--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -854.97 -866.31
2 -854.96 -866.16
--------------------------------------
TOTAL -854.97 -866.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.093203 0.000358 0.058858 0.131155 0.090837 1347.16 1424.08 1.000
r(A<->C){all} 0.082698 0.001753 0.015341 0.167786 0.076230 677.63 754.93 1.002
r(A<->G){all} 0.253154 0.005514 0.122308 0.407673 0.247810 340.57 371.16 1.000
r(A<->T){all} 0.082169 0.001618 0.014997 0.161858 0.075938 595.54 642.39 1.001
r(C<->G){all} 0.043326 0.001472 0.000018 0.118620 0.032519 467.44 515.63 1.003
r(C<->T){all} 0.390746 0.006680 0.231735 0.543070 0.388783 454.16 539.93 1.000
r(G<->T){all} 0.147908 0.003503 0.037087 0.260888 0.141226 590.27 620.87 1.007
pi(A){all} 0.295606 0.000421 0.256404 0.335086 0.294951 1199.82 1325.62 1.000
pi(C){all} 0.225250 0.000345 0.189409 0.262090 0.224890 1248.34 1254.17 1.000
pi(G){all} 0.193895 0.000330 0.157420 0.228435 0.193361 980.79 1184.40 1.000
pi(T){all} 0.285249 0.000404 0.248145 0.325299 0.284923 1177.44 1200.22 1.000
alpha{1,2} 0.703206 0.615702 0.000198 2.241400 0.441514 1152.55 1212.30 1.000
alpha{3} 1.324228 1.223212 0.000646 3.485764 1.019498 1202.04 1314.42 1.000
pinvar{all} 0.371197 0.041543 0.004650 0.708667 0.368601 727.96 808.22 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
-- Starting log on Thu Oct 20 00:46:21 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=8, Len=153
C1 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C2 MKLLLLLSILSFSSAAPTTYRASQAAKVLIHTTEKVTLNNQRTHSYTKWS
C3 MKLLLLLSILSFSSAAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C4 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C5 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C6 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C7 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C8 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
*********:*** :***************:************:*****.
C1 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C2 VCSTGWNTYTNTMVVVNGRWVETAKPPKPTAVAIPTFPYEPRSEKPGFGS
C3 VCSTGWNTYTNTMVVVNGRWVETTKPPRPTAIAIPTFPYEPRSEKPGFGS
C4 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C5 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C6 VCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGS
C7 VCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGS
C8 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
***********************:***.***.****.*** *********
C1 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C2 HFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWST
C3 HFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHQTFAVTTFRWST
C4 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C5 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C6 HFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C7 HFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C8 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
***********:***.**** *****************:*******:**:
C1 PLN
C2 PSN
C3 PSN
C4 PSN
C5 PSN
C6 PSN
C7 PSN
C8 PSN
* *
-- Starting log on Thu Oct 20 00:46:44 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=8, Len=153
C1 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C2 MKLLLLLSILSFSSAAPTTYRASQAAKVLIHTTEKVTLNNQRTHSYTKWS
C3 MKLLLLLSILSFSSAAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C4 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C5 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C6 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C7 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C8 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
*********:*** :***************:************:*****.
C1 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C2 VCSTGWNTYTNTMVVVNGRWVETAKPPKPTAVAIPTFPYEPRSEKPGFGS
C3 VCSTGWNTYTNTMVVVNGRWVETTKPPRPTAIAIPTFPYEPRSEKPGFGS
C4 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C5 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C6 VCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGS
C7 VCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGS
C8 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
***********************:***.***.****.*** *********
C1 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C2 HFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWST
C3 HFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHQTFAVTTFRWST
C4 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C5 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C6 HFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C7 HFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C8 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
***********:***.**** *****************:*******:**:
C1 PLN
C2 PSN
C3 PSN
C4 PSN
C5 PSN
C6 PSN
C7 PSN
C8 PSN
* *
-- Starting log on Thu Oct 20 00:46:21 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=8, Len=153
C1 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C2 MKLLLLLSILSFSSAAPTTYRASQAAKVLIHTTEKVTLNNQRTHSYTKWS
C3 MKLLLLLSILSFSSAAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C4 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C5 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
C6 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C7 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
C8 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
*********:*** :***************:************:*****.
C1 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C2 VCSTGWNTYTNTMVVVNGRWVETAKPPKPTAVAIPTFPYEPRSEKPGFGS
C3 VCSTGWNTYTNTMVVVNGRWVETTKPPRPTAIAIPTFPYEPRSEKPGFGS
C4 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C5 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
C6 VCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGS
C7 VCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGS
C8 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
***********************:***.***.****.*** *********
C1 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C2 HFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWST
C3 HFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHQTFAVTTFRWST
C4 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C5 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C6 HFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C7 HFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSS
C8 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
***********:***.**** *****************:*******:**:
C1 PLN
C2 PSN
C3 PSN
C4 PSN
C5 PSN
C6 PSN
C7 PSN
C8 PSN
* *
-- Starting log on Thu Oct 20 00:57:32 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/gapped_alignment/fubar,175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 8 taxa and 459 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666227456
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1936132395
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5175601111
Seed = 1949362178
Swapseed = 1666227456
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 15 unique site patterns
Division 2 has 10 unique site patterns
Division 3 has 15 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1055.039611 -- 29.153684
Chain 2 -- -1047.307883 -- 29.153684
Chain 3 -- -1054.507992 -- 29.153684
Chain 4 -- -1065.898740 -- 29.153684
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1060.882604 -- 29.153684
Chain 2 -- -1048.174008 -- 29.153684
Chain 3 -- -1053.851002 -- 29.153684
Chain 4 -- -1007.168667 -- 29.153684
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1055.040] (-1047.308) (-1054.508) (-1065.899) * [-1060.883] (-1048.174) (-1053.851) (-1007.169)
1000 -- (-867.629) (-870.951) (-867.480) [-869.131] * (-867.916) (-869.300) (-862.673) [-862.092] -- 0:00:00
2000 -- (-865.877) [-861.825] (-868.362) (-867.726) * (-861.554) (-869.962) [-856.094] (-860.227) -- 0:00:00
3000 -- (-863.668) [-857.907] (-864.108) (-863.422) * (-863.541) [-869.057] (-865.440) (-862.991) -- 0:05:32
4000 -- (-863.641) (-867.869) (-867.970) [-860.875] * (-866.085) (-877.182) [-855.558] (-857.483) -- 0:04:09
5000 -- (-862.163) [-860.720] (-866.715) (-859.426) * (-857.654) (-867.263) [-856.388] (-866.875) -- 0:03:19
Average standard deviation of split frequencies: 0.132960
6000 -- [-859.314] (-863.184) (-872.656) (-862.158) * [-861.449] (-869.637) (-856.891) (-866.396) -- 0:02:45
7000 -- [-856.712] (-860.742) (-862.205) (-864.715) * (-863.488) [-866.736] (-859.747) (-862.118) -- 0:02:21
8000 -- (-856.480) (-855.865) (-866.509) [-861.190] * (-859.462) (-861.283) [-858.369] (-875.916) -- 0:04:08
9000 -- (-861.116) (-855.565) [-864.238] (-860.761) * (-862.701) (-864.115) [-857.867] (-866.098) -- 0:03:40
10000 -- (-857.604) (-858.346) (-858.810) [-862.818] * (-864.111) (-860.958) [-858.120] (-867.447) -- 0:03:18
Average standard deviation of split frequencies: 0.081589
11000 -- (-859.583) (-858.622) [-857.306] (-859.648) * (-863.976) (-862.218) (-864.730) [-860.009] -- 0:02:59
12000 -- [-856.238] (-861.118) (-855.584) (-860.167) * [-862.907] (-858.340) (-859.938) (-864.336) -- 0:02:44
13000 -- [-859.262] (-854.607) (-865.766) (-864.506) * (-859.963) [-857.017] (-859.524) (-864.386) -- 0:03:47
14000 -- (-858.114) [-856.837] (-864.324) (-868.884) * (-858.899) (-864.654) (-853.267) [-853.718] -- 0:03:31
15000 -- (-864.954) (-856.840) [-861.382] (-858.364) * (-858.885) (-857.903) (-862.350) [-855.514] -- 0:03:17
Average standard deviation of split frequencies: 0.045327
16000 -- [-859.090] (-876.564) (-857.751) (-856.972) * [-854.714] (-857.935) (-853.147) (-861.908) -- 0:03:04
17000 -- (-866.586) (-859.752) (-864.319) [-853.785] * (-859.910) (-860.568) (-854.367) [-856.714] -- 0:02:53
18000 -- (-865.461) (-859.572) (-858.005) [-860.978] * (-856.513) (-859.234) [-859.879] (-858.500) -- 0:03:38
19000 -- (-855.017) (-861.373) [-857.206] (-863.005) * (-861.126) [-856.130] (-862.022) (-858.026) -- 0:03:26
20000 -- (-861.553) (-861.823) (-859.387) [-861.002] * [-858.490] (-856.147) (-870.709) (-857.091) -- 0:03:16
Average standard deviation of split frequencies: 0.038601
21000 -- [-858.980] (-868.482) (-863.921) (-860.877) * (-858.903) (-858.668) (-863.506) [-859.497] -- 0:03:06
22000 -- (-864.080) (-870.862) [-859.569] (-865.773) * (-863.556) [-858.109] (-864.182) (-862.862) -- 0:02:57
23000 -- [-858.408] (-868.607) (-864.755) (-861.405) * [-862.180] (-864.044) (-862.936) (-864.666) -- 0:03:32
24000 -- (-864.231) (-857.434) (-861.006) [-855.719] * (-863.719) (-860.474) (-858.121) [-859.974] -- 0:03:23
25000 -- (-859.405) (-860.531) [-851.822] (-860.410) * [-862.626] (-868.636) (-860.134) (-859.238) -- 0:03:15
Average standard deviation of split frequencies: 0.039051
26000 -- (-858.605) [-857.743] (-862.586) (-856.533) * (-865.933) (-861.286) (-873.290) [-857.554] -- 0:03:07
27000 -- [-865.779] (-862.857) (-866.467) (-858.164) * (-862.348) (-869.523) (-864.110) [-855.179] -- 0:03:00
28000 -- [-853.272] (-859.306) (-866.230) (-860.468) * [-860.310] (-866.233) (-871.860) (-857.581) -- 0:03:28
29000 -- [-854.461] (-864.314) (-854.966) (-861.491) * (-866.331) (-859.199) (-869.485) [-860.129] -- 0:03:20
30000 -- (-856.822) (-856.544) [-857.573] (-864.012) * (-855.088) (-856.188) (-866.864) [-855.699] -- 0:03:14
Average standard deviation of split frequencies: 0.037838
31000 -- (-865.550) (-854.185) [-855.257] (-859.044) * (-859.912) (-859.374) (-863.216) [-855.661] -- 0:03:07
32000 -- (-864.285) [-860.609] (-862.008) (-863.369) * [-857.900] (-862.526) (-859.300) (-856.590) -- 0:03:01
33000 -- (-865.148) (-868.209) [-858.735] (-857.661) * [-858.203] (-860.739) (-863.775) (-859.914) -- 0:03:25
34000 -- (-859.180) (-861.259) (-857.821) [-856.541] * [-860.630] (-863.406) (-863.933) (-862.971) -- 0:03:18
35000 -- [-855.154] (-863.288) (-868.756) (-860.953) * [-854.891] (-861.013) (-866.705) (-866.487) -- 0:03:13
Average standard deviation of split frequencies: 0.040291
36000 -- (-856.773) [-867.743] (-864.990) (-854.959) * [-858.787] (-874.721) (-861.334) (-863.676) -- 0:03:07
37000 -- (-856.025) (-867.583) [-857.036] (-856.428) * [-856.055] (-859.049) (-868.520) (-865.967) -- 0:03:02
38000 -- [-855.282] (-863.854) (-864.410) (-859.277) * [-858.574] (-861.087) (-871.576) (-854.865) -- 0:03:22
39000 -- (-864.475) (-871.415) (-857.888) [-858.452] * [-859.319] (-861.383) (-864.898) (-861.299) -- 0:03:17
40000 -- (-858.238) [-857.716] (-858.540) (-860.205) * (-857.023) [-857.530] (-861.051) (-867.406) -- 0:03:12
Average standard deviation of split frequencies: 0.021400
41000 -- (-857.977) (-862.778) [-862.957] (-862.663) * (-858.701) [-854.198] (-857.141) (-861.781) -- 0:03:07
42000 -- (-862.049) (-863.362) (-862.572) [-859.275] * [-865.294] (-864.657) (-862.134) (-869.955) -- 0:03:02
43000 -- (-860.797) [-857.614] (-860.403) (-865.589) * [-868.240] (-860.728) (-862.066) (-855.140) -- 0:03:20
44000 -- (-862.399) [-858.589] (-863.516) (-860.632) * (-862.245) (-858.248) [-858.336] (-862.290) -- 0:03:15
45000 -- (-857.994) (-863.919) [-860.958] (-862.155) * (-868.442) (-858.913) [-859.435] (-857.714) -- 0:03:11
Average standard deviation of split frequencies: 0.013401
46000 -- [-864.412] (-855.289) (-866.464) (-863.253) * [-854.463] (-864.280) (-860.430) (-858.021) -- 0:03:06
47000 -- (-867.010) (-860.059) [-868.559] (-856.697) * (-856.743) (-865.801) (-861.266) [-860.523] -- 0:03:02
48000 -- (-866.022) [-856.794] (-862.393) (-858.132) * [-856.187] (-874.150) (-858.562) (-861.966) -- 0:03:18
49000 -- (-855.565) (-860.680) (-862.240) [-857.546] * (-860.943) (-866.627) (-860.774) [-858.037] -- 0:03:14
50000 -- (-854.281) (-859.785) (-865.806) [-860.340] * (-854.081) [-866.108] (-861.175) (-868.058) -- 0:03:10
Average standard deviation of split frequencies: 0.014314
51000 -- [-855.177] (-860.026) (-867.349) (-863.512) * [-856.620] (-862.297) (-856.629) (-863.244) -- 0:03:06
52000 -- (-863.441) [-855.724] (-863.139) (-856.608) * (-859.667) (-865.152) [-852.322] (-860.456) -- 0:03:02
53000 -- (-861.626) [-863.780] (-872.181) (-868.214) * [-860.755] (-865.207) (-867.791) (-859.163) -- 0:03:16
54000 -- (-868.656) [-863.871] (-869.119) (-859.846) * (-862.259) (-864.053) (-860.816) [-854.996] -- 0:03:12
55000 -- (-858.775) [-860.966] (-862.895) (-871.226) * (-859.067) (-861.106) (-852.717) [-859.900] -- 0:03:09
Average standard deviation of split frequencies: 0.016836
56000 -- [-861.177] (-863.609) (-869.605) (-866.440) * (-856.883) (-858.461) [-864.316] (-858.612) -- 0:03:05
57000 -- (-866.082) (-856.029) (-862.051) [-864.422] * (-860.477) [-857.883] (-859.072) (-863.837) -- 0:03:01
58000 -- (-851.909) (-854.769) [-857.401] (-866.263) * (-858.962) [-859.283] (-863.325) (-855.194) -- 0:03:14
59000 -- (-858.272) (-850.658) [-861.937] (-854.878) * (-864.037) (-857.649) (-860.118) [-853.852] -- 0:03:11
60000 -- (-856.292) [-854.531] (-858.859) (-858.611) * (-861.468) (-855.418) [-862.192] (-860.156) -- 0:03:08
Average standard deviation of split frequencies: 0.016736
61000 -- (-855.881) (-860.638) (-858.939) [-861.338] * (-862.404) (-860.439) (-855.957) [-865.111] -- 0:03:04
62000 -- [-858.393] (-862.890) (-856.106) (-860.973) * (-857.694) [-863.375] (-868.684) (-856.700) -- 0:03:01
63000 -- [-856.435] (-854.007) (-863.045) (-866.552) * [-857.947] (-860.228) (-863.437) (-863.222) -- 0:03:13
64000 -- (-862.511) (-861.379) [-860.805] (-855.575) * (-858.954) (-860.063) (-853.213) [-857.882] -- 0:03:10
65000 -- (-857.411) [-863.954] (-866.995) (-864.043) * (-866.003) (-864.788) [-857.958] (-862.743) -- 0:03:07
Average standard deviation of split frequencies: 0.016483
66000 -- (-862.437) (-860.341) (-861.592) [-861.312] * [-863.490] (-858.782) (-858.803) (-859.007) -- 0:03:03
67000 -- [-864.226] (-858.545) (-858.051) (-859.303) * (-860.836) (-867.113) (-860.370) [-855.722] -- 0:03:01
68000 -- [-856.657] (-856.503) (-867.360) (-859.873) * [-860.715] (-862.054) (-860.894) (-858.379) -- 0:03:11
69000 -- (-864.477) [-857.137] (-855.360) (-855.807) * (-857.329) (-864.590) [-860.726] (-860.745) -- 0:03:08
70000 -- (-868.835) (-862.769) (-861.495) [-856.407] * [-858.707] (-863.860) (-857.341) (-868.232) -- 0:03:06
Average standard deviation of split frequencies: 0.017447
71000 -- [-862.673] (-860.031) (-863.792) (-858.340) * [-854.058] (-858.844) (-863.346) (-859.998) -- 0:03:03
72000 -- [-866.330] (-853.534) (-856.790) (-859.480) * (-865.892) [-861.649] (-856.448) (-860.194) -- 0:03:00
73000 -- (-862.530) (-858.337) (-858.802) [-857.100] * (-857.942) [-855.188] (-861.098) (-858.915) -- 0:03:10
74000 -- [-856.461] (-866.230) (-858.080) (-856.899) * (-860.996) [-857.632] (-861.373) (-858.248) -- 0:03:07
75000 -- (-863.259) [-858.864] (-861.172) (-866.455) * [-865.804] (-868.842) (-855.864) (-865.836) -- 0:03:05
Average standard deviation of split frequencies: 0.020994
76000 -- (-861.112) (-857.839) [-862.492] (-859.745) * (-870.321) (-866.641) [-854.832] (-859.095) -- 0:03:02
77000 -- (-863.345) (-859.276) [-858.556] (-867.567) * (-864.725) (-870.560) [-857.909] (-864.866) -- 0:02:59
78000 -- [-857.774] (-865.729) (-859.927) (-860.488) * (-878.581) (-866.988) (-862.259) [-858.246] -- 0:03:09
79000 -- (-862.578) (-854.719) [-853.509] (-867.118) * (-862.631) (-860.971) [-855.444] (-857.845) -- 0:03:06
80000 -- [-857.448] (-862.787) (-868.162) (-866.575) * (-861.310) (-870.893) (-865.435) [-864.221] -- 0:03:04
Average standard deviation of split frequencies: 0.023375
81000 -- (-862.491) (-864.343) [-855.062] (-867.494) * [-856.454] (-866.532) (-859.076) (-862.434) -- 0:03:01
82000 -- (-863.257) (-861.077) [-861.828] (-858.782) * (-862.546) (-858.229) (-860.964) [-854.674] -- 0:02:59
83000 -- (-855.438) [-857.082] (-860.745) (-857.536) * [-857.849] (-858.419) (-863.235) (-858.165) -- 0:03:07
84000 -- (-869.006) (-860.563) [-860.038] (-861.239) * (-859.063) (-856.184) (-861.159) [-855.805] -- 0:03:05
85000 -- [-859.101] (-858.312) (-860.017) (-866.139) * (-858.522) [-860.762] (-868.537) (-864.281) -- 0:03:03
Average standard deviation of split frequencies: 0.024456
86000 -- (-864.344) (-857.016) [-862.516] (-864.161) * (-857.953) (-856.092) (-867.765) [-868.843] -- 0:03:00
87000 -- (-858.209) (-859.395) [-858.288] (-858.633) * (-861.868) [-851.427] (-864.821) (-862.517) -- 0:02:58
88000 -- (-857.874) (-864.188) [-857.284] (-857.139) * (-863.645) (-862.789) (-858.959) [-854.699] -- 0:03:06
89000 -- (-856.664) (-860.528) [-856.875] (-857.446) * (-866.101) (-862.638) (-862.345) [-863.379] -- 0:03:04
90000 -- (-863.577) (-856.693) [-859.614] (-861.566) * (-862.458) (-861.832) (-862.224) [-858.376] -- 0:03:02
Average standard deviation of split frequencies: 0.023197
91000 -- (-860.455) [-855.487] (-866.389) (-866.497) * (-861.536) (-858.835) [-867.915] (-859.261) -- 0:02:59
92000 -- (-863.234) (-856.122) [-863.985] (-856.668) * [-855.081] (-852.889) (-857.258) (-861.250) -- 0:02:57
93000 -- (-862.942) (-858.027) [-868.604] (-857.388) * (-866.654) (-853.234) [-856.302] (-857.206) -- 0:03:05
94000 -- (-857.132) [-864.061] (-867.719) (-861.748) * (-859.673) [-856.765] (-859.292) (-865.716) -- 0:03:03
95000 -- (-855.904) [-856.048] (-867.277) (-866.173) * [-863.957] (-862.532) (-865.012) (-856.032) -- 0:03:01
Average standard deviation of split frequencies: 0.019642
96000 -- (-865.589) (-858.386) (-864.641) [-858.192] * [-863.427] (-870.518) (-862.858) (-857.819) -- 0:02:58
97000 -- (-861.486) [-859.971] (-856.677) (-863.212) * (-857.092) [-857.127] (-866.334) (-857.067) -- 0:02:56
98000 -- (-856.744) (-870.152) (-858.190) [-858.184] * [-853.885] (-871.621) (-859.425) (-861.413) -- 0:03:04
99000 -- (-856.897) [-857.559] (-859.352) (-863.125) * (-867.573) (-858.937) (-862.493) [-855.305] -- 0:03:02
100000 -- (-855.404) [-866.141] (-861.222) (-872.553) * (-857.623) (-865.579) (-864.175) [-855.001] -- 0:03:00
Average standard deviation of split frequencies: 0.015850
101000 -- (-857.469) (-861.179) [-855.518] (-866.693) * (-869.655) (-860.588) (-859.364) [-855.673] -- 0:02:58
102000 -- (-866.025) (-862.403) (-860.989) [-861.957] * [-856.876] (-865.666) (-860.490) (-860.226) -- 0:02:56
103000 -- (-864.445) [-855.121] (-855.843) (-861.686) * (-866.113) (-862.793) (-863.773) [-850.471] -- 0:03:02
104000 -- (-860.589) [-866.342] (-859.139) (-860.692) * (-853.730) (-862.275) [-858.790] (-861.168) -- 0:03:00
105000 -- (-862.848) [-857.727] (-860.284) (-857.828) * (-858.110) (-863.528) [-870.122] (-866.468) -- 0:02:59
Average standard deviation of split frequencies: 0.014368
106000 -- (-861.459) (-869.409) [-861.232] (-864.680) * [-858.240] (-863.364) (-861.880) (-860.142) -- 0:02:57
107000 -- (-863.077) (-859.291) (-855.950) [-860.143] * (-860.630) [-858.691] (-858.323) (-863.605) -- 0:02:55
108000 -- (-862.270) (-856.644) [-868.557] (-858.393) * [-858.786] (-868.549) (-860.472) (-860.082) -- 0:03:01
109000 -- [-856.557] (-859.580) (-855.332) (-861.640) * (-859.850) (-858.892) [-855.260] (-859.891) -- 0:02:59
110000 -- (-862.168) (-858.166) [-861.445] (-857.212) * (-857.169) [-853.714] (-860.903) (-865.190) -- 0:02:58
Average standard deviation of split frequencies: 0.012451
111000 -- [-863.638] (-858.448) (-861.206) (-859.654) * (-861.666) (-860.020) [-855.693] (-857.791) -- 0:02:56
112000 -- (-866.587) [-857.268] (-865.021) (-855.674) * (-862.351) [-860.699] (-858.334) (-860.651) -- 0:02:54
113000 -- (-867.446) (-857.200) (-857.401) [-858.419] * [-855.265] (-856.238) (-869.463) (-864.443) -- 0:03:00
114000 -- (-856.748) [-857.904] (-859.354) (-856.487) * (-857.319) (-860.761) (-860.516) [-862.323] -- 0:02:58
115000 -- (-862.103) [-857.018] (-858.049) (-855.217) * (-854.727) [-860.157] (-863.899) (-867.296) -- 0:02:57
Average standard deviation of split frequencies: 0.015630
116000 -- (-873.432) (-855.664) (-856.813) [-864.202] * (-857.661) (-857.710) [-858.673] (-863.253) -- 0:02:55
117000 -- (-864.307) (-857.811) [-858.252] (-862.308) * [-856.418] (-859.985) (-861.330) (-858.220) -- 0:02:53
118000 -- (-859.514) [-854.416] (-854.815) (-862.099) * (-867.778) [-857.279] (-857.388) (-864.089) -- 0:02:59
119000 -- (-855.656) [-854.965] (-859.364) (-863.878) * [-859.065] (-857.078) (-863.491) (-873.520) -- 0:02:57
120000 -- (-857.858) (-870.533) [-859.866] (-862.729) * (-862.303) (-860.462) (-856.341) [-854.220] -- 0:02:56
Average standard deviation of split frequencies: 0.014425
121000 -- (-856.385) (-857.232) [-859.112] (-864.974) * [-859.306] (-862.692) (-860.635) (-860.555) -- 0:02:54
122000 -- [-856.819] (-869.231) (-855.964) (-864.448) * (-861.327) [-857.746] (-860.576) (-858.601) -- 0:02:52
123000 -- (-852.616) (-858.729) [-856.015] (-863.577) * (-861.320) (-854.183) [-859.605] (-856.028) -- 0:02:58
124000 -- [-857.397] (-860.806) (-864.218) (-864.760) * (-860.784) (-867.630) (-861.684) [-856.426] -- 0:02:56
125000 -- [-851.149] (-867.804) (-859.657) (-853.956) * (-863.124) (-866.090) (-867.076) [-858.197] -- 0:02:55
Average standard deviation of split frequencies: 0.014965
126000 -- (-863.527) [-861.003] (-857.859) (-873.104) * (-859.296) (-864.937) [-854.696] (-865.217) -- 0:02:53
127000 -- (-859.775) (-863.753) (-859.431) [-859.522] * (-855.272) (-869.718) [-863.631] (-863.717) -- 0:02:51
128000 -- (-857.369) [-862.469] (-858.447) (-865.269) * [-864.650] (-858.403) (-867.165) (-857.753) -- 0:02:57
129000 -- (-859.345) (-866.115) [-857.702] (-856.050) * (-864.959) (-857.482) (-860.426) [-859.161] -- 0:02:55
130000 -- [-857.923] (-871.802) (-860.710) (-867.127) * (-862.488) (-863.519) [-860.080] (-870.551) -- 0:02:54
Average standard deviation of split frequencies: 0.015818
131000 -- (-868.777) (-863.391) (-862.710) [-862.414] * [-864.011] (-865.882) (-856.386) (-870.192) -- 0:02:52
132000 -- [-862.595] (-858.179) (-859.878) (-865.020) * (-858.890) [-858.687] (-858.069) (-859.704) -- 0:02:50
133000 -- (-859.445) [-864.950] (-860.677) (-857.626) * (-859.699) [-858.756] (-857.095) (-857.061) -- 0:02:56
134000 -- (-860.379) (-859.007) [-856.255] (-863.099) * (-869.033) [-858.079] (-860.517) (-860.349) -- 0:02:54
135000 -- (-856.448) [-859.071] (-860.279) (-857.137) * [-857.659] (-863.074) (-864.807) (-859.519) -- 0:02:53
Average standard deviation of split frequencies: 0.016265
136000 -- (-871.243) (-859.791) [-853.581] (-863.740) * (-859.413) (-866.742) [-859.536] (-863.417) -- 0:02:51
137000 -- (-870.012) (-854.736) (-857.551) [-856.025] * (-859.203) [-861.159] (-854.239) (-866.192) -- 0:02:50
138000 -- (-859.741) [-859.423] (-863.410) (-867.435) * [-855.847] (-865.484) (-855.144) (-864.422) -- 0:02:54
139000 -- (-860.719) [-862.270] (-862.370) (-864.443) * (-856.205) [-853.132] (-862.869) (-863.933) -- 0:02:53
140000 -- (-856.749) (-857.290) (-865.251) [-861.613] * (-855.505) [-855.741] (-859.279) (-862.510) -- 0:02:52
Average standard deviation of split frequencies: 0.014178
141000 -- (-860.543) (-865.739) [-858.661] (-858.211) * (-856.660) [-857.046] (-857.947) (-858.373) -- 0:02:50
142000 -- (-863.449) (-856.341) (-863.286) [-854.853] * (-859.330) (-853.064) [-865.321] (-857.323) -- 0:02:49
143000 -- (-857.393) [-865.945] (-864.776) (-861.869) * (-863.563) (-862.187) [-864.669] (-866.247) -- 0:02:53
144000 -- (-861.531) [-860.742] (-856.735) (-863.290) * [-860.234] (-858.427) (-863.732) (-859.824) -- 0:02:52
145000 -- (-864.236) (-859.575) [-859.039] (-863.038) * (-858.054) [-859.396] (-861.958) (-863.312) -- 0:02:51
Average standard deviation of split frequencies: 0.015647
146000 -- (-863.194) (-855.394) [-856.735] (-859.492) * (-863.266) (-856.894) (-860.890) [-857.813] -- 0:02:49
147000 -- (-863.968) [-854.556] (-858.433) (-858.928) * (-855.842) (-865.929) [-851.782] (-856.314) -- 0:02:48
148000 -- [-859.887] (-859.729) (-857.299) (-858.896) * [-856.731] (-861.428) (-860.138) (-867.690) -- 0:02:52
149000 -- (-854.014) (-861.778) (-864.408) [-859.846] * (-861.338) (-861.093) (-870.742) [-856.142] -- 0:02:51
150000 -- [-867.039] (-858.282) (-860.597) (-862.747) * (-861.633) (-860.795) (-860.832) [-859.354] -- 0:02:50
Average standard deviation of split frequencies: 0.017569
151000 -- (-857.634) (-859.899) [-862.854] (-859.556) * (-859.558) (-864.876) (-863.721) [-859.184] -- 0:02:48
152000 -- [-861.839] (-860.680) (-862.481) (-862.055) * (-859.553) (-863.545) (-859.839) [-857.963] -- 0:02:47
153000 -- (-869.371) (-863.392) (-859.331) [-862.179] * [-864.625] (-860.762) (-863.159) (-854.261) -- 0:02:51
154000 -- (-868.273) (-863.149) (-856.304) [-862.501] * (-860.879) (-865.288) (-870.559) [-853.914] -- 0:02:50
155000 -- (-861.057) [-856.708] (-862.708) (-861.186) * (-859.615) (-866.961) (-859.831) [-858.543] -- 0:02:49
Average standard deviation of split frequencies: 0.017666
156000 -- [-861.472] (-856.406) (-858.939) (-855.011) * (-877.613) (-864.705) (-858.253) [-856.847] -- 0:02:47
157000 -- (-861.166) (-871.508) [-860.524] (-856.096) * (-873.908) (-864.690) (-855.802) [-862.426] -- 0:02:46
158000 -- (-861.483) [-855.232] (-861.845) (-868.159) * (-854.387) (-862.598) [-860.879] (-868.752) -- 0:02:50
159000 -- (-871.720) [-858.666] (-861.028) (-856.057) * (-858.206) (-856.060) (-857.174) [-860.147] -- 0:02:49
160000 -- [-864.309] (-867.912) (-864.782) (-859.685) * [-855.769] (-858.035) (-857.368) (-862.947) -- 0:02:48
Average standard deviation of split frequencies: 0.018733
161000 -- (-860.832) (-858.885) (-855.653) [-857.622] * [-860.595] (-857.252) (-856.429) (-862.995) -- 0:02:46
162000 -- (-861.031) (-857.482) (-863.847) [-862.507] * (-866.299) (-859.293) (-856.339) [-854.462] -- 0:02:45
163000 -- [-858.688] (-857.671) (-860.766) (-857.523) * (-863.751) (-857.970) (-858.654) [-858.648] -- 0:02:49
164000 -- (-863.744) [-855.571] (-862.594) (-864.536) * (-855.551) [-857.053] (-857.337) (-859.421) -- 0:02:48
165000 -- (-858.116) (-855.406) [-857.453] (-875.377) * (-866.366) (-859.919) (-854.283) [-857.005] -- 0:02:47
Average standard deviation of split frequencies: 0.016383
166000 -- [-859.512] (-856.845) (-860.365) (-864.955) * (-862.449) (-861.676) (-856.838) [-858.462] -- 0:02:45
167000 -- (-857.866) (-853.389) [-857.613] (-866.529) * (-855.489) [-857.698] (-861.375) (-861.444) -- 0:02:44
168000 -- [-859.302] (-855.831) (-855.359) (-866.365) * (-869.028) (-859.744) (-861.407) [-860.353] -- 0:02:43
169000 -- (-863.495) (-862.215) [-856.282] (-864.013) * (-860.280) [-856.451] (-860.914) (-861.130) -- 0:02:47
170000 -- (-855.958) (-861.175) [-861.639] (-856.736) * (-866.357) [-856.564] (-857.111) (-863.383) -- 0:02:46
Average standard deviation of split frequencies: 0.013173
171000 -- (-857.450) (-868.035) [-860.143] (-866.980) * (-859.843) (-865.044) [-858.193] (-857.226) -- 0:02:44
172000 -- (-866.888) (-872.037) [-852.151] (-863.366) * (-861.673) (-865.236) (-858.727) [-862.091] -- 0:02:43
173000 -- (-861.271) (-858.886) [-853.833] (-853.685) * (-869.624) (-856.824) [-857.262] (-854.759) -- 0:02:42
174000 -- (-859.613) (-856.622) (-859.044) [-862.756] * (-860.595) [-862.884] (-862.118) (-856.935) -- 0:02:46
175000 -- [-860.618] (-862.826) (-857.522) (-857.094) * (-862.403) (-853.199) (-861.668) [-854.561] -- 0:02:45
Average standard deviation of split frequencies: 0.013186
176000 -- (-866.016) [-856.741] (-856.307) (-860.782) * [-852.508] (-860.307) (-855.669) (-863.260) -- 0:02:43
177000 -- (-854.828) [-860.420] (-867.172) (-855.531) * (-858.017) [-855.686] (-867.062) (-859.833) -- 0:02:42
178000 -- [-861.808] (-866.500) (-853.670) (-863.521) * (-855.846) (-856.596) (-862.407) [-859.185] -- 0:02:41
179000 -- (-871.494) (-860.112) [-857.980] (-859.737) * (-861.624) (-860.860) [-862.415] (-857.856) -- 0:02:45
180000 -- [-862.951] (-857.477) (-860.050) (-854.777) * [-852.393] (-858.665) (-857.911) (-857.705) -- 0:02:44
Average standard deviation of split frequencies: 0.012043
181000 -- (-862.858) (-866.662) [-857.650] (-857.940) * (-857.027) (-858.875) (-856.134) [-861.632] -- 0:02:42
182000 -- (-860.063) [-856.171] (-863.803) (-856.803) * (-853.666) (-859.681) (-855.460) [-852.712] -- 0:02:41
183000 -- (-862.046) (-859.908) (-865.002) [-857.225] * (-862.753) (-860.178) (-858.267) [-856.061] -- 0:02:40
184000 -- (-861.538) [-863.226] (-860.784) (-860.092) * (-862.579) (-863.401) [-859.334] (-860.770) -- 0:02:44
185000 -- (-854.796) [-856.303] (-860.103) (-861.376) * (-861.747) (-860.460) [-865.440] (-854.848) -- 0:02:43
Average standard deviation of split frequencies: 0.013647
186000 -- [-856.524] (-857.660) (-855.663) (-860.966) * (-861.513) (-856.946) (-866.009) [-855.461] -- 0:02:41
187000 -- [-853.739] (-861.737) (-867.180) (-855.924) * (-858.926) (-858.230) (-858.046) [-859.830] -- 0:02:40
188000 -- [-854.301] (-860.950) (-864.555) (-866.546) * (-860.828) [-857.076] (-858.202) (-863.303) -- 0:02:39
189000 -- (-860.858) [-850.889] (-866.675) (-865.311) * (-856.520) (-857.899) [-858.675] (-877.546) -- 0:02:43
190000 -- (-861.790) (-852.303) [-859.269] (-860.654) * (-859.628) [-855.132] (-863.612) (-859.561) -- 0:02:42
Average standard deviation of split frequencies: 0.016166
191000 -- (-863.677) [-859.912] (-858.933) (-856.409) * (-864.542) [-860.363] (-857.777) (-852.663) -- 0:02:40
192000 -- (-864.562) (-855.558) (-862.001) [-859.758] * (-854.126) [-854.419] (-854.997) (-862.142) -- 0:02:39
193000 -- (-868.540) (-857.801) (-860.137) [-855.736] * (-856.525) [-856.529] (-862.011) (-861.065) -- 0:02:38
194000 -- (-856.425) (-860.184) [-864.508] (-855.209) * [-854.449] (-859.064) (-872.037) (-863.030) -- 0:02:42
195000 -- [-858.227] (-863.812) (-859.214) (-860.828) * [-856.782] (-860.628) (-852.399) (-862.461) -- 0:02:41
Average standard deviation of split frequencies: 0.015911
196000 -- [-857.754] (-865.001) (-866.286) (-863.707) * (-863.100) [-857.398] (-860.766) (-863.381) -- 0:02:39
197000 -- (-866.077) (-855.326) [-860.116] (-863.240) * (-857.874) [-854.833] (-866.261) (-863.895) -- 0:02:38
198000 -- (-869.016) (-854.230) (-857.373) [-856.638] * (-865.976) [-860.312] (-856.516) (-858.507) -- 0:02:37
199000 -- (-856.898) [-858.362] (-858.852) (-862.189) * (-861.620) [-852.782] (-857.528) (-861.727) -- 0:02:41
200000 -- (-859.535) [-857.616] (-856.635) (-861.659) * (-868.623) (-856.674) [-857.801] (-859.367) -- 0:02:40
Average standard deviation of split frequencies: 0.015541
201000 -- (-859.089) (-864.786) [-859.522] (-860.647) * (-865.939) (-859.549) (-865.514) [-863.094] -- 0:02:39
202000 -- [-859.216] (-858.802) (-858.099) (-854.833) * (-854.986) [-861.758] (-870.164) (-856.050) -- 0:02:38
203000 -- (-861.850) (-862.411) [-857.905] (-861.194) * (-854.869) [-861.952] (-856.587) (-856.427) -- 0:02:37
204000 -- (-863.086) [-853.363] (-868.851) (-858.420) * (-856.889) [-860.448] (-860.981) (-862.846) -- 0:02:39
205000 -- (-857.151) [-858.209] (-870.238) (-856.412) * (-857.866) (-858.005) [-856.251] (-857.977) -- 0:02:39
Average standard deviation of split frequencies: 0.015138
206000 -- (-860.941) (-861.002) (-864.651) [-855.455] * (-857.099) [-862.310] (-857.372) (-862.026) -- 0:02:38
207000 -- (-872.265) [-854.337] (-864.052) (-860.099) * (-861.001) [-860.440] (-852.009) (-863.686) -- 0:02:37
208000 -- (-876.638) (-856.494) [-853.053] (-859.550) * [-863.209] (-865.696) (-856.246) (-861.953) -- 0:02:36
209000 -- (-867.714) [-854.841] (-863.468) (-856.778) * (-861.444) [-864.350] (-856.532) (-862.520) -- 0:02:38
210000 -- (-864.344) (-858.082) (-862.518) [-862.661] * (-866.827) [-858.211] (-861.911) (-865.448) -- 0:02:38
Average standard deviation of split frequencies: 0.012393
211000 -- [-855.456] (-855.526) (-855.740) (-863.267) * (-867.714) (-866.395) (-856.369) [-859.173] -- 0:02:37
212000 -- (-859.379) (-863.545) [-858.481] (-866.867) * (-857.226) (-873.311) [-856.817] (-855.298) -- 0:02:36
213000 -- [-853.461] (-860.520) (-859.228) (-854.616) * (-861.719) (-860.408) (-855.497) [-854.039] -- 0:02:35
214000 -- (-856.175) [-858.033] (-865.823) (-857.446) * [-861.646] (-861.635) (-856.493) (-859.742) -- 0:02:37
215000 -- (-856.564) (-857.548) (-860.503) [-861.252] * [-858.394] (-867.157) (-861.026) (-855.676) -- 0:02:37
Average standard deviation of split frequencies: 0.012255
216000 -- (-857.232) [-856.398] (-859.296) (-855.941) * (-856.036) (-863.042) [-862.265] (-860.406) -- 0:02:36
217000 -- (-858.169) (-862.211) [-857.593] (-862.914) * [-858.506] (-857.676) (-855.911) (-856.902) -- 0:02:35
218000 -- [-863.656] (-860.108) (-857.145) (-861.491) * [-858.616] (-862.775) (-862.186) (-855.159) -- 0:02:34
219000 -- [-860.670] (-861.009) (-861.371) (-864.719) * (-864.407) (-862.421) (-863.451) [-857.624] -- 0:02:36
220000 -- (-863.312) [-867.899] (-862.413) (-869.187) * (-857.930) [-859.849] (-856.138) (-861.000) -- 0:02:36
Average standard deviation of split frequencies: 0.010353
221000 -- (-858.993) [-857.988] (-864.676) (-868.134) * (-857.240) (-860.529) (-862.133) [-863.617] -- 0:02:35
222000 -- (-860.834) (-855.210) (-864.453) [-862.470] * (-854.200) (-861.534) (-858.102) [-858.783] -- 0:02:34
223000 -- (-863.079) [-858.675] (-875.859) (-858.816) * (-856.844) [-857.485] (-853.460) (-858.007) -- 0:02:33
224000 -- (-861.312) [-861.556] (-862.994) (-859.989) * (-857.015) [-855.621] (-859.924) (-862.562) -- 0:02:35
225000 -- (-857.299) (-863.351) [-861.437] (-863.440) * (-859.712) (-858.698) (-865.275) [-856.065] -- 0:02:35
Average standard deviation of split frequencies: 0.008825
226000 -- (-858.805) [-860.190] (-859.584) (-858.424) * (-859.042) (-862.866) (-862.925) [-856.848] -- 0:02:34
227000 -- (-863.214) (-861.500) [-860.472] (-870.103) * [-860.020] (-858.952) (-867.556) (-865.909) -- 0:02:33
228000 -- (-867.409) (-858.559) (-858.066) [-857.455] * (-859.518) [-859.148] (-865.491) (-865.571) -- 0:02:32
229000 -- (-859.014) [-856.094] (-867.822) (-862.604) * [-857.098] (-871.249) (-863.403) (-858.730) -- 0:02:34
230000 -- (-861.346) [-856.037] (-858.628) (-857.884) * [-855.409] (-859.774) (-858.503) (-864.589) -- 0:02:34
Average standard deviation of split frequencies: 0.008646
231000 -- (-864.180) (-856.718) (-863.819) [-865.970] * [-862.524] (-862.934) (-860.207) (-860.895) -- 0:02:33
232000 -- (-865.096) [-857.714] (-856.799) (-858.251) * (-857.789) (-854.918) [-857.366] (-865.829) -- 0:02:32
233000 -- (-863.782) (-859.056) (-862.258) [-855.406] * (-858.467) (-861.729) [-861.416] (-863.527) -- 0:02:31
234000 -- [-858.889] (-854.225) (-859.078) (-861.799) * [-858.576] (-862.465) (-859.564) (-862.648) -- 0:02:33
235000 -- (-861.923) (-861.148) (-866.151) [-864.388] * (-856.917) [-861.082] (-865.862) (-859.908) -- 0:02:33
Average standard deviation of split frequencies: 0.008144
236000 -- (-864.014) [-857.388] (-862.023) (-863.010) * [-853.981] (-855.079) (-864.176) (-864.282) -- 0:02:32
237000 -- (-859.766) (-855.827) (-865.525) [-860.872] * (-862.937) [-861.941] (-866.970) (-856.557) -- 0:02:31
238000 -- [-867.584] (-859.415) (-862.209) (-863.815) * (-858.989) [-858.373] (-860.036) (-862.053) -- 0:02:30
239000 -- (-866.506) (-860.406) [-861.409] (-860.572) * [-854.942] (-858.009) (-859.422) (-867.162) -- 0:02:32
240000 -- (-875.995) [-858.209] (-862.547) (-860.149) * (-860.780) (-860.342) (-856.517) [-855.423] -- 0:02:32
Average standard deviation of split frequencies: 0.007684
241000 -- (-868.126) (-863.795) [-857.248] (-862.249) * (-862.170) (-859.673) (-858.630) [-854.255] -- 0:02:31
242000 -- (-866.868) (-862.608) [-860.775] (-862.802) * (-861.667) (-854.583) (-856.344) [-860.636] -- 0:02:30
243000 -- (-859.022) (-860.499) [-862.960] (-863.131) * (-865.149) (-861.889) [-856.172] (-861.102) -- 0:02:29
244000 -- (-862.608) (-862.470) [-857.595] (-858.724) * (-870.410) (-860.754) (-857.390) [-857.954] -- 0:02:31
245000 -- (-860.990) [-856.161] (-865.438) (-858.182) * (-862.818) (-860.712) [-856.854] (-856.532) -- 0:02:31
Average standard deviation of split frequencies: 0.007223
246000 -- (-866.933) [-854.458] (-860.208) (-865.309) * (-856.110) [-859.167] (-857.737) (-860.995) -- 0:02:30
247000 -- (-863.899) [-855.715] (-858.475) (-856.300) * (-862.031) [-852.570] (-858.431) (-858.348) -- 0:02:29
248000 -- (-870.936) [-857.251] (-858.038) (-863.454) * (-861.180) (-864.453) (-865.699) [-856.804] -- 0:02:28
249000 -- (-865.407) [-855.534] (-858.371) (-866.338) * (-861.339) [-863.190] (-860.341) (-858.744) -- 0:02:30
250000 -- (-860.485) (-860.139) (-862.085) [-858.136] * (-857.431) (-862.504) [-859.512] (-864.325) -- 0:02:30
Average standard deviation of split frequencies: 0.006944
251000 -- [-860.123] (-857.915) (-859.509) (-873.050) * (-865.235) (-861.405) (-859.082) [-862.046] -- 0:02:29
252000 -- [-862.651] (-850.184) (-863.198) (-864.525) * (-859.560) (-865.568) (-856.342) [-856.062] -- 0:02:28
253000 -- [-863.583] (-862.817) (-857.039) (-863.937) * (-853.992) [-862.851] (-859.193) (-867.203) -- 0:02:27
254000 -- (-856.931) (-861.500) [-857.041] (-863.263) * (-863.790) (-858.350) [-852.671] (-861.395) -- 0:02:29
255000 -- (-862.128) (-864.461) (-865.019) [-858.320] * (-869.925) (-856.758) [-853.759] (-856.953) -- 0:02:29
Average standard deviation of split frequencies: 0.008216
256000 -- (-858.600) (-869.586) [-857.677] (-870.068) * (-855.829) (-852.402) (-856.486) [-860.746] -- 0:02:28
257000 -- [-861.159] (-866.750) (-859.152) (-866.371) * [-857.951] (-854.107) (-860.916) (-860.424) -- 0:02:27
258000 -- (-859.078) (-854.990) (-856.793) [-857.921] * (-864.514) [-855.935] (-859.977) (-868.239) -- 0:02:26
259000 -- (-864.898) (-864.902) [-853.080] (-862.091) * (-860.182) [-855.329] (-858.612) (-858.558) -- 0:02:28
260000 -- (-863.748) (-853.610) (-858.534) [-858.548] * (-860.740) [-854.564] (-861.608) (-863.572) -- 0:02:28
Average standard deviation of split frequencies: 0.009181
261000 -- (-864.598) [-854.811] (-863.088) (-862.068) * [-858.521] (-861.817) (-863.612) (-863.462) -- 0:02:27
262000 -- [-857.100] (-858.429) (-862.878) (-870.036) * (-863.936) (-865.971) [-855.447] (-855.655) -- 0:02:26
263000 -- [-857.099] (-870.203) (-863.391) (-855.487) * [-861.090] (-856.207) (-854.919) (-862.457) -- 0:02:25
264000 -- [-860.022] (-856.820) (-864.015) (-872.222) * (-856.481) (-859.226) [-863.573] (-862.437) -- 0:02:27
265000 -- [-853.780] (-857.432) (-856.921) (-864.441) * [-858.571] (-864.154) (-863.969) (-861.400) -- 0:02:27
Average standard deviation of split frequencies: 0.009270
266000 -- (-864.986) (-861.815) [-857.976] (-860.610) * (-857.706) (-870.147) [-854.526] (-859.591) -- 0:02:26
267000 -- (-855.374) (-859.701) (-856.710) [-858.356] * (-854.897) (-865.581) (-873.387) [-855.012] -- 0:02:25
268000 -- [-853.696] (-864.257) (-859.134) (-859.800) * (-856.891) (-870.398) (-856.136) [-861.051] -- 0:02:24
269000 -- (-865.497) (-857.738) [-855.605] (-856.730) * (-857.760) [-860.324] (-861.111) (-855.141) -- 0:02:26
270000 -- (-858.033) [-860.714] (-859.464) (-864.443) * (-859.360) (-859.476) (-862.046) [-862.082] -- 0:02:26
Average standard deviation of split frequencies: 0.009914
271000 -- [-855.107] (-864.131) (-855.751) (-866.777) * [-860.201] (-858.320) (-863.858) (-861.909) -- 0:02:25
272000 -- (-858.970) [-853.610] (-859.893) (-856.651) * (-856.318) (-855.363) [-855.198] (-853.863) -- 0:02:24
273000 -- (-860.266) (-861.591) (-854.185) [-858.805] * (-863.355) (-856.456) (-858.515) [-852.659] -- 0:02:23
274000 -- (-857.450) (-857.887) (-859.574) [-853.026] * (-858.479) (-859.854) [-853.907] (-862.372) -- 0:02:25
275000 -- [-858.498] (-861.774) (-862.715) (-863.066) * (-860.130) (-860.935) [-861.038] (-862.350) -- 0:02:25
Average standard deviation of split frequencies: 0.008671
276000 -- (-862.676) (-859.740) (-867.060) [-858.893] * (-865.954) (-861.347) (-860.289) [-865.865] -- 0:02:24
277000 -- [-855.018] (-853.303) (-857.607) (-857.849) * (-861.464) (-869.801) (-857.977) [-855.917] -- 0:02:23
278000 -- [-856.241] (-861.217) (-867.582) (-866.064) * (-856.622) (-859.802) (-857.834) [-862.967] -- 0:02:22
279000 -- (-860.481) (-860.119) (-860.620) [-862.510] * (-859.598) (-856.860) (-855.142) [-858.128] -- 0:02:24
280000 -- (-856.234) [-853.156] (-859.593) (-857.884) * (-858.803) (-863.885) [-859.286] (-862.272) -- 0:02:24
Average standard deviation of split frequencies: 0.010078
281000 -- (-861.687) (-857.455) (-860.126) [-856.895] * (-862.129) [-863.323] (-855.856) (-854.012) -- 0:02:23
282000 -- (-859.469) [-857.643] (-858.571) (-854.555) * (-863.987) [-859.675] (-857.924) (-865.249) -- 0:02:22
283000 -- (-864.662) (-856.242) [-862.695] (-861.665) * (-856.844) (-859.947) (-861.868) [-859.360] -- 0:02:21
284000 -- [-863.050] (-854.922) (-859.149) (-858.166) * [-861.435] (-860.806) (-860.935) (-858.917) -- 0:02:23
285000 -- [-856.049] (-863.650) (-863.319) (-860.197) * (-866.507) (-855.165) (-862.507) [-854.222] -- 0:02:23
Average standard deviation of split frequencies: 0.011284
286000 -- [-857.872] (-862.044) (-856.764) (-859.996) * (-863.242) [-862.025] (-862.154) (-857.475) -- 0:02:22
287000 -- [-853.173] (-854.418) (-859.847) (-863.926) * [-857.657] (-858.335) (-858.588) (-858.555) -- 0:02:21
288000 -- [-859.117] (-868.480) (-859.941) (-864.352) * (-857.562) (-863.003) [-855.079] (-865.443) -- 0:02:20
289000 -- (-862.633) [-860.245] (-860.281) (-857.914) * [-855.117] (-861.643) (-856.719) (-856.886) -- 0:02:22
290000 -- (-860.392) [-854.173] (-866.825) (-863.193) * (-861.284) (-862.524) (-865.160) [-863.861] -- 0:02:22
Average standard deviation of split frequencies: 0.010105
291000 -- (-857.762) [-856.292] (-855.811) (-862.257) * (-862.647) (-863.984) (-856.693) [-861.075] -- 0:02:21
292000 -- (-859.152) [-858.651] (-864.282) (-866.703) * (-858.499) [-858.660] (-862.159) (-857.260) -- 0:02:20
293000 -- (-861.728) (-858.725) [-854.508] (-857.558) * (-861.491) (-860.793) (-860.503) [-854.410] -- 0:02:19
294000 -- (-855.557) [-857.946] (-859.703) (-864.309) * [-856.110] (-854.721) (-861.743) (-870.454) -- 0:02:21
295000 -- (-856.693) (-856.610) [-855.129] (-870.576) * (-858.789) (-854.985) [-861.021] (-857.432) -- 0:02:21
Average standard deviation of split frequencies: 0.008943
296000 -- (-856.436) (-856.284) [-863.082] (-862.382) * (-863.302) [-857.886] (-860.519) (-854.752) -- 0:02:20
297000 -- (-859.950) [-856.933] (-862.098) (-865.951) * (-865.000) (-854.909) (-863.986) [-857.884] -- 0:02:19
298000 -- (-862.293) [-856.742] (-859.598) (-856.041) * (-862.495) [-857.666] (-861.622) (-869.542) -- 0:02:18
299000 -- (-859.521) [-856.905] (-860.068) (-863.863) * (-863.448) (-860.182) [-860.456] (-855.569) -- 0:02:20
300000 -- [-859.962] (-860.440) (-873.239) (-859.339) * (-860.284) (-860.213) [-857.938] (-854.263) -- 0:02:20
Average standard deviation of split frequencies: 0.009769
301000 -- [-858.986] (-856.380) (-881.786) (-862.756) * (-859.632) (-857.970) [-857.971] (-858.711) -- 0:02:19
302000 -- (-858.962) (-863.508) [-860.926] (-872.422) * (-854.039) (-860.107) (-857.093) [-858.756] -- 0:02:18
303000 -- (-861.719) (-856.192) [-855.307] (-866.613) * (-863.343) [-862.319] (-861.238) (-861.099) -- 0:02:18
304000 -- (-872.284) (-865.403) [-863.926] (-868.709) * (-858.904) [-856.579] (-859.326) (-865.667) -- 0:02:19
305000 -- (-859.598) [-854.039] (-869.646) (-869.216) * [-858.888] (-862.526) (-855.976) (-864.794) -- 0:02:19
Average standard deviation of split frequencies: 0.008414
306000 -- (-861.498) [-862.494] (-866.630) (-861.989) * (-864.753) (-862.577) (-855.490) [-857.485] -- 0:02:18
307000 -- [-859.221] (-856.672) (-854.446) (-863.092) * (-857.548) [-862.339] (-857.258) (-858.965) -- 0:02:17
308000 -- (-858.267) [-857.837] (-858.804) (-858.357) * (-862.671) (-862.254) [-861.077] (-860.511) -- 0:02:17
309000 -- [-853.484] (-861.135) (-859.217) (-859.632) * (-866.014) (-858.955) [-860.987] (-855.251) -- 0:02:18
310000 -- (-859.668) (-855.139) [-861.129] (-859.712) * (-857.310) (-856.771) (-858.730) [-855.825] -- 0:02:18
Average standard deviation of split frequencies: 0.008287
311000 -- (-859.553) (-867.657) [-860.092] (-858.421) * [-855.812] (-862.234) (-857.137) (-864.937) -- 0:02:17
312000 -- [-857.310] (-856.486) (-858.839) (-863.276) * [-853.758] (-863.259) (-859.182) (-860.496) -- 0:02:16
313000 -- (-854.840) (-858.499) [-856.085] (-865.290) * [-853.289] (-858.152) (-854.165) (-865.997) -- 0:02:16
314000 -- [-860.535] (-862.553) (-860.357) (-869.277) * [-859.381] (-858.703) (-864.729) (-858.401) -- 0:02:17
315000 -- (-862.522) (-855.978) [-861.787] (-859.461) * (-861.896) (-858.411) (-857.569) [-860.519] -- 0:02:17
Average standard deviation of split frequencies: 0.007688
316000 -- (-859.765) (-858.233) (-862.603) [-859.736] * (-856.029) (-867.979) [-863.491] (-855.898) -- 0:02:16
317000 -- (-862.977) [-859.349] (-860.467) (-861.376) * (-863.908) (-858.006) [-854.569] (-861.979) -- 0:02:15
318000 -- (-862.820) (-855.686) (-859.330) [-862.953] * (-864.952) (-865.867) (-856.693) [-857.379] -- 0:02:15
319000 -- (-857.673) (-862.579) [-859.816] (-859.280) * [-858.622] (-854.622) (-857.485) (-857.685) -- 0:02:16
320000 -- [-857.947] (-862.125) (-859.066) (-860.852) * (-853.787) (-861.162) [-853.404] (-861.166) -- 0:02:16
Average standard deviation of split frequencies: 0.007350
321000 -- (-859.443) (-861.176) (-856.183) [-858.608] * (-853.302) (-869.336) [-861.789] (-863.187) -- 0:02:15
322000 -- (-859.573) (-857.770) (-861.193) [-860.674] * (-861.092) [-859.061] (-855.356) (-864.384) -- 0:02:14
323000 -- (-861.475) (-869.443) [-857.149] (-860.950) * [-856.016] (-860.450) (-856.506) (-863.413) -- 0:02:14
324000 -- (-857.714) (-862.037) [-859.790] (-858.728) * [-860.473] (-861.284) (-856.989) (-864.294) -- 0:02:15
325000 -- (-857.806) (-861.263) (-857.801) [-853.946] * (-870.068) (-854.713) (-866.111) [-860.342] -- 0:02:15
Average standard deviation of split frequencies: 0.007230
326000 -- (-867.564) [-862.838] (-856.799) (-856.511) * [-872.136] (-857.087) (-863.280) (-858.891) -- 0:02:14
327000 -- (-853.394) [-857.557] (-859.326) (-855.526) * (-862.287) [-860.690] (-860.911) (-858.635) -- 0:02:13
328000 -- (-862.968) [-856.735] (-857.047) (-857.577) * (-862.334) (-867.594) (-860.909) [-858.077] -- 0:02:13
329000 -- (-866.027) [-855.971] (-863.862) (-857.734) * [-858.837] (-859.997) (-864.259) (-853.782) -- 0:02:14
330000 -- (-864.319) [-858.779] (-865.544) (-857.399) * (-861.397) [-864.252] (-864.255) (-856.313) -- 0:02:14
Average standard deviation of split frequencies: 0.006909
331000 -- (-862.170) [-855.803] (-862.925) (-860.916) * (-853.776) (-859.043) (-862.680) [-857.496] -- 0:02:13
332000 -- (-859.546) (-859.909) (-861.828) [-856.780] * [-862.891] (-859.831) (-860.437) (-865.399) -- 0:02:12
333000 -- (-867.709) [-858.235] (-862.489) (-860.503) * (-862.528) (-861.657) (-862.621) [-859.418] -- 0:02:12
334000 -- [-860.681] (-865.695) (-864.324) (-857.060) * [-861.419] (-862.357) (-867.897) (-858.077) -- 0:02:13
335000 -- (-862.941) [-856.242] (-864.545) (-857.981) * [-856.034] (-858.028) (-863.494) (-855.906) -- 0:02:13
Average standard deviation of split frequencies: 0.006583
336000 -- (-862.204) [-857.601] (-857.484) (-857.679) * [-861.802] (-859.078) (-862.495) (-856.367) -- 0:02:12
337000 -- [-859.504] (-856.507) (-861.832) (-859.695) * (-859.178) (-864.206) [-862.444] (-857.829) -- 0:02:11
338000 -- [-854.681] (-859.377) (-868.617) (-858.051) * (-856.962) [-861.238] (-863.437) (-861.219) -- 0:02:11
339000 -- (-859.320) (-864.837) (-864.560) [-854.165] * (-854.462) (-865.926) [-863.252] (-857.345) -- 0:02:12
340000 -- [-859.429] (-859.272) (-864.880) (-853.706) * (-863.506) (-858.816) (-858.213) [-855.878] -- 0:02:12
Average standard deviation of split frequencies: 0.006493
341000 -- (-865.686) (-855.704) (-864.592) [-857.790] * (-857.851) (-864.981) (-864.163) [-857.690] -- 0:02:11
342000 -- (-855.439) (-865.595) (-863.739) [-857.108] * (-858.508) [-859.831] (-862.790) (-853.678) -- 0:02:10
343000 -- (-859.383) (-863.842) (-855.515) [-857.296] * [-859.841] (-858.137) (-855.076) (-857.683) -- 0:02:10
344000 -- (-862.417) (-860.069) [-856.374] (-858.523) * (-854.616) (-861.975) (-862.590) [-853.936] -- 0:02:11
345000 -- (-865.923) (-864.317) [-852.886] (-862.397) * (-861.011) (-859.631) (-864.732) [-855.286] -- 0:02:11
Average standard deviation of split frequencies: 0.006393
346000 -- (-863.433) (-862.510) (-856.083) [-860.558] * [-857.507] (-859.971) (-855.552) (-861.970) -- 0:02:10
347000 -- (-857.897) (-862.617) [-860.226] (-861.397) * (-860.484) (-859.183) [-858.983] (-856.773) -- 0:02:09
348000 -- (-864.570) [-855.582] (-863.007) (-857.805) * (-860.429) (-867.876) [-855.175] (-860.712) -- 0:02:09
349000 -- (-867.267) (-864.599) (-856.168) [-857.511] * (-862.859) [-855.206] (-864.187) (-861.106) -- 0:02:10
350000 -- (-855.799) (-860.934) (-855.721) [-860.495] * (-866.810) (-860.914) [-854.464] (-852.411) -- 0:02:10
Average standard deviation of split frequencies: 0.006618
351000 -- [-855.740] (-856.558) (-867.606) (-861.494) * (-867.187) [-853.452] (-858.817) (-858.324) -- 0:02:09
352000 -- (-858.284) (-864.533) (-854.630) [-861.021] * (-859.123) [-860.027] (-859.982) (-856.504) -- 0:02:08
353000 -- (-860.211) [-857.756] (-856.844) (-861.717) * (-857.004) [-862.178] (-858.767) (-859.886) -- 0:02:08
354000 -- (-864.044) (-867.252) (-855.288) [-858.570] * (-859.753) [-864.545] (-865.763) (-856.773) -- 0:02:09
355000 -- (-855.197) [-860.997] (-859.865) (-860.472) * (-857.215) (-864.727) (-861.383) [-855.187] -- 0:02:09
Average standard deviation of split frequencies: 0.007028
356000 -- [-859.578] (-861.448) (-864.325) (-858.000) * (-861.652) (-862.479) [-857.227] (-862.554) -- 0:02:08
357000 -- (-859.856) (-862.312) [-857.889] (-862.860) * (-860.025) [-864.634] (-856.325) (-869.969) -- 0:02:07
358000 -- (-856.483) [-860.894] (-857.470) (-857.580) * (-863.875) [-856.118] (-866.538) (-863.383) -- 0:02:07
359000 -- [-860.286] (-858.555) (-862.199) (-869.037) * [-864.597] (-862.424) (-857.466) (-863.792) -- 0:02:08
360000 -- (-856.967) [-860.250] (-860.190) (-864.849) * (-858.690) [-855.373] (-859.664) (-863.979) -- 0:02:08
Average standard deviation of split frequencies: 0.007541
361000 -- (-854.030) (-857.569) (-861.435) [-865.399] * (-865.523) (-859.895) [-859.280] (-861.091) -- 0:02:07
362000 -- (-857.706) (-861.937) (-860.188) [-859.403] * (-859.184) [-857.580] (-855.576) (-881.449) -- 0:02:06
363000 -- (-866.307) (-862.034) (-859.003) [-859.336] * (-853.493) (-859.940) [-860.745] (-860.380) -- 0:02:06
364000 -- (-861.036) (-864.749) [-867.672] (-853.320) * (-852.399) [-854.054] (-859.762) (-859.921) -- 0:02:07
365000 -- (-862.663) (-857.293) (-862.682) [-851.636] * (-858.368) (-865.608) [-857.983] (-862.089) -- 0:02:07
Average standard deviation of split frequencies: 0.008421
366000 -- (-867.576) (-861.476) (-857.414) [-855.631] * (-861.974) (-865.413) (-866.953) [-855.506] -- 0:02:06
367000 -- [-860.541] (-863.998) (-857.050) (-865.482) * (-855.299) [-857.816] (-857.683) (-859.031) -- 0:02:05
368000 -- (-861.211) (-861.244) (-864.645) [-858.312] * (-864.482) (-856.571) [-857.378] (-853.869) -- 0:02:05
369000 -- [-856.850] (-866.305) (-858.529) (-856.825) * (-859.482) (-856.600) (-857.944) [-856.855] -- 0:02:06
370000 -- (-859.698) [-863.558] (-861.959) (-860.790) * (-860.371) (-858.697) (-867.376) [-857.170] -- 0:02:06
Average standard deviation of split frequencies: 0.007337
371000 -- (-854.849) (-863.828) [-855.221] (-858.207) * (-863.049) [-854.370] (-861.519) (-857.672) -- 0:02:05
372000 -- [-858.891] (-859.205) (-860.993) (-861.868) * [-855.474] (-859.195) (-859.011) (-858.834) -- 0:02:04
373000 -- (-857.147) (-860.447) (-864.685) [-862.231] * (-857.344) (-860.653) (-865.645) [-858.811] -- 0:02:04
374000 -- (-863.114) (-862.580) [-858.110] (-859.035) * [-856.626] (-861.505) (-860.461) (-858.558) -- 0:02:05
375000 -- (-856.526) (-857.925) (-863.372) [-853.714] * [-860.766] (-860.725) (-856.298) (-858.994) -- 0:02:05
Average standard deviation of split frequencies: 0.007619
376000 -- (-859.616) (-862.521) (-861.453) [-856.456] * [-857.752] (-858.188) (-859.867) (-861.674) -- 0:02:04
377000 -- (-864.543) [-852.599] (-865.107) (-861.628) * (-868.783) (-866.643) [-859.079] (-863.284) -- 0:02:03
378000 -- (-863.641) (-859.453) [-856.878] (-859.404) * (-855.300) (-858.679) [-859.592] (-863.193) -- 0:02:03
379000 -- (-863.825) (-866.140) (-862.031) [-856.924] * [-857.433] (-856.775) (-858.842) (-856.885) -- 0:02:04
380000 -- (-858.382) (-857.252) (-866.943) [-859.218] * (-855.756) (-861.074) (-855.868) [-858.096] -- 0:02:04
Average standard deviation of split frequencies: 0.007906
381000 -- (-857.772) (-861.939) (-873.427) [-854.095] * [-859.965] (-859.898) (-860.435) (-855.866) -- 0:02:03
382000 -- (-863.935) (-859.982) (-865.397) [-861.734] * [-860.881] (-850.703) (-856.166) (-855.195) -- 0:02:02
383000 -- (-857.982) (-859.575) [-856.282] (-865.899) * (-861.150) [-863.007] (-857.438) (-858.472) -- 0:02:04
384000 -- (-860.225) (-866.714) (-870.332) [-857.433] * [-859.481] (-859.365) (-861.406) (-855.857) -- 0:02:03
385000 -- [-856.777] (-858.590) (-864.791) (-865.935) * [-855.561] (-858.645) (-862.589) (-860.394) -- 0:02:03
Average standard deviation of split frequencies: 0.008925
386000 -- (-857.311) (-861.195) [-858.329] (-858.111) * (-853.316) [-857.030] (-873.368) (-862.383) -- 0:02:02
387000 -- (-856.277) (-856.820) [-866.104] (-858.028) * (-863.366) [-865.282] (-859.652) (-864.458) -- 0:02:01
388000 -- (-859.295) [-859.403] (-867.473) (-853.560) * (-868.121) (-862.766) [-861.795] (-861.660) -- 0:02:03
389000 -- [-855.631] (-854.765) (-858.521) (-856.387) * (-859.413) (-857.659) (-870.066) [-858.454] -- 0:02:02
390000 -- (-857.329) (-857.761) [-862.315] (-864.758) * (-860.059) (-863.224) [-866.217] (-859.487) -- 0:02:02
Average standard deviation of split frequencies: 0.009189
391000 -- (-864.055) [-859.405] (-856.180) (-857.176) * (-856.063) (-871.864) (-856.889) [-859.256] -- 0:02:01
392000 -- (-864.956) (-860.499) [-857.603] (-860.167) * [-858.663] (-867.126) (-859.984) (-863.534) -- 0:02:00
393000 -- (-859.337) (-864.741) [-859.059] (-863.350) * (-859.201) (-861.847) (-866.565) [-857.851] -- 0:02:02
394000 -- (-866.328) (-864.264) (-862.425) [-857.094] * (-864.902) (-861.305) (-861.624) [-857.706] -- 0:02:01
395000 -- (-859.742) (-859.512) (-862.315) [-860.209] * (-862.062) (-868.981) (-860.628) [-859.470] -- 0:02:01
Average standard deviation of split frequencies: 0.009432
396000 -- (-861.132) [-856.737] (-855.702) (-859.519) * (-855.494) (-860.115) (-859.850) [-859.035] -- 0:02:00
397000 -- (-864.740) (-863.409) (-856.394) [-860.236] * (-857.954) (-860.445) [-860.441] (-865.981) -- 0:01:59
398000 -- (-866.464) (-871.636) [-859.737] (-861.326) * [-853.135] (-854.855) (-871.065) (-860.973) -- 0:01:59
399000 -- [-858.991] (-870.627) (-856.591) (-866.774) * (-855.752) (-860.993) [-859.311] (-870.911) -- 0:02:00
400000 -- (-867.879) (-856.446) [-853.218] (-861.812) * (-859.278) (-858.500) (-862.629) [-865.191] -- 0:02:00
Average standard deviation of split frequencies: 0.007874
401000 -- (-865.008) (-855.520) (-864.831) [-864.500] * [-860.021] (-859.247) (-860.727) (-868.474) -- 0:01:59
402000 -- (-865.224) (-858.725) (-862.822) [-857.656] * (-858.172) [-856.127] (-861.058) (-864.135) -- 0:01:59
403000 -- (-864.624) (-856.769) [-862.010] (-855.235) * (-857.039) [-855.240] (-858.507) (-858.341) -- 0:01:58
404000 -- [-856.456] (-854.714) (-865.142) (-855.564) * [-863.036] (-871.519) (-854.617) (-864.548) -- 0:01:59
405000 -- (-866.209) (-865.282) [-854.558] (-858.854) * [-856.947] (-859.816) (-859.611) (-860.876) -- 0:01:59
Average standard deviation of split frequencies: 0.007770
406000 -- [-853.859] (-855.017) (-861.809) (-856.978) * [-860.207] (-872.526) (-857.218) (-853.110) -- 0:01:58
407000 -- (-859.708) (-859.606) [-861.222] (-859.978) * (-861.562) (-864.397) [-862.456] (-864.749) -- 0:01:58
408000 -- (-858.048) (-861.254) (-861.869) [-863.573] * (-863.253) [-854.193] (-855.462) (-864.735) -- 0:01:58
409000 -- [-861.855] (-864.088) (-861.589) (-857.985) * [-864.833] (-859.053) (-859.124) (-864.966) -- 0:01:58
410000 -- [-860.813] (-854.889) (-859.084) (-867.873) * (-859.888) (-856.883) [-859.486] (-864.957) -- 0:01:58
Average standard deviation of split frequencies: 0.007594
411000 -- (-862.306) (-859.552) (-857.771) [-855.222] * (-858.245) (-854.332) [-855.391] (-862.737) -- 0:01:57
412000 -- (-855.318) (-861.514) (-867.239) [-857.960] * [-861.143] (-863.968) (-854.607) (-859.779) -- 0:01:57
413000 -- (-856.759) (-862.033) (-866.118) [-851.467] * (-860.794) [-858.578] (-856.096) (-860.016) -- 0:01:57
414000 -- (-866.010) [-861.549] (-865.597) (-861.492) * (-865.364) [-854.833] (-874.721) (-862.252) -- 0:01:57
415000 -- [-868.501] (-858.163) (-856.362) (-864.698) * (-863.574) (-857.139) [-868.327] (-857.690) -- 0:01:57
Average standard deviation of split frequencies: 0.007148
416000 -- [-852.935] (-863.270) (-862.004) (-862.106) * [-858.321] (-854.277) (-862.332) (-859.989) -- 0:01:56
417000 -- (-858.231) [-862.102] (-856.674) (-861.594) * (-858.209) [-856.016] (-858.705) (-856.032) -- 0:01:56
418000 -- (-857.229) [-860.672] (-867.585) (-854.455) * (-858.698) (-854.394) [-858.228] (-861.753) -- 0:01:56
419000 -- [-854.219] (-857.403) (-862.195) (-864.613) * [-856.053] (-857.289) (-870.375) (-863.887) -- 0:01:56
420000 -- (-863.105) (-860.540) (-869.133) [-853.061] * (-860.001) (-863.259) (-858.587) [-855.341] -- 0:01:56
Average standard deviation of split frequencies: 0.007241
421000 -- [-859.458] (-865.283) (-862.794) (-857.508) * (-859.713) (-864.317) (-852.996) [-856.169] -- 0:01:55
422000 -- [-860.326] (-864.121) (-872.384) (-860.854) * (-861.116) [-857.850] (-865.510) (-858.011) -- 0:01:55
423000 -- (-857.156) [-859.222] (-865.589) (-857.063) * (-863.202) [-855.520] (-862.148) (-863.189) -- 0:01:55
424000 -- (-856.888) (-859.114) (-866.371) [-860.037] * (-865.900) [-856.459] (-858.470) (-861.618) -- 0:01:55
425000 -- (-861.642) [-855.112] (-862.826) (-858.568) * (-864.620) (-858.970) [-853.296] (-863.316) -- 0:01:55
Average standard deviation of split frequencies: 0.006469
426000 -- (-868.322) [-857.154] (-864.754) (-859.713) * (-867.161) (-864.480) (-857.457) [-858.761] -- 0:01:54
427000 -- (-862.548) (-860.240) (-859.507) [-852.255] * [-859.576] (-866.732) (-859.100) (-856.696) -- 0:01:54
428000 -- (-855.932) [-862.789] (-860.263) (-858.099) * (-863.220) [-857.903] (-856.689) (-861.761) -- 0:01:54
429000 -- (-857.325) (-868.528) [-857.322] (-857.087) * (-860.422) (-856.727) (-861.837) [-866.281] -- 0:01:54
430000 -- (-856.098) [-854.702] (-866.995) (-863.145) * (-864.012) (-858.488) [-858.101] (-862.409) -- 0:01:54
Average standard deviation of split frequencies: 0.006062
431000 -- (-863.446) (-863.309) (-857.749) [-865.023] * (-860.902) (-857.432) (-863.435) [-857.127] -- 0:01:53
432000 -- (-860.456) [-856.082] (-860.744) (-854.828) * (-856.973) (-861.136) (-861.949) [-864.430] -- 0:01:53
433000 -- (-858.588) (-866.746) [-855.767] (-860.339) * [-862.896] (-858.084) (-869.051) (-854.897) -- 0:01:53
434000 -- (-867.603) (-859.555) (-859.596) [-852.403] * (-861.895) [-856.642] (-869.205) (-859.281) -- 0:01:53
435000 -- (-861.319) [-859.390] (-857.780) (-867.974) * (-865.959) (-860.064) (-865.068) [-858.742] -- 0:01:53
Average standard deviation of split frequencies: 0.005822
436000 -- (-867.135) [-854.562] (-863.105) (-862.385) * [-857.235] (-858.162) (-856.189) (-872.213) -- 0:01:52
437000 -- (-861.065) (-876.258) [-855.891] (-866.078) * (-864.062) [-853.642] (-861.482) (-855.169) -- 0:01:52
438000 -- (-856.349) (-860.507) [-855.052] (-860.202) * (-865.122) (-857.893) (-866.250) [-855.739] -- 0:01:52
439000 -- (-857.140) [-856.994] (-860.219) (-860.970) * (-869.982) [-855.080] (-862.873) (-857.836) -- 0:01:52
440000 -- (-862.824) [-862.807] (-869.059) (-855.035) * (-855.367) [-861.976] (-869.830) (-862.405) -- 0:01:52
Average standard deviation of split frequencies: 0.005431
441000 -- [-860.410] (-860.930) (-860.455) (-856.087) * [-855.629] (-863.358) (-862.047) (-857.956) -- 0:01:51
442000 -- (-869.313) (-860.443) [-860.651] (-858.064) * (-857.926) [-865.345] (-859.629) (-859.102) -- 0:01:51
443000 -- [-861.326] (-862.377) (-853.903) (-859.235) * (-855.028) (-857.718) (-858.935) [-859.946] -- 0:01:51
444000 -- (-860.633) [-859.244] (-863.516) (-855.849) * (-862.717) (-860.024) [-858.994] (-862.510) -- 0:01:51
445000 -- [-865.554] (-862.164) (-859.679) (-856.579) * [-855.409] (-858.534) (-863.097) (-856.900) -- 0:01:51
Average standard deviation of split frequencies: 0.005854
446000 -- (-857.624) (-860.999) (-867.220) [-858.252] * (-863.911) [-861.002] (-869.041) (-863.422) -- 0:01:50
447000 -- (-859.861) (-863.211) (-855.753) [-863.826] * (-858.046) (-861.789) (-859.667) [-861.780] -- 0:01:50
448000 -- (-859.326) [-853.682] (-863.891) (-853.655) * (-862.460) (-857.003) [-857.739] (-859.853) -- 0:01:50
449000 -- [-851.634] (-859.275) (-858.429) (-857.693) * (-858.028) (-863.692) (-862.750) [-863.603] -- 0:01:50
450000 -- (-857.474) (-865.337) [-862.169] (-856.007) * [-854.507] (-860.840) (-859.739) (-857.022) -- 0:01:50
Average standard deviation of split frequencies: 0.005471
451000 -- (-860.845) (-854.733) (-856.857) [-860.370] * (-856.188) (-859.432) [-866.310] (-862.004) -- 0:01:49
452000 -- (-858.045) [-859.343] (-863.047) (-858.971) * (-854.436) (-857.584) (-854.954) [-859.386] -- 0:01:49
453000 -- (-856.090) [-865.160] (-858.105) (-862.978) * [-856.358] (-855.348) (-859.101) (-863.802) -- 0:01:49
454000 -- (-858.873) (-855.411) (-852.270) [-854.207] * (-865.874) (-854.845) (-857.131) [-858.924] -- 0:01:49
455000 -- (-855.890) (-864.561) (-871.566) [-861.062] * [-855.249] (-855.321) (-859.302) (-858.072) -- 0:01:49
Average standard deviation of split frequencies: 0.006203
456000 -- (-856.820) [-855.393] (-860.566) (-861.852) * (-857.489) [-860.470] (-858.973) (-852.323) -- 0:01:48
457000 -- (-864.650) [-858.035] (-859.725) (-862.056) * (-857.845) [-855.607] (-863.587) (-859.978) -- 0:01:48
458000 -- (-858.422) (-855.333) [-866.039] (-864.007) * (-855.398) (-857.448) [-856.653] (-860.720) -- 0:01:48
459000 -- (-861.267) (-855.518) (-855.564) [-861.893] * (-853.262) (-860.709) [-858.904] (-861.489) -- 0:01:48
460000 -- (-857.979) (-864.850) (-858.429) [-857.096] * [-855.149] (-857.530) (-857.142) (-860.604) -- 0:01:48
Average standard deviation of split frequencies: 0.005510
461000 -- [-855.687] (-853.627) (-856.040) (-864.914) * (-857.998) (-857.749) [-857.976] (-866.864) -- 0:01:47
462000 -- (-859.237) (-860.094) [-871.075] (-862.094) * (-859.913) [-856.122] (-861.625) (-859.392) -- 0:01:47
463000 -- (-859.736) (-860.830) [-855.484] (-855.398) * (-859.495) [-861.473] (-862.356) (-853.191) -- 0:01:47
464000 -- (-857.188) (-855.809) [-858.679] (-855.511) * (-860.579) (-854.362) (-859.125) [-856.478] -- 0:01:47
465000 -- (-863.504) (-863.205) [-865.550] (-854.643) * [-853.327] (-867.320) (-862.734) (-853.193) -- 0:01:47
Average standard deviation of split frequencies: 0.006459
466000 -- [-860.568] (-853.350) (-858.379) (-864.094) * [-863.314] (-858.924) (-856.995) (-861.700) -- 0:01:46
467000 -- (-860.362) (-854.082) (-861.526) [-861.885] * (-855.048) (-870.769) (-862.683) [-856.250] -- 0:01:46
468000 -- (-858.331) [-858.837] (-859.015) (-862.487) * (-863.020) (-859.133) [-855.848] (-857.659) -- 0:01:46
469000 -- (-860.633) (-859.747) (-858.821) [-855.788] * [-858.909] (-861.542) (-861.031) (-859.212) -- 0:01:46
470000 -- (-855.412) (-862.263) (-860.098) [-851.799] * (-862.166) (-868.515) (-857.196) [-859.238] -- 0:01:46
Average standard deviation of split frequencies: 0.005624
471000 -- (-858.800) (-858.673) (-864.247) [-853.779] * [-854.782] (-862.674) (-860.407) (-854.774) -- 0:01:45
472000 -- [-855.241] (-868.281) (-859.431) (-869.421) * [-857.862] (-862.143) (-867.467) (-857.123) -- 0:01:45
473000 -- (-857.702) (-863.189) [-857.857] (-862.635) * (-860.967) (-858.048) [-860.975] (-857.818) -- 0:01:45
474000 -- (-852.794) (-858.334) (-858.518) [-857.454] * [-856.452] (-865.006) (-862.983) (-857.396) -- 0:01:45
475000 -- (-862.911) (-865.231) [-858.529] (-858.308) * (-860.878) [-856.111] (-867.086) (-857.918) -- 0:01:45
Average standard deviation of split frequencies: 0.006018
476000 -- (-865.463) [-858.645] (-866.504) (-862.486) * (-857.590) (-852.601) [-860.221] (-870.942) -- 0:01:44
477000 -- [-863.067] (-862.090) (-867.903) (-859.704) * (-863.199) (-859.743) (-857.521) [-862.803] -- 0:01:44
478000 -- (-857.008) (-866.344) [-863.335] (-862.837) * (-858.709) (-862.635) (-857.000) [-854.413] -- 0:01:44
479000 -- (-860.134) (-869.225) (-864.063) [-861.098] * (-861.082) (-866.211) [-858.551] (-860.744) -- 0:01:44
480000 -- (-855.263) (-867.155) [-860.501] (-859.898) * (-860.305) [-859.766] (-858.144) (-861.892) -- 0:01:44
Average standard deviation of split frequencies: 0.005507
481000 -- (-858.860) (-862.226) (-861.851) [-862.206] * (-860.153) (-864.716) [-856.234] (-856.802) -- 0:01:43
482000 -- (-854.981) (-865.116) [-855.996] (-856.225) * [-858.660] (-866.398) (-867.201) (-857.207) -- 0:01:43
483000 -- (-865.585) (-856.605) [-852.523] (-867.648) * [-855.343] (-863.170) (-862.577) (-857.524) -- 0:01:43
484000 -- (-857.301) (-859.273) [-860.003] (-857.011) * [-859.592] (-869.867) (-862.364) (-857.911) -- 0:01:43
485000 -- [-857.179] (-864.138) (-861.160) (-870.644) * (-862.777) [-862.458] (-859.084) (-859.339) -- 0:01:43
Average standard deviation of split frequencies: 0.005596
486000 -- [-860.683] (-861.926) (-863.171) (-858.332) * (-853.843) (-857.736) [-867.703] (-872.974) -- 0:01:42
487000 -- (-871.860) (-865.046) [-860.990] (-855.869) * (-863.495) (-854.559) (-855.998) [-857.220] -- 0:01:42
488000 -- (-867.457) (-864.019) (-857.911) [-862.603] * (-855.450) (-860.426) (-858.283) [-854.903] -- 0:01:42
489000 -- [-855.110] (-863.848) (-860.094) (-861.302) * (-856.565) (-863.402) (-861.209) [-861.889] -- 0:01:42
490000 -- (-861.619) (-858.303) (-860.626) [-856.514] * [-863.531] (-858.164) (-866.691) (-857.702) -- 0:01:42
Average standard deviation of split frequencies: 0.005247
491000 -- (-863.703) (-858.578) (-860.040) [-855.391] * [-862.678] (-856.846) (-862.232) (-860.488) -- 0:01:41
492000 -- (-858.370) [-860.984] (-857.523) (-856.002) * (-859.092) [-855.812] (-863.346) (-860.642) -- 0:01:41
493000 -- (-856.136) [-855.474] (-859.103) (-863.066) * (-859.568) [-855.341] (-862.691) (-859.573) -- 0:01:41
494000 -- (-855.800) [-857.328] (-867.527) (-859.726) * (-856.945) (-865.100) (-857.047) [-855.534] -- 0:01:41
495000 -- (-867.435) (-860.776) (-872.505) [-859.862] * [-853.369] (-858.253) (-856.497) (-858.413) -- 0:01:41
Average standard deviation of split frequencies: 0.006214
496000 -- (-870.049) [-860.074] (-860.446) (-863.200) * (-861.760) [-856.405] (-859.919) (-857.183) -- 0:01:40
497000 -- (-858.095) [-861.427] (-860.681) (-863.877) * (-860.234) [-866.351] (-858.086) (-862.277) -- 0:01:40
498000 -- (-862.409) [-858.118] (-859.406) (-856.747) * (-861.357) (-865.842) [-857.005] (-860.035) -- 0:01:40
499000 -- [-862.140] (-871.083) (-858.599) (-866.186) * (-862.154) (-861.319) (-864.673) [-863.553] -- 0:01:40
500000 -- (-854.433) (-861.632) (-859.262) [-859.004] * [-857.628] (-856.940) (-859.060) (-856.120) -- 0:01:40
Average standard deviation of split frequencies: 0.006736
501000 -- [-853.983] (-865.390) (-860.047) (-868.626) * (-865.009) (-862.677) (-855.845) [-857.674] -- 0:01:39
502000 -- (-855.954) (-852.834) [-866.786] (-858.916) * (-859.797) (-862.066) [-857.476] (-857.797) -- 0:01:39
503000 -- [-862.407] (-858.926) (-866.952) (-853.731) * (-857.900) [-861.992] (-860.861) (-863.057) -- 0:01:38
504000 -- (-862.253) (-863.300) (-857.958) [-860.579] * (-858.570) (-858.202) [-863.684] (-855.003) -- 0:01:39
505000 -- [-866.203] (-868.943) (-861.523) (-859.975) * (-863.318) [-854.213] (-864.039) (-858.418) -- 0:01:39
Average standard deviation of split frequencies: 0.006808
506000 -- [-856.843] (-857.868) (-862.513) (-855.501) * [-856.524] (-860.186) (-862.883) (-857.672) -- 0:01:38
507000 -- (-858.307) [-856.904] (-860.119) (-856.984) * [-862.787] (-855.043) (-866.422) (-860.908) -- 0:01:38
508000 -- (-860.864) (-855.639) (-857.533) [-860.137] * (-860.516) [-856.968] (-863.102) (-859.291) -- 0:01:37
509000 -- (-859.993) [-853.599] (-856.831) (-864.358) * (-858.074) (-862.244) (-861.716) [-862.979] -- 0:01:38
510000 -- (-859.518) [-857.080] (-861.479) (-860.411) * (-861.918) (-860.204) [-858.181] (-868.922) -- 0:01:38
Average standard deviation of split frequencies: 0.007456
511000 -- (-859.020) (-854.463) (-861.981) [-854.460] * (-864.794) (-864.995) [-859.666] (-864.967) -- 0:01:37
512000 -- (-867.715) (-862.523) [-858.927] (-860.073) * (-863.375) [-859.993] (-858.296) (-858.776) -- 0:01:37
513000 -- [-862.226] (-861.328) (-866.873) (-855.216) * (-874.921) (-865.796) (-870.451) [-854.842] -- 0:01:36
514000 -- [-860.426] (-865.108) (-859.872) (-863.202) * (-866.662) [-855.554] (-871.954) (-862.275) -- 0:01:37
515000 -- [-855.626] (-861.402) (-859.000) (-862.950) * (-862.808) (-857.772) (-867.404) [-863.467] -- 0:01:37
Average standard deviation of split frequencies: 0.007801
516000 -- (-860.884) (-866.866) [-858.654] (-861.313) * [-860.202] (-861.212) (-859.381) (-870.327) -- 0:01:36
517000 -- (-858.636) (-864.645) [-862.363] (-871.053) * [-861.545] (-856.595) (-858.937) (-862.647) -- 0:01:36
518000 -- (-860.053) [-860.164] (-858.633) (-861.964) * (-861.116) (-867.831) [-868.205] (-865.312) -- 0:01:36
519000 -- [-855.357] (-859.632) (-863.687) (-867.776) * (-856.086) [-857.985] (-852.083) (-853.652) -- 0:01:36
520000 -- (-861.753) (-853.225) (-858.214) [-859.851] * (-854.264) (-858.259) [-859.821] (-861.812) -- 0:01:36
Average standard deviation of split frequencies: 0.006686
521000 -- [-861.356] (-860.564) (-864.376) (-864.745) * (-855.897) (-861.121) [-857.740] (-865.317) -- 0:01:35
522000 -- (-868.396) (-859.326) (-858.633) [-856.856] * (-860.858) [-861.268] (-858.029) (-863.454) -- 0:01:35
523000 -- (-864.178) (-859.501) (-861.814) [-855.983] * (-854.511) (-861.741) [-857.075] (-854.128) -- 0:01:35
524000 -- (-871.504) (-864.196) (-869.902) [-856.310] * (-862.202) (-859.110) (-857.269) [-857.827] -- 0:01:35
525000 -- (-862.566) (-856.361) [-856.189] (-858.497) * (-871.057) (-859.612) (-856.352) [-857.192] -- 0:01:35
Average standard deviation of split frequencies: 0.006480
526000 -- [-856.383] (-860.104) (-862.753) (-858.950) * [-861.542] (-858.181) (-859.171) (-855.478) -- 0:01:34
527000 -- [-863.156] (-864.821) (-853.801) (-871.203) * (-860.670) [-860.381] (-873.131) (-852.422) -- 0:01:34
528000 -- (-861.096) (-870.483) (-861.188) [-857.374] * [-854.576] (-859.932) (-859.584) (-861.756) -- 0:01:34
529000 -- (-861.116) (-867.536) [-861.439] (-860.792) * [-856.748] (-861.238) (-855.104) (-861.169) -- 0:01:34
530000 -- (-863.805) (-862.200) [-857.665] (-860.009) * (-861.666) [-859.541] (-856.132) (-860.464) -- 0:01:34
Average standard deviation of split frequencies: 0.006013
531000 -- [-860.723] (-854.567) (-854.137) (-862.868) * (-856.803) (-865.357) (-854.245) [-866.542] -- 0:01:33
532000 -- (-860.591) (-861.555) (-864.312) [-857.830] * [-855.915] (-862.810) (-854.196) (-862.331) -- 0:01:33
533000 -- [-857.528] (-878.223) (-859.677) (-859.722) * (-858.246) (-856.310) [-854.049] (-860.211) -- 0:01:33
534000 -- (-857.482) [-865.653] (-855.842) (-858.515) * [-861.613] (-864.070) (-854.999) (-857.868) -- 0:01:33
535000 -- (-864.501) (-874.224) (-859.167) [-857.926] * (-867.038) (-858.275) [-859.163] (-856.148) -- 0:01:33
Average standard deviation of split frequencies: 0.006224
536000 -- [-858.197] (-875.599) (-867.440) (-857.047) * (-861.202) (-858.160) (-861.113) [-862.004] -- 0:01:32
537000 -- [-854.616] (-870.471) (-863.015) (-862.880) * [-859.434] (-859.157) (-856.487) (-858.844) -- 0:01:32
538000 -- [-855.853] (-863.762) (-864.522) (-852.683) * (-862.034) (-854.105) (-864.609) [-856.099] -- 0:01:32
539000 -- [-856.337] (-862.396) (-860.487) (-850.673) * (-864.832) (-853.007) (-868.979) [-858.962] -- 0:01:32
540000 -- [-856.532] (-860.077) (-860.464) (-858.867) * (-859.705) (-868.389) (-870.506) [-855.905] -- 0:01:32
Average standard deviation of split frequencies: 0.005902
541000 -- (-861.550) (-858.198) [-855.356] (-855.365) * [-856.364] (-862.919) (-863.706) (-864.348) -- 0:01:31
542000 -- (-865.282) (-863.358) (-857.194) [-857.433] * [-858.663] (-862.172) (-861.267) (-863.990) -- 0:01:31
543000 -- (-862.317) [-858.443] (-854.284) (-862.573) * [-860.345] (-857.250) (-857.427) (-856.752) -- 0:01:31
544000 -- (-862.834) (-858.456) [-863.018] (-857.682) * (-858.291) (-859.321) [-851.469] (-857.807) -- 0:01:31
545000 -- [-859.277] (-860.756) (-863.115) (-856.397) * (-858.764) (-855.989) (-861.039) [-856.794] -- 0:01:31
Average standard deviation of split frequencies: 0.005712
546000 -- (-858.023) (-864.141) (-863.064) [-860.247] * (-853.296) (-856.744) [-857.190] (-854.187) -- 0:01:30
547000 -- (-864.968) [-852.135] (-868.948) (-863.580) * (-866.660) (-860.190) [-856.890] (-859.526) -- 0:01:30
548000 -- (-856.451) (-862.015) (-864.868) [-860.540] * (-866.134) (-859.242) (-865.209) [-862.611] -- 0:01:30
549000 -- [-857.068] (-856.722) (-866.460) (-862.168) * (-860.929) (-867.486) [-854.454] (-857.578) -- 0:01:30
550000 -- (-867.137) [-862.243] (-868.935) (-855.337) * [-856.811] (-865.971) (-856.286) (-862.984) -- 0:01:30
Average standard deviation of split frequencies: 0.005202
551000 -- (-860.611) (-853.910) (-861.954) [-853.885] * (-859.681) [-860.037] (-856.414) (-857.321) -- 0:01:29
552000 -- [-855.034] (-859.894) (-857.705) (-854.654) * [-857.108] (-859.474) (-862.071) (-865.695) -- 0:01:29
553000 -- (-867.211) [-856.217] (-858.553) (-862.851) * [-860.288] (-854.365) (-869.371) (-856.512) -- 0:01:29
554000 -- (-865.210) (-855.806) [-853.567] (-858.556) * [-861.250] (-855.626) (-863.532) (-857.947) -- 0:01:29
555000 -- (-858.995) [-860.057] (-859.633) (-856.561) * (-858.470) (-855.674) (-855.858) [-857.244] -- 0:01:29
Average standard deviation of split frequencies: 0.004891
556000 -- (-860.986) (-861.287) [-859.154] (-865.749) * (-856.354) [-858.822] (-858.322) (-855.924) -- 0:01:28
557000 -- (-860.910) (-857.041) [-861.516] (-864.398) * [-856.736] (-863.723) (-861.975) (-856.934) -- 0:01:28
558000 -- (-854.746) [-850.856] (-859.466) (-858.301) * (-867.542) [-860.803] (-868.537) (-854.658) -- 0:01:28
559000 -- (-863.696) (-861.953) [-856.105] (-863.832) * (-868.741) (-862.707) [-857.204] (-855.706) -- 0:01:28
560000 -- (-869.883) [-854.030] (-864.414) (-862.403) * (-859.689) [-860.008] (-862.453) (-862.476) -- 0:01:28
Average standard deviation of split frequencies: 0.004721
561000 -- [-865.928] (-858.260) (-857.192) (-859.474) * (-868.737) (-858.387) [-864.473] (-857.596) -- 0:01:27
562000 -- (-863.305) (-855.257) (-857.352) [-857.869] * [-858.748] (-860.241) (-863.307) (-854.397) -- 0:01:27
563000 -- (-865.128) (-867.446) (-866.784) [-855.738] * [-857.057] (-860.615) (-864.468) (-858.686) -- 0:01:27
564000 -- (-860.838) (-865.959) (-867.749) [-854.590] * (-860.197) (-864.990) (-867.115) [-857.525] -- 0:01:27
565000 -- (-862.226) [-864.042] (-860.084) (-858.545) * (-867.450) [-859.344] (-871.083) (-870.184) -- 0:01:27
Average standard deviation of split frequencies: 0.005446
566000 -- (-861.000) (-863.219) [-855.663] (-863.529) * (-862.550) (-856.774) [-863.504] (-867.454) -- 0:01:26
567000 -- (-859.240) [-858.577] (-855.766) (-857.036) * (-856.761) (-862.815) (-864.374) [-853.390] -- 0:01:26
568000 -- [-866.219] (-855.497) (-857.974) (-864.189) * (-861.102) [-858.062] (-866.060) (-858.998) -- 0:01:26
569000 -- (-857.461) (-865.071) [-856.990] (-870.046) * (-864.362) (-862.758) [-860.615] (-857.075) -- 0:01:26
570000 -- (-858.880) [-852.972] (-856.721) (-866.663) * [-864.794] (-860.498) (-857.106) (-860.520) -- 0:01:26
Average standard deviation of split frequencies: 0.004384
571000 -- [-854.062] (-857.349) (-862.175) (-868.464) * (-859.156) [-860.134] (-857.538) (-867.024) -- 0:01:25
572000 -- (-860.959) (-869.373) [-858.040] (-857.990) * (-863.709) (-861.518) [-859.955] (-864.933) -- 0:01:25
573000 -- (-861.650) (-860.659) (-863.972) [-860.540] * (-860.261) (-867.595) [-859.117] (-860.656) -- 0:01:25
574000 -- (-858.439) (-869.159) (-863.784) [-856.826] * (-854.919) [-858.017] (-865.290) (-865.766) -- 0:01:25
575000 -- (-861.394) (-858.830) (-858.828) [-855.316] * (-860.683) (-861.095) (-856.602) [-860.522] -- 0:01:25
Average standard deviation of split frequencies: 0.004092
576000 -- (-858.353) [-858.719] (-850.331) (-855.655) * (-867.287) (-862.494) [-853.120] (-864.652) -- 0:01:24
577000 -- (-856.476) [-856.514] (-863.169) (-854.320) * [-861.523] (-856.453) (-854.629) (-864.871) -- 0:01:24
578000 -- (-865.279) (-860.606) (-863.621) [-862.806] * (-861.111) [-859.301] (-856.174) (-859.991) -- 0:01:24
579000 -- (-858.888) (-864.613) (-866.214) [-857.378] * (-858.847) [-857.426] (-867.877) (-868.839) -- 0:01:24
580000 -- (-864.263) [-856.185] (-866.586) (-860.428) * (-860.732) (-864.588) (-864.097) [-855.286] -- 0:01:24
Average standard deviation of split frequencies: 0.003560
581000 -- [-861.732] (-856.742) (-861.024) (-856.166) * (-860.021) [-857.894] (-858.921) (-857.778) -- 0:01:23
582000 -- (-858.566) [-863.681] (-860.008) (-865.588) * (-865.254) [-860.158] (-858.184) (-857.672) -- 0:01:23
583000 -- (-856.529) (-864.697) [-860.026] (-858.065) * (-860.130) (-861.352) (-863.420) [-857.385] -- 0:01:23
584000 -- (-855.782) (-854.181) [-861.322] (-861.665) * (-861.657) (-861.023) [-856.896] (-859.979) -- 0:01:23
585000 -- (-873.751) (-859.913) [-856.694] (-861.724) * (-853.619) [-853.923] (-857.982) (-859.391) -- 0:01:23
Average standard deviation of split frequencies: 0.004208
586000 -- [-864.653] (-862.193) (-855.035) (-869.837) * (-867.674) (-866.078) (-859.399) [-858.640] -- 0:01:22
587000 -- (-868.747) (-865.330) [-857.574] (-860.920) * (-860.638) (-859.517) [-856.388] (-856.220) -- 0:01:22
588000 -- [-860.950] (-868.237) (-857.067) (-856.878) * (-863.169) (-858.228) (-867.033) [-860.846] -- 0:01:22
589000 -- (-868.176) [-854.465] (-857.575) (-863.014) * (-860.592) (-855.187) [-862.701] (-861.425) -- 0:01:22
590000 -- (-859.010) [-858.508] (-859.302) (-860.799) * (-859.732) (-868.041) (-856.317) [-855.308] -- 0:01:22
Average standard deviation of split frequencies: 0.003929
591000 -- (-861.784) (-857.828) [-855.289] (-865.378) * [-860.719] (-861.406) (-855.453) (-858.067) -- 0:01:21
592000 -- [-861.879] (-859.922) (-855.112) (-867.679) * (-861.598) [-857.544] (-860.822) (-862.170) -- 0:01:21
593000 -- (-868.475) (-863.097) [-854.026] (-862.885) * (-861.325) [-863.198] (-855.401) (-863.434) -- 0:01:21
594000 -- (-867.837) (-856.213) [-858.700] (-860.362) * (-865.842) (-861.310) (-859.204) [-856.883] -- 0:01:21
595000 -- (-852.803) [-862.484] (-858.332) (-858.351) * [-854.948] (-861.454) (-860.222) (-854.084) -- 0:01:21
Average standard deviation of split frequencies: 0.004867
596000 -- (-861.189) (-857.536) (-854.336) [-857.945] * [-857.663] (-862.554) (-860.469) (-858.266) -- 0:01:20
597000 -- (-860.264) (-864.146) [-858.544] (-857.848) * (-859.604) (-858.774) (-852.953) [-856.996] -- 0:01:20
598000 -- (-860.623) (-865.195) (-858.699) [-854.565] * (-862.887) (-857.375) [-862.150] (-859.248) -- 0:01:20
599000 -- (-864.175) (-852.638) (-857.027) [-857.789] * [-858.074] (-860.915) (-857.205) (-858.312) -- 0:01:20
600000 -- (-860.272) (-857.447) [-854.166] (-855.668) * (-857.119) (-864.200) (-865.924) [-858.571] -- 0:01:20
Average standard deviation of split frequencies: 0.005192
601000 -- [-854.971] (-865.007) (-861.000) (-859.628) * (-861.260) (-863.052) [-855.287] (-859.781) -- 0:01:19
602000 -- [-853.773] (-863.501) (-861.074) (-859.214) * (-863.167) (-860.028) (-862.047) [-856.361] -- 0:01:19
603000 -- [-861.301] (-861.021) (-854.684) (-863.705) * (-853.372) (-857.985) [-860.871] (-862.952) -- 0:01:19
604000 -- [-859.675] (-857.591) (-864.897) (-862.700) * [-855.363] (-856.997) (-856.974) (-861.411) -- 0:01:19
605000 -- (-863.419) [-855.433] (-856.630) (-860.585) * (-855.858) [-855.882] (-871.358) (-861.628) -- 0:01:19
Average standard deviation of split frequencies: 0.004787
606000 -- (-858.540) (-856.225) [-857.259] (-858.326) * [-854.399] (-861.752) (-864.504) (-865.209) -- 0:01:18
607000 -- (-855.379) (-858.102) [-858.406] (-862.113) * [-858.860] (-864.420) (-857.318) (-858.916) -- 0:01:18
608000 -- (-866.570) [-857.358] (-854.715) (-857.315) * [-856.601] (-856.643) (-862.872) (-865.182) -- 0:01:18
609000 -- [-858.828] (-857.405) (-862.777) (-857.495) * (-861.875) (-857.089) [-860.018] (-864.341) -- 0:01:18
610000 -- [-854.524] (-858.307) (-860.408) (-855.928) * (-861.309) [-862.297] (-858.593) (-858.668) -- 0:01:18
Average standard deviation of split frequencies: 0.004394
611000 -- (-860.765) (-867.216) [-861.475] (-861.281) * [-857.419] (-858.715) (-860.731) (-858.288) -- 0:01:17
612000 -- (-857.620) (-863.572) (-863.275) [-859.654] * (-854.932) (-864.388) [-859.886] (-863.112) -- 0:01:17
613000 -- [-859.374] (-858.623) (-864.108) (-856.585) * [-856.728] (-857.810) (-858.877) (-856.878) -- 0:01:17
614000 -- (-861.802) (-852.748) [-858.442] (-862.054) * (-861.712) (-854.948) (-856.151) [-853.201] -- 0:01:17
615000 -- (-863.997) [-854.784] (-862.841) (-854.838) * (-860.578) [-853.742] (-861.916) (-858.330) -- 0:01:17
Average standard deviation of split frequencies: 0.004180
616000 -- (-863.854) (-863.412) (-862.665) [-858.851] * (-863.638) [-858.529] (-855.938) (-859.808) -- 0:01:16
617000 -- [-858.491] (-862.831) (-871.171) (-854.985) * (-862.322) [-857.212] (-858.086) (-866.824) -- 0:01:16
618000 -- (-863.563) (-861.600) (-865.093) [-858.169] * (-856.816) [-859.383] (-857.993) (-862.260) -- 0:01:16
619000 -- (-861.495) (-861.879) (-854.086) [-856.603] * [-858.095] (-858.711) (-858.338) (-865.451) -- 0:01:16
620000 -- (-865.183) [-858.054] (-864.029) (-860.136) * (-859.929) [-857.496] (-869.027) (-863.815) -- 0:01:16
Average standard deviation of split frequencies: 0.004849
621000 -- (-861.950) (-857.982) [-868.877] (-862.080) * (-858.946) (-855.411) [-856.016] (-861.639) -- 0:01:15
622000 -- (-863.823) (-865.405) [-853.619] (-857.057) * (-865.173) (-861.348) [-856.047] (-858.190) -- 0:01:15
623000 -- (-857.983) (-853.615) [-859.411] (-861.873) * (-866.694) [-853.419] (-857.407) (-858.269) -- 0:01:15
624000 -- (-860.971) (-855.420) [-858.417] (-866.415) * [-856.617] (-863.696) (-859.786) (-853.444) -- 0:01:15
625000 -- (-857.948) [-857.876] (-858.753) (-867.517) * (-861.309) (-861.513) [-854.006] (-863.416) -- 0:01:15
Average standard deviation of split frequencies: 0.005271
626000 -- (-861.766) [-855.565] (-865.585) (-870.652) * (-868.136) (-858.580) [-860.266] (-860.329) -- 0:01:14
627000 -- (-855.996) (-859.580) (-855.141) [-860.692] * [-860.644] (-862.401) (-864.665) (-859.255) -- 0:01:14
628000 -- (-857.579) (-862.343) (-854.195) [-856.154] * (-869.876) (-862.220) (-866.222) [-855.687] -- 0:01:14
629000 -- (-863.114) (-867.227) [-858.215] (-864.350) * [-863.419] (-860.558) (-861.096) (-864.767) -- 0:01:14
630000 -- (-860.813) (-858.428) [-859.822] (-872.115) * (-863.225) [-857.398] (-867.331) (-860.170) -- 0:01:14
Average standard deviation of split frequencies: 0.005865
631000 -- [-860.197] (-867.390) (-860.995) (-862.545) * (-858.222) [-855.707] (-867.147) (-864.077) -- 0:01:13
632000 -- (-858.973) [-859.392] (-865.020) (-864.402) * (-859.566) (-855.179) (-872.588) [-860.989] -- 0:01:13
633000 -- (-864.383) (-859.254) [-853.774] (-864.592) * [-859.270] (-859.134) (-857.535) (-865.064) -- 0:01:13
634000 -- (-859.631) (-860.379) [-855.955] (-860.083) * [-861.311] (-855.316) (-856.093) (-863.188) -- 0:01:13
635000 -- [-858.200] (-865.509) (-859.177) (-866.818) * [-857.248] (-855.786) (-864.998) (-859.997) -- 0:01:13
Average standard deviation of split frequencies: 0.005759
636000 -- (-855.271) (-856.380) [-855.087] (-860.608) * [-864.543] (-861.359) (-862.906) (-860.959) -- 0:01:12
637000 -- (-862.778) (-861.849) [-855.377] (-855.489) * [-861.540] (-866.847) (-859.053) (-857.448) -- 0:01:12
638000 -- [-856.158] (-866.218) (-862.744) (-859.431) * (-859.442) (-854.860) [-854.032] (-860.462) -- 0:01:12
639000 -- (-860.002) (-861.691) [-865.733] (-859.775) * (-858.643) [-860.868] (-856.410) (-856.401) -- 0:01:12
640000 -- (-868.415) [-855.789] (-862.445) (-858.748) * [-862.160] (-857.719) (-856.834) (-865.753) -- 0:01:12
Average standard deviation of split frequencies: 0.005830
641000 -- (-857.533) (-862.084) [-854.630] (-867.713) * (-857.320) (-857.519) [-854.842] (-858.757) -- 0:01:11
642000 -- (-855.243) (-859.886) [-856.950] (-859.735) * (-858.942) (-859.296) (-861.285) [-862.233] -- 0:01:11
643000 -- (-870.953) (-858.754) [-853.915] (-871.411) * [-855.546] (-866.535) (-858.098) (-860.640) -- 0:01:11
644000 -- (-863.769) (-861.548) (-855.981) [-859.683] * (-858.822) (-859.022) (-874.902) [-867.625] -- 0:01:11
645000 -- [-859.580] (-865.829) (-865.416) (-859.853) * (-866.026) [-854.355] (-868.639) (-868.746) -- 0:01:11
Average standard deviation of split frequencies: 0.005501
646000 -- (-855.609) (-861.577) [-862.596] (-857.987) * [-856.107] (-855.936) (-864.850) (-861.392) -- 0:01:10
647000 -- (-859.555) (-860.003) [-858.106] (-860.294) * [-855.198] (-861.369) (-862.976) (-859.554) -- 0:01:10
648000 -- (-857.809) (-869.529) (-856.591) [-857.343] * (-859.256) (-868.592) [-858.158] (-860.324) -- 0:01:10
649000 -- (-858.791) (-865.161) (-861.966) [-857.676] * (-857.978) (-864.359) [-856.043] (-864.540) -- 0:01:10
650000 -- (-858.280) (-863.650) (-865.224) [-859.154] * [-858.264] (-857.634) (-856.391) (-860.886) -- 0:01:10
Average standard deviation of split frequencies: 0.005573
651000 -- (-861.101) (-872.480) (-859.522) [-858.092] * (-865.374) (-854.429) (-860.389) [-859.776] -- 0:01:09
652000 -- (-859.417) (-858.992) (-856.591) [-859.541] * [-864.236] (-856.516) (-858.150) (-857.722) -- 0:01:09
653000 -- (-855.682) [-853.776] (-860.999) (-868.448) * (-863.701) [-855.359] (-866.730) (-857.287) -- 0:01:09
654000 -- [-858.358] (-864.634) (-860.496) (-854.507) * [-859.999] (-866.664) (-860.069) (-855.637) -- 0:01:09
655000 -- (-858.639) (-859.585) (-859.027) [-858.417] * (-871.264) (-856.070) (-857.681) [-856.790] -- 0:01:09
Average standard deviation of split frequencies: 0.005749
656000 -- (-860.318) [-855.381] (-862.274) (-860.245) * (-864.075) [-861.065] (-855.532) (-856.915) -- 0:01:08
657000 -- (-856.488) (-873.428) (-858.325) [-855.719] * (-860.797) [-855.526] (-860.976) (-868.619) -- 0:01:08
658000 -- (-856.961) (-856.208) (-861.136) [-859.160] * [-854.001] (-861.107) (-866.170) (-863.125) -- 0:01:08
659000 -- (-863.726) [-855.332] (-858.561) (-860.167) * (-859.154) (-862.723) (-865.634) [-855.170] -- 0:01:08
660000 -- (-859.707) [-859.099] (-859.984) (-857.951) * (-861.290) (-864.937) [-857.280] (-860.157) -- 0:01:08
Average standard deviation of split frequencies: 0.004940
661000 -- [-856.292] (-861.576) (-875.288) (-856.754) * [-855.854] (-860.423) (-857.578) (-862.310) -- 0:01:07
662000 -- (-863.497) (-864.565) [-859.872] (-861.636) * (-858.017) (-866.087) (-858.245) [-871.883] -- 0:01:07
663000 -- (-857.398) (-863.356) [-861.049] (-853.383) * [-856.885] (-868.533) (-860.827) (-860.800) -- 0:01:07
664000 -- [-864.129] (-856.202) (-864.855) (-856.534) * (-863.461) (-862.767) [-855.758] (-864.548) -- 0:01:07
665000 -- (-861.588) [-858.517] (-862.123) (-858.206) * (-862.639) (-860.387) [-859.192] (-860.995) -- 0:01:07
Average standard deviation of split frequencies: 0.004682
666000 -- (-857.387) (-859.701) [-858.578] (-855.781) * (-860.849) [-853.618] (-863.220) (-855.186) -- 0:01:06
667000 -- (-859.580) [-860.206] (-856.604) (-855.221) * [-860.381] (-862.219) (-870.447) (-863.372) -- 0:01:06
668000 -- (-858.621) (-855.778) (-860.390) [-864.279] * (-855.165) (-858.754) [-862.321] (-866.842) -- 0:01:06
669000 -- (-868.733) (-856.076) [-859.799] (-859.879) * [-861.618] (-854.025) (-860.418) (-859.524) -- 0:01:06
670000 -- (-868.727) (-864.240) (-862.272) [-864.867] * [-857.750] (-864.697) (-865.176) (-860.615) -- 0:01:06
Average standard deviation of split frequencies: 0.004596
671000 -- [-859.534] (-863.839) (-866.906) (-861.200) * (-854.720) (-859.141) [-859.290] (-857.358) -- 0:01:05
672000 -- (-857.068) (-859.142) (-863.636) [-861.173] * (-861.487) (-857.207) [-854.047] (-856.223) -- 0:01:05
673000 -- (-856.579) [-855.549] (-861.679) (-858.413) * (-862.399) (-859.487) (-858.812) [-858.114] -- 0:01:05
674000 -- (-854.432) (-859.204) [-855.761] (-859.849) * (-861.149) (-859.408) (-856.789) [-855.321] -- 0:01:05
675000 -- [-854.727] (-858.705) (-858.341) (-869.299) * (-862.161) (-857.858) (-861.593) [-855.973] -- 0:01:05
Average standard deviation of split frequencies: 0.005096
676000 -- (-857.358) [-865.450] (-858.988) (-857.258) * (-858.472) (-860.985) (-858.790) [-853.347] -- 0:01:04
677000 -- (-858.609) (-861.390) [-863.110] (-865.795) * [-857.988] (-860.670) (-861.905) (-864.876) -- 0:01:04
678000 -- (-865.108) [-863.993] (-855.493) (-862.028) * [-854.273] (-860.652) (-865.646) (-857.528) -- 0:01:04
679000 -- [-857.066] (-859.413) (-857.871) (-860.382) * (-853.094) (-862.472) [-856.971] (-865.119) -- 0:01:04
680000 -- (-856.385) [-855.463] (-856.119) (-862.400) * (-860.833) (-858.103) (-857.735) [-861.844] -- 0:01:04
Average standard deviation of split frequencies: 0.005061
681000 -- [-857.258] (-862.845) (-860.313) (-857.424) * [-855.651] (-858.572) (-864.883) (-855.691) -- 0:01:03
682000 -- (-860.746) (-867.866) [-854.212] (-860.237) * (-865.459) (-859.367) [-860.588] (-857.182) -- 0:01:03
683000 -- (-854.962) [-862.862] (-860.611) (-859.301) * (-858.700) [-860.423] (-858.012) (-856.251) -- 0:01:03
684000 -- (-863.358) (-865.200) [-858.102] (-861.428) * (-860.208) (-858.622) (-856.653) [-853.310] -- 0:01:03
685000 -- (-862.709) (-870.816) [-862.704] (-857.293) * (-854.897) (-855.934) [-861.185] (-859.160) -- 0:01:03
Average standard deviation of split frequencies: 0.004229
686000 -- [-852.116] (-854.057) (-864.321) (-856.002) * (-864.061) [-858.601] (-854.587) (-861.428) -- 0:01:02
687000 -- (-859.377) (-867.661) (-854.040) [-857.892] * (-859.557) (-864.202) (-866.414) [-853.930] -- 0:01:02
688000 -- (-865.488) (-862.174) [-859.353] (-867.901) * (-856.805) (-860.455) (-863.288) [-857.160] -- 0:01:02
689000 -- (-868.688) (-868.581) [-862.402] (-870.954) * (-857.678) [-856.318] (-870.656) (-860.583) -- 0:01:02
690000 -- (-858.825) [-852.753] (-867.359) (-863.179) * (-863.202) (-859.685) (-861.028) [-857.028] -- 0:01:02
Average standard deviation of split frequencies: 0.004725
691000 -- (-860.510) (-864.680) [-863.270] (-858.651) * [-857.683] (-861.045) (-860.498) (-859.556) -- 0:01:01
692000 -- (-857.615) (-857.188) (-863.159) [-857.872] * (-856.635) (-861.473) [-859.403] (-861.249) -- 0:01:01
693000 -- (-858.984) [-862.270] (-865.081) (-856.714) * [-860.199] (-860.308) (-860.212) (-858.826) -- 0:01:01
694000 -- [-858.840] (-865.693) (-865.409) (-853.948) * (-854.338) (-855.801) (-856.641) [-856.925] -- 0:01:01
695000 -- (-859.570) [-858.873] (-871.485) (-857.329) * (-858.752) (-857.377) (-871.684) [-857.361] -- 0:01:01
Average standard deviation of split frequencies: 0.005366
696000 -- [-856.080] (-870.177) (-862.546) (-856.018) * (-857.805) [-858.263] (-857.861) (-861.766) -- 0:01:00
697000 -- (-862.680) (-861.740) [-856.551] (-865.117) * (-858.380) (-856.785) (-873.442) [-856.487] -- 0:01:00
698000 -- (-856.315) [-857.621] (-858.387) (-857.993) * (-853.380) (-863.552) (-862.443) [-861.245] -- 0:01:00
699000 -- (-864.858) [-855.367] (-859.209) (-865.035) * [-855.099] (-854.882) (-866.718) (-854.638) -- 0:01:00
700000 -- [-859.497] (-856.922) (-866.820) (-862.155) * (-857.694) (-859.308) (-866.487) [-853.102] -- 0:01:00
Average standard deviation of split frequencies: 0.005124
701000 -- (-870.009) (-857.519) [-859.641] (-860.793) * [-862.302] (-857.324) (-859.215) (-867.018) -- 0:00:59
702000 -- [-861.972] (-856.764) (-858.696) (-863.414) * (-864.530) [-858.761] (-860.795) (-859.710) -- 0:00:59
703000 -- (-867.507) (-858.002) [-865.870] (-858.872) * (-859.295) (-864.112) [-859.898] (-859.626) -- 0:00:59
704000 -- [-861.772] (-858.646) (-865.001) (-854.500) * [-861.349] (-862.521) (-868.550) (-860.016) -- 0:00:59
705000 -- (-854.749) [-859.785] (-857.080) (-860.349) * (-868.305) (-858.940) [-856.164] (-863.956) -- 0:00:59
Average standard deviation of split frequencies: 0.005085
706000 -- (-858.569) (-860.113) [-859.507] (-861.428) * (-858.107) (-854.978) (-859.721) [-863.417] -- 0:00:58
707000 -- (-856.381) (-859.895) (-869.589) [-853.684] * (-857.451) (-862.605) (-861.492) [-864.100] -- 0:00:58
708000 -- (-862.215) (-866.281) (-857.727) [-862.143] * [-857.489] (-858.953) (-857.630) (-858.760) -- 0:00:58
709000 -- (-857.960) (-860.114) (-861.135) [-856.735] * (-862.097) (-864.629) [-865.693] (-871.257) -- 0:00:58
710000 -- [-858.739] (-865.290) (-864.812) (-858.636) * (-872.289) (-859.035) [-860.436] (-868.223) -- 0:00:58
Average standard deviation of split frequencies: 0.005051
711000 -- (-862.040) [-864.469] (-863.357) (-861.083) * (-858.554) [-860.907] (-857.952) (-865.287) -- 0:00:57
712000 -- [-857.227] (-864.632) (-860.635) (-859.648) * (-857.282) (-865.067) [-864.960] (-857.817) -- 0:00:57
713000 -- (-861.213) (-861.158) (-859.742) [-858.983] * [-854.868] (-858.874) (-857.498) (-857.918) -- 0:00:57
714000 -- (-860.633) (-858.475) (-863.044) [-860.541] * (-863.268) (-865.841) [-860.617] (-863.874) -- 0:00:57
715000 -- (-858.362) (-863.723) [-857.475] (-861.944) * [-854.090] (-860.076) (-865.060) (-861.148) -- 0:00:57
Average standard deviation of split frequencies: 0.004913
716000 -- (-857.678) (-862.683) [-853.227] (-859.621) * (-858.448) (-866.232) [-860.989] (-866.408) -- 0:00:56
717000 -- (-856.248) (-860.412) [-856.957] (-860.564) * (-864.570) [-858.467] (-859.583) (-852.972) -- 0:00:56
718000 -- (-857.633) (-862.720) (-855.719) [-855.208] * (-863.210) [-859.458] (-860.889) (-867.465) -- 0:00:56
719000 -- [-859.266] (-861.540) (-857.964) (-856.380) * (-867.216) (-859.060) [-856.587] (-860.486) -- 0:00:56
720000 -- (-853.539) (-856.013) [-854.384] (-860.558) * (-858.093) (-857.604) (-856.867) [-857.646] -- 0:00:56
Average standard deviation of split frequencies: 0.005082
721000 -- (-864.482) [-861.785] (-855.559) (-857.212) * (-864.157) [-860.770] (-868.485) (-865.254) -- 0:00:55
722000 -- (-857.935) (-861.777) [-855.265] (-853.251) * (-862.549) (-864.150) (-866.726) [-858.277] -- 0:00:55
723000 -- (-864.973) [-859.157] (-855.958) (-853.015) * (-858.072) (-863.426) [-861.737] (-861.869) -- 0:00:55
724000 -- (-860.063) (-857.360) [-856.006] (-862.553) * (-855.631) (-871.744) (-866.295) [-857.906] -- 0:00:55
725000 -- [-860.809] (-861.518) (-862.555) (-861.607) * [-857.312] (-863.229) (-856.885) (-865.110) -- 0:00:55
Average standard deviation of split frequencies: 0.005045
726000 -- (-856.320) [-855.410] (-861.254) (-866.384) * [-860.480] (-858.572) (-857.067) (-863.722) -- 0:00:54
727000 -- (-861.250) [-861.665] (-855.401) (-865.447) * (-865.919) [-860.642] (-856.419) (-865.359) -- 0:00:54
728000 -- (-857.575) (-859.989) (-854.365) [-854.708] * (-869.861) [-856.370] (-856.333) (-863.471) -- 0:00:54
729000 -- [-857.833] (-861.604) (-861.250) (-858.156) * (-859.319) (-865.181) (-853.173) [-858.093] -- 0:00:54
730000 -- (-860.645) (-859.995) [-854.470] (-858.395) * (-866.865) (-857.634) (-859.369) [-866.338] -- 0:00:54
Average standard deviation of split frequencies: 0.004913
731000 -- [-856.283] (-861.682) (-859.826) (-856.608) * (-868.769) (-857.601) [-857.339] (-864.918) -- 0:00:53
732000 -- (-864.434) [-860.934] (-857.705) (-857.188) * (-857.908) [-859.876] (-861.497) (-864.053) -- 0:00:53
733000 -- (-867.388) [-857.516] (-865.655) (-855.384) * (-864.587) (-863.911) [-857.421] (-861.864) -- 0:00:53
734000 -- (-863.771) [-861.360] (-861.145) (-859.567) * (-860.515) [-861.077] (-857.228) (-860.690) -- 0:00:53
735000 -- (-865.911) [-854.974] (-863.886) (-855.193) * (-865.697) (-868.860) (-862.383) [-865.667] -- 0:00:53
Average standard deviation of split frequencies: 0.005025
736000 -- (-866.816) [-859.772] (-851.617) (-863.590) * (-865.659) [-855.153] (-851.681) (-855.958) -- 0:00:52
737000 -- (-869.744) (-857.831) [-864.103] (-856.748) * [-861.104] (-856.599) (-856.784) (-855.147) -- 0:00:52
738000 -- (-871.492) (-860.551) (-854.566) [-859.531] * (-860.004) (-860.627) [-864.572] (-855.065) -- 0:00:52
739000 -- (-865.334) (-859.176) (-868.963) [-858.608] * (-854.706) [-867.879] (-867.572) (-858.205) -- 0:00:52
740000 -- (-857.056) (-864.749) (-860.926) [-856.030] * (-867.976) [-866.358] (-859.461) (-859.846) -- 0:00:52
Average standard deviation of split frequencies: 0.005973
741000 -- (-865.756) (-863.209) (-855.728) [-865.351] * (-858.552) (-865.445) (-862.314) [-861.330] -- 0:00:51
742000 -- (-853.446) [-859.167] (-863.497) (-868.198) * (-858.820) [-855.347] (-861.194) (-867.905) -- 0:00:51
743000 -- (-859.859) (-858.403) (-861.115) [-857.170] * (-859.602) (-856.239) [-863.910] (-867.036) -- 0:00:51
744000 -- (-857.700) (-863.674) (-855.909) [-857.943] * (-863.441) (-863.630) [-855.838] (-862.641) -- 0:00:51
745000 -- (-856.735) (-857.701) [-860.951] (-856.732) * (-856.870) (-860.378) [-856.634] (-867.696) -- 0:00:51
Average standard deviation of split frequencies: 0.006611
746000 -- [-865.534] (-853.218) (-861.764) (-858.270) * (-857.668) [-866.356] (-857.838) (-866.480) -- 0:00:50
747000 -- (-855.985) [-854.290] (-857.437) (-859.492) * (-854.994) (-858.592) [-860.097] (-860.516) -- 0:00:50
748000 -- (-862.125) (-860.040) [-864.497] (-865.796) * (-858.379) [-860.878] (-857.206) (-856.595) -- 0:00:50
749000 -- (-855.683) (-860.852) (-857.109) [-861.128] * (-860.453) [-854.486] (-866.368) (-860.174) -- 0:00:50
750000 -- [-855.044] (-864.123) (-862.113) (-862.183) * (-858.371) [-856.675] (-856.473) (-856.805) -- 0:00:50
Average standard deviation of split frequencies: 0.006715
751000 -- (-869.746) (-861.432) [-862.033] (-857.128) * (-855.636) (-862.354) [-862.556] (-863.112) -- 0:00:49
752000 -- (-858.331) (-857.736) (-851.844) [-862.631] * [-854.489] (-865.951) (-861.464) (-867.419) -- 0:00:49
753000 -- (-863.788) [-855.416] (-860.533) (-859.594) * [-856.810] (-863.578) (-864.737) (-866.028) -- 0:00:49
754000 -- (-869.202) (-868.098) [-857.501] (-857.022) * (-858.797) (-862.935) (-866.760) [-863.132] -- 0:00:49
755000 -- (-866.221) (-859.034) [-855.904] (-863.875) * [-862.521] (-873.079) (-868.653) (-857.502) -- 0:00:49
Average standard deviation of split frequencies: 0.007051
756000 -- (-862.462) [-854.555] (-859.285) (-857.106) * (-865.411) (-868.546) (-873.195) [-854.003] -- 0:00:48
757000 -- [-857.896] (-865.310) (-857.148) (-866.757) * (-863.070) (-861.985) (-866.543) [-857.000] -- 0:00:48
758000 -- (-856.781) [-860.243] (-863.703) (-857.482) * (-871.542) (-865.154) [-862.652] (-855.848) -- 0:00:48
759000 -- (-860.788) [-861.960] (-857.031) (-858.954) * (-863.715) [-866.217] (-861.370) (-859.451) -- 0:00:48
760000 -- (-862.058) [-858.771] (-856.195) (-861.013) * [-868.243] (-854.048) (-867.248) (-856.862) -- 0:00:48
Average standard deviation of split frequencies: 0.007198
761000 -- [-857.546] (-855.444) (-858.150) (-860.876) * (-860.365) (-850.756) [-856.161] (-856.077) -- 0:00:47
762000 -- (-858.986) (-855.642) (-859.862) [-859.775] * (-865.352) (-853.540) [-865.565] (-858.317) -- 0:00:47
763000 -- (-864.684) (-856.943) (-856.989) [-851.751] * (-865.026) (-868.502) [-853.555] (-858.832) -- 0:00:47
764000 -- [-858.767] (-860.273) (-854.773) (-858.536) * (-867.247) (-859.746) [-856.188] (-871.044) -- 0:00:47
765000 -- (-863.164) (-859.948) [-860.446] (-856.113) * [-860.701] (-869.442) (-856.485) (-858.386) -- 0:00:47
Average standard deviation of split frequencies: 0.007432
766000 -- (-868.305) (-858.398) [-857.166] (-862.527) * (-859.076) (-857.967) (-858.978) [-858.868] -- 0:00:46
767000 -- (-859.386) [-855.843] (-858.285) (-861.029) * (-857.825) (-855.158) (-864.321) [-856.013] -- 0:00:46
768000 -- (-861.335) [-859.922] (-860.008) (-860.800) * (-867.320) (-856.658) [-857.660] (-855.680) -- 0:00:46
769000 -- (-870.902) (-854.906) (-858.768) [-857.064] * (-862.187) [-856.478] (-861.435) (-861.711) -- 0:00:46
770000 -- (-860.028) [-854.754] (-861.281) (-860.898) * (-861.207) (-857.379) [-865.297] (-861.317) -- 0:00:46
Average standard deviation of split frequencies: 0.007623
771000 -- (-866.847) (-861.469) [-853.752] (-855.816) * (-871.120) (-864.844) (-858.848) [-861.231] -- 0:00:45
772000 -- (-865.862) [-862.091] (-858.080) (-859.300) * (-870.211) [-855.309] (-857.017) (-861.948) -- 0:00:45
773000 -- (-869.696) [-855.623] (-868.828) (-873.662) * (-863.233) (-856.348) (-860.033) [-860.550] -- 0:00:45
774000 -- [-862.457] (-863.332) (-859.213) (-864.724) * [-869.199] (-863.137) (-852.611) (-865.898) -- 0:00:45
775000 -- (-861.024) [-856.295] (-862.000) (-869.856) * [-860.484] (-852.114) (-863.703) (-859.921) -- 0:00:45
Average standard deviation of split frequencies: 0.007617
776000 -- (-854.487) (-860.393) (-873.792) [-857.777] * (-864.964) (-858.502) (-856.952) [-857.873] -- 0:00:44
777000 -- (-856.781) (-857.686) [-872.477] (-860.222) * (-863.737) [-855.179] (-863.580) (-856.346) -- 0:00:44
778000 -- (-856.802) [-859.676] (-866.596) (-864.546) * (-855.340) (-862.760) (-875.960) [-855.052] -- 0:00:44
779000 -- (-871.765) (-863.334) [-862.948] (-863.279) * (-862.804) (-857.930) [-863.601] (-865.296) -- 0:00:44
780000 -- (-865.984) [-854.140] (-858.007) (-857.880) * (-859.865) [-855.538] (-867.669) (-863.185) -- 0:00:44
Average standard deviation of split frequencies: 0.007339
781000 -- (-860.988) (-862.779) [-859.225] (-857.368) * (-864.330) [-855.477] (-870.067) (-868.621) -- 0:00:43
782000 -- (-860.304) [-855.842] (-859.881) (-866.904) * (-867.979) (-857.323) (-863.518) [-866.864] -- 0:00:43
783000 -- (-855.089) [-862.577] (-864.361) (-868.291) * (-860.461) (-862.546) (-860.686) [-864.633] -- 0:00:43
784000 -- [-852.726] (-859.385) (-855.687) (-858.867) * (-862.933) [-860.223] (-861.573) (-860.715) -- 0:00:43
785000 -- (-855.413) (-866.228) (-856.501) [-854.009] * (-861.892) [-858.633] (-856.437) (-859.405) -- 0:00:43
Average standard deviation of split frequencies: 0.007105
786000 -- (-855.720) [-859.204] (-865.597) (-870.447) * (-857.058) (-860.950) (-862.199) [-856.671] -- 0:00:42
787000 -- (-864.277) (-859.019) [-858.526] (-861.178) * (-862.557) (-857.512) [-856.806] (-860.122) -- 0:00:42
788000 -- (-863.314) [-862.382] (-853.137) (-864.714) * [-867.705] (-863.625) (-857.020) (-863.286) -- 0:00:42
789000 -- (-859.770) [-853.505] (-857.416) (-861.517) * (-866.241) [-860.957] (-859.272) (-866.908) -- 0:00:42
790000 -- (-866.182) (-855.014) [-857.062] (-869.090) * (-871.058) (-864.329) (-864.258) [-859.934] -- 0:00:42
Average standard deviation of split frequencies: 0.007246
791000 -- (-862.084) (-857.340) (-863.267) [-859.187] * [-856.575] (-867.427) (-860.327) (-866.993) -- 0:00:41
792000 -- (-863.283) [-855.184] (-861.146) (-861.049) * [-855.610] (-859.009) (-857.702) (-857.829) -- 0:00:41
793000 -- (-864.203) (-859.700) [-858.665] (-866.712) * (-856.747) (-857.047) [-856.344] (-862.852) -- 0:00:41
794000 -- [-858.977] (-861.789) (-858.648) (-863.164) * [-855.989] (-863.482) (-860.497) (-864.578) -- 0:00:41
795000 -- (-861.289) (-861.814) (-860.271) [-857.414] * (-859.891) (-858.783) (-854.327) [-859.537] -- 0:00:41
Average standard deviation of split frequencies: 0.007015
796000 -- (-858.011) (-855.131) [-856.789] (-863.492) * (-867.178) (-863.276) [-860.028] (-864.921) -- 0:00:40
797000 -- (-858.247) (-866.858) (-863.525) [-860.680] * (-856.733) (-856.925) [-858.047] (-862.230) -- 0:00:40
798000 -- (-860.746) (-860.633) [-850.263] (-860.477) * [-857.587] (-855.161) (-870.465) (-860.970) -- 0:00:40
799000 -- (-854.370) (-862.481) (-857.218) [-863.718] * (-856.586) (-857.247) [-851.972] (-866.226) -- 0:00:40
800000 -- (-860.025) (-862.006) [-856.154] (-868.582) * [-856.637] (-857.159) (-862.626) (-863.517) -- 0:00:40
Average standard deviation of split frequencies: 0.006884
801000 -- (-856.662) [-858.117] (-853.913) (-861.788) * (-860.539) (-858.882) (-861.517) [-856.762] -- 0:00:39
802000 -- (-858.746) [-858.191] (-857.936) (-858.975) * (-857.841) (-856.810) (-858.619) [-860.511] -- 0:00:39
803000 -- (-854.937) (-853.262) [-854.517] (-858.514) * [-860.854] (-854.296) (-867.154) (-854.350) -- 0:00:39
804000 -- (-860.545) [-857.186] (-853.869) (-858.449) * (-860.254) (-855.214) (-862.961) [-857.195] -- 0:00:39
805000 -- (-861.775) (-850.857) [-858.074] (-858.136) * (-857.292) (-863.657) [-856.140] (-860.539) -- 0:00:39
Average standard deviation of split frequencies: 0.006928
806000 -- (-858.011) (-857.982) [-861.470] (-862.401) * (-864.473) [-858.052] (-864.134) (-863.629) -- 0:00:38
807000 -- [-862.079] (-861.684) (-858.168) (-864.810) * (-860.081) (-863.705) (-856.577) [-857.345] -- 0:00:38
808000 -- [-855.330] (-873.365) (-862.080) (-855.448) * (-860.859) [-859.288] (-857.486) (-868.532) -- 0:00:38
809000 -- (-857.879) (-861.025) (-859.108) [-857.436] * (-863.670) (-867.327) (-860.286) [-858.826] -- 0:00:38
810000 -- (-854.997) (-860.139) (-856.746) [-854.251] * (-860.762) (-861.708) [-859.756] (-867.325) -- 0:00:38
Average standard deviation of split frequencies: 0.007157
811000 -- (-855.671) (-860.026) [-858.086] (-861.577) * (-859.824) [-859.154] (-856.806) (-863.142) -- 0:00:37
812000 -- (-857.864) (-862.265) (-860.050) [-861.104] * (-858.846) (-859.926) [-853.749] (-865.107) -- 0:00:37
813000 -- (-857.217) [-855.430] (-859.728) (-859.413) * (-852.852) (-864.456) (-859.169) [-856.244] -- 0:00:37
814000 -- (-861.980) [-858.943] (-858.813) (-859.146) * (-860.961) [-864.820] (-857.745) (-862.632) -- 0:00:37
815000 -- (-861.535) [-851.935] (-869.722) (-858.141) * (-865.594) (-859.726) [-855.104] (-867.017) -- 0:00:37
Average standard deviation of split frequencies: 0.006844
816000 -- (-861.324) (-861.474) [-864.352] (-860.502) * (-859.024) (-858.035) (-857.788) [-862.041] -- 0:00:36
817000 -- [-855.617] (-860.592) (-859.508) (-859.177) * (-862.947) [-853.795] (-864.212) (-862.698) -- 0:00:36
818000 -- [-855.320] (-863.155) (-863.891) (-858.249) * (-859.424) (-862.256) [-859.897] (-860.134) -- 0:00:36
819000 -- [-861.491] (-865.100) (-866.030) (-858.935) * [-853.894] (-868.448) (-858.161) (-859.377) -- 0:00:36
820000 -- (-863.173) (-867.575) (-858.828) [-852.152] * (-856.351) (-859.875) [-859.995] (-856.199) -- 0:00:36
Average standard deviation of split frequencies: 0.006628
821000 -- [-865.610] (-861.403) (-861.187) (-863.789) * [-860.380] (-856.689) (-863.069) (-868.775) -- 0:00:35
822000 -- (-867.774) (-862.455) (-858.569) [-856.809] * (-864.314) [-862.552] (-858.065) (-861.562) -- 0:00:35
823000 -- (-862.075) (-858.410) [-863.637] (-857.947) * (-856.807) [-856.439] (-861.008) (-862.756) -- 0:00:35
824000 -- (-861.686) (-857.898) [-855.970] (-856.896) * [-857.698] (-856.845) (-864.606) (-859.622) -- 0:00:35
825000 -- (-863.002) [-862.464] (-861.707) (-864.991) * [-856.369] (-852.586) (-863.961) (-864.646) -- 0:00:35
Average standard deviation of split frequencies: 0.006234
826000 -- (-858.934) (-867.616) (-858.619) [-859.554] * (-857.040) (-856.680) (-859.245) [-858.355] -- 0:00:34
827000 -- (-857.803) (-860.000) (-869.741) [-856.345] * (-864.415) (-858.519) [-863.825] (-858.277) -- 0:00:34
828000 -- (-862.834) [-852.039] (-854.065) (-868.875) * (-855.765) (-862.628) (-865.865) [-857.065] -- 0:00:34
829000 -- (-855.012) (-870.783) [-861.663] (-863.668) * (-860.082) (-871.387) (-857.420) [-858.173] -- 0:00:34
830000 -- (-851.698) (-855.213) [-860.305] (-868.351) * (-855.088) (-866.708) (-857.694) [-862.546] -- 0:00:34
Average standard deviation of split frequencies: 0.006286
831000 -- (-861.329) (-856.273) (-861.967) [-860.725] * [-859.659] (-856.079) (-859.902) (-865.263) -- 0:00:33
832000 -- (-856.581) (-871.146) [-858.303] (-854.192) * (-862.552) (-868.727) (-856.807) [-861.906] -- 0:00:33
833000 -- [-855.404] (-861.379) (-859.059) (-857.326) * [-858.912] (-864.672) (-860.043) (-861.576) -- 0:00:33
834000 -- (-857.238) [-861.559] (-866.247) (-867.084) * [-858.075] (-856.344) (-863.319) (-863.777) -- 0:00:33
835000 -- (-862.431) (-864.209) [-860.803] (-869.128) * [-859.578] (-865.987) (-861.308) (-861.133) -- 0:00:33
Average standard deviation of split frequencies: 0.006463
836000 -- (-862.703) (-854.353) [-856.997] (-862.821) * [-856.740] (-860.881) (-860.153) (-855.993) -- 0:00:32
837000 -- [-857.777] (-860.656) (-859.082) (-861.498) * (-856.455) [-856.370] (-861.847) (-864.489) -- 0:00:32
838000 -- (-857.990) (-870.780) (-867.681) [-862.392] * (-863.383) (-864.903) [-853.866] (-856.848) -- 0:00:32
839000 -- (-854.112) (-865.933) [-855.792] (-855.226) * [-853.987] (-862.709) (-857.071) (-859.912) -- 0:00:32
840000 -- (-861.281) (-858.196) [-863.291] (-861.688) * [-859.598] (-869.780) (-867.151) (-864.875) -- 0:00:32
Average standard deviation of split frequencies: 0.006858
841000 -- [-858.905] (-864.910) (-869.107) (-858.235) * [-857.872] (-866.753) (-858.006) (-858.516) -- 0:00:31
842000 -- (-857.189) [-851.315] (-861.744) (-861.932) * (-862.727) [-858.005] (-864.834) (-861.130) -- 0:00:31
843000 -- (-864.332) (-871.518) (-857.111) [-860.985] * (-864.996) (-864.980) [-858.100] (-854.902) -- 0:00:31
844000 -- (-864.060) [-859.605] (-863.425) (-856.273) * [-856.288] (-865.035) (-857.737) (-861.734) -- 0:00:31
845000 -- [-858.211] (-858.547) (-861.417) (-859.921) * (-861.837) (-856.660) [-856.127] (-863.129) -- 0:00:31
Average standard deviation of split frequencies: 0.007244
846000 -- (-860.081) (-862.304) (-860.138) [-856.682] * (-854.583) [-856.571] (-860.730) (-856.780) -- 0:00:30
847000 -- (-863.199) (-858.656) (-860.511) [-852.864] * (-866.382) (-857.955) [-859.228] (-855.605) -- 0:00:30
848000 -- [-854.681] (-861.993) (-860.271) (-860.120) * (-858.138) (-866.269) (-857.749) [-856.407] -- 0:00:30
849000 -- (-859.452) [-858.780] (-867.657) (-865.765) * (-863.917) [-860.846] (-860.577) (-856.872) -- 0:00:30
850000 -- (-856.610) (-867.116) (-862.581) [-863.227] * (-856.904) (-863.884) (-856.226) [-855.977] -- 0:00:30
Average standard deviation of split frequencies: 0.007034
851000 -- (-861.152) (-866.093) (-856.906) [-856.675] * (-863.508) [-863.393] (-865.839) (-862.881) -- 0:00:29
852000 -- (-859.306) (-864.321) [-862.152] (-865.899) * (-857.418) [-857.388] (-860.084) (-856.578) -- 0:00:29
853000 -- [-854.880] (-864.684) (-867.003) (-858.034) * (-858.188) [-857.024] (-858.372) (-855.197) -- 0:00:29
854000 -- (-857.255) [-856.339] (-858.212) (-862.823) * (-861.618) (-863.024) (-862.240) [-854.190] -- 0:00:29
855000 -- (-856.621) (-861.311) (-856.553) [-859.502] * (-865.852) (-873.370) (-861.768) [-858.947] -- 0:00:29
Average standard deviation of split frequencies: 0.007074
856000 -- (-859.278) (-861.626) (-854.906) [-858.522] * (-864.469) (-861.640) (-865.090) [-856.779] -- 0:00:28
857000 -- (-864.930) [-856.175] (-864.463) (-860.414) * (-856.550) (-866.463) (-868.708) [-859.484] -- 0:00:28
858000 -- (-857.048) (-857.212) [-856.985] (-858.443) * (-856.906) (-855.512) (-863.879) [-859.749] -- 0:00:28
859000 -- (-872.309) [-872.000] (-861.397) (-860.551) * (-866.820) [-859.303] (-859.650) (-858.275) -- 0:00:28
860000 -- (-859.346) (-862.604) (-861.307) [-853.649] * [-857.337] (-854.692) (-862.881) (-861.868) -- 0:00:28
Average standard deviation of split frequencies: 0.006994
861000 -- (-857.203) (-860.336) (-854.188) [-855.697] * (-857.568) [-857.827] (-860.363) (-861.758) -- 0:00:27
862000 -- [-861.322] (-875.182) (-861.848) (-856.150) * (-866.237) [-854.112] (-860.890) (-859.421) -- 0:00:27
863000 -- [-856.800] (-858.242) (-863.052) (-857.399) * (-873.031) (-857.647) [-855.195] (-857.969) -- 0:00:27
864000 -- [-858.000] (-853.662) (-857.377) (-861.672) * (-859.677) (-861.171) (-862.754) [-860.477] -- 0:00:27
865000 -- (-861.537) (-866.259) (-867.938) [-858.640] * [-855.302] (-868.328) (-861.202) (-867.219) -- 0:00:27
Average standard deviation of split frequencies: 0.007370
866000 -- [-855.023] (-861.927) (-867.614) (-862.995) * (-858.834) (-859.554) (-865.787) [-855.137] -- 0:00:26
867000 -- (-860.183) [-856.853] (-858.879) (-858.250) * (-870.086) (-860.837) [-855.389] (-862.371) -- 0:00:26
868000 -- (-859.300) (-856.073) (-860.396) [-862.265] * (-870.745) (-856.995) (-859.235) [-857.594] -- 0:00:26
869000 -- (-864.240) (-850.387) (-865.421) [-858.179] * (-857.818) (-866.271) [-858.250] (-860.379) -- 0:00:26
870000 -- (-858.599) [-859.682] (-861.782) (-857.326) * [-862.663] (-856.892) (-856.138) (-863.194) -- 0:00:26
Average standard deviation of split frequencies: 0.007080
871000 -- [-858.141] (-862.783) (-865.912) (-862.615) * (-862.562) (-859.673) [-854.007] (-861.472) -- 0:00:25
872000 -- [-865.814] (-861.900) (-859.803) (-856.793) * (-862.022) (-864.731) [-859.122] (-857.893) -- 0:00:25
873000 -- [-860.328] (-866.927) (-858.359) (-858.553) * (-861.563) (-862.627) (-861.845) [-857.316] -- 0:00:25
874000 -- [-860.812] (-861.578) (-866.547) (-855.004) * (-863.397) (-856.724) [-856.058] (-869.115) -- 0:00:25
875000 -- [-857.643] (-870.560) (-860.019) (-855.931) * [-865.614] (-860.907) (-860.071) (-864.263) -- 0:00:25
Average standard deviation of split frequencies: 0.007285
876000 -- (-860.082) [-864.851] (-862.543) (-860.326) * [-857.039] (-858.751) (-862.415) (-867.558) -- 0:00:24
877000 -- (-854.386) [-853.505] (-861.666) (-859.254) * (-855.587) (-865.518) [-854.243] (-862.663) -- 0:00:24
878000 -- (-855.010) (-857.182) (-858.598) [-859.693] * [-858.696] (-860.875) (-866.424) (-852.688) -- 0:00:24
879000 -- [-858.149] (-863.057) (-857.304) (-857.624) * (-864.046) (-856.290) [-859.969] (-856.806) -- 0:00:24
880000 -- (-861.398) (-858.618) [-856.951] (-856.763) * (-862.138) [-855.117] (-856.423) (-857.035) -- 0:00:24
Average standard deviation of split frequencies: 0.007535
881000 -- (-864.501) (-861.539) [-853.822] (-859.808) * (-855.907) (-876.851) [-858.430] (-864.781) -- 0:00:23
882000 -- (-856.289) (-866.381) (-858.614) [-863.569] * (-859.353) (-856.938) (-861.269) [-855.361] -- 0:00:23
883000 -- (-857.743) [-859.883] (-858.239) (-857.303) * (-865.761) (-856.584) [-857.688] (-855.990) -- 0:00:23
884000 -- [-855.490] (-871.672) (-858.368) (-856.660) * [-856.835] (-854.888) (-862.232) (-857.145) -- 0:00:23
885000 -- (-859.071) (-859.159) [-861.654] (-856.062) * [-858.827] (-864.225) (-869.932) (-865.315) -- 0:00:23
Average standard deviation of split frequencies: 0.007490
886000 -- [-853.516] (-863.010) (-854.444) (-860.091) * [-854.026] (-862.323) (-876.772) (-859.548) -- 0:00:22
887000 -- (-855.736) [-855.353] (-857.293) (-858.695) * (-863.904) (-859.208) (-863.892) [-860.230] -- 0:00:22
888000 -- (-860.823) [-855.162] (-857.594) (-861.383) * [-864.395] (-858.678) (-857.940) (-855.754) -- 0:00:22
889000 -- (-859.730) (-860.715) (-855.399) [-859.293] * (-855.001) (-862.683) (-855.402) [-856.743] -- 0:00:22
890000 -- (-858.701) (-862.025) (-861.446) [-857.573] * (-857.379) [-859.786] (-860.351) (-857.739) -- 0:00:22
Average standard deviation of split frequencies: 0.007369
891000 -- [-855.075] (-852.737) (-863.115) (-862.628) * (-851.440) (-865.287) (-868.711) [-854.796] -- 0:00:21
892000 -- [-855.457] (-858.608) (-862.171) (-872.186) * (-858.786) (-863.885) (-861.290) [-854.418] -- 0:00:21
893000 -- (-859.423) (-863.284) (-857.185) [-857.897] * (-858.594) [-856.839] (-861.737) (-867.576) -- 0:00:21
894000 -- [-857.368] (-862.350) (-859.341) (-861.369) * (-854.793) [-855.536] (-865.200) (-862.632) -- 0:00:21
895000 -- (-855.944) [-864.271] (-864.601) (-859.628) * [-858.441] (-863.850) (-861.338) (-859.485) -- 0:00:21
Average standard deviation of split frequencies: 0.007325
896000 -- (-858.312) (-854.826) (-858.993) [-855.357] * (-862.110) [-864.143] (-859.555) (-862.479) -- 0:00:20
897000 -- (-864.582) (-852.935) [-857.159] (-861.107) * (-855.665) [-862.521] (-868.754) (-864.858) -- 0:00:20
898000 -- [-855.390] (-859.968) (-856.947) (-858.765) * [-862.543] (-858.551) (-858.989) (-863.425) -- 0:00:20
899000 -- [-859.996] (-857.524) (-855.805) (-862.951) * (-859.456) (-856.292) [-858.412] (-859.739) -- 0:00:20
900000 -- (-856.156) [-850.911] (-858.383) (-864.451) * (-861.245) [-854.420] (-862.333) (-857.396) -- 0:00:20
Average standard deviation of split frequencies: 0.007368
901000 -- [-857.464] (-858.975) (-860.816) (-856.754) * [-860.622] (-871.469) (-857.383) (-861.900) -- 0:00:19
902000 -- [-855.313] (-862.544) (-860.838) (-857.996) * (-867.274) [-857.397] (-858.533) (-857.471) -- 0:00:19
903000 -- (-854.301) [-859.806] (-859.000) (-862.237) * (-860.762) (-859.479) (-860.970) [-856.353] -- 0:00:19
904000 -- (-860.529) (-857.108) (-858.672) [-860.027] * [-856.147] (-860.510) (-856.525) (-863.241) -- 0:00:19
905000 -- [-858.650] (-861.089) (-854.155) (-861.220) * (-857.924) [-855.225] (-864.084) (-865.254) -- 0:00:19
Average standard deviation of split frequencies: 0.007805
906000 -- (-863.270) [-857.041] (-860.970) (-862.926) * (-860.132) (-862.551) (-859.314) [-857.930] -- 0:00:18
907000 -- (-862.073) (-859.686) [-859.655] (-861.808) * [-855.699] (-867.138) (-862.923) (-867.134) -- 0:00:18
908000 -- (-859.912) (-861.913) [-855.003] (-857.817) * [-859.900] (-862.826) (-860.751) (-856.150) -- 0:00:18
909000 -- (-860.254) (-861.977) (-868.963) [-857.735] * [-855.471] (-861.934) (-862.942) (-860.362) -- 0:00:18
910000 -- (-853.291) (-860.910) [-854.959] (-856.412) * (-852.890) (-865.535) (-865.268) [-857.090] -- 0:00:18
Average standard deviation of split frequencies: 0.007924
911000 -- (-861.910) [-857.278] (-855.425) (-856.600) * [-857.117] (-856.280) (-862.829) (-860.334) -- 0:00:17
912000 -- (-858.844) [-862.017] (-855.902) (-860.306) * (-860.330) (-857.298) (-863.465) [-854.956] -- 0:00:17
913000 -- (-856.971) (-858.019) (-857.994) [-855.642] * (-853.815) (-856.386) (-855.843) [-856.830] -- 0:00:17
914000 -- (-861.730) [-852.066] (-862.573) (-856.080) * (-858.048) (-860.808) (-858.925) [-860.212] -- 0:00:17
915000 -- (-861.228) [-860.111] (-861.520) (-856.754) * (-867.503) (-855.937) [-859.066] (-856.104) -- 0:00:17
Average standard deviation of split frequencies: 0.007878
916000 -- (-857.086) (-860.569) [-861.275] (-860.154) * (-859.119) [-858.641] (-859.085) (-860.723) -- 0:00:16
917000 -- (-860.684) (-860.266) [-864.594] (-854.203) * [-861.721] (-859.168) (-867.513) (-857.429) -- 0:00:16
918000 -- [-866.153] (-866.163) (-859.379) (-858.205) * (-859.212) (-856.204) (-861.028) [-853.518] -- 0:00:16
919000 -- (-860.835) (-863.053) [-857.750] (-860.991) * (-861.722) (-858.333) (-863.485) [-866.826] -- 0:00:16
920000 -- (-859.172) (-863.473) (-860.583) [-852.659] * (-858.284) (-853.887) (-862.385) [-867.061] -- 0:00:16
Average standard deviation of split frequencies: 0.007917
921000 -- (-862.036) (-866.642) (-859.677) [-851.463] * (-868.641) (-859.293) (-862.215) [-863.902] -- 0:00:15
922000 -- (-863.461) (-861.522) (-866.236) [-851.769] * (-865.962) (-855.461) [-858.320] (-865.811) -- 0:00:15
923000 -- (-860.097) [-861.740] (-864.394) (-854.523) * [-861.194] (-853.569) (-856.429) (-858.218) -- 0:00:15
924000 -- (-861.458) (-868.032) [-856.987] (-859.770) * (-857.162) [-857.818] (-870.802) (-860.286) -- 0:00:15
925000 -- (-860.883) (-860.769) [-858.795] (-867.359) * (-861.474) (-860.421) (-868.252) [-857.435] -- 0:00:15
Average standard deviation of split frequencies: 0.008028
926000 -- (-867.360) (-856.404) (-857.506) [-857.388] * (-863.278) [-857.958] (-865.841) (-863.658) -- 0:00:14
927000 -- (-860.795) (-859.240) (-865.593) [-859.328] * [-859.159] (-854.974) (-852.727) (-867.017) -- 0:00:14
928000 -- (-860.453) (-869.833) (-853.807) [-860.761] * (-865.714) (-859.025) (-863.277) [-866.459] -- 0:00:14
929000 -- (-856.225) (-860.169) [-857.944] (-866.287) * [-859.817] (-854.887) (-857.999) (-869.748) -- 0:00:14
930000 -- (-856.083) (-860.632) [-862.340] (-862.421) * [-859.461] (-865.271) (-860.743) (-867.088) -- 0:00:14
Average standard deviation of split frequencies: 0.008143
931000 -- (-852.698) [-862.943] (-861.721) (-863.944) * [-859.526] (-857.875) (-865.309) (-866.814) -- 0:00:13
932000 -- [-853.940] (-861.499) (-872.051) (-856.363) * [-866.647] (-864.065) (-859.801) (-861.243) -- 0:00:13
933000 -- (-857.047) [-858.872] (-856.554) (-864.519) * (-857.843) (-876.081) [-857.423] (-860.594) -- 0:00:13
934000 -- (-860.418) (-863.759) (-856.908) [-859.412] * (-861.124) (-864.827) (-858.500) [-859.313] -- 0:00:13
935000 -- (-860.914) (-855.029) (-857.934) [-856.869] * [-863.594] (-857.535) (-864.359) (-869.058) -- 0:00:13
Average standard deviation of split frequencies: 0.007516
936000 -- (-861.796) (-866.608) [-859.517] (-856.507) * (-861.747) [-860.344] (-858.895) (-859.157) -- 0:00:12
937000 -- (-858.930) (-862.089) (-857.740) [-862.544] * (-863.254) (-865.382) [-861.349] (-854.803) -- 0:00:12
938000 -- (-856.064) (-871.336) [-859.249] (-860.593) * (-869.484) (-859.730) (-871.856) [-864.428] -- 0:00:12
939000 -- (-855.010) (-854.952) [-853.059] (-876.917) * (-861.218) [-856.768] (-862.908) (-860.474) -- 0:00:12
940000 -- [-860.420] (-856.655) (-854.045) (-860.736) * [-860.283] (-864.612) (-864.411) (-864.966) -- 0:00:12
Average standard deviation of split frequencies: 0.007633
941000 -- (-854.859) (-859.120) [-863.119] (-860.900) * (-862.306) (-858.590) (-866.231) [-858.799] -- 0:00:11
942000 -- (-859.053) (-860.274) (-870.242) [-861.274] * [-862.281] (-856.653) (-859.137) (-863.994) -- 0:00:11
943000 -- (-864.999) (-853.141) (-865.902) [-861.267] * (-856.896) (-864.139) [-863.248] (-863.828) -- 0:00:11
944000 -- (-856.436) (-861.946) (-860.507) [-853.224] * [-861.286] (-856.415) (-869.154) (-856.010) -- 0:00:11
945000 -- (-861.644) [-856.319] (-858.315) (-856.719) * [-862.764] (-859.928) (-853.564) (-865.591) -- 0:00:11
Average standard deviation of split frequencies: 0.007551
946000 -- (-861.857) (-858.498) [-853.818] (-857.955) * (-863.932) [-851.161] (-857.798) (-863.444) -- 0:00:10
947000 -- (-856.803) (-858.578) (-856.540) [-862.318] * (-858.953) [-859.195] (-864.184) (-867.945) -- 0:00:10
948000 -- (-858.906) (-858.408) (-862.925) [-855.008] * [-862.963] (-856.311) (-860.359) (-858.223) -- 0:00:10
949000 -- [-869.224] (-861.566) (-862.649) (-861.937) * (-855.264) [-860.104] (-871.272) (-858.105) -- 0:00:10
950000 -- [-857.353] (-865.683) (-864.204) (-858.758) * [-852.833] (-860.824) (-864.179) (-862.470) -- 0:00:10
Average standard deviation of split frequencies: 0.007896
951000 -- (-859.358) (-863.351) [-853.594] (-857.328) * (-859.018) (-856.538) (-866.558) [-860.290] -- 0:00:09
952000 -- [-865.939] (-862.191) (-857.673) (-858.148) * (-857.404) [-855.036] (-863.725) (-855.883) -- 0:00:09
953000 -- [-856.160] (-858.980) (-855.735) (-865.773) * (-861.398) (-858.305) [-854.918] (-862.448) -- 0:00:09
954000 -- (-859.978) (-855.352) (-861.437) [-863.355] * [-860.263] (-862.383) (-854.866) (-856.439) -- 0:00:09
955000 -- (-864.432) (-860.607) (-862.444) [-866.376] * (-858.578) [-864.325] (-855.157) (-860.357) -- 0:00:09
Average standard deviation of split frequencies: 0.007321
956000 -- (-854.962) (-866.026) (-857.915) [-861.317] * [-854.901] (-858.626) (-857.174) (-860.682) -- 0:00:08
957000 -- (-862.346) (-864.989) [-853.918] (-859.143) * (-860.197) (-856.685) [-860.445] (-868.855) -- 0:00:08
958000 -- (-861.427) (-855.410) [-855.736] (-857.605) * (-855.590) [-853.893] (-858.942) (-859.885) -- 0:00:08
959000 -- [-857.724] (-856.782) (-862.156) (-861.376) * (-856.733) (-863.779) [-854.538] (-859.216) -- 0:00:08
960000 -- (-860.984) (-859.392) (-869.528) [-858.126] * [-857.626] (-876.977) (-856.230) (-860.337) -- 0:00:08
Average standard deviation of split frequencies: 0.007663
961000 -- (-863.804) (-859.173) (-863.765) [-858.147] * (-856.494) (-866.950) [-853.589] (-855.795) -- 0:00:07
962000 -- (-859.237) [-856.704] (-865.522) (-869.185) * (-858.437) [-865.563] (-858.004) (-859.254) -- 0:00:07
963000 -- [-859.147] (-857.945) (-861.190) (-858.480) * (-860.376) (-873.360) [-855.887] (-862.901) -- 0:00:07
964000 -- (-864.038) (-856.943) (-870.872) [-852.903] * (-854.569) (-869.023) (-862.382) [-855.806] -- 0:00:07
965000 -- (-864.297) (-859.717) (-862.223) [-854.994] * (-858.165) (-861.668) (-862.181) [-859.061] -- 0:00:07
Average standard deviation of split frequencies: 0.007020
966000 -- [-861.929] (-862.293) (-870.447) (-857.974) * [-863.278] (-871.681) (-872.211) (-853.659) -- 0:00:06
967000 -- (-854.481) (-858.251) (-857.646) [-854.778] * [-861.128] (-859.026) (-858.263) (-863.332) -- 0:00:06
968000 -- (-858.976) [-859.234] (-859.777) (-855.047) * (-862.042) (-861.409) (-862.097) [-856.177] -- 0:00:06
969000 -- (-862.789) [-860.843] (-858.125) (-856.629) * (-861.144) [-852.201] (-861.097) (-863.336) -- 0:00:06
970000 -- [-855.425] (-863.338) (-861.236) (-856.152) * [-854.975] (-863.603) (-855.854) (-859.904) -- 0:00:06
Average standard deviation of split frequencies: 0.007061
971000 -- (-863.457) [-861.245] (-871.015) (-858.980) * (-862.512) (-860.401) (-856.395) [-860.121] -- 0:00:05
972000 -- (-860.823) (-861.151) [-860.551] (-868.324) * (-860.225) (-862.786) (-863.647) [-861.409] -- 0:00:05
973000 -- (-859.450) (-858.229) [-858.140] (-859.147) * [-857.116] (-855.488) (-864.388) (-862.798) -- 0:00:05
974000 -- (-857.373) [-853.827] (-854.499) (-864.337) * [-854.927] (-857.665) (-867.468) (-864.371) -- 0:00:05
975000 -- (-858.619) (-861.713) [-859.205] (-862.665) * (-861.515) (-860.284) [-861.845] (-861.541) -- 0:00:05
Average standard deviation of split frequencies: 0.006799
976000 -- (-855.797) (-861.132) [-853.785] (-861.620) * (-859.080) (-861.722) [-858.069] (-863.961) -- 0:00:04
977000 -- [-857.319] (-859.691) (-864.270) (-860.407) * (-868.291) [-854.850] (-862.566) (-863.315) -- 0:00:04
978000 -- (-859.782) (-861.186) (-862.492) [-856.788] * (-858.391) [-854.037] (-854.367) (-863.177) -- 0:00:04
979000 -- (-860.391) (-858.245) [-858.575] (-860.710) * (-860.200) (-858.407) [-854.452] (-858.353) -- 0:00:04
980000 -- (-861.163) (-866.162) [-857.016] (-860.505) * [-861.028] (-861.912) (-858.407) (-855.387) -- 0:00:04
Average standard deviation of split frequencies: 0.006915
981000 -- (-856.464) [-858.071] (-859.166) (-857.933) * (-862.855) (-863.299) [-864.445] (-859.386) -- 0:00:03
982000 -- (-861.144) (-858.402) [-857.125] (-866.370) * [-858.830] (-855.433) (-861.030) (-861.777) -- 0:00:03
983000 -- (-856.145) [-861.352] (-858.471) (-858.265) * (-854.562) [-855.714] (-858.001) (-856.221) -- 0:00:03
984000 -- (-858.142) (-860.703) [-858.691] (-856.552) * (-866.857) [-855.007] (-865.739) (-858.079) -- 0:00:03
985000 -- (-864.606) (-854.670) [-860.716] (-862.219) * (-863.923) [-858.450] (-855.945) (-865.192) -- 0:00:03
Average standard deviation of split frequencies: 0.007392
986000 -- (-861.354) (-856.877) (-863.293) [-858.780] * (-862.217) (-873.741) [-860.774] (-862.862) -- 0:00:02
987000 -- [-858.927] (-873.301) (-859.675) (-854.894) * (-860.633) [-853.657] (-862.226) (-863.990) -- 0:00:02
988000 -- (-858.271) (-866.999) [-858.516] (-858.699) * (-856.863) (-861.660) (-860.116) [-858.122] -- 0:00:02
989000 -- [-868.735] (-866.351) (-855.802) (-855.727) * (-870.087) [-858.196] (-865.062) (-859.666) -- 0:00:02
990000 -- (-858.636) (-862.552) (-862.062) [-865.220] * (-869.244) [-861.887] (-870.260) (-866.945) -- 0:00:02
Average standard deviation of split frequencies: 0.007650
991000 -- (-857.690) (-863.350) [-858.815] (-867.162) * (-863.264) (-861.547) [-856.749] (-861.691) -- 0:00:01
992000 -- (-859.893) (-859.506) (-860.673) [-862.065] * [-860.506] (-867.221) (-857.378) (-864.530) -- 0:00:01
993000 -- (-856.650) [-853.519] (-865.649) (-864.819) * [-864.307] (-861.723) (-861.316) (-865.267) -- 0:00:01
994000 -- (-861.242) (-862.472) (-858.103) [-855.664] * (-868.174) (-861.178) (-863.835) [-855.748] -- 0:00:01
995000 -- (-858.625) (-862.295) [-858.060] (-863.581) * (-862.341) (-868.038) [-855.602] (-861.602) -- 0:00:01
Average standard deviation of split frequencies: 0.007900
996000 -- (-862.039) [-862.394] (-859.396) (-861.146) * (-858.151) (-857.447) [-857.769] (-865.828) -- 0:00:00
997000 -- [-860.636] (-853.892) (-862.105) (-857.146) * (-862.248) (-868.782) (-864.006) [-858.543] -- 0:00:00
998000 -- [-859.442] (-855.898) (-866.363) (-863.885) * (-866.209) (-858.722) [-863.236] (-857.532) -- 0:00:00
999000 -- (-857.076) [-858.726] (-858.985) (-858.171) * [-858.126] (-858.448) (-858.910) (-867.067) -- 0:00:00
1000000 -- [-865.331] (-864.222) (-855.848) (-858.095) * (-860.822) (-854.345) (-866.359) [-866.494] -- 0:00:00
Average standard deviation of split frequencies: 0.007682
Analysis completed in 3 mins 20 seconds
Analysis used 199.43 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -849.06
Likelihood of best state for "cold" chain of run 2 was -849.10
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
67.4 % ( 61 %) Dirichlet(Revmat{all})
82.3 % ( 73 %) Slider(Revmat{all})
32.9 % ( 36 %) Dirichlet(Pi{all})
33.7 % ( 28 %) Slider(Pi{all})
79.8 % ( 65 %) Multiplier(Alpha{1,2})
74.9 % ( 53 %) Multiplier(Alpha{3})
90.4 % ( 92 %) Slider(Pinvar{all})
37.0 % ( 43 %) ExtSPR(Tau{all},V{all})
24.9 % ( 33 %) ExtTBR(Tau{all},V{all})
40.1 % ( 41 %) NNI(Tau{all},V{all})
40.3 % ( 34 %) ParsSPR(Tau{all},V{all})
27.0 % ( 33 %) Multiplier(V{all})
51.7 % ( 54 %) Nodeslider(V{all})
26.5 % ( 32 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
68.7 % ( 65 %) Dirichlet(Revmat{all})
82.5 % ( 73 %) Slider(Revmat{all})
32.5 % ( 31 %) Dirichlet(Pi{all})
34.1 % ( 30 %) Slider(Pi{all})
79.8 % ( 70 %) Multiplier(Alpha{1,2})
74.4 % ( 52 %) Multiplier(Alpha{3})
89.7 % ( 83 %) Slider(Pinvar{all})
37.4 % ( 33 %) ExtSPR(Tau{all},V{all})
25.1 % ( 20 %) ExtTBR(Tau{all},V{all})
40.1 % ( 41 %) NNI(Tau{all},V{all})
40.6 % ( 31 %) ParsSPR(Tau{all},V{all})
27.1 % ( 28 %) Multiplier(V{all})
51.5 % ( 55 %) Nodeslider(V{all})
26.3 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.77 0.57 0.41
2 | 166930 0.78 0.60
3 | 165911 166218 0.80
4 | 166835 167228 166878
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.76 0.57 0.41
2 | 166324 0.78 0.60
3 | 167306 166890 0.80
4 | 166350 166044 167086
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -856.74
| 2 |
| 1 1 1 1 |
| 21 2 2 1 2 *1 |
| 2 1 2 11 22 1 1 11 2 |
| 2 2 21 1 112 2 1 2 2 1** |
|2 1 2 2 11 2 1 21 1 * 2 |
| 2 * 1 2 1 *1 1 2 2 1 |
|1 * 1 2* 1 1 122 1 1 1 |
| 1 * 2 22 2 1 1 2 1 2 2 12 1|
| 2 21 1 1 1 2 |
| 2 1 2 2 2 |
| 1 2 2|
| |
| 2 |
| 2 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -861.02
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -854.85 -865.95
2 -854.98 -867.89
--------------------------------------
TOTAL -854.92 -867.33
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.092875 0.000357 0.057565 0.129556 0.091363 1158.92 1329.96 1.000
r(A<->C){all} 0.079939 0.001727 0.011718 0.163824 0.073825 606.41 715.96 1.000
r(A<->G){all} 0.255574 0.005736 0.128504 0.424591 0.251281 468.36 501.63 1.000
r(A<->T){all} 0.083112 0.001599 0.014191 0.158056 0.077325 525.11 600.48 1.000
r(C<->G){all} 0.043157 0.001528 0.000024 0.121421 0.032054 497.06 542.15 1.003
r(C<->T){all} 0.391477 0.006492 0.240316 0.555939 0.388057 573.48 616.43 1.000
r(G<->T){all} 0.146741 0.003476 0.042324 0.261820 0.138604 524.41 587.45 1.000
pi(A){all} 0.295688 0.000441 0.255827 0.337544 0.295302 1263.61 1263.85 1.001
pi(C){all} 0.225913 0.000350 0.190637 0.263648 0.225945 1191.64 1250.30 1.001
pi(G){all} 0.194070 0.000316 0.159174 0.228003 0.193503 1287.40 1337.52 1.000
pi(T){all} 0.284328 0.000435 0.246031 0.325568 0.283826 1244.71 1255.44 1.000
alpha{1,2} 0.738954 0.719907 0.000020 2.432164 0.456265 1143.14 1143.46 1.000
alpha{3} 1.323106 1.254616 0.000264 3.480914 1.015594 983.47 1194.93 1.000
pinvar{all} 0.373306 0.043269 0.000543 0.705739 0.370966 563.58 755.07 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
--------------
1 -- .*******
2 -- .*......
3 -- ..*.....
4 -- ...*....
5 -- ....*...
6 -- .....*..
7 -- ......*.
8 -- .......*
9 -- .**.....
10 -- .....**.
11 -- .**..**.
12 -- ....*..*
13 -- ...**..*
14 -- ...**...
15 -- .**.****
16 -- ...*...*
17 -- .**..***
18 -- .***.**.
19 -- .**.***.
20 -- .******.
21 -- .***.***
--------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
9 3002 1.000000 0.000000 1.000000 1.000000 2
10 3002 1.000000 0.000000 1.000000 1.000000 2
11 2960 0.986009 0.004711 0.982678 0.989340 2
12 623 0.207528 0.002355 0.205863 0.209194 2
13 618 0.205863 0.002827 0.203864 0.207861 2
14 607 0.202199 0.025910 0.183877 0.220520 2
15 605 0.201532 0.005182 0.197868 0.205197 2
16 604 0.201199 0.001884 0.199867 0.202532 2
17 594 0.197868 0.016959 0.185876 0.209860 2
18 594 0.197868 0.015075 0.187209 0.208528 2
19 587 0.195536 0.002355 0.193871 0.197202 2
20 580 0.193205 0.012248 0.184544 0.201865 2
21 556 0.185210 0.010364 0.177881 0.192538 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.005171 0.000010 0.000475 0.011156 0.004617 1.000 2
length{all}[2] 0.010685 0.000027 0.001447 0.020368 0.009953 1.000 2
length{all}[3] 0.011949 0.000030 0.002882 0.022695 0.011094 1.002 2
length{all}[4] 0.001679 0.000003 0.000000 0.005140 0.001158 1.000 2
length{all}[5] 0.001728 0.000003 0.000001 0.005133 0.001206 1.000 2
length{all}[6] 0.001753 0.000003 0.000000 0.005336 0.001198 1.000 2
length{all}[7] 0.001697 0.000003 0.000001 0.005085 0.001180 1.000 2
length{all}[8] 0.001750 0.000003 0.000000 0.005303 0.001142 1.000 2
length{all}[9] 0.023198 0.000070 0.008642 0.039449 0.022201 1.000 2
length{all}[10] 0.020517 0.000056 0.008117 0.036541 0.019448 1.000 2
length{all}[11] 0.009348 0.000024 0.001270 0.019420 0.008537 1.000 2
length{all}[12] 0.001805 0.000003 0.000002 0.005524 0.001245 1.002 2
length{all}[13] 0.001759 0.000003 0.000000 0.005267 0.001209 1.000 2
length{all}[14] 0.001671 0.000003 0.000002 0.005341 0.001158 0.998 2
length{all}[15] 0.001761 0.000004 0.000000 0.005445 0.001194 0.998 2
length{all}[16] 0.001778 0.000003 0.000001 0.005491 0.001219 1.000 2
length{all}[17] 0.001757 0.000003 0.000002 0.005302 0.001149 1.000 2
length{all}[18] 0.001678 0.000003 0.000000 0.004745 0.001228 0.998 2
length{all}[19] 0.001844 0.000003 0.000001 0.005764 0.001314 0.999 2
length{all}[20] 0.001782 0.000004 0.000000 0.005332 0.001198 1.008 2
length{all}[21] 0.001726 0.000003 0.000002 0.004987 0.001209 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007682
Maximum standard deviation of split frequencies = 0.025910
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
+------------------------------------------------------------------------ C8 (8)
|
| /------------------------ C2 (2)
| /----------100----------+
| | \------------------------ C3 (3)
\-----------99----------+
| /------------------------ C6 (6)
\----------100----------+
\------------------------ C7 (7)
Phylogram (based on average branch lengths):
/-------- C1 (1)
|
|-- C4 (4)
|
|-- C5 (5)
|
+-- C8 (8)
|
| /----------------- C2 (2)
| /-------------------------------------+
| | \------------------- C3 (3)
\--------------+
| /-- C6 (6)
\--------------------------------+
\-- C7 (7)
|-------| 0.005 expected changes per site
Calculating tree probabilities...
Credible sets of trees (46 trees sampled):
50 % credible set contains 8 trees
90 % credible set contains 14 trees
95 % credible set contains 15 trees
99 % credible set contains 21 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
Running FUBAR...
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\
***************** TYPES OF STANDARD ANALYSES *****************
(1) Selection Analyses
(2) Evolutionary Hypothesis Testing
(3) Relative evolutionary rate inference
(4) Coevolutionary analysis
(5) Basic Analyses
(6) Codon Selection Analyses
(7) Compartmentalization
(8) Data File Tools
(9) Miscellaneous
(10) Model Comparison
(11) Kernel Analysis Tools
(12) Molecular Clock
(13) Phylogeny Reconstruction
(14) Positive Selection
(15) Recombination
(16) Selection/Recombination
(17) Relative Rate
(18) Relative Ratio
(19) Substitution Rates
Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' *****************
(1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution).
(2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood).
(3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting).
(4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection).
(5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification).
(6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood).
(7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation).
Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types):
Analysis Description
--------------------
Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a
coding sequence alignment to determine whether some sites have been
subject to pervasive purifying or diversifying selection. v2.1
introduces two more methods for estimating the posterior distribution of
grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation
Bayes approximation (fastest). Please note that a FUBAR analysis
generates a cache and a results JSON file in the same directory as
directory as the original alignment. HyPhy needs to have write
privileges to this directory. For example if the original file is in
/home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there
will also exist FUBAR-generated files
/home/sergei/FUBAR/data/pol.nex.FUBAR.json,
/home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide
checkpointing so that a partially completed analysis can be restarted.
- __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree
(one per partition)
- __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring
selection (2013), Mol Biol Evol. 30(5):1196-205
- __Written by__: Sergei L Kosakovsky Pond
- __Contact Information__: spond@temple.edu
- __Analysis Version__: 2.1
####Choose Genetic Code
1. [**Universal**] Universal code. (Genebank transl_table=1).
2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2).
3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3).
4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4).
5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5).
6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6).
7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9).
8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10).
9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12).
10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13).
11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14).
12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15).
13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16).
14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21).
15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22).
16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23).
17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24).
18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25).
19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26).
>Please choose an option (or press q to cancel selection):
>Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`)
>A tree was found in the data file: `(C1,C4,C5,C8,((C2,C3),(C6,C7)))`
>Would you like to use it (y/n)?
>Loaded a multiple sequence alignment with **8** sequences, **153** codons, and **1** partitions from `/data//pss_subsets/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna`
> FUBAR will write cache and result files to _/data//pss_subsets/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna.FUBAR.json_, respectively
> Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer):
####Posterior estimation method
1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation)
2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed)
3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default)
>Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5):
### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model
* Log(L) = -847.97, AIC-c = 1734.14 (19 estimated parameters)
* Tree length (expected substitutions/site) for partition 1 : 0.083
### Computing the phylogenetic likelihood function on the grid
* Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid
* Best scaling achieved for
* synonymous rate = 1.227
* non-synonymous rate = 0.786
* Computing conditional site likelihoods on a 20 x 20 rate grid
### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights
* Using the following settings
* Dirichlet alpha : 0.5
### Tabulating site-level results
| Codon | Partition | alpha | beta |Posterior prob for positive selection|
|:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:|
| 78 | 1 | 2.813 | 29.036 | Pos. posterior = 0.9511 |
| 82 | 1 | 2.293 | 18.830 | Pos. posterior = 0.9197 |
----
## FUBAR inferred 2 sites subject to diversifying positive selection at posterior probability >= 0.9
Of these, 0.13 are expected to be false positives (95% confidence interval of 0-1 )
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=8, Len=153
LSH5A_NS7b_AFU92101_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSAAPTTYRASQAAKVLIHTTEKVTLNNQRTHSYTKWS
183A_NS7b_AFU92110_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSAAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
SL12A_NS7b_AFU92083_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
TLC1310A_NS7b_AFU92092_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
TLC1343A_NS7b_AFU92128_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
TLC1347A_NS7b_AFU92137_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG
TT3A_NS7b_AFU92075_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG
*********:*** :***************:************:*****.
LSH5A_NS7b_AFU92101_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10 VCSTGWNTYTNTMVVVNGRWVETAKPPKPTAVAIPTFPYEPRSEKPGFGS
183A_NS7b_AFU92110_1_2005_10_China_Bat_Bat_coronavirus_HKU10 VCSTGWNTYTNTMVVVNGRWVETTKPPRPTAIAIPTFPYEPRSEKPGFGS
SL12A_NS7b_AFU92083_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
TLC1310A_NS7b_AFU92092_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
TLC1343A_NS7b_AFU92128_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 VCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGS
TLC1347A_NS7b_AFU92137_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 VCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGS
TT3A_NS7b_AFU92075_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS
***********************:***.***.****.*** *********
LSH5A_NS7b_AFU92101_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10 HFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWST
183A_NS7b_AFU92110_1_2005_10_China_Bat_Bat_coronavirus_HKU10 HFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHQTFAVTTFRWST
SL12A_NS7b_AFU92083_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
TLC1310A_NS7b_AFU92092_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
TLC1343A_NS7b_AFU92128_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 HFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSS
TLC1347A_NS7b_AFU92137_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 HFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSS
TT3A_NS7b_AFU92075_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS
***********:***.**** *****************:*******:**:
LSH5A_NS7b_AFU92101_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 PLN
175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10 PSN
183A_NS7b_AFU92110_1_2005_10_China_Bat_Bat_coronavirus_HKU10 PSN
SL12A_NS7b_AFU92083_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 PSN
TLC1310A_NS7b_AFU92092_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 PSN
TLC1343A_NS7b_AFU92128_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 PSN
TLC1347A_NS7b_AFU92137_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 PSN
TT3A_NS7b_AFU92075_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 PSN
* *
>LSH5A_NS7b_AFU92101_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGAAATTGTTACTGCTTCTTAGTATTCTTAGCTTTTCCTCTTCTGCCCCAACTACCTATCGGGCATCTCAAGCTGCTAAAGTACTAATTTATACCACTGAAAAAGTCACTCTAAATAACCAGAGAACATACTCATACACAAAATGGGGTGTGTGCTCCACAGGATGGAACACATACACGAACACAATGGTTGTGGTTAATGGTAGGTGGGTTGAAACAGCCAAACCGCCAAGACCAACAGCCTTTGCCATTCCAACATTTCCATACGAGCCTAGAAGTGAAAAACCAGGTTTTGGTTCTCACTTTGATTATGGCCGTATTGAGTATGAGAGTATCTTGTGTGCTGCATTTGAGCATGTCATTAATGACATTGCAAAAATTGCTGCTCAATTGGCTCAAACACAGCGTAGACATCATACTTTTGCTGTGACGACTTTCAAGTGGTCTTCTCCTTTAAAT >175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ATGAAATTGTTACTGCTTCTTAGTATTCTTAGCTTTTCTTCTGCAGCCCCAACTACCTATCGGGCATCTCAAGCTGCTAAAGTACTAATTCATACCACTGAAAAAGTCACTCTAAATAACCAGAGAACACACTCATACACAAAATGGAGTGTGTGCTCCACAGGATGGAACACATACACGAACACAATGGTTGTGGTTAATGGTAGGTGGGTTGAAACAGCCAAACCGCCAAAACCAACAGCCGTTGCTATTCCAACATTCCCATACGAGCCTAGAAGTGAAAAACCAGGTTTTGGTTCTCACTTTGACTACGGCCGTATTGAGTATGAGAGTATCTTGTGTGCTGCATTTGAGCATGTCAGTAATGACATTGCAAAAATTGCTGCTCAATTGGCTCAGACACAGCGACGACATCACACTTTCGCTGTGACGACTTTTAAGTGGTCTACTCCTTCAAAT >183A_NS7b_AFU92110_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ATGAAATTGTTACTGCTTCTTAGTATTCTTAGCTTTTCTTCTGCAGCCCCAACTACCTATCGGGCATCTCAAGCTGCTAAAGTACTAATTTATACCACTGAAAAAGTCACTCTAAATAACCAGAGAACACACTCATACACAAAATGGGGTGTGTGCTCCACAGGATGGAACACATACACGAACACAATGGTTGTGGTTAATGGTAGGTGGGTTGAAACAACCAAACCGCCAAGACCCACAGCCATTGCTATTCCAACATTCCCATACGAGCCTAGAAGTGAAAAACCAGGTTTTGGTTCTCACTTTGACTATGGCCGTATTGAGTATGAGAGTATCTTGTGTGCTGCATTTGAGCATGTCAGTAATGACATTGCAAAAATTGCTGCTCAATTGGCTCAGACACAGCGACGACATCAGACTTTCGCTGTGACTACTTTTAGGTGGTCTACTCCTTCAAAT >SL12A_NS7b_AFU92083_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGAAATTGTTACTGCTTCTTAGTATTCTTAGCTTTTCCTCTTCTGCCCCAACTACCTATCGGGCATCTCAAGCTGCTAAAGTACTAATTTATACCACTGAAAAAGTCACTCTAAATAACCAGAGAACATACTCATACACAAAATGGGGTGTGTGCTCCACAGGATGGAACACATACACGAACACAATGGTTGTGGTTAATGGTAGGTGGGTTGAAACAGCCAAACCGCCAAGACCAACAGCCTTTGCTATTCCAACATTTCCATACGAGCCTAGAAGTGAAAAACCAGGTTTTGGTTCTCACTTTGATTATGGCCGTATTGAGTATGAGAGTATCTTGTGTGCTGCATTTGAGCATGTCATTAATGACATTGCAAAAATTGCTGCTCAATTGGCTCAAACACAGCGTAGACATCATACTTTTGCTGTGACGACTTTCAAGTGGTCTTCTCCTTCAAAT >TLC1310A_NS7b_AFU92092_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGAAATTGTTACTGCTTCTTAGTATTCTTAGCTTTTCCTCTTCTGCCCCAACTACCTATCGGGCATCTCAAGCTGCTAAAGTACTAATTTATACCACTGAAAAAGTCACTCTAAATAACCAGAGAACATACTCATACACAAAATGGGGTGTGTGCTCCACAGGATGGAACACATACACGAACACAATGGTTGTGGTTAATGGTAGGTGGGTTGAAACAGCCAAACCGCCAAGACCAACAGCCTTTGCTATTCCAACATTTCCATACGAGCCTAGAAGTGAAAAACCAGGTTTTGGTTCTCACTTTGATTATGGCCGTATTGAGTATGAGAGTATCTTGTGTGCTGCATTTGAGCATGTCATTAATGACATTGCAAAAATTGCTGCTCAATTGGCTCAAACACAGCGTAGACATCATACTTTTGCTGTGACGACTTTCAAGTGGTCTTCTCCTTCAAAT >TLC1343A_NS7b_AFU92128_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGAAATTGTTACTGCTTCTTAGTATTTTTAGCTTTTCCTATTCTGCCCCAACTACCTATCGGGCATCTCAAGCTGCTAAAGTACTAATTTACACCACTGAAAAAGTCACTCTAAATAACCAGAGAACACACTCATACACAAAATGGGGTGTGTGCTCCACAGGATGGAACACATACACGAACACAATGGTTGTGGTTAATGGTAGGTGGGTTGAAACAGCCAAACCGCCAGAACCAACAGCCATTGCTATTCCAACAGTCCCATACGAGCTTAGAAGTGAAAAACCAGGTTTTGGTTCTCACTTTGATTATGGCCGTATTGAGTATGAGAGTGTCTTGTGTGCTGTATTTGAGCATGTCAGTAATGACATTGCAAAAATTGCTGCCCAATTGGCTCAAACACAGCGTAGACATCATACTTTTGCTGTGACGACTTTCAAGTGGTCTTCTCCTTCAAAT >TLC1347A_NS7b_AFU92137_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGAAATTGTTACTGCTTCTTAGTATTTTTAGCTTTTCCTATTCTGCCCCAACTACCTATCGGGCATCTCAAGCTGCTAAAGTACTAATTTACACCACTGAAAAAGTCACTCTAAATAACCAGAGAACACACTCATACACAAAATGGGGTGTGTGCTCCACAGGATGGAACACATACACGAACACAATGGTTGTGGTTAATGGTAGGTGGGTTGAAACAGCCAAACCGCCAGAACCAACAGCCATTGCTATTCCAACAGTCCCATACGAGCTTAGAAGTGAAAAACCAGGTTTTGGTTCTCACTTTGATTATGGCCGTATTGAGTATGAGAGTGTCTTGTGTGCTGTATTTGAGCATGTCAGTAATGACATTGCAAAAATTGCTGCCCAATTGGCTCAAACACAGCGTAGACATCATACTTTTGCTGTGACGACTTTCAAGTGGTCTTCTCCTTCAAAT >TT3A_NS7b_AFU92075_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGAAATTGTTACTGCTTCTTAGTATTCTTAGCTTTTCCTCTTCTGCCCCAACTACCTATCGGGCATCTCAAGCTGCTAAAGTACTAATTTATACCACTGAAAAAGTCACTCTAAATAACCAGAGAACATACTCATACACAAAATGGGGTGTGTGCTCCACAGGATGGAACACATACACGAACACAATGGTTGTGGTTAATGGTAGGTGGGTTGAAACAGCCAAACCGCCAAGACCAACAGCCTTTGCTATTCCAACATTTCCATACGAGCCTAGAAGTGAAAAACCAGGTTTTGGTTCTCACTTTGATTATGGCCGTATTGAGTATGAGAGTATCTTGTGTGCTGCATTTGAGCATGTCATTAATGACATTGCAAAAATTGCTGCTCAATTGGCTCAAACACAGCGTAGACATCATACTTTTGCTGTGACGACTTTCAAGTGGTCTTCTCCTTCAAAT
>LSH5A_NS7b_AFU92101_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS PLN >175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSAAPTTYRASQAAKVLIHTTEKVTLNNQRTHSYTKWS VCSTGWNTYTNTMVVVNGRWVETAKPPKPTAVAIPTFPYEPRSEKPGFGS HFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWST PSN >183A_NS7b_AFU92110_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSAAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG VCSTGWNTYTNTMVVVNGRWVETTKPPRPTAIAIPTFPYEPRSEKPGFGS HFDYGRIEYESILCAAFEHVSNDIAKIAAQLAQTQRRHQTFAVTTFRWST PSN >SL12A_NS7b_AFU92083_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS PSN >TLC1310A_NS7b_AFU92092_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS PSN >TLC1343A_NS7b_AFU92128_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG VCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGS HFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSS PSN >TLC1347A_NS7b_AFU92137_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSIFSFSYSAPTTYRASQAAKVLIYTTEKVTLNNQRTHSYTKWG VCSTGWNTYTNTMVVVNGRWVETAKPPEPTAIAIPTVPYELRSEKPGFGS HFDYGRIEYESVLCAVFEHVSNDIAKIAAQLAQTQRRHHTFAVTTFKWSS PSN >TT3A_NS7b_AFU92075_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MKLLLLLSILSFSSSAPTTYRASQAAKVLIYTTEKVTLNNQRTYSYTKWG VCSTGWNTYTNTMVVVNGRWVETAKPPRPTAFAIPTFPYEPRSEKPGFGS HFDYGRIEYESILCAAFEHVINDIAKIAAQLAQTQRRHHTFAVTTFKWSS PSN
Reading sequence file /data//pss_subsets/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/fasta/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1
Found 8 sequences of length 459
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 3.0%
Found 24 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 4
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 22 polymorphic sites
**p-Value(s)**
----------
NSS: 1.05e-01 (1000 permutations)
Max Chi^2: 3.47e-01 (1000 permutations)
PHI (Permutation): 9.20e-02 (1000 permutations)
PHI (Normal): 4.66e-02
#NEXUS
[ID: 5175601111]
begin taxa;
dimensions ntax=8;
taxlabels
LSH5A_NS7b_AFU92101_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10
183A_NS7b_AFU92110_1_2005_10_China_Bat_Bat_coronavirus_HKU10
SL12A_NS7b_AFU92083_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1310A_NS7b_AFU92092_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1343A_NS7b_AFU92128_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1347A_NS7b_AFU92137_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10
TT3A_NS7b_AFU92075_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
;
end;
begin trees;
translate
1 LSH5A_NS7b_AFU92101_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10,
2 175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10,
3 183A_NS7b_AFU92110_1_2005_10_China_Bat_Bat_coronavirus_HKU10,
4 SL12A_NS7b_AFU92083_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10,
5 TLC1310A_NS7b_AFU92092_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10,
6 TLC1343A_NS7b_AFU92128_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10,
7 TLC1347A_NS7b_AFU92137_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10,
8 TT3A_NS7b_AFU92075_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:4.617026e-03,4:1.158163e-03,5:1.205889e-03,8:1.142244e-03,((2:9.953314e-03,3:1.109382e-02)1.000:2.220128e-02,(6:1.198174e-03,7:1.179639e-03)1.000:1.944816e-02)0.986:8.536948e-03);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:4.617026e-03,4:1.158163e-03,5:1.205889e-03,8:1.142244e-03,((2:9.953314e-03,3:1.109382e-02):2.220128e-02,(6:1.198174e-03,7:1.179639e-03):1.944816e-02):8.536948e-03);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -854.97 -866.31
2 -854.96 -866.16
--------------------------------------
TOTAL -854.97 -866.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.093203 0.000358 0.058858 0.131155 0.090837 1347.16 1424.08 1.000
r(A<->C){all} 0.082698 0.001753 0.015341 0.167786 0.076230 677.63 754.93 1.002
r(A<->G){all} 0.253154 0.005514 0.122308 0.407673 0.247810 340.57 371.16 1.000
r(A<->T){all} 0.082169 0.001618 0.014997 0.161858 0.075938 595.54 642.39 1.001
r(C<->G){all} 0.043326 0.001472 0.000018 0.118620 0.032519 467.44 515.63 1.003
r(C<->T){all} 0.390746 0.006680 0.231735 0.543070 0.388783 454.16 539.93 1.000
r(G<->T){all} 0.147908 0.003503 0.037087 0.260888 0.141226 590.27 620.87 1.007
pi(A){all} 0.295606 0.000421 0.256404 0.335086 0.294951 1199.82 1325.62 1.000
pi(C){all} 0.225250 0.000345 0.189409 0.262090 0.224890 1248.34 1254.17 1.000
pi(G){all} 0.193895 0.000330 0.157420 0.228435 0.193361 980.79 1184.40 1.000
pi(T){all} 0.285249 0.000404 0.248145 0.325299 0.284923 1177.44 1200.22 1.000
alpha{1,2} 0.703206 0.615702 0.000198 2.241400 0.441514 1152.55 1212.30 1.000
alpha{3} 1.324228 1.223212 0.000646 3.485764 1.019498 1202.04 1314.42 1.000
pinvar{all} 0.371197 0.041543 0.004650 0.708667 0.368601 727.96 808.22 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C4,C5,C8,((C2,C3),(C6,C7)))` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **8** sequences, **153** codons, and **1** partitions from `/data//pss_subsets/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_NS7b_AFU92119_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -847.97, AIC-c = 1734.14 (19 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.083 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 1.227 * non-synonymous rate = 0.786 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results | Codon | Partition | alpha | beta |Posterior prob for positive selection| |:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:| | 78 | 1 | 2.813 | 29.036 | Pos. posterior = 0.9511 | | 82 | 1 | 2.293 | 18.830 | Pos. posterior = 0.9197 | ---- ## FUBAR inferred 2 sites subject to diversifying positive selection at posterior probability >= 0.9 Of these, 0.13 are expected to be false positives (95% confidence interval of 0-1 )
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
