 0:01:42
738000 -- (-636.442) [-629.840] (-644.842) (-621.301) * (-620.390) (-616.777) [-622.853] (-627.238) -- 0:01:42
739000 -- (-636.676) [-622.904] (-636.491) (-620.400) * (-617.952) [-628.931] (-627.851) (-628.256) -- 0:01:41
740000 -- (-630.414) [-615.448] (-630.973) (-623.369) * (-627.401) (-628.377) [-614.770] (-625.987) -- 0:01:41
Average standard deviation of split frequencies: 0.007110
741000 -- [-638.390] (-631.285) (-638.081) (-632.964) * (-625.041) [-623.086] (-621.466) (-629.520) -- 0:01:41
742000 -- [-634.532] (-622.131) (-623.067) (-632.950) * (-622.011) [-614.272] (-620.472) (-629.141) -- 0:01:40
743000 -- (-638.695) (-629.171) [-628.566] (-626.910) * (-620.241) (-631.599) (-615.911) [-621.485] -- 0:01:40
744000 -- (-619.207) (-633.194) (-635.612) [-621.990] * [-628.168] (-628.337) (-634.211) (-627.662) -- 0:01:39
745000 -- [-623.437] (-625.755) (-633.298) (-623.238) * [-625.064] (-627.490) (-627.096) (-634.310) -- 0:01:39
Average standard deviation of split frequencies: 0.006969
746000 -- (-619.077) (-631.325) [-618.242] (-622.282) * [-622.952] (-622.312) (-634.187) (-644.947) -- 0:01:39
747000 -- (-630.313) [-622.879] (-623.820) (-627.617) * (-619.028) (-632.582) (-631.600) [-626.417] -- 0:01:38
748000 -- (-625.791) (-627.149) (-631.749) [-622.194] * [-622.175] (-632.448) (-634.867) (-625.025) -- 0:01:38
749000 -- [-615.509] (-623.851) (-626.150) (-619.265) * [-631.957] (-629.730) (-638.543) (-623.155) -- 0:01:37
750000 -- (-634.007) [-622.091] (-631.316) (-640.188) * (-633.919) [-626.740] (-631.387) (-634.827) -- 0:01:37
Average standard deviation of split frequencies: 0.007105
751000 -- (-626.095) (-634.043) [-619.653] (-627.005) * (-630.407) (-640.819) (-616.802) [-621.209] -- 0:01:37
752000 -- (-623.367) (-617.788) [-625.058] (-622.658) * (-633.218) (-624.913) [-623.101] (-624.269) -- 0:01:36
753000 -- (-621.010) [-631.381] (-630.204) (-630.458) * (-639.764) (-633.617) (-634.927) [-612.954] -- 0:01:36
754000 -- (-628.366) [-624.226] (-633.761) (-621.771) * (-630.350) [-625.104] (-630.309) (-624.226) -- 0:01:35
755000 -- (-642.146) [-621.459] (-623.985) (-640.451) * (-626.305) [-622.378] (-634.373) (-629.640) -- 0:01:35
Average standard deviation of split frequencies: 0.007108
756000 -- (-625.592) [-619.129] (-629.095) (-620.619) * (-646.395) [-625.768] (-632.572) (-626.315) -- 0:01:35
757000 -- (-634.075) [-623.879] (-625.977) (-646.403) * (-629.663) (-634.805) [-621.887] (-631.510) -- 0:01:34
758000 -- (-642.469) (-631.002) [-620.995] (-626.607) * [-626.101] (-634.093) (-621.082) (-633.365) -- 0:01:34
759000 -- (-625.613) (-629.833) [-619.268] (-629.263) * [-623.518] (-626.588) (-624.826) (-635.729) -- 0:01:33
760000 -- (-628.500) (-626.733) (-626.840) [-620.204] * [-620.429] (-630.965) (-625.508) (-626.988) -- 0:01:33
Average standard deviation of split frequencies: 0.007313
761000 -- (-622.375) (-627.093) [-623.641] (-621.092) * (-621.176) [-625.656] (-631.237) (-627.779) -- 0:01:33
762000 -- [-620.353] (-634.825) (-625.147) (-628.523) * (-629.826) (-626.176) (-631.952) [-619.211] -- 0:01:32
763000 -- [-625.467] (-631.646) (-625.282) (-639.759) * (-617.661) (-631.203) (-629.462) [-618.571] -- 0:01:32
764000 -- [-627.427] (-629.563) (-627.567) (-638.514) * [-621.310] (-632.910) (-624.395) (-630.840) -- 0:01:32
765000 -- (-628.374) (-627.923) (-622.238) [-619.702] * (-631.520) (-638.731) (-623.576) [-627.423] -- 0:01:31
Average standard deviation of split frequencies: 0.007244
766000 -- (-627.867) [-623.259] (-638.682) (-634.395) * [-621.031] (-643.988) (-622.711) (-632.137) -- 0:01:31
767000 -- (-626.742) [-623.918] (-614.638) (-637.278) * (-619.939) [-622.343] (-621.581) (-630.644) -- 0:01:30
768000 -- (-621.012) [-628.398] (-633.211) (-620.128) * (-628.983) (-619.776) [-616.254] (-622.877) -- 0:01:30
769000 -- (-626.203) (-619.853) [-626.066] (-646.982) * (-626.776) (-635.531) (-636.751) [-620.678] -- 0:01:30
770000 -- (-628.499) (-626.033) (-624.123) [-618.418] * (-621.312) [-628.737] (-624.477) (-629.763) -- 0:01:29
Average standard deviation of split frequencies: 0.007270
771000 -- (-622.964) (-626.029) [-627.387] (-635.375) * (-619.021) (-622.600) (-626.460) [-635.516] -- 0:01:29
772000 -- (-625.416) (-626.300) (-638.867) [-618.572] * (-620.462) (-628.730) [-626.123] (-625.145) -- 0:01:28
773000 -- (-629.711) [-618.769] (-629.243) (-632.986) * (-621.607) (-624.297) [-624.765] (-639.388) -- 0:01:28
774000 -- (-621.515) [-618.042] (-639.867) (-630.164) * [-626.767] (-625.181) (-630.538) (-631.865) -- 0:01:28
775000 -- (-626.524) [-622.998] (-626.431) (-632.935) * (-625.385) (-625.460) (-620.865) [-618.555] -- 0:01:27
Average standard deviation of split frequencies: 0.007134
776000 -- (-630.013) [-626.378] (-615.835) (-619.978) * (-621.158) (-626.472) (-628.807) [-617.258] -- 0:01:27
777000 -- [-618.294] (-631.921) (-621.697) (-636.073) * (-623.617) [-620.625] (-628.064) (-629.518) -- 0:01:26
778000 -- (-630.076) (-622.768) [-622.347] (-623.749) * [-626.471] (-629.713) (-622.768) (-619.327) -- 0:01:26
779000 -- (-616.598) (-632.542) [-622.631] (-634.858) * (-629.719) [-623.369] (-622.644) (-622.698) -- 0:01:26
780000 -- (-621.211) (-626.024) (-632.288) [-626.321] * (-617.376) [-618.721] (-625.212) (-627.978) -- 0:01:25
Average standard deviation of split frequencies: 0.006591
781000 -- (-628.936) (-635.891) (-621.459) [-625.938] * (-624.813) [-616.111] (-629.690) (-629.389) -- 0:01:25
782000 -- (-638.708) (-628.732) (-625.893) [-625.193] * (-628.683) [-634.961] (-614.869) (-628.343) -- 0:01:25
783000 -- (-624.354) [-630.159] (-625.823) (-631.921) * (-623.785) [-624.189] (-621.629) (-626.180) -- 0:01:24
784000 -- [-620.721] (-627.275) (-629.970) (-632.054) * (-629.302) (-640.342) (-622.110) [-630.041] -- 0:01:24
785000 -- [-620.605] (-642.698) (-617.976) (-613.019) * [-627.029] (-633.974) (-616.272) (-634.600) -- 0:01:23
Average standard deviation of split frequencies: 0.006632
786000 -- (-619.617) [-629.741] (-623.571) (-637.700) * (-621.312) [-624.847] (-624.569) (-628.800) -- 0:01:23
787000 -- (-626.210) (-639.246) [-626.213] (-629.128) * (-619.878) (-623.541) [-624.053] (-628.709) -- 0:01:23
788000 -- (-626.488) [-625.638] (-622.920) (-629.920) * [-618.268] (-621.172) (-630.745) (-634.897) -- 0:01:22
789000 -- (-629.972) (-633.764) (-626.640) [-626.847] * [-625.053] (-632.125) (-624.836) (-623.027) -- 0:01:22
790000 -- (-617.194) (-640.190) [-624.186] (-628.531) * [-625.474] (-626.261) (-620.107) (-621.562) -- 0:01:21
Average standard deviation of split frequencies: 0.006609
791000 -- (-617.054) [-628.462] (-630.032) (-633.370) * (-639.882) (-628.396) (-625.278) [-613.228] -- 0:01:21
792000 -- [-616.165] (-624.101) (-616.276) (-635.907) * [-631.116] (-623.759) (-623.423) (-629.722) -- 0:01:21
793000 -- (-621.343) [-623.671] (-626.647) (-625.637) * (-624.152) (-625.735) [-630.096] (-620.212) -- 0:01:20
794000 -- (-627.090) [-625.936] (-627.354) (-631.908) * (-625.451) (-622.299) [-613.766] (-631.715) -- 0:01:20
795000 -- (-634.721) [-627.675] (-620.964) (-618.744) * (-627.595) (-625.385) [-626.034] (-640.273) -- 0:01:19
Average standard deviation of split frequencies: 0.006650
796000 -- [-623.537] (-652.026) (-625.754) (-619.993) * [-629.710] (-639.074) (-629.623) (-632.203) -- 0:01:19
797000 -- [-617.863] (-636.029) (-626.370) (-622.326) * (-622.474) (-618.183) [-619.057] (-630.650) -- 0:01:19
798000 -- [-621.715] (-634.373) (-620.667) (-621.349) * (-630.498) [-628.001] (-628.102) (-622.108) -- 0:01:18
799000 -- (-627.947) (-625.735) [-616.948] (-623.810) * [-625.968] (-625.676) (-623.711) (-619.151) -- 0:01:18
800000 -- (-631.121) [-618.826] (-628.896) (-624.223) * (-627.289) [-622.383] (-618.251) (-623.986) -- 0:01:18
Average standard deviation of split frequencies: 0.006544
801000 -- (-630.993) [-623.086] (-625.296) (-624.321) * (-626.505) [-622.083] (-634.064) (-627.626) -- 0:01:17
802000 -- [-615.024] (-627.220) (-618.798) (-631.930) * [-631.303] (-631.606) (-614.329) (-625.687) -- 0:01:17
803000 -- (-623.476) [-628.233] (-636.278) (-620.222) * (-635.729) [-620.337] (-635.364) (-617.477) -- 0:01:16
804000 -- (-630.509) [-626.210] (-627.946) (-622.268) * (-630.454) (-626.958) [-624.733] (-638.963) -- 0:01:16
805000 -- (-627.561) [-619.427] (-627.799) (-619.854) * (-627.678) (-620.291) (-636.523) [-625.842] -- 0:01:16
Average standard deviation of split frequencies: 0.006584
806000 -- (-635.977) (-627.067) [-631.564] (-622.612) * (-626.729) (-629.041) [-625.605] (-632.641) -- 0:01:15
807000 -- (-621.550) (-618.733) [-622.291] (-626.413) * (-633.996) (-625.070) [-624.901] (-626.484) -- 0:01:15
808000 -- (-623.867) [-618.332] (-634.105) (-629.666) * (-631.396) (-634.690) (-632.359) [-618.066] -- 0:01:14
809000 -- (-622.904) (-627.584) (-621.733) [-637.217] * [-615.129] (-622.289) (-624.956) (-625.544) -- 0:01:14
810000 -- (-632.589) (-628.788) (-621.201) [-626.833] * (-627.891) (-616.680) [-619.797] (-626.703) -- 0:01:14
Average standard deviation of split frequencies: 0.006779
811000 -- (-629.455) (-625.562) (-633.357) [-619.666] * (-633.056) [-620.480] (-630.039) (-623.440) -- 0:01:13
812000 -- [-627.332] (-620.683) (-629.533) (-635.700) * [-623.761] (-627.963) (-628.116) (-636.116) -- 0:01:13
813000 -- (-632.617) [-618.248] (-622.340) (-620.520) * [-617.243] (-624.759) (-629.965) (-640.000) -- 0:01:12
814000 -- [-617.677] (-628.829) (-629.919) (-624.376) * (-621.001) [-622.151] (-629.052) (-628.981) -- 0:01:12
815000 -- (-635.089) [-623.441] (-635.701) (-624.659) * (-619.359) (-619.069) (-632.473) [-620.668] -- 0:01:12
Average standard deviation of split frequencies: 0.006916
816000 -- (-637.464) [-621.713] (-621.959) (-630.019) * (-617.186) [-625.318] (-633.512) (-628.253) -- 0:01:11
817000 -- (-626.268) [-622.388] (-642.217) (-626.199) * (-627.912) (-636.510) (-621.435) [-625.145] -- 0:01:11
818000 -- (-638.066) [-631.946] (-623.028) (-627.999) * (-622.061) [-623.065] (-637.144) (-626.139) -- 0:01:10
819000 -- (-622.703) (-625.300) (-631.692) [-625.751] * (-632.257) [-617.141] (-625.995) (-619.692) -- 0:01:10
820000 -- (-621.937) [-626.581] (-628.770) (-623.660) * (-632.487) (-639.785) (-632.413) [-613.746] -- 0:01:10
Average standard deviation of split frequencies: 0.007106
821000 -- [-633.749] (-629.864) (-625.071) (-621.807) * (-622.347) (-634.481) [-623.499] (-625.719) -- 0:01:09
822000 -- (-635.828) (-630.566) (-623.819) [-630.222] * [-624.549] (-627.561) (-635.924) (-623.725) -- 0:01:09
823000 -- [-623.148] (-627.870) (-633.985) (-629.479) * (-626.711) (-627.406) [-613.600] (-618.854) -- 0:01:09
824000 -- (-623.099) [-624.801] (-633.080) (-632.674) * (-631.872) [-627.796] (-625.534) (-626.488) -- 0:01:08
825000 -- (-619.963) (-622.967) [-632.441] (-631.051) * [-634.182] (-631.551) (-633.951) (-632.652) -- 0:01:08
Average standard deviation of split frequencies: 0.006881
826000 -- [-617.218] (-624.162) (-625.718) (-626.702) * [-623.166] (-622.536) (-635.517) (-626.789) -- 0:01:07
827000 -- (-623.097) (-631.854) (-631.045) [-623.399] * [-624.684] (-638.634) (-623.468) (-626.405) -- 0:01:07
828000 -- (-624.419) (-634.956) (-626.698) [-620.693] * (-620.139) (-630.337) [-616.385] (-624.272) -- 0:01:07
829000 -- [-623.849] (-628.266) (-621.998) (-633.047) * (-621.242) (-626.715) [-617.254] (-618.995) -- 0:01:06
830000 -- (-621.770) (-630.838) (-625.402) [-621.506] * (-623.741) (-635.354) [-622.229] (-617.785) -- 0:01:06
Average standard deviation of split frequencies: 0.006891
831000 -- (-630.813) (-621.678) [-620.236] (-639.171) * (-629.988) (-618.142) (-620.199) [-619.989] -- 0:01:05
832000 -- (-643.984) (-626.671) [-626.843] (-620.467) * (-630.921) [-615.728] (-621.780) (-636.224) -- 0:01:05
833000 -- (-617.767) (-629.545) (-645.205) [-622.402] * (-634.661) (-622.560) (-639.767) [-628.069] -- 0:01:05
834000 -- (-625.041) [-623.837] (-629.307) (-638.293) * (-625.138) (-622.530) (-630.077) [-623.976] -- 0:01:04
835000 -- [-620.439] (-623.796) (-629.061) (-629.059) * (-631.828) (-635.464) [-623.634] (-624.348) -- 0:01:04
Average standard deviation of split frequencies: 0.006912
836000 -- (-624.882) (-635.125) (-620.568) [-625.934] * [-622.373] (-624.367) (-623.792) (-628.957) -- 0:01:03
837000 -- (-631.846) [-630.323] (-620.707) (-628.824) * (-636.354) (-619.856) (-614.972) [-620.396] -- 0:01:03
838000 -- [-631.617] (-623.945) (-622.590) (-625.886) * [-619.341] (-635.344) (-626.459) (-634.008) -- 0:01:03
839000 -- (-624.523) (-621.323) [-614.015] (-623.441) * (-630.810) (-628.408) (-621.685) [-624.438] -- 0:01:02
840000 -- (-632.606) (-626.577) (-623.172) [-627.655] * [-622.650] (-623.982) (-627.822) (-626.327) -- 0:01:02
Average standard deviation of split frequencies: 0.006761
841000 -- (-630.147) (-623.538) (-623.080) [-621.116] * [-621.964] (-625.567) (-626.895) (-627.101) -- 0:01:02
842000 -- (-625.745) (-628.494) [-622.448] (-615.460) * (-627.140) (-627.099) [-624.666] (-627.879) -- 0:01:01
843000 -- (-626.588) [-620.856] (-624.723) (-621.026) * (-627.604) (-625.180) (-616.932) [-618.825] -- 0:01:01
844000 -- (-628.244) (-629.081) (-626.382) [-621.332] * (-628.436) (-632.571) [-626.938] (-630.267) -- 0:01:00
845000 -- (-627.408) (-635.650) (-620.227) [-624.582] * (-619.728) [-623.528] (-625.077) (-635.201) -- 0:01:00
Average standard deviation of split frequencies: 0.006671
846000 -- [-628.796] (-635.514) (-627.091) (-618.633) * (-629.723) [-619.577] (-623.835) (-632.226) -- 0:01:00
847000 -- (-625.906) (-624.070) [-629.075] (-631.497) * (-623.684) (-631.567) [-621.410] (-625.686) -- 0:00:59
848000 -- (-620.470) [-630.710] (-629.484) (-624.840) * [-618.554] (-636.279) (-619.497) (-626.506) -- 0:00:59
849000 -- (-634.368) [-619.531] (-624.424) (-623.133) * (-617.478) [-626.552] (-622.144) (-627.279) -- 0:00:58
850000 -- (-620.425) (-641.597) (-629.669) [-623.514] * (-634.475) [-620.586] (-616.702) (-639.847) -- 0:00:58
Average standard deviation of split frequencies: 0.006523
851000 -- (-625.404) (-632.652) (-622.536) [-617.317] * (-629.575) (-626.518) [-630.293] (-632.448) -- 0:00:58
852000 -- (-618.273) (-620.832) [-625.976] (-628.145) * (-631.067) (-623.196) (-617.871) [-624.670] -- 0:00:57
853000 -- (-620.620) (-632.699) [-617.700] (-644.532) * (-637.157) [-619.597] (-618.264) (-629.675) -- 0:00:57
854000 -- (-626.301) (-627.278) [-628.528] (-638.280) * (-626.290) [-620.900] (-633.102) (-637.412) -- 0:00:56
855000 -- (-633.728) (-631.352) (-620.110) [-623.989] * (-624.373) (-627.159) [-632.043] (-626.984) -- 0:00:56
Average standard deviation of split frequencies: 0.006546
856000 -- (-625.744) [-621.020] (-622.833) (-631.962) * (-625.556) [-625.336] (-626.850) (-629.395) -- 0:00:56
857000 -- (-642.555) [-619.986] (-638.901) (-634.279) * (-624.599) (-630.802) (-618.958) [-625.147] -- 0:00:55
858000 -- (-628.619) (-623.656) [-625.018] (-634.856) * [-618.473] (-640.867) (-622.058) (-625.737) -- 0:00:55
859000 -- (-626.564) (-633.796) (-633.055) [-627.845] * (-629.060) (-635.673) (-624.196) [-623.104] -- 0:00:54
860000 -- (-619.408) (-625.820) (-636.990) [-621.823] * (-631.327) (-626.533) (-627.165) [-619.496] -- 0:00:54
Average standard deviation of split frequencies: 0.006588
861000 -- [-620.367] (-640.801) (-631.278) (-640.402) * (-631.328) [-625.132] (-621.831) (-636.203) -- 0:00:54
862000 -- (-622.119) (-628.784) (-633.168) [-621.610] * (-623.924) (-636.705) [-616.002] (-629.966) -- 0:00:53
863000 -- [-621.199] (-627.438) (-624.441) (-622.359) * [-616.947] (-624.252) (-624.032) (-632.481) -- 0:00:53
864000 -- (-628.544) [-618.503] (-637.960) (-630.562) * [-626.653] (-632.832) (-627.519) (-625.402) -- 0:00:53
865000 -- (-632.462) (-624.471) [-617.858] (-628.636) * (-616.963) (-640.152) (-626.527) [-623.991] -- 0:00:52
Average standard deviation of split frequencies: 0.006610
866000 -- (-622.595) (-633.084) [-630.137] (-640.039) * (-625.189) [-620.996] (-619.566) (-619.484) -- 0:00:52
867000 -- (-628.402) (-636.226) (-619.692) [-618.784] * (-620.220) [-621.285] (-634.079) (-626.590) -- 0:00:51
868000 -- (-624.957) (-629.274) (-643.318) [-621.784] * [-620.704] (-619.727) (-634.105) (-640.539) -- 0:00:51
869000 -- (-636.965) (-628.445) (-618.177) [-621.867] * (-627.755) (-626.678) [-626.465] (-635.791) -- 0:00:51
870000 -- (-629.685) (-641.844) (-626.695) [-619.230] * (-627.354) [-624.059] (-620.904) (-630.332) -- 0:00:50
Average standard deviation of split frequencies: 0.006760
871000 -- (-618.218) [-630.165] (-638.649) (-618.278) * (-631.145) (-630.490) (-629.264) [-626.043] -- 0:00:50
872000 -- (-622.824) [-618.165] (-628.739) (-623.070) * (-623.488) (-619.989) (-619.381) [-618.763] -- 0:00:49
873000 -- [-620.228] (-621.956) (-629.607) (-630.767) * [-623.316] (-629.553) (-624.214) (-628.685) -- 0:00:49
874000 -- [-628.006] (-625.611) (-629.335) (-626.347) * [-630.895] (-631.449) (-622.253) (-630.166) -- 0:00:49
875000 -- (-623.793) [-619.566] (-624.289) (-628.057) * [-630.779] (-615.268) (-627.128) (-628.021) -- 0:00:48
Average standard deviation of split frequencies: 0.006381
876000 -- (-622.040) (-635.735) (-622.647) [-628.570] * [-625.127] (-620.195) (-634.220) (-640.683) -- 0:00:48
877000 -- (-630.189) (-617.619) [-624.442] (-630.497) * (-628.357) [-621.584] (-632.608) (-620.109) -- 0:00:47
878000 -- (-635.375) [-624.499] (-619.418) (-628.566) * (-626.761) (-624.003) (-626.996) [-618.808] -- 0:00:47
879000 -- [-618.998] (-627.879) (-638.532) (-621.092) * (-620.270) (-627.629) (-625.756) [-626.500] -- 0:00:47
880000 -- (-620.561) [-626.353] (-620.932) (-626.387) * [-620.633] (-619.264) (-624.922) (-624.305) -- 0:00:46
Average standard deviation of split frequencies: 0.006316
881000 -- [-625.491] (-638.382) (-621.267) (-625.068) * (-628.117) (-628.469) (-621.231) [-621.381] -- 0:00:46
882000 -- [-621.423] (-620.343) (-633.632) (-628.770) * (-626.915) [-620.572] (-630.856) (-646.229) -- 0:00:46
883000 -- (-627.091) (-616.832) (-622.616) [-617.853] * [-627.565] (-623.928) (-622.602) (-636.584) -- 0:00:45
884000 -- (-629.534) [-624.505] (-625.915) (-615.228) * (-627.635) [-623.507] (-623.150) (-628.858) -- 0:00:45
885000 -- [-616.968] (-627.444) (-621.473) (-631.611) * [-622.274] (-631.052) (-637.850) (-630.980) -- 0:00:44
Average standard deviation of split frequencies: 0.006461
886000 -- (-624.261) (-634.844) [-627.412] (-634.005) * (-627.200) (-629.636) [-616.676] (-626.915) -- 0:00:44
887000 -- [-619.331] (-640.143) (-631.664) (-626.688) * (-629.248) (-628.726) [-622.945] (-623.141) -- 0:00:44
888000 -- (-628.360) (-635.947) (-626.898) [-620.719] * (-629.066) [-627.463] (-621.649) (-643.784) -- 0:00:43
889000 -- [-628.490] (-630.250) (-617.914) (-628.445) * [-617.105] (-624.326) (-619.835) (-618.886) -- 0:00:43
890000 -- (-619.602) [-621.647] (-618.689) (-636.343) * (-622.533) (-623.166) [-621.290] (-619.809) -- 0:00:42
Average standard deviation of split frequencies: 0.006518
891000 -- [-619.088] (-625.190) (-623.694) (-632.596) * [-625.478] (-617.914) (-634.617) (-628.091) -- 0:00:42
892000 -- (-630.018) (-634.506) [-636.431] (-626.421) * (-630.379) [-616.105] (-622.087) (-627.007) -- 0:00:42
893000 -- (-627.009) (-624.166) [-625.682] (-626.979) * (-626.889) (-618.690) [-622.294] (-628.261) -- 0:00:41
894000 -- (-628.318) [-620.350] (-632.613) (-628.601) * (-620.145) [-617.352] (-630.296) (-631.145) -- 0:00:41
895000 -- (-625.990) (-624.580) (-630.912) [-627.983] * (-620.650) (-630.808) (-630.072) [-625.248] -- 0:00:40
Average standard deviation of split frequencies: 0.006494
896000 -- (-623.161) (-626.208) [-619.724] (-630.090) * (-634.516) (-626.492) (-619.720) [-622.843] -- 0:00:40
897000 -- (-620.559) (-624.065) [-627.815] (-625.146) * (-626.354) (-631.939) [-626.684] (-630.008) -- 0:00:40
898000 -- (-620.422) (-628.690) (-625.587) [-631.546] * (-637.853) (-632.159) [-636.324] (-624.618) -- 0:00:39
899000 -- [-616.671] (-636.195) (-624.979) (-629.446) * (-631.651) (-626.514) [-623.952] (-625.956) -- 0:00:39
900000 -- [-626.824] (-628.055) (-625.878) (-625.347) * (-623.233) (-633.289) [-625.214] (-631.948) -- 0:00:39
Average standard deviation of split frequencies: 0.006445
901000 -- (-630.489) (-624.211) [-621.016] (-635.456) * (-624.469) (-624.626) [-630.054] (-623.928) -- 0:00:38
902000 -- [-621.533] (-626.780) (-627.406) (-634.878) * (-620.741) (-633.653) (-624.232) [-626.949] -- 0:00:38
903000 -- [-614.697] (-631.328) (-631.759) (-625.887) * (-633.635) (-623.992) [-618.106] (-623.196) -- 0:00:37
904000 -- (-627.445) (-627.562) (-626.428) [-623.443] * (-628.928) (-628.739) (-629.635) [-622.557] -- 0:00:37
905000 -- (-618.957) (-634.642) (-629.769) [-620.917] * (-634.242) (-627.328) (-619.817) [-626.973] -- 0:00:37
Average standard deviation of split frequencies: 0.006938
906000 -- (-620.427) (-625.508) (-617.661) [-630.223] * (-621.347) (-634.812) (-627.712) [-629.301] -- 0:00:36
907000 -- (-633.519) (-626.331) [-620.588] (-634.793) * (-623.898) (-628.175) (-625.305) [-617.473] -- 0:00:36
908000 -- (-625.863) (-621.529) [-624.691] (-630.385) * (-620.633) (-633.195) (-619.586) [-621.059] -- 0:00:35
909000 -- (-624.283) (-631.456) (-620.359) [-624.946] * (-631.031) [-618.895] (-628.386) (-615.283) -- 0:00:35
910000 -- (-623.645) (-635.194) (-617.509) [-619.989] * (-635.024) (-622.597) [-634.842] (-624.197) -- 0:00:35
Average standard deviation of split frequencies: 0.006537
911000 -- (-621.352) (-624.315) [-616.980] (-630.307) * (-624.064) (-624.847) (-625.675) [-614.612] -- 0:00:34
912000 -- (-630.451) [-621.129] (-628.079) (-628.211) * (-637.795) (-626.914) [-622.372] (-627.260) -- 0:00:34
913000 -- (-631.620) [-630.273] (-619.671) (-622.112) * (-648.559) [-618.093] (-625.484) (-636.786) -- 0:00:33
914000 -- (-629.561) [-626.993] (-638.634) (-634.106) * (-633.830) (-615.797) [-629.913] (-625.205) -- 0:00:33
915000 -- [-624.249] (-625.826) (-638.784) (-626.600) * (-627.059) (-623.454) [-624.338] (-630.318) -- 0:00:33
Average standard deviation of split frequencies: 0.006293
916000 -- (-637.699) (-628.784) [-625.217] (-632.472) * (-631.376) (-621.992) [-620.125] (-630.436) -- 0:00:32
917000 -- (-623.855) [-624.785] (-626.324) (-627.161) * (-624.321) [-624.337] (-627.533) (-629.845) -- 0:00:32
918000 -- (-636.872) (-639.877) (-632.944) [-625.777] * (-628.569) (-628.654) (-631.372) [-625.377] -- 0:00:31
919000 -- (-638.346) [-619.740] (-633.307) (-626.585) * (-622.340) (-639.722) [-616.962] (-626.085) -- 0:00:31
920000 -- (-630.375) [-625.910] (-628.958) (-639.726) * [-623.242] (-636.550) (-630.461) (-620.818) -- 0:00:31
Average standard deviation of split frequencies: 0.006481
921000 -- (-628.474) (-637.063) [-628.138] (-624.731) * (-619.241) (-648.174) (-627.959) [-620.809] -- 0:00:30
922000 -- (-631.013) [-624.337] (-625.568) (-626.939) * (-632.729) (-640.284) (-629.515) [-629.696] -- 0:00:30
923000 -- (-626.436) (-651.086) (-619.632) [-626.953] * [-623.401] (-630.371) (-642.659) (-625.860) -- 0:00:30
924000 -- (-621.829) (-633.915) (-625.615) [-619.866] * [-621.354] (-639.615) (-627.295) (-625.196) -- 0:00:29
925000 -- [-629.329] (-634.026) (-626.870) (-628.675) * (-634.761) (-631.001) [-621.166] (-629.353) -- 0:00:29
Average standard deviation of split frequencies: 0.006531
926000 -- [-622.151] (-621.381) (-625.566) (-639.717) * (-636.646) (-634.311) (-627.521) [-617.044] -- 0:00:28
927000 -- (-626.507) [-623.965] (-630.344) (-629.427) * (-619.676) (-631.922) (-618.156) [-622.277] -- 0:00:28
928000 -- (-619.268) (-636.649) [-618.327] (-624.458) * [-621.581] (-623.516) (-615.408) (-631.106) -- 0:00:28
929000 -- [-626.146] (-619.691) (-627.247) (-624.523) * (-629.141) [-620.319] (-629.095) (-622.052) -- 0:00:27
930000 -- (-634.340) (-622.320) (-629.553) [-620.931] * [-623.035] (-618.136) (-625.442) (-620.458) -- 0:00:27
Average standard deviation of split frequencies: 0.006585
931000 -- (-638.456) (-624.642) (-629.913) [-621.615] * [-620.602] (-623.953) (-631.981) (-627.969) -- 0:00:26
932000 -- (-629.217) [-620.273] (-643.162) (-624.288) * (-619.781) (-624.393) [-623.684] (-639.168) -- 0:00:26
933000 -- (-635.403) [-627.388] (-629.512) (-630.686) * (-634.265) (-634.423) [-624.293] (-628.346) -- 0:00:26
934000 -- (-622.807) (-637.139) [-622.748] (-635.953) * (-616.722) (-642.232) [-626.029] (-625.970) -- 0:00:25
935000 -- [-626.231] (-624.890) (-635.660) (-629.343) * (-623.203) (-625.990) [-616.194] (-630.669) -- 0:00:25
Average standard deviation of split frequencies: 0.007037
936000 -- (-635.072) [-628.308] (-630.763) (-639.885) * (-633.355) (-628.234) (-624.013) [-622.903] -- 0:00:24
937000 -- (-623.447) (-637.260) (-622.648) [-622.341] * (-634.819) [-620.211] (-626.788) (-630.027) -- 0:00:24
938000 -- (-630.043) [-629.840] (-626.854) (-634.187) * (-628.918) [-617.632] (-631.691) (-619.432) -- 0:00:24
939000 -- (-628.090) (-640.615) (-620.504) [-625.656] * (-622.418) (-636.416) (-624.832) [-621.580] -- 0:00:23
940000 -- (-629.101) (-643.695) (-625.880) [-616.778] * (-625.113) [-617.211] (-623.312) (-623.231) -- 0:00:23
Average standard deviation of split frequencies: 0.006329
941000 -- (-620.878) (-630.517) [-629.337] (-622.854) * (-630.059) (-629.930) (-624.241) [-621.729] -- 0:00:23
942000 -- [-630.313] (-626.853) (-641.864) (-619.617) * (-624.820) [-620.602] (-626.743) (-621.221) -- 0:00:22
943000 -- (-629.587) (-620.706) (-628.077) [-620.150] * [-617.809] (-642.141) (-632.130) (-630.220) -- 0:00:22
944000 -- (-627.610) (-623.354) (-630.475) [-627.408] * (-631.629) (-628.924) [-619.514] (-625.350) -- 0:00:21
945000 -- (-625.631) (-624.088) (-623.043) [-626.252] * [-624.587] (-620.650) (-631.399) (-628.249) -- 0:00:21
Average standard deviation of split frequencies: 0.006393
946000 -- (-633.843) [-622.325] (-624.499) (-621.649) * (-626.050) (-630.064) [-619.654] (-626.641) -- 0:00:21
947000 -- (-638.127) [-636.803] (-625.252) (-627.430) * (-634.427) (-631.817) [-618.679] (-621.894) -- 0:00:20
948000 -- (-643.078) (-621.351) [-628.053] (-631.889) * (-624.458) (-624.241) (-625.036) [-626.084] -- 0:00:20
949000 -- (-629.598) (-630.687) (-621.286) [-622.789] * (-632.803) [-621.977] (-629.256) (-630.376) -- 0:00:19
950000 -- [-616.831] (-620.670) (-626.675) (-625.066) * (-636.815) [-616.894] (-627.946) (-618.271) -- 0:00:19
Average standard deviation of split frequencies: 0.006361
951000 -- (-632.913) (-630.949) (-625.753) [-621.085] * (-625.890) [-619.376] (-630.415) (-621.826) -- 0:00:19
952000 -- (-632.619) [-629.182] (-628.818) (-629.674) * (-631.024) (-647.475) (-624.445) [-618.236] -- 0:00:18
953000 -- (-629.838) [-621.303] (-627.594) (-624.037) * (-632.092) [-619.112] (-632.936) (-614.094) -- 0:00:18
954000 -- (-620.289) (-645.157) [-621.139] (-625.051) * [-617.041] (-623.669) (-627.573) (-630.411) -- 0:00:17
955000 -- [-628.249] (-614.917) (-622.700) (-625.280) * (-621.994) (-622.613) [-629.866] (-622.670) -- 0:00:17
Average standard deviation of split frequencies: 0.006467
956000 -- (-627.377) [-618.161] (-624.029) (-628.936) * (-624.435) [-631.018] (-630.416) (-619.338) -- 0:00:17
957000 -- [-630.045] (-622.758) (-624.547) (-621.901) * (-632.308) [-624.611] (-621.916) (-628.172) -- 0:00:16
958000 -- (-630.194) (-624.874) (-617.228) [-616.912] * (-634.608) [-625.503] (-619.021) (-622.735) -- 0:00:16
959000 -- (-618.153) (-629.226) [-621.192] (-626.759) * (-629.346) (-628.128) (-635.867) [-621.688] -- 0:00:15
960000 -- (-629.264) (-627.061) [-623.730] (-628.639) * (-614.288) [-629.403] (-626.878) (-618.034) -- 0:00:15
Average standard deviation of split frequencies: 0.006463
961000 -- (-631.572) [-625.998] (-622.771) (-623.565) * (-627.038) [-621.819] (-617.038) (-621.720) -- 0:00:15
962000 -- (-628.523) [-614.327] (-621.333) (-621.876) * (-623.224) (-622.159) [-616.491] (-627.403) -- 0:00:14
963000 -- (-628.563) (-633.265) [-623.158] (-628.504) * (-620.168) (-627.627) (-621.624) [-617.320] -- 0:00:14
964000 -- (-622.236) [-618.115] (-625.760) (-632.524) * (-623.337) (-630.591) [-623.033] (-633.130) -- 0:00:14
965000 -- (-627.608) (-634.154) [-624.419] (-627.434) * (-631.140) [-626.811] (-619.340) (-621.943) -- 0:00:13
Average standard deviation of split frequencies: 0.006539
966000 -- (-636.166) [-633.437] (-627.372) (-625.905) * (-627.754) (-622.506) [-619.414] (-629.043) -- 0:00:13
967000 -- (-634.673) (-627.693) [-632.625] (-624.850) * (-635.197) (-628.393) (-626.925) [-620.408] -- 0:00:12
968000 -- (-624.437) (-626.898) [-621.114] (-619.242) * (-635.683) (-628.678) (-621.734) [-622.120] -- 0:00:12
969000 -- (-638.780) [-627.757] (-631.375) (-622.576) * (-626.160) (-639.425) [-628.332] (-635.084) -- 0:00:12
970000 -- (-634.789) (-634.265) (-630.839) [-623.693] * (-621.507) (-628.069) [-620.434] (-621.029) -- 0:00:11
Average standard deviation of split frequencies: 0.006535
971000 -- (-630.729) (-622.796) (-616.087) [-624.122] * [-627.273] (-636.165) (-638.383) (-636.159) -- 0:00:11
972000 -- (-638.861) (-626.948) [-628.589] (-633.491) * (-631.393) [-625.596] (-630.130) (-618.968) -- 0:00:10
973000 -- (-632.887) (-627.062) (-623.502) [-625.879] * (-635.553) (-635.278) [-627.601] (-623.667) -- 0:00:10
974000 -- (-619.337) [-621.101] (-624.944) (-626.205) * [-617.829] (-614.864) (-631.068) (-623.950) -- 0:00:10
975000 -- (-637.390) (-631.294) (-647.311) [-613.400] * (-623.072) [-619.516] (-628.421) (-630.311) -- 0:00:09
Average standard deviation of split frequencies: 0.006431
976000 -- [-615.500] (-624.145) (-628.138) (-624.259) * [-627.528] (-620.491) (-632.093) (-626.704) -- 0:00:09
977000 -- [-613.478] (-631.212) (-630.219) (-622.804) * [-632.547] (-631.241) (-630.731) (-625.485) -- 0:00:08
978000 -- [-617.156] (-627.117) (-631.788) (-625.118) * [-634.341] (-633.428) (-624.476) (-625.473) -- 0:00:08
979000 -- (-634.156) (-620.796) (-631.803) [-623.579] * (-613.032) [-619.055] (-622.442) (-629.334) -- 0:00:08
980000 -- (-628.097) [-620.339] (-623.690) (-624.757) * (-627.896) (-630.691) (-629.040) [-617.730] -- 0:00:07
Average standard deviation of split frequencies: 0.006414
981000 -- (-632.572) (-626.618) (-627.149) [-617.683] * (-626.023) [-621.739] (-622.786) (-624.483) -- 0:00:07
982000 -- (-631.906) (-626.560) (-629.734) [-631.903] * (-631.250) [-622.410] (-628.807) (-635.528) -- 0:00:07
983000 -- (-626.873) (-627.483) [-626.809] (-638.881) * (-624.861) (-626.134) (-625.931) [-621.026] -- 0:00:06
984000 -- [-620.132] (-624.812) (-641.776) (-624.196) * (-633.403) (-622.533) [-623.377] (-626.238) -- 0:00:06
985000 -- (-627.779) (-627.608) [-614.699] (-633.483) * (-616.410) (-625.662) (-631.504) [-620.627] -- 0:00:05
Average standard deviation of split frequencies: 0.006325
986000 -- (-631.091) (-619.883) [-619.882] (-627.790) * (-616.941) (-628.225) (-622.501) [-623.519] -- 0:00:05
987000 -- (-631.033) [-629.969] (-619.696) (-621.728) * (-634.399) [-622.589] (-618.552) (-619.082) -- 0:00:05
988000 -- (-616.228) [-626.679] (-625.789) (-629.678) * [-626.485] (-627.554) (-626.091) (-626.142) -- 0:00:04
989000 -- (-629.412) (-633.571) (-635.420) [-628.789] * [-618.436] (-628.997) (-633.008) (-627.915) -- 0:00:04
990000 -- (-632.794) (-624.565) [-621.986] (-624.197) * [-620.967] (-632.757) (-629.945) (-619.986) -- 0:00:03
Average standard deviation of split frequencies: 0.006458
991000 -- (-624.586) (-624.825) [-626.330] (-629.685) * [-619.186] (-627.229) (-627.395) (-632.250) -- 0:00:03
992000 -- (-622.523) (-625.566) (-635.359) [-627.821] * [-625.274] (-633.307) (-630.734) (-620.484) -- 0:00:03
993000 -- (-621.860) [-623.225] (-625.811) (-631.228) * (-630.645) (-629.133) [-622.466] (-630.301) -- 0:00:02
994000 -- [-623.193] (-636.348) (-623.295) (-641.905) * (-624.611) (-636.101) [-622.084] (-620.856) -- 0:00:02
995000 -- (-622.654) (-624.376) [-629.383] (-630.252) * (-624.693) [-621.780] (-635.168) (-626.290) -- 0:00:01
Average standard deviation of split frequencies: 0.006518
996000 -- (-618.857) (-633.465) [-617.939] (-642.295) * [-628.359] (-629.655) (-633.473) (-624.934) -- 0:00:01
997000 -- (-626.856) (-629.693) [-626.821] (-626.151) * [-622.607] (-619.789) (-632.520) (-626.546) -- 0:00:01
998000 -- (-622.775) (-622.175) [-622.317] (-630.069) * [-616.560] (-630.356) (-625.928) (-639.398) -- 0:00:00
999000 -- (-627.122) [-621.357] (-628.811) (-626.439) * (-622.526) (-622.610) (-635.039) [-622.261] -- 0:00:00
1000000 -- (-617.953) [-626.209] (-629.519) (-636.161) * (-625.082) [-628.998] (-624.841) (-631.637) -- 0:00:00
Average standard deviation of split frequencies: 0.006138
Analysis completed in 6 mins 31 seconds
Analysis used 390.89 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -609.67
Likelihood of best state for "cold" chain of run 2 was -609.82
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
66.2 % ( 55 %) Dirichlet(Revmat{all})
79.6 % ( 68 %) Slider(Revmat{all})
40.6 % ( 33 %) Dirichlet(Pi{all})
39.7 % ( 27 %) Slider(Pi{all})
73.9 % ( 57 %) Multiplier(Alpha{1,2})
71.5 % ( 51 %) Multiplier(Alpha{3})
89.2 % ( 78 %) Slider(Pinvar{all})
43.7 % ( 41 %) ExtSPR(Tau{all},V{all})
31.2 % ( 31 %) ExtTBR(Tau{all},V{all})
47.0 % ( 40 %) NNI(Tau{all},V{all})
37.9 % ( 32 %) ParsSPR(Tau{all},V{all})
27.4 % ( 29 %) Multiplier(V{all})
67.5 % ( 68 %) Nodeslider(V{all})
26.3 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
66.4 % ( 56 %) Dirichlet(Revmat{all})
80.3 % ( 79 %) Slider(Revmat{all})
40.3 % ( 25 %) Dirichlet(Pi{all})
38.7 % ( 31 %) Slider(Pi{all})
73.1 % ( 56 %) Multiplier(Alpha{1,2})
71.1 % ( 48 %) Multiplier(Alpha{3})
88.7 % ( 78 %) Slider(Pinvar{all})
43.5 % ( 39 %) ExtSPR(Tau{all},V{all})
31.4 % ( 37 %) ExtTBR(Tau{all},V{all})
46.9 % ( 43 %) NNI(Tau{all},V{all})
38.0 % ( 34 %) ParsSPR(Tau{all},V{all})
27.4 % ( 29 %) Multiplier(V{all})
67.6 % ( 64 %) Nodeslider(V{all})
26.2 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.62 0.34 0.17
2 | 166858 0.65 0.37
3 | 166533 166669 0.66
4 | 166314 167112 166514
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.63 0.35 0.17
2 | 166858 0.65 0.37
3 | 166430 167039 0.66
4 | 167086 166179 166408
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -621.31
| 1 1 2 222 1 |
| 1 |
| 2 1 22 21 12 1 2 1 2 |
| 2 221 2 2 2 * 2 1 2 2 1 2|
|1 2 2 1 2 1 2 2 2 1 1 1 |
| 1 1 2 *1 12 1 21 122 1 |
| 1 11 2 112 12 1 2 2*2 22 |
| 2 1 2 1 1 1 1 1 2 |
| 2 1 2 1 2 2 1 * 1 1|
| 1 2 1 2 1 2 12 2 2 |
|2 1 1 2 1 1 |
| 1 1 1 |
| 2 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -625.86
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -617.23 -634.03
2 -617.10 -634.94
--------------------------------------
TOTAL -617.16 -634.58
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.178525 0.001083 0.118449 0.245673 0.175180 1069.38 1285.19 1.000
r(A<->C){all} 0.079549 0.002244 0.005966 0.172616 0.071294 445.81 460.78 1.000
r(A<->G){all} 0.227788 0.004510 0.100509 0.357308 0.222740 523.58 560.73 1.000
r(A<->T){all} 0.063576 0.000874 0.017655 0.122787 0.058889 779.14 808.69 1.000
r(C<->G){all} 0.062269 0.001921 0.000218 0.151444 0.052603 627.76 634.85 1.003
r(C<->T){all} 0.441494 0.006141 0.296266 0.598963 0.442575 433.96 625.34 1.001
r(G<->T){all} 0.125323 0.001945 0.044063 0.214347 0.121603 783.05 819.62 1.001
pi(A){all} 0.261108 0.000659 0.211589 0.310465 0.260066 1085.09 1125.04 1.000
pi(C){all} 0.155686 0.000421 0.118434 0.198902 0.155454 1025.41 1141.73 1.000
pi(G){all} 0.209133 0.000525 0.164448 0.253978 0.208606 1070.75 1168.28 1.000
pi(T){all} 0.374072 0.000751 0.320422 0.427242 0.373577 1176.78 1209.52 1.000
alpha{1,2} 1.183508 0.925405 0.001747 3.072595 0.912898 1243.53 1254.03 1.000
alpha{3} 1.353413 1.133575 0.011997 3.437711 1.069774 906.21 1203.60 1.000
pinvar{all} 0.244839 0.025675 0.000026 0.531946 0.227621 1123.78 1127.93 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C10
3 -- C11
4 -- C12
5 -- C13
6 -- C14
7 -- C15
8 -- C16
9 -- C17
10 -- C2
11 -- C3
12 -- C4
13 -- C5
14 -- C6
15 -- C7
16 -- C8
17 -- C9
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
-----------------------
1 -- .****************
2 -- .*...............
3 -- ..*..............
4 -- ...*.............
5 -- ....*............
6 -- .....*...........
7 -- ......*..........
8 -- .......*.........
9 -- ........*........
10 -- .........*.......
11 -- ..........*......
12 -- ...........*.....
13 -- ............*....
14 -- .............*...
15 -- ..............*..
16 -- ...............*.
17 -- ................*
18 -- ....*.***.*.*..*.
19 -- .*.*.........*...
20 -- .*.**************
21 -- ....*.***.*.*....
22 -- .....*...*.......
23 -- ....*.***.***..*.
24 -- ....*********..*.
25 -- ....*********.***
26 -- ...*.........*...
27 -- .*.*.............
28 -- .*...........*...
29 -- ....*********.**.
30 -- ..............*.*
31 -- ....*********..**
32 -- ....*.....*......
33 -- ......**.........
34 -- ......*.....*....
35 -- .......*..*......
36 -- ....*.***.*......
37 -- ....*.**..*.*....
38 -- ....*..**.*.*....
39 -- ......***.*.*....
40 -- ......*.*........
41 -- .......**........
42 -- .......*....*....
43 -- ....*..*.........
44 -- ........*.*......
45 -- ..........*.*....
46 -- ....*.*.*.*.*....
47 -- ....*.......*....
48 -- ......*...*......
49 -- ....*.*..........
50 -- ....*...*........
51 -- ....*.***...*....
52 -- ........*...*....
-----------------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
18 3002 1.000000 0.000000 1.000000 1.000000 2
19 3002 1.000000 0.000000 1.000000 1.000000 2
20 2997 0.998334 0.001413 0.997335 0.999334 2
21 2997 0.998334 0.001413 0.997335 0.999334 2
22 2995 0.997668 0.000471 0.997335 0.998001 2
23 2838 0.945370 0.016959 0.933378 0.957362 2
24 2633 0.877082 0.001413 0.876083 0.878081 2
25 1985 0.661226 0.008009 0.655563 0.666889 2
26 1033 0.344104 0.018373 0.331113 0.357095 2
27 987 0.328781 0.004240 0.325783 0.331779 2
28 982 0.327115 0.014133 0.317122 0.337109 2
29 823 0.274151 0.001413 0.273151 0.275150 2
30 794 0.264490 0.018844 0.251166 0.277815 2
31 782 0.260493 0.003769 0.257828 0.263158 2
32 358 0.119254 0.006595 0.114590 0.123917 2
33 355 0.118254 0.004240 0.115256 0.121252 2
34 353 0.117588 0.000471 0.117255 0.117921 2
35 350 0.116589 0.009422 0.109927 0.123251 2
36 350 0.116589 0.015075 0.105929 0.127249 2
37 347 0.115590 0.001413 0.114590 0.116589 2
38 343 0.114257 0.005182 0.110593 0.117921 2
39 341 0.113591 0.007066 0.108594 0.118588 2
40 336 0.111925 0.004711 0.108594 0.115256 2
41 335 0.111592 0.012719 0.102598 0.120586 2
42 334 0.111259 0.010364 0.103931 0.118588 2
43 333 0.110926 0.006124 0.106596 0.115256 2
44 333 0.110926 0.002355 0.109260 0.112592 2
45 327 0.108927 0.002355 0.107262 0.110593 2
46 326 0.108594 0.003769 0.105929 0.111259 2
47 324 0.107928 0.001884 0.106596 0.109260 2
48 323 0.107595 0.004240 0.104597 0.110593 2
49 321 0.106929 0.005182 0.103264 0.110593 2
50 319 0.106262 0.014604 0.095936 0.116589 2
51 317 0.105596 0.006124 0.101266 0.109927 2
52 315 0.104930 0.000471 0.104597 0.105263 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.002270 0.000005 0.000003 0.006859 0.001547 1.000 2
length{all}[2] 0.002302 0.000006 0.000002 0.007394 0.001522 1.001 2
length{all}[3] 0.002324 0.000006 0.000000 0.006979 0.001592 1.001 2
length{all}[4] 0.002326 0.000006 0.000002 0.007321 0.001524 1.000 2
length{all}[5] 0.002299 0.000006 0.000000 0.006926 0.001600 1.000 2
length{all}[6] 0.011518 0.000033 0.002099 0.023027 0.010666 1.000 2
length{all}[7] 0.002343 0.000006 0.000000 0.007054 0.001629 1.000 2
length{all}[8] 0.002324 0.000006 0.000000 0.007166 0.001561 1.000 2
length{all}[9] 0.002270 0.000005 0.000000 0.006999 0.001566 1.000 2
length{all}[10] 0.023514 0.000077 0.008539 0.040602 0.022462 1.000 2
length{all}[11] 0.002217 0.000005 0.000001 0.006685 0.001531 1.000 2
length{all}[12] 0.004888 0.000013 0.000076 0.011814 0.004065 1.000 2
length{all}[13] 0.002282 0.000005 0.000000 0.006920 0.001567 1.000 2
length{all}[14] 0.002289 0.000006 0.000001 0.006806 0.001500 1.000 2
length{all}[15] 0.007064 0.000018 0.000551 0.015183 0.006172 1.000 2
length{all}[16] 0.002344 0.000006 0.000001 0.007292 0.001552 1.000 2
length{all}[17] 0.026729 0.000082 0.009795 0.043864 0.025616 1.000 2
length{all}[18] 0.011752 0.000032 0.002776 0.022797 0.010844 1.000 2
length{all}[19] 0.012840 0.000037 0.002969 0.025000 0.011839 1.002 2
length{all}[20] 0.007752 0.000022 0.000533 0.016836 0.006815 1.000 2
length{all}[21] 0.007113 0.000019 0.000575 0.015323 0.006357 1.000 2
length{all}[22] 0.010030 0.000029 0.001413 0.020847 0.009084 1.000 2
length{all}[23] 0.005131 0.000015 0.000198 0.012363 0.004198 1.000 2
length{all}[24] 0.004787 0.000012 0.000013 0.011395 0.003979 1.001 2
length{all}[25] 0.004601 0.000013 0.000025 0.011399 0.003676 1.000 2
length{all}[26] 0.002422 0.000007 0.000002 0.007590 0.001578 1.002 2
length{all}[27] 0.002356 0.000006 0.000002 0.006995 0.001592 0.999 2
length{all}[28] 0.002365 0.000006 0.000000 0.007248 0.001574 0.999 2
length{all}[29] 0.002659 0.000007 0.000004 0.007814 0.001812 1.000 2
length{all}[30] 0.002541 0.000007 0.000001 0.007350 0.001772 1.000 2
length{all}[31] 0.002449 0.000007 0.000001 0.007725 0.001603 1.000 2
length{all}[32] 0.002456 0.000006 0.000003 0.006882 0.001706 1.006 2
length{all}[33] 0.002413 0.000006 0.000011 0.007277 0.001718 0.998 2
length{all}[34] 0.002203 0.000005 0.000008 0.006276 0.001530 0.997 2
length{all}[35] 0.002294 0.000005 0.000003 0.006795 0.001666 0.997 2
length{all}[36] 0.002426 0.000006 0.000037 0.007355 0.001760 0.998 2
length{all}[37] 0.002477 0.000006 0.000006 0.007483 0.001710 0.997 2
length{all}[38] 0.002335 0.000004 0.000007 0.006948 0.001716 1.000 2
length{all}[39] 0.002289 0.000006 0.000008 0.006442 0.001490 0.998 2
length{all}[40] 0.002288 0.000005 0.000000 0.006568 0.001600 1.003 2
length{all}[41] 0.002470 0.000006 0.000025 0.007979 0.001693 1.004 2
length{all}[42] 0.002470 0.000006 0.000001 0.007366 0.001826 1.002 2
length{all}[43] 0.002528 0.000006 0.000012 0.007152 0.001933 0.997 2
length{all}[44] 0.002401 0.000006 0.000004 0.007057 0.001748 0.997 2
length{all}[45] 0.002480 0.000005 0.000008 0.006783 0.001808 0.999 2
length{all}[46] 0.002478 0.000006 0.000001 0.006440 0.001799 1.001 2
length{all}[47] 0.002083 0.000005 0.000001 0.007215 0.001445 1.007 2
length{all}[48] 0.002651 0.000009 0.000009 0.008022 0.001765 1.005 2
length{all}[49] 0.002327 0.000006 0.000005 0.007132 0.001570 1.014 2
length{all}[50] 0.002335 0.000006 0.000000 0.007069 0.001583 0.998 2
length{all}[51] 0.002211 0.000005 0.000003 0.006760 0.001573 1.007 2
length{all}[52] 0.002254 0.000006 0.000005 0.006155 0.001513 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006138
Maximum standard deviation of split frequencies = 0.018844
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.014
Clade credibility values:
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C11 (3)
|
| /---------- C10 (2)
| |
| /------------------------100-----------------------+---------- C12 (4)
| | |
| | \---------- C6 (14)
+ |
| | /---------- C13 (5)
| | |
| | |---------- C15 (7)
| | |
| | |---------- C16 (8)
| | /---100---+
| | | |---------- C17 (9)
| | | |
\---100---+ | |---------- C3 (11)
| /---100---+ |
| | | \---------- C5 (13)
| | |
| /----95----+ \-------------------- C8 (16)
| | |
| | \------------------------------ C4 (12)
| /----88---+
| | | /---------- C14 (6)
| | \--------------100-------------+
| | \---------- C2 (10)
\----66---+
|--------------------------------------------------- C7 (15)
|
\--------------------------------------------------- C9 (17)
Phylogram (based on average branch lengths):
/-- C1 (1)
|
|-- C11 (3)
|
| /-- C10 (2)
| |
| /-----------------+-- C12 (4)
| | |
| | \-- C6 (14)
+ |
| | /--- C13 (5)
| | |
| | |--- C15 (7)
| | |
| | |--- C16 (8)
| | /--------+
| | | |--- C17 (9)
| | | |
\----------+ | |--- C3 (11)
| /----------------+ |
| | | \--- C5 (13)
| | |
| /------+ \-- C8 (16)
| | |
| | \------ C4 (12)
| /-----+
| | | /----------------- C14 (6)
| | \-------------+
| | \----------------------------------- C2 (10)
\----+
|---------- C7 (15)
|
\---------------------------------------- C9 (17)
|--------------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (2816 trees sampled):
50 % credible set contains 1315 trees
90 % credible set contains 2516 trees
95 % credible set contains 2666 trees
99 % credible set contains 2786 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
Running FUBAR...
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\
***************** TYPES OF STANDARD ANALYSES *****************
(1) Selection Analyses
(2) Evolutionary Hypothesis Testing
(3) Relative evolutionary rate inference
(4) Coevolutionary analysis
(5) Basic Analyses
(6) Codon Selection Analyses
(7) Compartmentalization
(8) Data File Tools
(9) Miscellaneous
(10) Model Comparison
(11) Kernel Analysis Tools
(12) Molecular Clock
(13) Phylogeny Reconstruction
(14) Positive Selection
(15) Recombination
(16) Selection/Recombination
(17) Relative Rate
(18) Relative Ratio
(19) Substitution Rates
Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' *****************
(1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution).
(2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood).
(3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting).
(4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection).
(5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification).
(6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood).
(7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation).
Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types):
Analysis Description
--------------------
Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a
coding sequence alignment to determine whether some sites have been
subject to pervasive purifying or diversifying selection. v2.1
introduces two more methods for estimating the posterior distribution of
grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation
Bayes approximation (fastest). Please note that a FUBAR analysis
generates a cache and a results JSON file in the same directory as
directory as the original alignment. HyPhy needs to have write
privileges to this directory. For example if the original file is in
/home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there
will also exist FUBAR-generated files
/home/sergei/FUBAR/data/pol.nex.FUBAR.json,
/home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide
checkpointing so that a partially completed analysis can be restarted.
- __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree
(one per partition)
- __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring
selection (2013), Mol Biol Evol. 30(5):1196-205
- __Written by__: Sergei L Kosakovsky Pond
- __Contact Information__: spond@temple.edu
- __Analysis Version__: 2.1
####Choose Genetic Code
1. [**Universal**] Universal code. (Genebank transl_table=1).
2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2).
3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3).
4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4).
5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5).
6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6).
7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9).
8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10).
9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12).
10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13).
11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14).
12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15).
13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16).
14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21).
15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22).
16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23).
17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24).
18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25).
19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26).
>Please choose an option (or press q to cancel selection):
>Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`)
>A tree was found in the data file: `(C1,C11,((C10,C12,C6),(((((C13,C15,C16,C17,C3,C5),C8),C4),(C14,C2)),C7,C9)))`
>Would you like to use it (y/n)?
>Loaded a multiple sequence alignment with **17** sequences, **88** codons, and **1** partitions from `/data//pss_subsets/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result/original_alignment/fubar/results/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result.1/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result.1.fna`
> FUBAR will write cache and result files to _/data//pss_subsets/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result/original_alignment/fubar/results/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result.1/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result/original_alignment/fubar/results/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result.1/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result.1.fna.FUBAR.json_, respectively
> Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer):
####Posterior estimation method
1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation)
2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed)
3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default)
>Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5):
### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model
* Log(L) = -601.28, AIC-c = 1269.07 (33 estimated parameters)
* Tree length (expected substitutions/site) for partition 1 : 0.169
### Computing the phylogenetic likelihood function on the grid
* Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid
* Best scaling achieved for
* synonymous rate = 1.227
* non-synonymous rate = 0.714
* Computing conditional site likelihoods on a 20 x 20 rate grid
### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights
* Using the following settings
* Dirichlet alpha : 0.5
### Tabulating site-level results
| Codon | Partition | alpha | beta |Posterior prob for positive selection|
|:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:|
| 58 | 1 | 1.049 | 9.055 | Pos. posterior = 0.9055 |
----
## FUBAR inferred 1 sites subject to diversifying positive selection at posterior probability >= 0.9
Of these, 0.09 are expected to be false positives (95% confidence interval of 0-1 )
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=17, Len=88
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus MFNLFLIDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus MFNLFLTDTVWYVGQIIFIFAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
JHM_WU_E_AFO11520_1_1947_08_14_USA_Unknown_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
MHV_1_NA_ACN89738_1_NA_USA_Mouse_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
JHM_WU_Dns2_E_AFO11510_1_1947_08_14_USA_Unknown_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
MHV_2_NA_AAF19391_1_NA_NA_Unknown_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
MHV_3_NA_ACN89744_1_NA_USA_Mouse_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
MHV_JHM_IA_NA_ACN89766_1_NA_USA_Mouse_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
MHV_MI_E_BAJ04699_1_1994_Australia_Mouse_Murine_coronavirus MFNVLSTDTVWYVGQIIFIVAVCLMVTIVVVAFLASIKLCIQLCGLCNTL
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus0 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus1 MFNLFLIDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus2 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus3 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus4 MFNLFLTDTVWYVGQIIFIVAVCLMVTITVVAFLASIKLCIQLCGLCNTL
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus5 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus6 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus7 MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL
***:: ************.******** ********* ***********
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus VLSPSIYLYDRSKQLYKYYNEEMRMPLLEVDDI-----
JHM_WU_E_AFO11520_1_1947_08_14_USA_Unknown_Murine_coronavirus LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
MHV_1_NA_ACN89738_1_NA_USA_Mouse_Murine_coronavirus LLSPSIYVYNGSKQLYKYYNEEVRPPPLEVDDKIIQTL
JHM_WU_Dns2_E_AFO11510_1_1947_08_14_USA_Unknown_Murine_coronavirus LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
MHV_2_NA_AAF19391_1_NA_NA_Unknown_Murine_coronavirus LLSPSICVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
MHV_3_NA_ACN89744_1_NA_USA_Mouse_Murine_coronavirus LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
MHV_JHM_IA_NA_ACN89766_1_NA_USA_Mouse_Murine_coronavirus LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
MHV_MI_E_BAJ04699_1_1994_Australia_Mouse_Murine_coronavirus LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus0 LLSPSICVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus1 LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus2 LLSPSICVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus3 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus4 VLSPSIYLYDRSKQLYKYYNEEVRPPPLEVDDIIIQTL
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus5 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus6 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus7 LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
:***** :*: ***********:* * *****
>8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus ATGTTTAATTTATTCCTTATAGACACAGTATGGTACGTGGGGCAGATTATTTTTATAGTCGCAGTGTGTTTGATGGTCACCATAATTGTGGTTGCCTTCCTTGCGTCTATTAAACTTTGTATTCAACTTTGCGGTTTGTGTAATACTTTGTTGCTGTCTCCTTCTATTTATGTGTATAATAGGAGTAAGCAGCTTTATAAGTATTATAATGAAGAAGTGAGACCGCCCCCGTTAGAGGTGGATGATATAATAATCCAAACATTA >A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus ATGTTTAATTTATTCCTTACAGACACAGTATGGTATGTGGGGCAGATTATTTTTATATTCGCAGTGTGTTTGATGGTCACCATAATTGTGGTTGCCTTCCTTGCGTCTATCAAACTTTGTATTCAACTTTGCGGTTTATGTAATACTTTGGTGCTGTCCCCTTCTATTTATTTGTATGATAGGAGTAAGCAGCTTTATAAGTATTATAATGAAGAAATGAGAATGCCCCTATTAGAGGTGGATGATATC--------------- >JHM_WU_E_AFO11520_1_1947_08_14_USA_Unknown_Murine_coronavirus ATGTTTAATTTATTCCTTACAGACACAGTATGGTATGTGGGGCAGATTATCTTTATAGTCGCAGTGTGTTTGATGGTCACCATAATTGTGGTTGCCTTCCTTGCGTCTATTAAACGTTGTATTCAACTTTGCGGTTTATGTAATACTTTGTTGCTGTCTCCCTCTATTTATCTGTATAATAGGAGTAAGCAGCTTTATAAGTATTATAATGAAGAAGTGAGACCGCCCCCGTTAGAGGTGGATGATAATATAATCCAAACATTA >MHV_1_NA_ACN89738_1_NA_USA_Mouse_Murine_coronavirus ATGTTTAATTTATTCCTTACAGACACAGTATGGTATGTGGGGCAGATTATTTTTATAGTCGCAGTGTGTTTGATGGTCACCATAATTGTGGTTGCCTTCCTTGCGTCTATTAAACTTTGTATTCAACTTTGCGGTTTATGTAATACTTTGTTGCTGTCCCCTTCTATTTATGTGTATAATGGGAGTAAGCAGCTTTATAAGTATTATAATGAAGAAGTGAGACCGCCCCCGTTAGAGGTGGATGATAAAATAATCCAAACATTA >JHM_WU_Dns2_E_AFO11510_1_1947_08_14_USA_Unknown_Murine_coronavirus ATGTTTAATTTATTCCTTACAGACACAGTATGGTATGTGGGGCAGATTATCTTTATAGTCGCAGTGTGTTTGATGGTCACCATAATTGTGGTTGCCTTCCTTGCGTCTATTAAACGTTGTATTCAACTTTGCGGTTTATGTAATACTTTGTTGCTGTCTCCCTCTATTTATCTGTATAATAGGAGTAAGCAGCTTTATAAGTATTATAATGAAGAAGTGAGACCGCCCCCGTTAGAGGTGGATGATAATATAATCCAAACATTA >MHV_2_NA_AAF19391_1_NA_NA_Unknown_Murine_coronavirus ATGTTTAATTTATTCCTTACAGATACAGTATGGTATGTGGGGCAGATTATTTTTATAGTCGCAGTGTGTTTGATGGTCACCATAATAGTGGTTGCCTTCCTTGCGTCTATCAAACTTTGTATTCAACTTTGCGGTTTGTGTAATACTTTGTTGCTGTCTCCTTCTATTTGTGTGTATAATAGGAGTAAGCAGCTTTATAAGTATTATAATGAAGAAGTGAGACCGCCCCCGTTAGAGGTGGATGATATAATAATCCAAACATTA >MHV_3_NA_ACN89744_1_NA_USA_Mouse_Murine_coronavirus ATGTTTAATTTATTCCTTACAGACACAGTATGGTATGTGGGGCAGATTATTTTTATAGTCGCAGTGTGTTTGATGGTCACCATAATTGTGGTTGCCTTCCTTGCGTCTATTAAACGTTGTATTCAACTTTGCGGTTTGTGTAATACTTTGTTGCTGTCCCCTTCTATTTATGTGTATAATAGGAGTAAGCAGCTTTATAAGTATTATAATGAAGAAGTGAGGCCGCCCCCGTTAGAGGTGGATGATATAATAATCCAAACATTA >MHV_JHM_IA_NA_ACN89766_1_NA_USA_Mouse_Murine_coronavirus ATGTTTAATTTATTCCTTACAGACACAGTATGGTATGTGGGGCAGATTATCTTTATAGTCGCAGTGTGTTTGATGGTCACCATAATTGTGGTTGCCTTCCTTGCGTCTATTAAACTTTGTATTCAACTTTGCGGTTTATGTAATACTTTGTTGCTGTCTCCCTCTATTTATGTGTATAATAGGAGTAAGCAGCTTTATAAGTATTATAATGAAGAAGTGAGACCGCCCCCGTTAGAGGTGGATGATAATATAATCCAAACATTA >MHV_MI_E_BAJ04699_1_1994_Australia_Mouse_Murine_coronavirus ATGTTTAATGTACTCTCTACAGACACAGTATGGTATGTGGGGCAGATTATTTTTATAGTCGCAGTGTGTTTAATGGTCACTATAGTTGTGGTCGCTTTCCTTGCGTCTATTAAACTTTGTATTCAACTTTGCGGTTTGTGTAATACTTTGTTGCTGTCCCCTTCTATTTATGTGTATAATAGGAGTAAGCAGCTATATAAGTATTATAATGAAGAAGTGAGACCGCCCCCGTTAGAGGTGGATGATATAATAATCCAAACATTA >ML_11_orf5B_AAF68928_1_NA_NA_Unknown_Murine_coronavirus ATGTTTAATTTATTCCTTACAGATACAGTATGGTATGTGGGGCAGATTATTTTTATAGTCGCAGTGTGTTTGATGGTCACCATAATAGTGGTTGCCTTCCTTGCGTCTATCAAACTTTGTATTCAACTTTGCGGTTTGTGTAATACTTTGTTGCTGTCTCCTTCTATTTGTGTGTATAATAGGAGTAAGCAGCTTTATAAGTATTATAATGAAGAAGTGAGACCGCCCCCGTTAGAGGTGGATGATATAATAATCCAAACATTA >Parker_E_YP_003029850_1_NA_NA_Rat_Murine_coronavirus ATGTTTAATTTATTCCTTATAGACACAGTATGGTACGTGGGGCAGATTATTTTTATAGTCGCAGTGTGTTTGATGGTCACCATAATTGTGGTTGCCTTCCTTGCGTCTATTAAACTTTGTATTCAACTTTGCGGTTTGTGTAATACTTTGTTGCTGTCTCCTTCTATTTATGTGTATAATAGGAGTAAGCAGCTTTATAAGTATTATAATGAAGAAGTGAGACCGCCCCCGTTAGAGGTGGATGATATAATAATCCAAACATTA >Penn_97_1_ORF5B_AAF69336_1_NA_NA_Unknown_Murine_coronavirus ATGTTTAATTTATTCCTTACAGATACAGTATGGTATGTGGGGCAGATTATTTTTATAGTCGCAGTGTGTTTGATGGTCACCATAATAGTGGTTGCCTTCCTTGCGTCTATCAAACTTTGTATTCAACTTTGCGGTTTGTGTAATACTTTGTTGCTGTCTCCTTCTATTTGTGTGTATAATAGGAGTAAGCAGCTTTATAAGTATTATAATGAAGAAGTGAGACCGCCCCCGTTAGAGGTGGATGATATAATAATCCAAACATTA >RJHM_A_NA_ACN89698_1_NA_USA_Mouse_Murine_coronavirus ATGTTTAATTTATTCCTTACAGACACAGTATGGTATGTGGGGCAGATTATCTTTATAGTCGCAGTGTGTTTGATGGTCACCATAATTGTGGTTGCCTTCCTTGCGTCTATTAAACGTTGTATTCAACTTTGCGGTTTATGTAATACTTTGTTGCTGTCTCCCTCTATTTATCTGTATAATAGGAGTAAGCAGCTTTATAAGTATTATAATGAAGAAGTGAGACCGCCCCCGTTAGAGGTGGATGATAATATAATCCAAACATTA >S_E_ADI59791_1_NA_USA_Mouse_Murine_coronavirus ATGTTTAATTTATTCCTTACAGACACAGTATGGTATGTGGGGCAGATTATCTTTATAGTCGCAGTGTGTTTGATGGTTACCATAACTGTGGTTGCCTTCCTTGCGTCTATTAAACTTTGTATTCAACTTTGCGGTTTATGTAATACTTTGGTGCTGTCCCCTTCTATTTATTTGTATGATAGGAGTAAGCAGCTTTATAAGTATTATAATGAAGAAGTTAGACCGCCCCCGTTAGAGGTGGATGATATAATAATCCAAACATTA >SA59_RJHM_NA_ACN89726_1_NA_USA_Mouse_Murine_coronavirus ATGTTTAATTTATTCCTTACAGACACAGTATGGTATGTGGGGCAGATTATCTTTATAGTCGCAGTGTGTTTGATGGTCACCATAATTGTGGTTGCCTTCCTTGCGTCTATTAAACGTTGTATTCAACTTTGCGGTTTATGTAATACTTTGTTGCTGTCTCCCTCTATTTATCTGTATAATAGGAGTAAGCAGCTTTATAAGTATTATAATGAAGAAGTGAGACCGCCCCCGTTAGAGGTGGATGATAATATAATCCAAACATTA >UNKNOWN_AC_000192_E_YP_209236_1_NA_NA_Unknown_Murine_coronavirus ATGTTTAATTTATTCCTTACAGACACAGTATGGTATGTGGGGCAGATTATCTTTATAGTCGCAGTGTGTTTGATGGTCACCATAATTGTGGTTGCCTTCCTTGCGTCTATTAAACGTTGTATTCAACTTTGCGGTTTATGTAATACTTTGTTGCTGTCTCCCTCTATTTATCTGTATAATAGGAGTAAGCAGCTTTATAAGTATTATAATGAAGAAGTGAGACCGCCCCCGTTAGAGGTGGATGATAATATAATCCAAACATTA >repA59_RJHM_NA_ACN89719_1_NA_USA_Mouse_Murine_coronavirus ATGTTTAATTTATTCCTTACAGACACAGTATGGTATGTGGGGCAGATTATCTTTATAGTCGCAGTGTGTTTGATGGTCACCATAATTGTGGTTGCCTTCCTTGCGTCTATTAAACGTTGTATTCAACTTTGCGGTTTATGTAATACTTTGTTGCTGTCTCCCTCTATTTATCTGTATAATAGGAGTAAGCAGCTTTATAAGTATTATAATGAAGAAGTGAGACCGCCCCCGTTAGAGGTGGATGATAATATAATCCAAACATTA
>8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus MFNLFLIDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL >A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus MFNLFLTDTVWYVGQIIFIFAVCLMVTIIVVAFLASIKLCIQLCGLCNTL VLSPSIYLYDRSKQLYKYYNEEMRMPLLEVDDI----- >JHM_WU_E_AFO11520_1_1947_08_14_USA_Unknown_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL >MHV_1_NA_ACN89738_1_NA_USA_Mouse_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL LLSPSIYVYNGSKQLYKYYNEEVRPPPLEVDDKIIQTL >JHM_WU_Dns2_E_AFO11510_1_1947_08_14_USA_Unknown_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL >MHV_2_NA_AAF19391_1_NA_NA_Unknown_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL LLSPSICVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL >MHV_3_NA_ACN89744_1_NA_USA_Mouse_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL >MHV_JHM_IA_NA_ACN89766_1_NA_USA_Mouse_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL >MHV_MI_E_BAJ04699_1_1994_Australia_Mouse_Murine_coronavirus MFNVLSTDTVWYVGQIIFIVAVCLMVTIVVVAFLASIKLCIQLCGLCNTL LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL >ML_11_orf5B_AAF68928_1_NA_NA_Unknown_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL LLSPSICVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL >Parker_E_YP_003029850_1_NA_NA_Rat_Murine_coronavirus MFNLFLIDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL LLSPSIYVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL >Penn_97_1_ORF5B_AAF69336_1_NA_NA_Unknown_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTL LLSPSICVYNRSKQLYKYYNEEVRPPPLEVDDIIIQTL >RJHM_A_NA_ACN89698_1_NA_USA_Mouse_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL >S_E_ADI59791_1_NA_USA_Mouse_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTITVVAFLASIKLCIQLCGLCNTL VLSPSIYLYDRSKQLYKYYNEEVRPPPLEVDDIIIQTL >SA59_RJHM_NA_ACN89726_1_NA_USA_Mouse_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL >UNKNOWN_AC_000192_E_YP_209236_1_NA_NA_Unknown_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL >repA59_RJHM_NA_ACN89719_1_NA_USA_Mouse_Murine_coronavirus MFNLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTL LLSPSIYLYNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
Reading sequence file /data//pss_subsets/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result/original_alignment/fubar/fasta/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result.1
Found 17 sequences of length 264
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 3.4%
Found 16 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 5
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 24 polymorphic sites
**p-Value(s)**
----------
NSS: 2.28e-01 (1000 permutations)
Max Chi^2: 4.20e-01 (1000 permutations)
PHI (Permutation): 6.58e-01 (1000 permutations)
PHI (Normal): 5.51e-01
#NEXUS
[ID: 8018085733]
begin taxa;
dimensions ntax=17;
taxlabels
8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus
ML_11_orf5B_AAF68928_1_NA_NA_Unknown_Murine_coronavirus
Parker_E_YP_003029850_1_NA_NA_Rat_Murine_coronavirus
Penn_97_1_ORF5B_AAF69336_1_NA_NA_Unknown_Murine_coronavirus
RJHM_A_NA_ACN89698_1_NA_USA_Mouse_Murine_coronavirus
S_E_ADI59791_1_NA_USA_Mouse_Murine_coronavirus
SA59_RJHM_NA_ACN89726_1_NA_USA_Mouse_Murine_coronavirus
UNKNOWN_AC_000192_E_YP_209236_1_NA_NA_Unknown_Murine_coronavirus
repA59_RJHM_NA_ACN89719_1_NA_USA_Mouse_Murine_coronavirus
A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus
JHM_WU_E_AFO11520_1_1947_08_14_USA_Unknown_Murine_coronavirus
MHV_1_NA_ACN89738_1_NA_USA_Mouse_Murine_coronavirus
JHM_WU_Dns2_E_AFO11510_1_1947_08_14_USA_Unknown_Murine_coronavirus
MHV_2_NA_AAF19391_1_NA_NA_Unknown_Murine_coronavirus
MHV_3_NA_ACN89744_1_NA_USA_Mouse_Murine_coronavirus
MHV_JHM_IA_NA_ACN89766_1_NA_USA_Mouse_Murine_coronavirus
MHV_MI_E_BAJ04699_1_1994_Australia_Mouse_Murine_coronavirus
;
end;
begin trees;
translate
1 8190_NA_AFG25767_1_NA_NA_Rat_Murine_coronavirus,
2 ML_11_orf5B_AAF68928_1_NA_NA_Unknown_Murine_coronavirus,
3 Parker_E_YP_003029850_1_NA_NA_Rat_Murine_coronavirus,
4 Penn_97_1_ORF5B_AAF69336_1_NA_NA_Unknown_Murine_coronavirus,
5 RJHM_A_NA_ACN89698_1_NA_USA_Mouse_Murine_coronavirus,
6 S_E_ADI59791_1_NA_USA_Mouse_Murine_coronavirus,
7 SA59_RJHM_NA_ACN89726_1_NA_USA_Mouse_Murine_coronavirus,
8 UNKNOWN_AC_000192_E_YP_209236_1_NA_NA_Unknown_Murine_coronavirus,
9 repA59_RJHM_NA_ACN89719_1_NA_USA_Mouse_Murine_coronavirus,
10 A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus,
11 JHM_WU_E_AFO11520_1_1947_08_14_USA_Unknown_Murine_coronavirus,
12 MHV_1_NA_ACN89738_1_NA_USA_Mouse_Murine_coronavirus,
13 JHM_WU_Dns2_E_AFO11510_1_1947_08_14_USA_Unknown_Murine_coronavirus,
14 MHV_2_NA_AAF19391_1_NA_NA_Unknown_Murine_coronavirus,
15 MHV_3_NA_ACN89744_1_NA_USA_Mouse_Murine_coronavirus,
16 MHV_JHM_IA_NA_ACN89766_1_NA_USA_Mouse_Murine_coronavirus,
17 MHV_MI_E_BAJ04699_1_1994_Australia_Mouse_Murine_coronavirus
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:1.546888e-03,3:1.591628e-03,((2:1.521750e-03,4:1.524188e-03,14:1.500320e-03)1.000:1.183904e-02,(((((5:1.599755e-03,7:1.629410e-03,8:1.561086e-03,9:1.565986e-03,11:1.531027e-03,13:1.566756e-03)0.998:6.357044e-03,16:1.552424e-03)1.000:1.084438e-02,12:4.065261e-03)0.945:4.197988e-03,(6:1.066602e-02,10:2.246192e-02)0.998:9.083714e-03)0.877:3.979489e-03,15:6.171795e-03,17:2.561557e-02)0.661:3.676336e-03)0.998:6.814817e-03);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:1.546888e-03,3:1.591628e-03,((2:1.521750e-03,4:1.524188e-03,14:1.500320e-03):1.183904e-02,(((((5:1.599755e-03,7:1.629410e-03,8:1.561086e-03,9:1.565986e-03,11:1.531027e-03,13:1.566756e-03):6.357044e-03,16:1.552424e-03):1.084438e-02,12:4.065261e-03):4.197988e-03,(6:1.066602e-02,10:2.246192e-02):9.083714e-03):3.979489e-03,15:6.171795e-03,17:2.561557e-02):3.676336e-03):6.814817e-03);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -617.48 -634.77
2 -617.23 -636.92
--------------------------------------
TOTAL -617.34 -636.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.178313 0.001050 0.116801 0.239773 0.175271 1303.08 1402.04 1.000
r(A<->C){all} 0.079048 0.002041 0.009457 0.170477 0.071840 467.36 537.39 1.000
r(A<->G){all} 0.225054 0.004421 0.103278 0.355008 0.219789 438.36 505.03 1.001
r(A<->T){all} 0.064725 0.000963 0.013930 0.127309 0.059625 648.09 709.40 1.000
r(C<->G){all} 0.065099 0.002079 0.000015 0.154581 0.055015 502.87 512.51 1.000
r(C<->T){all} 0.439084 0.006526 0.281725 0.595534 0.437984 455.10 550.56 1.001
r(G<->T){all} 0.126991 0.002040 0.042310 0.209926 0.121780 811.66 890.80 1.000
pi(A){all} 0.261889 0.000657 0.210931 0.310406 0.261649 1003.58 1032.23 1.002
pi(C){all} 0.155242 0.000433 0.116419 0.196806 0.154836 1096.47 1124.74 1.000
pi(G){all} 0.209123 0.000563 0.163449 0.255496 0.209300 1063.42 1092.50 1.000
pi(T){all} 0.373746 0.000812 0.319034 0.431979 0.373304 1090.53 1183.59 1.001
alpha{1,2} 1.185373 0.943523 0.003009 3.161392 0.895914 1261.56 1381.28 1.001
alpha{3} 1.318890 0.943571 0.001626 3.242017 1.073839 1117.90 1195.80 1.000
pinvar{all} 0.236886 0.024629 0.000053 0.515873 0.222638 724.47 828.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C11,((C10,C12,C6),(((((C13,C15,C16,C17,C3,C5),C8),C4),(C14,C2)),C7,C9)))` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **17** sequences, **88** codons, and **1** partitions from `/data//pss_subsets/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result/original_alignment/fubar/results/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result.1/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result/original_alignment/fubar/results/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result.1/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result/original_alignment/fubar/results/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result.1/A59_NA_ATN37890_1_2014_01_16_USA_Mouse_Murine_coronavirus.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -601.28, AIC-c = 1269.07 (33 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.169 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 1.227 * non-synonymous rate = 0.714 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results | Codon | Partition | alpha | beta |Posterior prob for positive selection| |:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:| | 58 | 1 | 1.049 | 9.055 | Pos. posterior = 0.9055 | ---- ## FUBAR inferred 1 sites subject to diversifying positive selection at posterior probability >= 0.9 Of these, 0.09 are expected to be false positives (95% confidence interval of 0-1 )
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
