--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -290.58 -294.71
2 -290.55 -293.07
--------------------------------------
TOTAL -290.57 -294.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 8.803618 97.945221 0.000004 28.539790 5.756821 243.91 381.41 1.000
r(A<->C){all} 0.155064 0.016987 0.000004 0.419258 0.122201 191.94 239.33 1.000
r(A<->G){all} 0.161628 0.018658 0.000103 0.432568 0.125444 101.82 150.70 1.000
r(A<->T){all} 0.178465 0.023202 0.000001 0.486067 0.134419 105.69 123.61 1.005
r(C<->G){all} 0.163775 0.019277 0.000006 0.440523 0.124338 131.07 185.38 1.003
r(C<->T){all} 0.174810 0.021618 0.000313 0.470862 0.138058 109.91 174.30 1.000
r(G<->T){all} 0.166259 0.018852 0.000046 0.430731 0.133882 139.48 192.46 1.002
pi(A){all} 0.283943 0.000843 0.224475 0.339072 0.283198 1091.33 1282.11 1.001
pi(C){all} 0.122505 0.000448 0.082847 0.164546 0.121574 1231.58 1298.53 1.000
pi(G){all} 0.178791 0.000650 0.127935 0.229106 0.178006 1084.02 1170.00 1.001
pi(T){all} 0.414761 0.001030 0.350167 0.474762 0.414714 1005.24 1068.80 1.000
alpha{1,2} 0.914205 0.990830 0.000316 2.812838 0.601827 1016.32 1108.77 1.000
alpha{3} 0.960329 1.011446 0.000666 3.012459 0.641850 1106.19 1137.09 1.002
pinvar{all} 0.966101 0.011349 0.711975 0.999996 0.995926 15.69 31.20 1.003
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
-- Starting log on Thu Oct 20 00:46:20 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=8, Len=75
C1 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C2 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C3 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C4 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C5 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C6 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C7 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C8 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
**************************************************
C1 YVPVYSAYVMYKNFMQIDPCPVIDV
C2 YVPVYSAYVMYKNFMQIDPCPVIDV
C3 YVPVYSAYVMYKNFMQIDPCPVIDV
C4 YVPVYSAYVMYKNFMQIDPCPVIDV
C5 YVPVYSAYVMYKNFMQIDPCPVIDV
C6 YVPVYSAYVMYKNFMQIDPCPVIDV
C7 YVPVYSAYVMYKNFMQIDPCPVIDV
C8 YVPVYSAYVMYKNFMQIDPCPVIDV
*************************
-- Starting log on Thu Oct 20 00:46:52 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=8, Len=75
C1 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C2 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C3 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C4 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C5 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C6 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C7 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C8 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
**************************************************
C1 YVPVYSAYVMYKNFMQIDPCPVIDV
C2 YVPVYSAYVMYKNFMQIDPCPVIDV
C3 YVPVYSAYVMYKNFMQIDPCPVIDV
C4 YVPVYSAYVMYKNFMQIDPCPVIDV
C5 YVPVYSAYVMYKNFMQIDPCPVIDV
C6 YVPVYSAYVMYKNFMQIDPCPVIDV
C7 YVPVYSAYVMYKNFMQIDPCPVIDV
C8 YVPVYSAYVMYKNFMQIDPCPVIDV
*************************
-- Starting log on Thu Oct 20 00:46:20 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=8, Len=75
C1 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C2 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C3 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C4 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C5 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C6 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C7 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
C8 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
**************************************************
C1 YVPVYSAYVMYKNFMQIDPCPVIDV
C2 YVPVYSAYVMYKNFMQIDPCPVIDV
C3 YVPVYSAYVMYKNFMQIDPCPVIDV
C4 YVPVYSAYVMYKNFMQIDPCPVIDV
C5 YVPVYSAYVMYKNFMQIDPCPVIDV
C6 YVPVYSAYVMYKNFMQIDPCPVIDV
C7 YVPVYSAYVMYKNFMQIDPCPVIDV
C8 YVPVYSAYVMYKNFMQIDPCPVIDV
*************************
-- Starting log on Thu Oct 20 00:53:52 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/gapped_alignment/fubar,175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 8 taxa and 225 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666227239
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1338076351
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5579049873
Seed = 1376327414
Swapseed = 1666227239
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -364.897132 -- 29.153684
Chain 2 -- -364.897138 -- 29.153684
Chain 3 -- -364.897135 -- 29.153684
Chain 4 -- -364.897125 -- 29.153684
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -364.897136 -- 29.153684
Chain 2 -- -364.897142 -- 29.153684
Chain 3 -- -364.897138 -- 29.153684
Chain 4 -- -364.897138 -- 29.153684
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-364.897] (-364.897) (-364.897) (-364.897) * [-364.897] (-364.897) (-364.897) (-364.897)
1000 -- (-297.790) (-301.887) [-292.070] (-292.050) * [-293.948] (-296.571) (-294.107) (-291.959) -- 0:00:00
2000 -- (-295.398) (-294.310) [-294.537] (-291.611) * (-292.992) [-290.665] (-299.696) (-295.554) -- 0:00:00
3000 -- (-291.833) (-293.324) (-290.990) [-289.883] * [-291.104] (-292.897) (-293.030) (-296.916) -- 0:00:00
4000 -- (-295.846) (-295.063) (-295.053) [-290.708] * (-292.184) (-296.333) (-293.409) [-292.548] -- 0:04:09
5000 -- (-293.884) (-293.865) [-289.436] (-295.760) * (-294.488) [-292.001] (-295.204) (-297.614) -- 0:03:19
Average standard deviation of split frequencies: 0.089404
6000 -- (-292.794) (-291.427) [-291.232] (-295.080) * (-294.943) (-294.495) [-289.269] (-298.199) -- 0:02:45
7000 -- (-293.572) [-292.086] (-291.129) (-298.512) * (-292.100) (-292.004) [-290.629] (-295.402) -- 0:02:21
8000 -- (-294.959) (-294.209) (-294.203) [-292.616] * (-294.892) (-294.753) (-289.935) [-293.989] -- 0:02:04
9000 -- (-295.661) [-289.484] (-292.056) (-294.036) * [-290.479] (-294.291) (-291.497) (-292.740) -- 0:01:50
10000 -- [-290.746] (-297.743) (-298.494) (-290.874) * [-293.249] (-297.915) (-290.409) (-295.937) -- 0:01:39
Average standard deviation of split frequencies: 0.091150
11000 -- [-290.093] (-293.336) (-290.933) (-294.807) * (-293.954) (-292.114) (-297.636) [-291.017] -- 0:01:29
12000 -- [-289.486] (-295.571) (-291.779) (-295.639) * (-295.175) (-291.534) (-291.302) [-290.034] -- 0:02:44
13000 -- (-292.550) (-293.259) (-293.934) [-290.891] * (-292.134) (-293.827) [-291.302] (-293.283) -- 0:02:31
14000 -- (-294.783) (-297.660) (-299.786) [-293.136] * (-293.787) (-291.440) [-291.978] (-292.473) -- 0:02:20
15000 -- (-291.770) (-294.066) (-294.556) [-291.419] * (-291.121) (-297.236) [-290.451] (-294.084) -- 0:02:11
Average standard deviation of split frequencies: 0.071202
16000 -- (-289.892) (-296.724) (-293.510) [-290.418] * (-294.633) (-294.777) [-292.953] (-291.884) -- 0:02:03
17000 -- [-292.889] (-292.018) (-296.909) (-290.273) * (-296.729) [-289.494] (-293.551) (-295.260) -- 0:01:55
18000 -- (-291.227) (-289.669) (-294.699) [-290.581] * (-292.776) (-293.207) (-291.765) [-291.487] -- 0:01:49
19000 -- [-290.367] (-298.437) (-295.825) (-297.524) * [-294.205] (-292.344) (-292.146) (-295.316) -- 0:02:34
20000 -- [-290.162] (-294.513) (-293.798) (-299.495) * (-291.726) [-290.242] (-293.850) (-294.391) -- 0:02:27
Average standard deviation of split frequencies: 0.050987
21000 -- (-293.127) (-295.606) (-293.943) [-289.242] * (-292.395) [-290.503] (-291.817) (-304.498) -- 0:02:19
22000 -- (-294.536) [-291.551] (-291.025) (-295.163) * (-295.823) [-289.713] (-291.573) (-291.619) -- 0:02:13
23000 -- (-295.857) (-292.138) (-293.814) [-290.089] * (-291.780) (-292.771) (-294.582) [-293.675] -- 0:02:07
24000 -- (-292.020) (-294.659) [-292.501] (-294.894) * (-294.210) [-289.434] (-291.398) (-292.804) -- 0:02:02
25000 -- (-293.389) [-289.231] (-290.106) (-293.091) * (-291.834) [-289.891] (-293.203) (-295.724) -- 0:01:57
Average standard deviation of split frequencies: 0.051920
26000 -- (-292.408) [-290.111] (-292.315) (-296.571) * (-295.294) (-304.628) (-296.415) [-290.378] -- 0:02:29
27000 -- (-292.369) (-292.118) [-292.523] (-292.622) * (-292.865) (-299.555) [-290.520] (-291.090) -- 0:02:24
28000 -- (-289.787) (-293.159) [-289.762] (-295.094) * (-291.698) (-295.053) (-290.616) [-289.364] -- 0:02:18
29000 -- (-291.277) (-289.724) [-292.120] (-293.092) * (-293.674) (-293.260) (-296.778) [-291.182] -- 0:02:13
30000 -- (-292.681) [-290.147] (-296.074) (-293.608) * (-296.981) [-290.632] (-291.265) (-290.265) -- 0:02:09
Average standard deviation of split frequencies: 0.039198
31000 -- (-290.303) [-289.808] (-290.345) (-295.277) * (-292.395) [-290.584] (-293.981) (-292.061) -- 0:02:05
32000 -- (-289.309) [-289.355] (-290.407) (-292.113) * (-292.729) (-291.655) [-293.591] (-291.043) -- 0:02:01
33000 -- (-295.597) (-290.557) (-294.804) [-293.571] * (-291.862) [-293.122] (-291.122) (-290.091) -- 0:02:26
34000 -- (-291.434) (-290.479) [-292.112] (-293.783) * (-298.897) [-292.502] (-293.358) (-292.383) -- 0:02:22
35000 -- (-297.884) [-291.432] (-291.496) (-292.888) * (-298.370) [-292.405] (-297.370) (-293.625) -- 0:02:17
Average standard deviation of split frequencies: 0.039284
36000 -- (-290.729) (-295.959) [-291.007] (-293.517) * (-296.324) (-291.056) [-291.705] (-292.558) -- 0:02:13
37000 -- (-289.658) [-290.780] (-290.881) (-290.492) * [-291.388] (-294.150) (-292.499) (-290.549) -- 0:02:10
38000 -- (-292.331) (-296.396) (-293.814) [-290.105] * (-291.638) [-290.025] (-292.082) (-289.523) -- 0:02:06
39000 -- (-291.300) (-293.240) (-296.549) [-292.910] * (-292.801) [-290.975] (-295.116) (-292.131) -- 0:02:03
40000 -- (-289.318) (-295.054) [-289.255] (-293.762) * [-289.903] (-295.228) (-294.864) (-290.886) -- 0:02:00
Average standard deviation of split frequencies: 0.039657
41000 -- (-291.555) [-290.645] (-291.548) (-293.415) * [-290.902] (-291.665) (-291.965) (-290.147) -- 0:02:20
42000 -- (-290.829) [-289.769] (-297.602) (-296.395) * (-293.819) (-291.214) [-292.599] (-290.747) -- 0:02:16
43000 -- (-291.410) [-291.314] (-292.298) (-294.026) * (-290.723) [-289.608] (-293.549) (-293.088) -- 0:02:13
44000 -- (-290.353) [-290.258] (-293.259) (-290.034) * (-293.337) [-290.831] (-290.455) (-291.563) -- 0:02:10
45000 -- (-289.991) (-291.130) (-291.511) [-290.517] * (-293.997) [-289.913] (-292.557) (-290.553) -- 0:02:07
Average standard deviation of split frequencies: 0.036536
46000 -- (-293.056) [-289.868] (-292.842) (-295.206) * (-290.661) [-289.774] (-291.610) (-293.953) -- 0:02:04
47000 -- (-291.943) [-289.507] (-290.785) (-295.526) * (-291.278) [-291.981] (-290.652) (-292.059) -- 0:02:01
48000 -- (-290.184) (-298.847) (-291.163) [-290.232] * (-292.241) [-290.270] (-291.611) (-290.740) -- 0:02:18
49000 -- (-292.086) (-292.606) (-290.257) [-294.957] * (-291.479) [-290.547] (-292.779) (-290.094) -- 0:02:15
50000 -- (-290.198) [-296.516] (-290.820) (-292.062) * (-291.828) [-290.090] (-291.552) (-290.976) -- 0:02:13
Average standard deviation of split frequencies: 0.037216
51000 -- (-291.660) [-291.674] (-297.964) (-293.778) * (-292.096) [-290.890] (-292.398) (-289.904) -- 0:02:10
52000 -- (-290.318) (-291.443) (-293.194) [-291.404] * (-297.127) [-293.259] (-294.169) (-295.891) -- 0:02:07
53000 -- (-289.710) [-290.243] (-291.130) (-290.338) * (-290.215) [-292.125] (-291.003) (-298.750) -- 0:02:05
54000 -- (-291.393) (-293.714) (-293.254) [-289.839] * (-290.478) [-290.654] (-291.124) (-296.751) -- 0:02:02
55000 -- (-291.980) [-293.998] (-294.334) (-289.596) * (-289.933) [-289.384] (-292.438) (-294.153) -- 0:02:00
Average standard deviation of split frequencies: 0.038348
56000 -- (-296.473) [-290.372] (-292.460) (-298.048) * (-290.948) [-292.084] (-290.562) (-290.834) -- 0:02:14
57000 -- (-290.668) [-292.664] (-296.793) (-295.420) * (-292.462) [-292.385] (-292.762) (-292.383) -- 0:02:12
58000 -- (-290.089) [-289.588] (-291.941) (-290.183) * (-289.356) [-290.341] (-290.408) (-291.933) -- 0:02:09
59000 -- (-290.956) [-290.030] (-292.084) (-292.246) * (-289.777) [-289.885] (-291.842) (-293.211) -- 0:02:07
60000 -- (-290.045) [-290.238] (-292.334) (-289.894) * (-298.443) [-289.637] (-291.377) (-293.200) -- 0:02:05
Average standard deviation of split frequencies: 0.037024
61000 -- (-290.866) [-294.540] (-294.015) (-293.596) * (-293.097) [-290.105] (-291.376) (-292.176) -- 0:02:03
62000 -- (-293.687) [-290.180] (-289.786) (-291.952) * (-293.370) [-291.486] (-290.483) (-292.319) -- 0:02:01
63000 -- (-291.016) [-289.856] (-292.844) (-299.679) * (-291.417) [-290.089] (-291.645) (-294.748) -- 0:01:58
64000 -- (-289.652) [-292.876] (-291.140) (-291.785) * (-293.896) [-291.515] (-290.635) (-295.196) -- 0:02:11
65000 -- (-289.459) [-290.638] (-291.122) (-294.996) * (-292.045) [-291.935] (-292.233) (-291.204) -- 0:02:09
Average standard deviation of split frequencies: 0.033213
66000 -- (-292.450) [-289.590] (-291.935) (-289.956) * (-291.413) [-290.645] (-292.413) (-291.498) -- 0:02:07
67000 -- (-296.187) [-290.481] (-291.255) (-291.256) * (-289.086) [-292.391] (-293.285) (-289.476) -- 0:02:05
68000 -- (-290.638) [-292.329] (-291.103) (-293.618) * (-292.610) [-290.443] (-290.298) (-290.559) -- 0:02:03
69000 -- (-293.053) [-290.914] (-289.493) (-294.451) * (-290.705) [-290.206] (-292.112) (-289.589) -- 0:02:01
70000 -- (-290.833) [-289.960] (-291.263) (-295.106) * (-291.322) [-289.625] (-290.279) (-292.472) -- 0:01:59
Average standard deviation of split frequencies: 0.034688
71000 -- (-294.425) [-290.856] (-290.350) (-291.704) * (-292.994) [-291.000] (-290.739) (-292.150) -- 0:01:57
72000 -- (-293.314) [-289.944] (-297.109) (-290.190) * (-292.161) [-293.758] (-290.921) (-291.705) -- 0:02:08
73000 -- (-291.310) [-290.382] (-292.542) (-293.856) * (-293.912) [-293.128] (-289.886) (-292.133) -- 0:02:06
74000 -- (-292.798) [-292.493] (-290.815) (-294.181) * (-289.243) [-290.920] (-290.969) (-291.427) -- 0:02:05
75000 -- (-289.793) [-292.800] (-292.765) (-290.073) * (-290.224) [-289.118] (-290.217) (-289.498) -- 0:02:03
Average standard deviation of split frequencies: 0.030034
76000 -- (-290.658) [-290.973] (-291.351) (-291.365) * (-289.978) [-292.089] (-288.964) (-292.157) -- 0:02:01
77000 -- (-291.448) [-290.384] (-290.213) (-292.169) * (-291.741) [-290.652] (-296.292) (-291.396) -- 0:01:59
78000 -- (-289.206) [-293.184] (-290.770) (-292.192) * (-289.983) [-292.565] (-291.978) (-292.676) -- 0:01:58
79000 -- (-290.638) [-290.137] (-289.884) (-291.688) * (-291.030) [-290.228] (-291.059) (-291.994) -- 0:01:56
80000 -- (-292.516) [-289.885] (-294.143) (-293.170) * (-289.434) [-291.185] (-293.392) (-293.652) -- 0:02:06
Average standard deviation of split frequencies: 0.030193
81000 -- (-294.165) [-291.634] (-293.680) (-293.750) * (-290.986) [-289.626] (-290.117) (-292.357) -- 0:02:04
82000 -- (-292.583) [-292.750] (-291.955) (-293.325) * [-291.979] (-292.574) (-290.413) (-289.745) -- 0:02:03
83000 -- (-292.006) [-291.664] (-290.749) (-289.321) * (-290.154) (-291.275) (-292.199) [-289.765] -- 0:02:01
84000 -- (-289.959) [-289.553] (-292.898) (-292.154) * [-292.077] (-292.719) (-290.005) (-291.918) -- 0:01:59
85000 -- (-291.641) [-290.536] (-289.981) (-292.847) * [-294.218] (-290.923) (-289.756) (-291.665) -- 0:01:58
Average standard deviation of split frequencies: 0.028229
86000 -- (-293.243) [-291.974] (-295.179) (-292.452) * (-290.597) [-289.572] (-289.703) (-290.473) -- 0:01:56
87000 -- (-294.295) [-289.366] (-291.366) (-295.684) * (-292.783) (-290.050) [-289.420] (-290.337) -- 0:01:55
88000 -- (-292.188) [-289.999] (-290.277) (-294.739) * (-290.660) (-291.854) [-291.513] (-289.649) -- 0:02:04
89000 -- (-293.511) [-290.769] (-291.333) (-292.692) * [-289.024] (-292.791) (-290.009) (-290.252) -- 0:02:02
90000 -- (-289.260) [-291.926] (-293.929) (-290.188) * (-291.770) (-297.250) (-292.219) [-292.417] -- 0:02:01
Average standard deviation of split frequencies: 0.029280
91000 -- (-290.710) [-291.530] (-295.218) (-290.460) * (-290.888) [-293.552] (-294.329) (-290.840) -- 0:01:59
92000 -- (-291.066) [-290.306] (-290.647) (-289.612) * [-293.092] (-300.355) (-292.434) (-292.124) -- 0:01:58
93000 -- (-290.562) [-289.616] (-289.797) (-291.101) * (-290.004) (-292.464) (-292.605) [-293.763] -- 0:01:57
94000 -- (-289.414) [-291.029] (-293.228) (-290.302) * (-290.849) (-290.728) [-294.458] (-292.728) -- 0:01:55
95000 -- (-295.295) [-291.265] (-289.339) (-290.447) * (-294.699) (-291.434) (-291.032) [-288.941] -- 0:01:54
Average standard deviation of split frequencies: 0.026361
96000 -- (-291.968) [-291.465] (-290.494) (-291.086) * [-292.517] (-293.004) (-290.202) (-292.480) -- 0:02:02
97000 -- (-290.498) [-290.791] (-293.148) (-293.778) * (-290.541) [-294.279] (-290.626) (-293.191) -- 0:02:01
98000 -- (-291.312) [-292.250] (-291.597) (-290.914) * [-292.965] (-298.384) (-291.759) (-290.837) -- 0:01:59
99000 -- (-297.069) [-292.328] (-291.305) (-290.069) * (-289.559) (-291.686) [-290.226] (-292.778) -- 0:01:58
100000 -- (-290.747) [-290.534] (-292.238) (-289.884) * [-292.883] (-291.415) (-290.855) (-292.244) -- 0:01:56
Average standard deviation of split frequencies: 0.026634
101000 -- (-291.749) [-289.924] (-289.966) (-290.987) * (-296.507) [-292.009] (-292.322) (-289.464) -- 0:01:55
102000 -- (-292.798) [-290.343] (-290.444) (-294.991) * (-291.779) (-291.491) [-291.662] (-290.561) -- 0:01:54
103000 -- (-289.588) [-290.270] (-295.415) (-290.219) * (-293.308) (-290.020) (-291.692) [-290.538] -- 0:01:53
104000 -- (-299.892) [-292.407] (-290.269) (-292.698) * (-291.536) [-289.503] (-290.782) (-292.146) -- 0:02:00
105000 -- (-292.642) [-291.679] (-290.192) (-290.753) * (-292.293) (-294.529) [-289.409] (-290.863) -- 0:01:59
Average standard deviation of split frequencies: 0.025201
106000 -- (-290.354) [-292.111] (-291.834) (-292.699) * (-293.023) [-291.759] (-289.214) (-290.929) -- 0:01:58
107000 -- (-297.135) [-290.199] (-291.864) (-295.598) * (-291.603) [-292.748] (-290.998) (-292.022) -- 0:01:56
108000 -- (-292.625) [-290.451] (-289.997) (-292.328) * (-291.506) [-293.444] (-292.354) (-289.220) -- 0:01:55
109000 -- (-290.860) (-293.147) (-290.169) [-292.229] * (-291.433) (-292.190) [-292.159] (-295.369) -- 0:01:54
110000 -- (-291.719) (-291.724) [-292.038] (-293.600) * (-292.126) (-291.300) [-291.080] (-291.791) -- 0:01:53
Average standard deviation of split frequencies: 0.025782
111000 -- (-291.077) (-290.997) (-289.396) [-294.556] * (-293.339) (-289.376) (-289.468) [-299.399] -- 0:01:52
112000 -- [-290.757] (-295.950) (-293.384) (-291.270) * (-290.287) [-290.082] (-290.453) (-296.092) -- 0:01:58
113000 -- (-293.095) [-291.185] (-293.013) (-292.705) * (-290.816) (-289.116) [-291.346] (-290.828) -- 0:01:57
114000 -- (-290.463) (-290.291) (-291.452) [-293.766] * (-290.964) (-290.198) [-292.450] (-296.783) -- 0:01:56
115000 -- [-290.027] (-289.757) (-291.381) (-295.687) * (-293.501) [-290.092] (-290.646) (-292.796) -- 0:01:55
Average standard deviation of split frequencies: 0.030253
116000 -- (-293.844) [-292.639] (-289.921) (-291.698) * [-289.808] (-294.056) (-291.950) (-289.911) -- 0:01:54
117000 -- (-292.759) (-289.940) (-290.858) [-290.607] * (-294.998) (-293.766) (-292.882) [-290.692] -- 0:01:53
118000 -- [-294.497] (-292.327) (-291.572) (-290.552) * (-294.744) (-291.214) (-291.037) [-290.285] -- 0:01:52
119000 -- (-292.272) (-294.721) (-290.091) [-289.135] * (-294.205) [-290.636] (-293.940) (-292.736) -- 0:01:51
120000 -- (-290.371) (-291.087) (-291.517) [-290.084] * (-294.764) (-289.633) (-292.524) [-290.973] -- 0:01:50
Average standard deviation of split frequencies: 0.030602
121000 -- (-289.505) (-290.768) (-290.530) [-290.444] * (-289.187) (-291.241) (-295.698) [-291.301] -- 0:01:56
122000 -- (-292.455) (-290.656) (-291.562) [-290.433] * [-291.927] (-289.164) (-297.627) (-291.055) -- 0:01:55
123000 -- [-290.671] (-291.887) (-291.493) (-290.424) * (-292.614) [-293.940] (-291.296) (-293.008) -- 0:01:54
124000 -- (-291.862) [-291.346] (-292.608) (-290.266) * (-292.137) [-289.908] (-290.827) (-294.329) -- 0:01:53
125000 -- [-290.497] (-291.393) (-296.200) (-290.112) * (-293.737) (-289.568) (-289.818) [-291.114] -- 0:01:52
Average standard deviation of split frequencies: 0.030151
126000 -- (-290.241) (-292.401) (-292.227) [-289.567] * (-292.185) (-294.819) [-291.204] (-290.453) -- 0:01:50
127000 -- (-291.725) (-293.862) (-289.571) [-295.881] * (-290.452) (-290.861) [-295.924] (-294.832) -- 0:01:49
128000 -- (-292.171) [-289.460] (-290.955) (-293.329) * (-290.378) (-292.402) [-290.829] (-289.968) -- 0:01:49
129000 -- (-292.987) (-290.045) (-289.476) [-291.425] * (-289.576) (-293.570) [-290.152] (-291.231) -- 0:01:54
130000 -- [-291.236] (-291.605) (-293.328) (-290.398) * (-289.295) [-290.109] (-293.251) (-293.398) -- 0:01:53
Average standard deviation of split frequencies: 0.027342
131000 -- (-290.511) (-294.470) [-290.852] (-292.724) * [-290.103] (-289.411) (-293.830) (-292.673) -- 0:01:52
132000 -- [-291.835] (-291.464) (-292.333) (-292.162) * [-292.225] (-290.722) (-294.111) (-289.645) -- 0:01:51
133000 -- (-293.309) (-294.571) [-289.962] (-290.459) * (-294.131) [-290.717] (-291.315) (-291.323) -- 0:01:50
134000 -- (-290.609) (-293.145) [-289.528] (-292.245) * (-289.754) (-292.207) (-293.352) [-290.707] -- 0:01:49
135000 -- (-292.764) [-291.147] (-291.456) (-291.167) * (-291.859) [-289.702] (-291.687) (-291.737) -- 0:01:48
Average standard deviation of split frequencies: 0.025283
136000 -- [-291.848] (-290.929) (-289.696) (-291.635) * (-290.089) [-291.059] (-290.507) (-290.918) -- 0:01:48
137000 -- (-292.473) [-290.098] (-290.897) (-292.227) * [-293.326] (-290.275) (-293.604) (-290.605) -- 0:01:47
138000 -- [-289.717] (-292.978) (-290.622) (-289.574) * [-291.683] (-292.014) (-294.063) (-293.337) -- 0:01:52
139000 -- (-292.775) (-292.666) (-290.922) [-292.278] * [-291.238] (-290.091) (-289.288) (-291.111) -- 0:01:51
140000 -- (-289.650) [-293.743] (-292.283) (-290.750) * (-295.311) (-292.134) [-289.154] (-291.715) -- 0:01:50
Average standard deviation of split frequencies: 0.023877
141000 -- [-291.022] (-292.579) (-292.623) (-290.442) * (-292.305) [-293.520] (-289.683) (-295.931) -- 0:01:49
142000 -- [-289.924] (-292.393) (-294.484) (-290.985) * [-291.338] (-292.257) (-292.198) (-291.901) -- 0:01:48
143000 -- [-291.781] (-296.745) (-296.211) (-293.648) * [-289.199] (-289.907) (-293.251) (-290.924) -- 0:01:47
144000 -- (-292.148) (-291.097) (-290.589) [-293.333] * (-292.236) (-291.632) (-289.890) [-289.388] -- 0:01:47
145000 -- [-291.033] (-292.690) (-292.659) (-291.475) * (-292.424) [-291.591] (-291.860) (-289.000) -- 0:01:46
Average standard deviation of split frequencies: 0.022262
146000 -- (-290.242) (-290.302) [-293.300] (-289.642) * (-293.644) [-290.184] (-289.907) (-291.277) -- 0:01:51
147000 -- (-290.150) (-292.932) (-299.663) [-292.224] * (-292.169) [-289.959] (-290.253) (-289.830) -- 0:01:50
148000 -- (-291.856) [-291.841] (-290.896) (-291.340) * (-292.928) (-295.918) [-289.609] (-290.135) -- 0:01:49
149000 -- (-291.121) (-292.631) [-291.829] (-293.667) * [-290.276] (-293.182) (-290.154) (-293.225) -- 0:01:48
150000 -- (-297.847) (-291.728) (-289.908) [-291.659] * (-292.431) [-293.204] (-293.946) (-292.917) -- 0:01:47
Average standard deviation of split frequencies: 0.025617
151000 -- (-293.471) (-289.727) [-289.791] (-293.859) * (-290.723) (-290.143) [-289.374] (-292.546) -- 0:01:46
152000 -- [-290.691] (-292.754) (-290.159) (-295.072) * [-293.569] (-291.156) (-294.987) (-291.100) -- 0:01:46
153000 -- (-292.483) (-290.143) [-293.203] (-292.245) * (-293.507) (-289.525) (-290.438) [-290.268] -- 0:01:45
154000 -- [-291.709] (-292.030) (-293.985) (-291.448) * (-290.558) [-291.457] (-291.032) (-295.379) -- 0:01:44
155000 -- (-290.565) (-292.166) [-292.072] (-290.797) * [-291.471] (-292.832) (-290.053) (-294.837) -- 0:01:49
Average standard deviation of split frequencies: 0.024606
156000 -- [-289.774] (-291.425) (-291.089) (-290.466) * (-291.193) [-291.219] (-290.695) (-295.740) -- 0:01:48
157000 -- (-290.911) [-292.183] (-290.268) (-291.093) * (-291.960) (-290.341) (-290.250) [-295.019] -- 0:01:47
158000 -- (-290.987) [-291.370] (-290.263) (-291.206) * [-294.156] (-289.651) (-292.474) (-290.252) -- 0:01:46
159000 -- [-291.253] (-290.501) (-291.076) (-293.040) * (-293.279) [-290.078] (-290.808) (-291.405) -- 0:01:45
160000 -- (-291.160) [-291.364] (-298.070) (-291.736) * (-293.745) [-289.160] (-290.485) (-289.823) -- 0:01:45
Average standard deviation of split frequencies: 0.025278
161000 -- (-291.246) [-290.249] (-292.036) (-294.764) * (-291.964) (-290.689) (-290.138) [-290.331] -- 0:01:44
162000 -- (-293.131) (-293.106) (-290.979) [-291.956] * (-291.953) [-290.611] (-291.716) (-296.432) -- 0:01:43
163000 -- (-291.273) [-289.773] (-290.628) (-289.468) * (-289.925) (-290.067) [-291.078] (-291.323) -- 0:01:47
164000 -- [-290.840] (-296.183) (-290.007) (-290.933) * [-289.472] (-290.287) (-296.181) (-294.359) -- 0:01:47
165000 -- (-294.247) (-292.732) [-289.213] (-291.325) * (-293.787) [-293.670] (-291.574) (-290.307) -- 0:01:46
Average standard deviation of split frequencies: 0.023251
166000 -- (-292.000) (-294.702) [-292.041] (-291.678) * (-293.203) (-293.038) (-291.080) [-290.582] -- 0:01:45
167000 -- [-291.917] (-299.205) (-290.011) (-290.435) * (-292.014) (-289.995) (-293.023) [-289.922] -- 0:01:44
168000 -- (-291.756) [-292.089] (-290.073) (-293.677) * [-291.759] (-291.313) (-291.474) (-291.483) -- 0:01:44
169000 -- (-289.064) [-293.491] (-289.514) (-291.305) * (-293.024) (-289.308) (-291.077) [-290.393] -- 0:01:43
170000 -- [-291.542] (-290.633) (-291.710) (-289.710) * (-289.581) [-292.560] (-291.409) (-293.228) -- 0:01:42
Average standard deviation of split frequencies: 0.022442
171000 -- (-291.556) (-292.694) [-292.986] (-292.070) * (-293.214) (-291.040) [-291.404] (-292.805) -- 0:01:46
172000 -- [-293.311] (-289.209) (-292.063) (-294.788) * (-292.746) (-291.918) (-294.390) [-290.600] -- 0:01:45
173000 -- (-290.176) [-292.410] (-292.485) (-291.111) * (-293.840) (-291.666) (-289.712) [-296.288] -- 0:01:45
174000 -- (-289.555) [-291.025] (-289.814) (-291.636) * [-290.755] (-291.669) (-292.323) (-290.738) -- 0:01:44
175000 -- (-291.703) [-289.948] (-292.357) (-296.422) * (-290.932) [-291.725] (-291.972) (-293.017) -- 0:01:43
Average standard deviation of split frequencies: 0.020955
176000 -- (-292.936) (-290.841) [-290.525] (-290.992) * (-292.386) [-290.919] (-296.167) (-290.241) -- 0:01:43
177000 -- [-291.683] (-289.902) (-289.876) (-290.652) * (-291.901) (-289.822) [-290.312] (-290.788) -- 0:01:42
178000 -- [-291.908] (-290.158) (-290.640) (-289.547) * (-289.816) (-292.575) [-291.346] (-290.486) -- 0:01:41
179000 -- [-291.468] (-289.477) (-294.489) (-289.729) * (-289.352) (-292.005) [-292.410] (-294.902) -- 0:01:40
180000 -- (-290.020) [-292.883] (-302.957) (-290.126) * (-292.802) (-290.617) (-288.985) [-291.079] -- 0:01:44
Average standard deviation of split frequencies: 0.021075
181000 -- (-290.825) (-293.522) [-292.193] (-289.644) * [-294.802] (-291.263) (-290.230) (-290.695) -- 0:01:44
182000 -- (-294.195) (-289.416) (-289.861) [-294.019] * (-293.435) (-289.236) (-291.396) [-289.312] -- 0:01:43
183000 -- [-289.683] (-293.136) (-290.849) (-291.086) * (-291.427) (-291.403) (-290.192) [-297.706] -- 0:01:42
184000 -- (-290.478) [-291.264] (-289.466) (-290.369) * (-291.454) [-290.627] (-290.500) (-292.735) -- 0:01:42
185000 -- (-292.265) (-290.747) (-291.781) [-291.072] * (-291.471) (-290.422) [-296.531] (-289.427) -- 0:01:41
Average standard deviation of split frequencies: 0.018827
186000 -- (-290.574) [-290.635] (-290.712) (-291.800) * (-290.245) [-291.642] (-291.537) (-292.476) -- 0:01:40
187000 -- (-291.220) [-292.484] (-290.686) (-289.592) * (-295.920) (-292.708) (-291.800) [-290.957] -- 0:01:39
188000 -- [-290.181] (-290.534) (-290.350) (-293.331) * [-293.542] (-291.252) (-290.891) (-290.222) -- 0:01:43
189000 -- (-289.608) [-289.180] (-292.353) (-290.417) * [-289.978] (-294.978) (-295.178) (-294.931) -- 0:01:42
190000 -- (-290.387) (-293.272) (-292.037) [-291.808] * (-292.208) [-291.348] (-291.772) (-291.118) -- 0:01:42
Average standard deviation of split frequencies: 0.016424
191000 -- (-292.993) (-291.447) [-290.704] (-294.468) * [-291.146] (-289.997) (-291.006) (-290.113) -- 0:01:41
192000 -- (-290.268) [-291.606] (-289.257) (-290.141) * (-291.744) [-293.098] (-294.568) (-290.490) -- 0:01:41
193000 -- [-290.594] (-296.961) (-291.770) (-291.183) * (-292.594) (-294.360) (-293.243) [-291.543] -- 0:01:40
194000 -- [-289.415] (-291.899) (-295.649) (-291.146) * [-290.938] (-294.041) (-294.549) (-292.248) -- 0:01:39
195000 -- (-296.953) [-291.065] (-292.207) (-291.130) * (-291.271) (-289.879) [-292.731] (-289.937) -- 0:01:39
Average standard deviation of split frequencies: 0.015805
196000 -- (-291.422) [-291.714] (-295.600) (-290.288) * [-289.686] (-291.916) (-296.692) (-293.822) -- 0:01:42
197000 -- (-289.844) (-290.836) (-293.340) [-293.044] * (-288.963) [-289.388] (-292.501) (-293.398) -- 0:01:41
198000 -- [-290.966] (-290.794) (-289.930) (-291.004) * (-289.987) (-290.525) (-292.401) [-290.102] -- 0:01:41
199000 -- (-289.609) (-295.606) (-290.327) [-290.059] * (-295.812) [-290.157] (-289.194) (-292.177) -- 0:01:40
200000 -- (-290.938) [-291.024] (-290.860) (-296.376) * (-292.481) (-290.047) [-289.525] (-291.933) -- 0:01:40
Average standard deviation of split frequencies: 0.016806
201000 -- [-293.538] (-291.452) (-293.127) (-289.794) * (-291.089) (-292.592) (-294.328) [-291.712] -- 0:01:39
202000 -- (-291.086) (-294.401) (-290.646) [-289.872] * (-291.018) [-291.737] (-290.290) (-289.656) -- 0:01:38
203000 -- (-293.339) (-291.076) [-290.152] (-292.279) * (-290.915) [-289.221] (-290.192) (-290.045) -- 0:01:38
204000 -- (-291.473) (-293.056) (-289.274) [-289.111] * (-291.040) [-290.453] (-291.885) (-293.527) -- 0:01:37
205000 -- (-290.804) [-289.203] (-297.982) (-290.280) * (-291.975) [-296.512] (-289.741) (-294.371) -- 0:01:40
Average standard deviation of split frequencies: 0.014711
206000 -- (-290.210) [-290.318] (-292.958) (-295.511) * (-291.498) (-290.145) [-291.755] (-290.708) -- 0:01:40
207000 -- [-291.503] (-289.541) (-289.584) (-292.770) * (-290.082) (-292.462) [-295.412] (-292.120) -- 0:01:39
208000 -- [-290.182] (-290.568) (-290.933) (-291.132) * (-290.864) [-290.586] (-293.644) (-293.855) -- 0:01:39
209000 -- [-295.169] (-289.779) (-294.172) (-293.994) * (-291.282) (-291.645) (-292.434) [-289.527] -- 0:01:38
210000 -- (-288.989) (-292.905) [-291.212] (-290.137) * (-295.930) (-291.238) (-292.523) [-291.271] -- 0:01:37
Average standard deviation of split frequencies: 0.015836
211000 -- [-289.615] (-291.969) (-291.421) (-290.646) * (-292.186) (-291.396) [-290.528] (-290.994) -- 0:01:37
212000 -- [-292.369] (-292.771) (-290.212) (-290.988) * (-290.706) (-290.440) (-291.820) [-290.085] -- 0:01:36
213000 -- (-289.352) [-292.789] (-291.644) (-293.324) * (-292.908) [-289.668] (-292.046) (-291.995) -- 0:01:39
214000 -- (-289.237) [-292.709] (-295.801) (-291.850) * (-292.418) (-293.222) (-291.764) [-289.418] -- 0:01:39
215000 -- [-289.463] (-292.767) (-291.832) (-289.991) * (-293.628) [-291.080] (-293.789) (-292.999) -- 0:01:38
Average standard deviation of split frequencies: 0.016186
216000 -- (-295.754) [-290.935] (-290.752) (-289.289) * (-291.438) [-291.222] (-290.751) (-291.164) -- 0:01:38
217000 -- [-291.281] (-292.273) (-292.492) (-290.674) * (-291.094) (-292.706) [-289.889] (-291.660) -- 0:01:37
218000 -- (-290.963) (-295.053) (-290.048) [-290.205] * (-290.894) (-290.460) (-289.882) [-290.147] -- 0:01:36
219000 -- [-290.453] (-291.089) (-291.720) (-291.425) * (-290.479) (-292.778) (-294.560) [-289.504] -- 0:01:36
220000 -- (-290.784) (-289.752) (-289.611) [-292.062] * [-290.527] (-290.880) (-289.441) (-290.207) -- 0:01:35
Average standard deviation of split frequencies: 0.016508
221000 -- (-290.204) (-290.496) [-291.094] (-291.720) * (-290.640) (-290.995) (-291.608) [-290.622] -- 0:01:35
222000 -- (-291.380) [-289.650] (-290.576) (-289.685) * (-293.859) [-290.338] (-292.602) (-292.635) -- 0:01:38
223000 -- (-290.510) (-289.480) [-289.279] (-290.609) * (-294.286) (-292.375) [-292.384] (-289.792) -- 0:01:37
224000 -- (-290.412) (-290.444) (-291.566) [-291.588] * (-290.201) [-289.305] (-293.721) (-289.702) -- 0:01:37
225000 -- (-291.273) [-290.277] (-290.067) (-291.145) * [-292.292] (-291.131) (-292.068) (-293.033) -- 0:01:36
Average standard deviation of split frequencies: 0.013260
226000 -- (-289.807) (-293.490) (-290.048) [-291.466] * (-290.929) [-291.462] (-292.976) (-289.845) -- 0:01:35
227000 -- (-292.819) (-297.094) [-290.167] (-291.230) * (-296.740) [-289.937] (-291.438) (-290.059) -- 0:01:35
228000 -- (-291.262) (-289.306) [-289.363] (-291.182) * (-290.306) (-289.282) (-292.405) [-291.637] -- 0:01:34
229000 -- (-291.832) (-289.739) [-290.172] (-293.516) * (-291.144) [-293.185] (-290.711) (-294.014) -- 0:01:34
230000 -- (-292.356) (-289.935) (-292.271) [-291.166] * [-292.412] (-296.120) (-289.454) (-291.201) -- 0:01:37
Average standard deviation of split frequencies: 0.015327
231000 -- [-291.973] (-291.098) (-291.356) (-291.274) * (-296.161) (-291.692) [-290.234] (-290.950) -- 0:01:36
232000 -- (-290.209) [-291.399] (-289.229) (-296.526) * [-290.771] (-289.649) (-296.040) (-292.146) -- 0:01:36
233000 -- (-289.862) (-291.902) [-289.849] (-290.025) * [-291.678] (-293.309) (-289.751) (-289.490) -- 0:01:35
234000 -- [-292.254] (-296.261) (-293.399) (-290.266) * (-289.667) (-291.750) (-291.649) [-291.532] -- 0:01:34
235000 -- (-291.224) (-291.964) (-292.462) [-290.038] * (-293.198) (-291.488) (-294.044) [-291.239] -- 0:01:34
Average standard deviation of split frequencies: 0.015813
236000 -- (-290.599) (-295.256) [-290.326] (-289.465) * [-292.457] (-290.905) (-291.135) (-290.915) -- 0:01:33
237000 -- (-291.645) (-289.711) [-294.052] (-289.682) * (-290.650) (-293.251) (-291.944) [-291.155] -- 0:01:33
238000 -- (-291.569) [-291.237] (-291.042) (-291.263) * [-293.930] (-295.336) (-293.367) (-290.460) -- 0:01:36
239000 -- (-289.684) [-291.761] (-291.407) (-292.577) * (-290.165) [-290.407] (-289.492) (-289.862) -- 0:01:35
240000 -- (-292.810) (-290.321) [-293.233] (-293.145) * (-289.883) (-291.700) [-292.532] (-290.107) -- 0:01:35
Average standard deviation of split frequencies: 0.016160
241000 -- (-289.143) (-289.620) [-288.994] (-291.102) * (-291.306) (-289.532) (-290.598) [-290.760] -- 0:01:34
242000 -- (-291.358) (-289.344) [-293.719] (-289.787) * [-289.655] (-292.010) (-292.921) (-291.585) -- 0:01:33
243000 -- (-290.421) (-291.343) [-290.203] (-291.865) * (-293.013) (-291.801) (-291.547) [-292.695] -- 0:01:33
244000 -- (-292.739) (-294.819) [-291.600] (-289.113) * (-290.217) (-290.327) (-292.628) [-290.579] -- 0:01:32
245000 -- (-289.776) (-290.903) [-291.585] (-289.217) * (-290.254) [-290.332] (-289.459) (-289.600) -- 0:01:32
Average standard deviation of split frequencies: 0.016608
246000 -- (-291.309) (-292.136) [-289.912] (-290.140) * (-290.549) [-291.571] (-292.574) (-291.235) -- 0:01:31
247000 -- [-290.906] (-289.915) (-292.571) (-291.338) * (-295.715) (-293.190) (-291.421) [-294.304] -- 0:01:34
248000 -- (-293.549) (-296.493) [-294.087] (-291.790) * [-297.753] (-290.866) (-293.848) (-291.643) -- 0:01:34
249000 -- (-289.550) [-291.079] (-289.331) (-290.712) * (-289.999) [-290.384] (-292.152) (-291.069) -- 0:01:33
250000 -- (-289.740) (-292.023) (-291.801) [-291.193] * (-290.445) (-292.806) (-290.175) [-289.661] -- 0:01:33
Average standard deviation of split frequencies: 0.015672
251000 -- (-291.105) (-290.738) [-292.831] (-296.337) * [-290.971] (-292.940) (-290.226) (-293.789) -- 0:01:32
252000 -- (-292.172) (-292.719) [-290.735] (-291.755) * (-291.173) (-289.754) [-291.414] (-289.374) -- 0:01:32
253000 -- (-291.368) (-292.519) [-297.182] (-293.857) * (-290.526) (-290.160) (-294.019) [-296.454] -- 0:01:31
254000 -- [-291.507] (-291.629) (-292.341) (-292.599) * (-290.369) [-290.204] (-293.309) (-295.715) -- 0:01:31
255000 -- [-289.815] (-291.999) (-290.580) (-293.254) * (-291.553) (-290.584) (-292.026) [-296.950] -- 0:01:33
Average standard deviation of split frequencies: 0.015499
256000 -- (-289.849) (-291.526) (-291.782) [-291.367] * [-290.988] (-291.123) (-293.728) (-289.216) -- 0:01:33
257000 -- (-289.684) [-289.349] (-289.607) (-291.444) * (-293.398) [-290.366] (-291.065) (-291.727) -- 0:01:32
258000 -- (-290.646) (-292.245) (-290.619) [-291.811] * [-292.256] (-290.142) (-290.828) (-296.752) -- 0:01:32
259000 -- (-290.811) [-292.407] (-291.391) (-293.925) * (-294.132) (-290.879) [-290.844] (-292.126) -- 0:01:31
260000 -- (-295.191) [-289.110] (-291.548) (-290.726) * (-291.186) (-296.136) (-292.264) [-289.618] -- 0:01:31
Average standard deviation of split frequencies: 0.014885
261000 -- (-292.510) [-290.435] (-290.994) (-292.983) * (-292.691) [-289.731] (-297.801) (-289.750) -- 0:01:30
262000 -- (-290.663) (-292.480) [-291.099] (-290.516) * (-290.488) (-291.547) (-290.068) [-289.741] -- 0:01:30
263000 -- [-290.186] (-290.744) (-290.532) (-290.185) * (-293.819) (-289.553) [-290.052] (-291.573) -- 0:01:32
264000 -- [-290.436] (-291.382) (-295.206) (-289.589) * (-294.205) (-296.578) [-290.605] (-292.750) -- 0:01:32
265000 -- [-290.262] (-291.350) (-296.527) (-294.520) * (-292.289) (-296.473) (-293.814) [-290.291] -- 0:01:31
Average standard deviation of split frequencies: 0.013418
266000 -- [-289.699] (-291.050) (-290.482) (-289.829) * (-291.407) (-290.474) (-290.365) [-291.543] -- 0:01:31
267000 -- [-291.529] (-291.026) (-290.484) (-292.603) * (-290.053) (-290.310) (-289.699) [-288.941] -- 0:01:30
268000 -- (-289.059) (-292.633) (-293.068) [-293.870] * (-291.719) (-291.648) (-292.577) [-294.541] -- 0:01:30
269000 -- (-291.772) (-292.181) (-290.583) [-289.613] * (-294.340) [-289.914] (-291.359) (-293.057) -- 0:01:29
270000 -- (-292.361) (-294.070) (-289.289) [-290.484] * (-295.058) (-289.981) [-289.689] (-292.240) -- 0:01:29
Average standard deviation of split frequencies: 0.012917
271000 -- (-289.925) (-292.941) [-291.857] (-289.687) * (-293.474) [-293.528] (-289.810) (-293.327) -- 0:01:28
272000 -- [-294.234] (-292.079) (-292.765) (-291.132) * (-290.932) (-291.765) [-291.492] (-293.082) -- 0:01:31
273000 -- (-289.628) (-292.708) (-289.662) [-291.464] * (-295.055) (-293.031) [-289.709] (-291.704) -- 0:01:30
274000 -- (-293.120) (-292.197) (-289.437) [-290.915] * (-291.186) (-290.451) (-289.301) [-290.865] -- 0:01:30
275000 -- (-290.902) [-293.259] (-290.563) (-296.379) * (-289.479) [-291.327] (-289.954) (-291.868) -- 0:01:29
Average standard deviation of split frequencies: 0.012810
276000 -- (-293.563) [-289.757] (-293.324) (-297.350) * (-292.768) (-293.003) [-289.885] (-292.998) -- 0:01:29
277000 -- (-295.424) [-290.262] (-290.552) (-293.653) * (-292.347) (-291.336) [-290.772] (-290.594) -- 0:01:28
278000 -- (-291.266) [-291.488] (-292.854) (-289.901) * (-292.256) (-289.410) [-290.924] (-290.357) -- 0:01:28
279000 -- (-293.718) [-290.163] (-294.793) (-290.028) * (-290.798) [-291.632] (-289.965) (-289.795) -- 0:01:27
280000 -- (-290.252) [-290.664] (-290.382) (-290.364) * (-290.798) (-292.962) [-290.908] (-292.252) -- 0:01:30
Average standard deviation of split frequencies: 0.013017
281000 -- (-290.951) [-290.278] (-292.103) (-290.868) * (-290.547) (-291.917) [-290.166] (-296.146) -- 0:01:29
282000 -- (-294.338) [-292.639] (-292.573) (-292.906) * (-290.280) [-294.579] (-290.469) (-291.824) -- 0:01:29
283000 -- (-291.991) [-294.885] (-292.993) (-293.891) * (-290.107) (-290.433) [-290.728] (-291.529) -- 0:01:28
284000 -- (-289.855) [-290.521] (-290.513) (-295.544) * (-292.615) (-290.511) (-290.794) [-291.207] -- 0:01:28
285000 -- (-293.498) [-290.091] (-290.406) (-291.165) * (-295.274) (-294.257) (-290.765) [-296.222] -- 0:01:27
Average standard deviation of split frequencies: 0.013598
286000 -- (-290.915) [-292.028] (-291.350) (-290.472) * (-290.450) (-290.526) (-290.544) [-289.954] -- 0:01:27
287000 -- [-290.878] (-289.622) (-292.633) (-290.891) * (-290.736) (-289.981) (-293.948) [-290.463] -- 0:01:26
288000 -- [-293.743] (-291.090) (-292.373) (-291.969) * (-292.451) (-292.174) (-290.354) [-290.625] -- 0:01:29
289000 -- (-293.250) (-290.090) (-290.611) [-294.205] * (-290.415) (-293.959) (-292.849) [-293.359] -- 0:01:28
290000 -- (-296.211) [-290.967] (-290.264) (-290.635) * (-291.114) (-290.423) (-292.146) [-291.593] -- 0:01:28
Average standard deviation of split frequencies: 0.014222
291000 -- (-291.789) (-291.048) (-291.542) [-290.704] * [-289.967] (-289.845) (-293.768) (-292.780) -- 0:01:27
292000 -- [-296.043] (-291.235) (-290.286) (-290.877) * (-291.157) (-291.326) [-293.778] (-290.052) -- 0:01:27
293000 -- (-293.568) (-290.945) (-289.846) [-289.968] * (-295.554) [-292.131] (-290.815) (-290.453) -- 0:01:26
294000 -- [-290.590] (-292.576) (-289.513) (-289.883) * (-291.143) (-293.234) (-290.652) [-290.255] -- 0:01:26
295000 -- [-292.411] (-291.909) (-292.014) (-290.569) * [-291.841] (-289.838) (-289.809) (-292.374) -- 0:01:26
Average standard deviation of split frequencies: 0.013231
296000 -- [-289.872] (-290.380) (-289.738) (-291.371) * (-290.184) (-292.521) (-295.020) [-290.563] -- 0:01:28
297000 -- (-291.367) [-289.543] (-291.101) (-293.882) * (-291.350) (-296.349) [-290.845] (-292.246) -- 0:01:27
298000 -- (-289.830) (-293.524) (-291.874) [-290.585] * (-290.594) (-294.260) (-291.923) [-290.880] -- 0:01:27
299000 -- [-291.348] (-289.964) (-290.178) (-290.683) * (-292.271) (-294.225) (-290.731) [-289.617] -- 0:01:26
300000 -- (-293.305) [-294.154] (-291.426) (-291.775) * [-290.563] (-294.761) (-289.597) (-290.922) -- 0:01:26
Average standard deviation of split frequencies: 0.013066
301000 -- (-294.616) (-291.590) (-295.339) [-290.070] * (-289.995) (-290.649) [-292.488] (-291.555) -- 0:01:25
302000 -- [-289.733] (-290.120) (-291.335) (-291.409) * (-289.660) (-291.089) [-291.831] (-292.568) -- 0:01:25
303000 -- (-292.643) (-292.601) [-291.596] (-292.350) * (-290.031) (-289.804) [-291.097] (-292.171) -- 0:01:25
304000 -- (-291.081) (-290.407) [-293.313] (-290.709) * [-289.855] (-290.951) (-295.931) (-290.977) -- 0:01:24
305000 -- (-290.843) (-290.341) (-290.035) [-290.130] * [-293.590] (-289.149) (-290.946) (-290.898) -- 0:01:26
Average standard deviation of split frequencies: 0.012561
306000 -- (-290.487) (-292.799) [-289.612] (-290.937) * (-292.421) (-290.067) (-289.495) [-292.282] -- 0:01:26
307000 -- (-292.457) (-291.928) (-293.381) [-296.014] * (-289.888) (-290.426) [-289.975] (-294.500) -- 0:01:25
308000 -- (-289.684) (-290.958) [-292.112] (-289.959) * (-295.616) (-290.708) [-289.560] (-291.830) -- 0:01:25
309000 -- (-291.028) (-294.209) (-290.876) [-290.581] * (-291.413) (-296.103) (-292.206) [-291.347] -- 0:01:24
310000 -- (-291.675) [-289.316] (-296.681) (-290.943) * (-289.589) (-289.557) (-290.265) [-290.924] -- 0:01:24
Average standard deviation of split frequencies: 0.011906
311000 -- [-298.001] (-289.731) (-294.076) (-291.929) * (-292.172) (-290.946) (-294.023) [-293.428] -- 0:01:24
312000 -- (-291.877) [-289.700] (-292.095) (-289.215) * (-298.025) [-292.896] (-290.130) (-292.194) -- 0:01:23
313000 -- (-290.896) (-291.046) [-290.547] (-290.510) * [-289.782] (-293.421) (-290.930) (-291.021) -- 0:01:25
314000 -- (-299.613) [-290.628] (-290.165) (-294.268) * (-291.426) (-291.557) [-290.529] (-291.228) -- 0:01:25
315000 -- (-290.543) (-291.607) (-289.664) [-294.166] * (-293.702) (-289.681) [-292.611] (-292.023) -- 0:01:24
Average standard deviation of split frequencies: 0.012183
316000 -- (-295.473) (-292.744) [-289.594] (-292.200) * (-290.649) (-290.182) (-289.521) [-290.185] -- 0:01:24
317000 -- (-290.101) [-292.165] (-292.415) (-291.067) * [-292.284] (-295.138) (-291.424) (-291.099) -- 0:01:24
318000 -- (-291.204) (-296.369) [-290.800] (-293.066) * (-290.531) [-289.831] (-290.362) (-289.251) -- 0:01:23
319000 -- [-291.542] (-290.962) (-290.095) (-289.241) * (-293.174) (-291.091) [-291.402] (-293.197) -- 0:01:23
320000 -- (-290.130) [-290.074] (-292.661) (-290.431) * (-291.266) (-289.319) [-292.161] (-294.243) -- 0:01:22
Average standard deviation of split frequencies: 0.012087
321000 -- (-290.609) (-290.301) [-292.648] (-291.677) * (-290.405) (-290.910) [-289.682] (-294.078) -- 0:01:22
322000 -- (-291.014) (-290.002) (-291.554) [-291.366] * (-290.085) [-292.483] (-289.795) (-293.264) -- 0:01:24
323000 -- (-289.342) [-290.354] (-292.026) (-291.896) * (-290.849) [-292.212] (-292.072) (-289.567) -- 0:01:23
324000 -- (-290.661) (-289.837) [-292.368] (-290.913) * (-291.882) [-291.413] (-290.655) (-292.435) -- 0:01:23
325000 -- (-293.248) [-296.035] (-292.309) (-293.302) * (-290.769) [-294.040] (-293.989) (-292.959) -- 0:01:23
Average standard deviation of split frequencies: 0.012171
326000 -- [-289.933] (-292.994) (-291.001) (-291.929) * (-292.079) [-290.582] (-292.889) (-292.944) -- 0:01:22
327000 -- (-291.286) (-290.593) (-291.644) [-291.013] * [-290.679] (-291.183) (-292.572) (-289.862) -- 0:01:22
328000 -- [-291.542] (-293.447) (-290.583) (-289.644) * (-290.141) [-292.238] (-291.498) (-290.155) -- 0:01:21
329000 -- (-293.904) [-289.635] (-293.188) (-297.341) * (-295.709) (-290.567) [-290.138] (-292.093) -- 0:01:21
330000 -- (-293.772) (-291.261) (-291.809) [-290.087] * [-290.549] (-290.961) (-294.817) (-292.402) -- 0:01:23
Average standard deviation of split frequencies: 0.011120
331000 -- [-291.043] (-290.797) (-293.752) (-296.694) * (-291.219) [-291.917] (-290.733) (-290.676) -- 0:01:22
332000 -- (-290.846) (-291.383) [-290.498] (-292.624) * (-293.975) (-289.309) (-290.004) [-290.073] -- 0:01:22
333000 -- (-289.448) (-292.256) [-292.011] (-292.456) * (-291.333) (-291.216) (-290.814) [-294.078] -- 0:01:22
334000 -- (-296.749) (-295.207) [-289.887] (-289.245) * (-291.003) (-292.201) [-293.772] (-291.919) -- 0:01:21
335000 -- (-291.234) (-290.631) (-291.629) [-290.288] * (-296.403) (-291.989) [-292.780] (-289.954) -- 0:01:21
Average standard deviation of split frequencies: 0.010663
336000 -- (-291.006) [-291.009] (-290.557) (-291.189) * (-291.193) [-289.435] (-292.036) (-289.688) -- 0:01:21
337000 -- (-290.008) (-292.352) (-289.944) [-291.158] * (-290.006) (-289.569) [-290.717] (-290.160) -- 0:01:20
338000 -- (-289.792) (-294.785) (-294.981) [-289.732] * [-295.637] (-295.842) (-293.758) (-294.494) -- 0:01:22
339000 -- [-293.645] (-291.799) (-290.372) (-290.975) * [-290.409] (-292.624) (-294.223) (-290.841) -- 0:01:21
340000 -- (-290.362) (-291.212) [-290.249] (-290.780) * [-291.370] (-291.035) (-292.733) (-290.322) -- 0:01:21
Average standard deviation of split frequencies: 0.009340
341000 -- (-292.649) (-289.854) [-292.209] (-289.907) * [-291.737] (-290.825) (-291.617) (-291.625) -- 0:01:21
342000 -- (-292.065) [-291.471] (-290.094) (-289.961) * (-294.000) (-290.842) (-291.903) [-295.311] -- 0:01:20
343000 -- (-291.675) [-289.998] (-291.129) (-297.766) * (-290.085) (-290.348) (-294.538) [-293.184] -- 0:01:20
344000 -- [-292.666] (-291.483) (-290.298) (-290.066) * (-289.727) [-296.780] (-291.825) (-291.249) -- 0:01:20
345000 -- (-292.569) [-290.399] (-292.439) (-289.830) * (-290.541) (-291.482) [-294.290] (-290.445) -- 0:01:19
Average standard deviation of split frequencies: 0.010900
346000 -- (-291.179) (-292.594) (-292.866) [-292.757] * (-293.697) [-292.523] (-294.265) (-289.539) -- 0:01:21
347000 -- (-289.776) (-290.266) [-289.957] (-292.764) * [-290.930] (-291.292) (-291.464) (-291.529) -- 0:01:20
348000 -- (-292.361) (-292.512) [-292.527] (-293.640) * (-290.207) [-291.938] (-292.355) (-290.242) -- 0:01:20
349000 -- (-291.229) (-292.114) (-289.882) [-295.199] * (-290.355) (-289.694) [-292.961] (-291.005) -- 0:01:20
350000 -- [-290.923] (-293.257) (-292.854) (-291.191) * (-291.381) (-293.836) [-290.937] (-297.210) -- 0:01:19
Average standard deviation of split frequencies: 0.012343
351000 -- (-293.308) (-290.134) (-292.178) [-292.060] * (-291.414) [-291.453] (-290.345) (-290.361) -- 0:01:19
352000 -- [-292.783] (-290.689) (-292.431) (-291.669) * (-291.633) [-291.609] (-294.300) (-293.443) -- 0:01:19
353000 -- [-292.891] (-289.842) (-289.927) (-289.954) * (-293.329) (-292.519) (-293.146) [-290.535] -- 0:01:18
354000 -- (-292.745) (-289.377) (-290.141) [-289.371] * (-290.229) [-292.410] (-292.136) (-290.696) -- 0:01:18
355000 -- (-289.250) [-290.822] (-294.654) (-289.386) * [-289.589] (-290.499) (-297.755) (-289.941) -- 0:01:19
Average standard deviation of split frequencies: 0.013242
356000 -- [-293.741] (-294.621) (-292.297) (-290.977) * (-290.140) (-291.008) [-296.136] (-290.523) -- 0:01:19
357000 -- [-292.605] (-292.161) (-290.278) (-292.611) * (-289.871) [-293.017] (-291.342) (-289.902) -- 0:01:19
358000 -- (-290.617) (-293.057) [-291.145] (-292.298) * (-289.810) (-290.478) (-293.696) [-291.035] -- 0:01:18
359000 -- (-292.929) [-289.277] (-292.164) (-290.643) * (-289.992) (-291.406) (-294.623) [-294.492] -- 0:01:18
360000 -- (-292.339) (-290.743) (-292.023) [-291.485] * [-291.317] (-292.866) (-290.783) (-296.603) -- 0:01:18
Average standard deviation of split frequencies: 0.013796
361000 -- [-290.657] (-293.833) (-289.623) (-291.965) * (-290.147) (-296.137) [-290.192] (-293.345) -- 0:01:17
362000 -- (-290.992) (-291.673) [-289.956] (-295.061) * (-295.581) (-291.553) (-290.632) [-295.525] -- 0:01:17
363000 -- (-290.808) [-292.399] (-290.376) (-293.394) * (-289.792) [-290.430] (-289.577) (-291.664) -- 0:01:18
364000 -- [-290.335] (-291.552) (-290.392) (-294.700) * (-290.798) (-294.488) (-289.759) [-293.056] -- 0:01:18
365000 -- (-289.400) [-293.030] (-291.736) (-290.241) * (-291.944) (-292.215) [-291.660] (-294.220) -- 0:01:18
Average standard deviation of split frequencies: 0.011978
366000 -- (-290.907) (-292.353) (-290.002) [-291.733] * (-289.071) (-289.647) (-289.109) [-292.176] -- 0:01:17
367000 -- (-292.001) (-293.931) [-290.691] (-292.137) * (-291.168) [-291.115] (-292.916) (-290.028) -- 0:01:17
368000 -- (-290.134) [-293.409] (-292.389) (-291.669) * (-292.832) [-290.549] (-289.725) (-290.611) -- 0:01:17
369000 -- [-290.940] (-296.192) (-292.784) (-290.942) * [-290.499] (-291.039) (-290.227) (-296.894) -- 0:01:16
370000 -- (-289.493) (-292.624) (-290.287) [-290.855] * (-295.340) (-289.550) [-290.314] (-290.082) -- 0:01:16
Average standard deviation of split frequencies: 0.013065
371000 -- (-289.018) (-295.163) (-290.142) [-297.263] * (-292.676) (-289.773) [-289.577] (-295.194) -- 0:01:16
372000 -- (-293.299) (-289.873) [-291.738] (-290.550) * (-290.125) [-293.537] (-292.876) (-289.864) -- 0:01:17
373000 -- (-290.142) (-289.743) [-291.210] (-290.481) * (-290.531) (-294.238) [-293.746] (-291.318) -- 0:01:17
374000 -- (-292.140) (-292.914) [-290.634] (-292.135) * (-292.937) (-293.980) (-291.497) [-294.329] -- 0:01:16
375000 -- (-290.889) (-290.277) (-290.502) [-290.071] * (-291.663) [-293.988] (-291.340) (-290.301) -- 0:01:16
Average standard deviation of split frequencies: 0.013290
376000 -- (-290.574) (-290.259) [-289.826] (-291.975) * [-289.910] (-292.868) (-292.500) (-290.093) -- 0:01:16
377000 -- (-291.357) (-289.964) (-292.595) [-291.184] * (-290.278) [-291.803] (-291.713) (-292.959) -- 0:01:16
378000 -- (-295.536) [-291.611] (-291.100) (-290.464) * (-289.663) (-291.750) (-291.525) [-292.544] -- 0:01:15
379000 -- (-291.172) [-292.289] (-290.679) (-292.397) * (-293.243) (-291.820) [-292.958] (-290.137) -- 0:01:15
380000 -- [-291.952] (-289.174) (-291.017) (-293.116) * (-290.111) (-291.057) [-292.330] (-291.751) -- 0:01:16
Average standard deviation of split frequencies: 0.013127
381000 -- [-289.843] (-291.411) (-294.841) (-291.736) * (-292.569) [-290.479] (-293.967) (-290.333) -- 0:01:16
382000 -- (-290.835) [-290.272] (-289.896) (-292.112) * (-289.973) [-289.997] (-292.231) (-290.927) -- 0:01:16
383000 -- (-289.891) (-289.077) (-289.605) [-289.758] * (-290.438) (-291.845) (-290.130) [-291.543] -- 0:01:15
384000 -- (-291.248) (-294.397) [-291.684] (-289.388) * (-290.453) [-289.537] (-290.394) (-291.646) -- 0:01:15
385000 -- (-291.618) (-290.599) [-290.971] (-291.666) * (-290.853) (-289.184) [-291.876] (-290.247) -- 0:01:15
Average standard deviation of split frequencies: 0.012879
386000 -- (-293.539) (-293.199) (-295.366) [-289.864] * (-294.264) (-290.842) [-290.997] (-290.275) -- 0:01:14
387000 -- (-290.065) [-292.903] (-292.485) (-289.559) * (-291.191) (-294.163) (-292.114) [-295.053] -- 0:01:14
388000 -- [-290.922] (-291.794) (-291.003) (-289.820) * (-290.847) (-299.436) (-290.886) [-291.085] -- 0:01:15
389000 -- (-291.110) (-292.737) [-290.881] (-292.275) * (-290.513) [-291.617] (-295.055) (-293.282) -- 0:01:15
390000 -- (-290.991) (-298.301) [-289.593] (-292.566) * (-289.776) [-289.255] (-289.258) (-293.255) -- 0:01:15
Average standard deviation of split frequencies: 0.011695
391000 -- (-290.891) (-292.386) (-289.180) [-291.405] * (-291.437) [-292.388] (-291.209) (-290.658) -- 0:01:14
392000 -- (-294.888) (-289.266) (-289.888) [-290.060] * (-291.679) [-295.567] (-290.178) (-289.925) -- 0:01:14
393000 -- (-294.150) [-290.730] (-291.423) (-292.498) * (-289.910) (-289.233) [-291.180] (-290.428) -- 0:01:14
394000 -- (-290.832) [-291.719] (-289.785) (-290.210) * (-293.198) (-290.179) (-289.138) [-293.058] -- 0:01:13
395000 -- (-292.301) [-291.141] (-292.853) (-293.991) * [-290.405] (-291.268) (-289.709) (-290.752) -- 0:01:13
Average standard deviation of split frequencies: 0.013003
396000 -- (-290.902) [-297.398] (-289.508) (-294.257) * (-291.115) [-291.014] (-290.164) (-292.965) -- 0:01:13
397000 -- (-293.244) [-290.585] (-298.272) (-293.963) * (-295.037) (-290.500) [-289.653] (-292.708) -- 0:01:14
398000 -- (-292.616) [-291.701] (-294.631) (-289.914) * (-289.709) (-291.741) (-291.120) [-291.662] -- 0:01:14
399000 -- (-290.084) [-290.527] (-294.049) (-297.540) * [-293.933] (-294.011) (-291.411) (-291.105) -- 0:01:13
400000 -- (-291.961) [-292.304] (-290.499) (-293.905) * (-289.933) [-293.246] (-294.467) (-291.698) -- 0:01:13
Average standard deviation of split frequencies: 0.011979
401000 -- (-293.283) [-291.122] (-292.253) (-292.201) * (-290.510) (-291.404) (-291.202) [-291.500] -- 0:01:13
402000 -- (-290.895) [-291.052] (-292.996) (-291.615) * [-290.019] (-290.349) (-290.178) (-290.482) -- 0:01:12
403000 -- (-290.420) [-291.846] (-292.932) (-289.735) * (-290.034) [-289.651] (-293.475) (-291.011) -- 0:01:12
404000 -- (-294.627) [-291.028] (-291.576) (-295.736) * (-298.281) [-292.635] (-289.928) (-289.805) -- 0:01:12
405000 -- (-291.640) [-290.830] (-290.899) (-290.128) * (-293.522) [-292.247] (-290.792) (-291.922) -- 0:01:13
Average standard deviation of split frequencies: 0.012951
406000 -- [-291.712] (-290.517) (-293.200) (-299.148) * (-295.300) (-289.198) [-291.165] (-294.775) -- 0:01:13
407000 -- (-294.182) [-291.864] (-289.248) (-292.042) * (-289.712) (-290.424) [-289.220] (-290.543) -- 0:01:12
408000 -- (-295.537) [-290.473] (-291.137) (-289.544) * (-290.344) (-289.828) [-289.289] (-291.897) -- 0:01:12
409000 -- (-291.113) (-289.772) [-290.184] (-293.063) * (-289.912) [-290.753] (-291.437) (-291.123) -- 0:01:12
410000 -- (-291.512) (-292.426) [-289.936] (-295.384) * (-289.368) [-291.446] (-294.911) (-294.195) -- 0:01:11
Average standard deviation of split frequencies: 0.013068
411000 -- (-293.023) (-291.723) [-289.098] (-289.766) * (-290.600) [-290.596] (-292.045) (-293.811) -- 0:01:11
412000 -- (-290.954) (-293.572) [-291.774] (-294.112) * (-293.128) [-291.000] (-289.339) (-290.847) -- 0:01:11
413000 -- [-291.814] (-291.028) (-291.321) (-291.661) * (-292.591) (-291.966) [-290.086] (-295.196) -- 0:01:11
414000 -- [-290.427] (-295.092) (-292.113) (-289.180) * (-292.834) (-291.919) (-291.313) [-292.056] -- 0:01:12
415000 -- (-292.719) [-291.781] (-293.097) (-290.142) * (-291.514) [-292.519] (-295.105) (-292.073) -- 0:01:11
Average standard deviation of split frequencies: 0.013032
416000 -- [-293.601] (-291.350) (-290.336) (-291.048) * (-293.504) (-294.895) (-290.773) [-291.311] -- 0:01:11
417000 -- (-292.349) (-290.918) (-290.082) [-290.794] * (-291.793) (-292.035) [-290.795] (-292.605) -- 0:01:11
418000 -- (-290.770) (-290.805) (-289.988) [-291.851] * [-289.771] (-290.008) (-291.753) (-290.787) -- 0:01:11
419000 -- (-290.323) (-290.227) [-290.699] (-295.034) * (-290.427) (-290.195) [-289.862] (-292.520) -- 0:01:10
420000 -- (-290.441) (-290.053) (-292.700) [-290.758] * (-289.497) [-290.958] (-291.474) (-290.287) -- 0:01:10
Average standard deviation of split frequencies: 0.013335
421000 -- (-293.068) (-291.159) (-293.085) [-292.145] * (-295.663) (-291.448) (-291.293) [-293.652] -- 0:01:10
422000 -- (-292.437) (-290.274) (-292.733) [-293.271] * (-292.615) [-289.511] (-291.732) (-291.106) -- 0:01:11
423000 -- (-291.788) [-290.965] (-291.586) (-289.777) * (-290.817) (-291.960) (-290.573) [-293.370] -- 0:01:10
424000 -- (-293.356) [-290.088] (-290.675) (-293.097) * (-291.300) (-291.704) [-290.800] (-295.318) -- 0:01:10
425000 -- [-292.663] (-292.328) (-293.051) (-294.086) * (-289.792) (-292.528) [-289.652] (-289.640) -- 0:01:10
Average standard deviation of split frequencies: 0.012273
426000 -- [-290.760] (-289.998) (-290.442) (-292.022) * (-295.397) (-290.258) [-291.081] (-291.816) -- 0:01:10
427000 -- (-290.983) (-289.441) (-290.279) [-290.495] * (-292.969) (-292.545) [-291.087] (-293.154) -- 0:01:09
428000 -- [-289.875] (-292.114) (-290.689) (-292.025) * (-291.089) [-292.404] (-290.824) (-289.580) -- 0:01:09
429000 -- (-294.051) (-289.195) (-293.238) [-291.125] * (-292.483) [-292.349] (-290.486) (-297.316) -- 0:01:09
430000 -- [-294.497] (-292.064) (-291.567) (-292.203) * (-290.735) (-291.661) (-290.391) [-290.975] -- 0:01:10
Average standard deviation of split frequencies: 0.012339
431000 -- (-293.305) [-290.959] (-291.987) (-292.070) * (-291.445) (-294.814) (-292.436) [-289.456] -- 0:01:09
432000 -- [-290.457] (-297.032) (-295.552) (-292.152) * (-290.850) (-290.540) (-289.659) [-291.758] -- 0:01:09
433000 -- [-290.891] (-289.559) (-290.555) (-290.070) * [-289.661] (-291.006) (-293.558) (-290.171) -- 0:01:09
434000 -- (-290.649) [-290.622] (-289.430) (-290.357) * [-291.289] (-293.082) (-289.695) (-292.100) -- 0:01:09
435000 -- (-289.803) (-294.717) (-292.589) [-290.646] * (-290.535) (-291.054) [-290.942] (-290.328) -- 0:01:08
Average standard deviation of split frequencies: 0.012974
436000 -- [-290.541] (-293.357) (-295.497) (-295.203) * [-289.456] (-294.714) (-294.697) (-290.964) -- 0:01:08
437000 -- (-292.877) (-290.829) (-294.519) [-293.315] * [-291.716] (-291.369) (-290.044) (-289.869) -- 0:01:08
438000 -- [-292.248] (-295.146) (-290.066) (-293.056) * (-289.403) (-289.199) (-289.273) [-290.424] -- 0:01:08
439000 -- (-294.578) (-290.049) [-291.930] (-293.160) * [-290.733] (-291.507) (-291.373) (-290.693) -- 0:01:09
440000 -- (-289.912) (-298.082) (-290.443) [-291.278] * (-292.401) (-292.251) [-290.997] (-292.550) -- 0:01:08
Average standard deviation of split frequencies: 0.012718
441000 -- [-295.700] (-291.145) (-297.616) (-293.404) * (-291.055) (-294.824) (-292.516) [-290.312] -- 0:01:08
442000 -- (-291.238) [-290.623] (-289.440) (-293.942) * (-291.407) (-292.473) (-290.559) [-291.484] -- 0:01:08
443000 -- (-292.808) (-292.085) [-289.531] (-291.492) * (-293.509) (-291.685) [-290.356] (-291.468) -- 0:01:07
444000 -- (-291.079) (-296.684) [-291.027] (-292.530) * (-290.563) [-291.660] (-294.261) (-290.115) -- 0:01:07
445000 -- (-291.870) [-293.461] (-292.028) (-294.666) * (-289.577) (-293.242) (-295.126) [-289.898] -- 0:01:07
Average standard deviation of split frequencies: 0.011819
446000 -- (-289.625) (-289.281) [-291.197] (-290.845) * (-291.475) (-290.281) [-292.304] (-290.546) -- 0:01:07
447000 -- [-290.496] (-292.712) (-289.846) (-290.883) * (-291.609) (-290.065) [-292.272] (-291.870) -- 0:01:08
448000 -- (-295.476) [-289.723] (-291.178) (-289.693) * [-290.860] (-290.868) (-290.648) (-293.702) -- 0:01:07
449000 -- (-292.712) (-289.696) [-291.051] (-289.364) * (-292.217) (-292.215) [-290.544] (-289.670) -- 0:01:07
450000 -- (-292.299) (-292.048) (-293.341) [-292.177] * (-291.472) [-294.430] (-289.250) (-292.167) -- 0:01:07
Average standard deviation of split frequencies: 0.011696
451000 -- [-291.543] (-295.338) (-289.477) (-293.228) * (-290.321) (-291.618) (-290.370) [-291.975] -- 0:01:06
452000 -- (-290.587) (-291.326) (-291.409) [-289.457] * (-291.629) [-291.768] (-290.281) (-291.528) -- 0:01:06
453000 -- [-290.832] (-295.229) (-292.141) (-289.304) * (-292.035) (-290.685) (-291.268) [-294.301] -- 0:01:06
454000 -- (-291.916) (-290.567) (-294.952) [-293.091] * [-291.980] (-290.384) (-292.252) (-291.745) -- 0:01:06
455000 -- [-290.051] (-289.988) (-294.195) (-288.955) * (-290.982) (-290.966) (-291.258) [-292.129] -- 0:01:07
Average standard deviation of split frequencies: 0.011475
456000 -- (-297.042) [-290.212] (-293.082) (-291.990) * (-291.532) (-289.116) (-292.797) [-291.219] -- 0:01:06
457000 -- (-303.333) (-292.180) (-289.989) [-294.945] * (-290.419) (-291.606) (-292.846) [-291.123] -- 0:01:06
458000 -- (-291.244) (-291.023) [-292.320] (-290.678) * (-290.732) [-289.752] (-291.217) (-295.626) -- 0:01:06
459000 -- (-291.899) [-289.479] (-291.283) (-290.779) * (-294.483) (-289.998) (-294.404) [-292.393] -- 0:01:06
460000 -- [-295.361] (-291.945) (-290.575) (-293.565) * [-291.201] (-293.530) (-290.530) (-291.103) -- 0:01:05
Average standard deviation of split frequencies: 0.011461
461000 -- [-291.875] (-289.855) (-289.071) (-299.195) * (-292.446) (-290.062) [-292.212] (-290.683) -- 0:01:05
462000 -- (-293.099) (-290.883) [-293.676] (-291.397) * (-291.360) (-293.593) (-289.926) [-290.912] -- 0:01:05
463000 -- (-297.141) (-290.033) [-291.149] (-292.051) * (-290.263) (-292.549) [-289.996] (-289.279) -- 0:01:06
464000 -- [-290.024] (-294.845) (-292.120) (-291.948) * (-290.873) [-296.521] (-291.077) (-291.010) -- 0:01:05
465000 -- (-291.782) (-291.328) (-292.389) [-294.864] * (-291.714) [-290.736] (-290.955) (-291.826) -- 0:01:05
Average standard deviation of split frequencies: 0.011431
466000 -- (-290.667) (-289.816) [-292.859] (-290.752) * [-290.399] (-291.588) (-291.399) (-298.969) -- 0:01:05
467000 -- (-290.901) (-291.440) (-292.456) [-289.040] * (-292.654) (-295.163) [-290.224] (-297.529) -- 0:01:05
468000 -- (-292.236) [-289.954] (-290.025) (-295.429) * (-290.904) (-296.178) [-290.719] (-290.357) -- 0:01:04
469000 -- (-289.198) (-290.880) [-289.851] (-292.280) * [-291.435] (-296.024) (-290.556) (-291.038) -- 0:01:04
470000 -- [-291.029] (-291.953) (-292.864) (-290.836) * (-292.358) (-294.254) [-290.923] (-291.710) -- 0:01:04
Average standard deviation of split frequencies: 0.011919
471000 -- (-290.434) [-290.476] (-294.749) (-291.893) * (-292.881) (-290.977) (-294.300) [-291.283] -- 0:01:04
472000 -- (-291.747) (-289.407) [-290.133] (-291.017) * [-291.070] (-290.219) (-292.612) (-292.548) -- 0:01:04
473000 -- (-290.119) (-289.773) (-291.092) [-289.694] * (-292.022) (-290.002) [-294.473] (-295.263) -- 0:01:04
474000 -- (-292.841) (-295.276) [-291.932] (-293.590) * [-290.294] (-291.669) (-297.142) (-290.574) -- 0:01:04
475000 -- [-291.182] (-289.566) (-293.867) (-290.844) * [-293.443] (-290.780) (-290.167) (-289.826) -- 0:01:04
Average standard deviation of split frequencies: 0.011444
476000 -- (-292.557) (-292.601) (-298.140) [-291.209] * (-292.959) (-294.960) (-295.193) [-291.596] -- 0:01:03
477000 -- [-290.945] (-293.098) (-289.807) (-290.269) * [-290.449] (-297.778) (-291.246) (-291.029) -- 0:01:03
478000 -- (-293.503) (-293.154) [-292.050] (-289.773) * [-291.567] (-291.671) (-290.547) (-291.145) -- 0:01:03
479000 -- (-289.370) (-289.480) (-289.136) [-290.758] * (-290.710) [-294.886] (-291.194) (-290.483) -- 0:01:03
480000 -- [-289.710] (-291.490) (-289.917) (-289.813) * (-292.034) (-292.001) (-292.620) [-290.877] -- 0:01:03
Average standard deviation of split frequencies: 0.011234
481000 -- [-290.157] (-295.643) (-290.654) (-290.238) * [-290.126] (-290.998) (-289.477) (-289.688) -- 0:01:03
482000 -- (-291.659) [-293.720] (-290.709) (-293.341) * (-291.664) (-290.224) [-289.764] (-291.530) -- 0:01:03
483000 -- (-296.163) (-293.929) [-289.904] (-290.212) * (-291.729) [-290.423] (-291.863) (-290.359) -- 0:01:03
484000 -- (-293.074) (-290.322) (-291.807) [-291.355] * [-291.978] (-293.737) (-291.142) (-289.727) -- 0:01:02
485000 -- (-291.641) (-291.736) (-290.992) [-292.591] * (-292.955) [-293.335] (-293.510) (-292.042) -- 0:01:02
Average standard deviation of split frequencies: 0.011074
486000 -- (-290.741) (-289.840) [-291.240] (-289.817) * (-293.519) (-299.609) (-295.299) [-290.449] -- 0:01:02
487000 -- [-291.207] (-291.402) (-289.309) (-289.439) * [-290.993] (-296.013) (-289.136) (-289.217) -- 0:01:02
488000 -- (-295.809) [-295.339] (-289.700) (-290.323) * (-289.614) [-289.228] (-292.336) (-292.312) -- 0:01:01
489000 -- (-293.073) (-293.062) [-289.339] (-290.383) * (-290.001) (-290.536) (-289.414) [-291.998] -- 0:01:02
490000 -- (-289.932) (-291.876) [-294.017] (-290.959) * [-289.715] (-289.935) (-296.451) (-291.056) -- 0:01:02
Average standard deviation of split frequencies: 0.011129
491000 -- (-293.074) (-289.200) (-292.626) [-290.796] * [-291.158] (-296.352) (-294.964) (-293.766) -- 0:01:02
492000 -- (-292.360) (-289.524) [-291.487] (-291.519) * [-290.612] (-290.252) (-291.595) (-289.489) -- 0:01:01
493000 -- [-291.183] (-293.326) (-291.194) (-291.059) * [-290.183] (-290.269) (-291.734) (-293.112) -- 0:01:01
494000 -- (-289.238) [-291.254] (-297.083) (-293.928) * (-294.669) [-289.839] (-292.745) (-295.579) -- 0:01:01
495000 -- (-289.912) [-291.239] (-294.501) (-290.224) * (-289.764) (-292.319) [-292.419] (-290.521) -- 0:01:01
Average standard deviation of split frequencies: 0.011664
496000 -- (-290.138) (-290.148) (-290.297) [-292.529] * (-291.113) [-290.480] (-291.857) (-291.037) -- 0:01:00
497000 -- [-291.891] (-290.380) (-289.792) (-292.205) * (-292.602) (-290.409) [-290.979] (-292.808) -- 0:01:01
498000 -- (-294.145) (-293.964) (-290.042) [-289.269] * (-292.191) (-291.864) [-290.337] (-292.297) -- 0:01:01
499000 -- [-290.472] (-292.139) (-291.325) (-291.383) * [-292.878] (-289.938) (-289.398) (-289.285) -- 0:01:01
500000 -- (-291.710) (-292.303) [-290.419] (-292.076) * (-290.885) [-290.199] (-289.598) (-292.537) -- 0:01:01
Average standard deviation of split frequencies: 0.011487
501000 -- (-296.574) (-292.870) (-289.918) [-289.839] * (-292.674) [-290.177] (-290.145) (-292.510) -- 0:01:00
502000 -- [-290.721] (-293.757) (-289.231) (-300.721) * [-291.615] (-289.637) (-292.404) (-290.443) -- 0:01:00
503000 -- (-293.876) (-293.211) (-290.067) [-290.487] * (-289.171) (-292.584) (-297.334) [-292.844] -- 0:01:00
504000 -- (-290.733) (-291.781) (-293.171) [-291.477] * (-290.483) (-289.801) [-292.428] (-294.304) -- 0:01:00
505000 -- [-294.621] (-293.056) (-292.088) (-291.938) * (-290.414) (-290.926) [-292.575] (-290.651) -- 0:00:59
Average standard deviation of split frequencies: 0.010636
506000 -- [-289.798] (-290.460) (-296.021) (-289.694) * (-292.427) [-289.795] (-291.105) (-292.383) -- 0:01:00
507000 -- (-291.544) (-290.975) (-293.270) [-291.197] * (-294.680) [-292.518] (-290.908) (-293.900) -- 0:01:00
508000 -- [-289.979] (-292.159) (-293.628) (-291.377) * (-291.195) (-290.234) [-291.575] (-289.021) -- 0:01:00
509000 -- (-290.292) (-291.563) (-290.325) [-289.928] * [-290.229] (-294.723) (-289.457) (-293.407) -- 0:00:59
510000 -- [-291.832] (-289.685) (-290.932) (-289.806) * (-291.838) (-295.263) (-291.744) [-292.386] -- 0:00:59
Average standard deviation of split frequencies: 0.010238
511000 -- (-292.746) (-289.969) [-290.386] (-290.586) * (-289.366) (-292.141) [-293.842] (-291.600) -- 0:00:59
512000 -- (-289.970) [-292.134] (-291.000) (-291.329) * (-291.128) (-290.619) (-292.276) [-289.754] -- 0:00:59
513000 -- (-292.325) (-289.792) (-292.418) [-289.719] * [-294.057] (-289.763) (-295.238) (-294.665) -- 0:00:59
514000 -- (-290.045) [-295.268] (-290.558) (-291.515) * (-296.144) (-289.625) (-294.400) [-291.257] -- 0:00:59
515000 -- (-290.971) [-291.159] (-291.319) (-291.661) * (-293.147) (-291.386) (-290.418) [-290.374] -- 0:00:59
Average standard deviation of split frequencies: 0.010557
516000 -- [-290.909] (-294.968) (-289.469) (-291.056) * (-289.727) [-289.686] (-289.684) (-289.672) -- 0:00:59
517000 -- [-293.631] (-290.993) (-294.645) (-294.429) * (-289.279) [-290.479] (-290.601) (-290.929) -- 0:00:58
518000 -- [-290.425] (-290.651) (-290.619) (-294.070) * (-291.352) [-293.249] (-290.004) (-289.997) -- 0:00:58
519000 -- (-291.292) [-290.822] (-292.523) (-295.021) * [-291.679] (-290.745) (-290.369) (-293.860) -- 0:00:58
520000 -- (-290.541) (-291.446) (-290.621) [-289.249] * (-294.496) [-291.743] (-292.169) (-294.227) -- 0:00:58
Average standard deviation of split frequencies: 0.010965
521000 -- (-290.408) (-296.766) [-291.400] (-289.179) * (-289.805) [-294.830] (-293.913) (-294.473) -- 0:00:57
522000 -- (-292.025) (-291.925) (-290.159) [-289.537] * (-290.764) (-290.055) (-289.510) [-291.387] -- 0:00:58
523000 -- (-293.249) (-290.331) (-290.592) [-292.339] * [-289.260] (-293.435) (-290.269) (-293.651) -- 0:00:58
524000 -- (-291.473) (-290.709) [-289.309] (-289.597) * [-291.762] (-292.651) (-294.066) (-291.744) -- 0:00:58
525000 -- (-294.519) (-290.736) [-291.884] (-289.214) * (-291.717) (-291.933) [-295.158] (-291.337) -- 0:00:57
Average standard deviation of split frequencies: 0.010555
526000 -- (-291.627) [-292.184] (-293.234) (-291.656) * (-294.434) (-291.647) (-290.815) [-290.560] -- 0:00:57
527000 -- (-290.440) (-290.071) [-293.349] (-290.956) * (-292.607) (-292.176) (-293.011) [-295.395] -- 0:00:57
528000 -- (-289.566) (-290.336) (-296.939) [-289.345] * (-290.189) (-290.216) [-299.734] (-294.891) -- 0:00:57
529000 -- (-291.031) (-293.151) (-292.029) [-293.357] * (-289.886) (-290.924) [-288.975] (-292.270) -- 0:00:56
530000 -- (-291.502) [-290.185] (-300.701) (-291.029) * (-292.463) (-292.685) (-290.695) [-289.169] -- 0:00:57
Average standard deviation of split frequencies: 0.010561
531000 -- (-291.375) (-290.052) (-291.800) [-289.856] * (-290.671) (-293.759) (-295.083) [-290.264] -- 0:00:57
532000 -- (-290.783) (-295.698) [-290.812] (-290.444) * (-292.142) (-290.276) (-291.389) [-290.555] -- 0:00:57
533000 -- (-294.115) [-290.782] (-290.849) (-291.778) * (-290.936) (-290.710) [-290.589] (-290.061) -- 0:00:56
534000 -- (-289.726) (-290.634) [-292.094] (-289.828) * (-290.813) (-290.206) (-289.928) [-294.490] -- 0:00:56
535000 -- (-291.414) (-291.733) (-290.519) [-290.280] * (-291.636) [-291.334] (-289.866) (-289.937) -- 0:00:56
Average standard deviation of split frequencies: 0.010358
536000 -- (-290.090) (-292.495) [-293.236] (-289.526) * (-290.116) [-291.777] (-296.051) (-290.457) -- 0:00:56
537000 -- (-291.316) (-291.981) [-290.139] (-292.267) * (-293.146) (-289.441) (-291.428) [-289.066] -- 0:00:56
538000 -- [-292.038] (-293.721) (-291.356) (-292.497) * (-289.557) (-298.682) (-289.114) [-290.736] -- 0:00:56
539000 -- [-289.667] (-290.248) (-290.757) (-292.277) * (-292.582) [-291.929] (-296.932) (-292.444) -- 0:00:56
540000 -- (-290.691) [-293.345] (-290.143) (-294.148) * (-292.503) [-291.245] (-291.710) (-290.420) -- 0:00:56
Average standard deviation of split frequencies: 0.010463
541000 -- [-290.264] (-292.517) (-297.628) (-292.314) * (-292.735) [-291.002] (-292.695) (-290.836) -- 0:00:55
542000 -- (-294.340) (-291.235) [-295.576] (-291.401) * (-291.247) [-292.547] (-290.929) (-292.532) -- 0:00:55
543000 -- (-294.016) [-291.863] (-292.086) (-293.249) * (-290.291) [-291.418] (-290.241) (-289.351) -- 0:00:55
544000 -- (-293.633) (-290.036) (-289.748) [-289.601] * (-291.258) [-290.232] (-295.142) (-291.434) -- 0:00:55
545000 -- (-292.750) (-290.228) (-297.103) [-290.403] * (-289.823) [-289.437] (-293.402) (-289.768) -- 0:00:55
Average standard deviation of split frequencies: 0.011224
546000 -- (-294.301) (-291.729) [-292.216] (-289.676) * (-291.874) [-289.753] (-290.597) (-290.509) -- 0:00:54
547000 -- (-290.589) [-290.112] (-296.778) (-297.750) * (-294.571) [-291.652] (-289.580) (-290.546) -- 0:00:55
548000 -- (-290.055) [-290.241] (-294.431) (-289.210) * (-294.116) [-291.767] (-289.780) (-290.047) -- 0:00:55
549000 -- [-295.008] (-298.765) (-292.943) (-296.165) * (-295.050) [-290.447] (-290.016) (-290.883) -- 0:00:55
550000 -- [-291.032] (-291.415) (-290.543) (-293.525) * (-290.032) [-293.752] (-291.048) (-296.183) -- 0:00:54
Average standard deviation of split frequencies: 0.011829
551000 -- [-293.236] (-290.122) (-290.566) (-294.070) * (-290.548) [-290.639] (-290.032) (-290.325) -- 0:00:54
552000 -- [-290.186] (-292.412) (-296.274) (-290.713) * (-291.608) [-292.589] (-290.430) (-289.794) -- 0:00:54
553000 -- (-292.062) (-294.237) (-290.083) [-292.209] * (-291.823) [-294.279] (-289.453) (-292.136) -- 0:00:54
554000 -- (-289.941) [-290.681] (-290.561) (-295.622) * (-289.821) [-292.138] (-292.466) (-292.972) -- 0:00:53
555000 -- (-293.160) (-290.935) (-291.095) [-293.647] * (-289.724) [-294.085] (-290.268) (-295.255) -- 0:00:54
Average standard deviation of split frequencies: 0.012255
556000 -- (-294.194) (-297.853) [-291.638] (-290.394) * (-289.264) [-289.822] (-291.849) (-293.504) -- 0:00:54
557000 -- (-290.734) [-290.320] (-290.661) (-290.997) * (-292.153) [-290.631] (-291.647) (-290.641) -- 0:00:54
558000 -- (-290.581) [-291.254] (-289.034) (-295.313) * (-288.988) [-289.951] (-289.202) (-291.676) -- 0:00:53
559000 -- (-291.901) (-291.604) [-289.790] (-291.211) * (-296.976) [-291.634] (-290.098) (-292.008) -- 0:00:53
560000 -- [-289.497] (-295.307) (-295.400) (-290.451) * (-290.799) [-297.111] (-290.623) (-290.572) -- 0:00:53
Average standard deviation of split frequencies: 0.013032
561000 -- (-289.606) (-295.346) [-291.178] (-293.188) * (-290.725) [-292.714] (-291.580) (-290.251) -- 0:00:53
562000 -- (-290.555) (-290.070) [-291.837] (-292.562) * (-292.672) [-290.339] (-295.410) (-291.514) -- 0:00:52
563000 -- (-295.406) (-294.947) (-293.401) [-290.383] * (-296.287) [-293.547] (-291.107) (-290.348) -- 0:00:53
564000 -- (-290.613) [-289.870] (-290.339) (-290.589) * (-289.767) [-292.571] (-291.871) (-290.038) -- 0:00:53
565000 -- (-289.754) (-290.658) (-291.541) [-290.588] * (-295.131) [-291.284] (-294.872) (-292.805) -- 0:00:53
Average standard deviation of split frequencies: 0.013048
566000 -- (-296.747) (-293.666) [-292.890] (-296.965) * (-293.138) [-291.983] (-292.148) (-290.091) -- 0:00:52
567000 -- (-294.316) (-292.716) (-290.618) [-293.186] * (-290.710) [-292.515] (-294.630) (-296.137) -- 0:00:52
568000 -- (-295.208) [-291.227] (-290.069) (-290.637) * (-293.349) [-290.822] (-291.837) (-290.775) -- 0:00:52
569000 -- (-292.417) [-288.901] (-294.141) (-290.310) * (-289.969) [-289.107] (-289.546) (-290.758) -- 0:00:52
570000 -- [-292.587] (-293.170) (-291.652) (-291.919) * (-290.237) [-289.973] (-291.146) (-290.159) -- 0:00:52
Average standard deviation of split frequencies: 0.012942
571000 -- (-291.985) (-292.257) (-293.005) [-289.522] * (-289.619) [-291.939] (-290.992) (-290.256) -- 0:00:51
572000 -- (-295.068) (-291.867) [-294.890] (-290.251) * (-293.032) [-290.424] (-293.519) (-291.937) -- 0:00:52
573000 -- (-290.340) (-298.155) (-292.143) [-291.309] * (-289.597) [-290.472] (-289.843) (-290.862) -- 0:00:52
574000 -- (-292.174) (-295.018) (-289.702) [-292.349] * (-292.346) [-290.738] (-292.709) (-291.757) -- 0:00:51
575000 -- (-290.482) (-290.461) [-289.167] (-292.697) * (-289.786) [-292.505] (-290.520) (-291.903) -- 0:00:51
Average standard deviation of split frequencies: 0.013276
576000 -- (-290.475) [-292.200] (-290.485) (-289.365) * (-289.580) [-292.919] (-290.902) (-293.234) -- 0:00:51
577000 -- (-290.860) (-292.616) [-293.648] (-293.021) * (-294.379) [-292.251] (-292.438) (-291.165) -- 0:00:51
578000 -- (-292.851) (-291.249) [-291.676] (-293.413) * (-290.381) [-289.219] (-290.257) (-290.731) -- 0:00:51
579000 -- (-292.106) [-289.828] (-289.603) (-289.756) * (-289.724) [-290.754] (-291.728) (-289.739) -- 0:00:50
580000 -- (-289.132) [-289.926] (-289.765) (-290.021) * (-291.550) [-289.526] (-289.036) (-299.422) -- 0:00:51
Average standard deviation of split frequencies: 0.012746
581000 -- (-290.462) [-292.059] (-292.323) (-290.704) * (-291.405) [-289.949] (-292.307) (-290.422) -- 0:00:51
582000 -- (-291.811) (-291.120) (-292.332) [-289.840] * (-289.461) [-291.969] (-295.375) (-289.722) -- 0:00:50
583000 -- (-289.300) (-289.705) (-289.587) [-289.991] * (-290.318) [-291.152] (-290.398) (-292.189) -- 0:00:50
584000 -- (-293.106) (-293.915) (-290.712) [-290.531] * (-291.013) (-290.431) [-291.232] (-290.696) -- 0:00:50
585000 -- (-296.109) (-294.134) [-289.796] (-291.572) * (-291.393) [-289.714] (-290.907) (-291.644) -- 0:00:50
Average standard deviation of split frequencies: 0.011628
586000 -- (-292.623) (-301.090) [-291.713] (-290.249) * [-292.567] (-290.797) (-290.557) (-294.778) -- 0:00:50
587000 -- [-295.829] (-294.108) (-291.398) (-289.964) * (-295.624) [-292.237] (-290.062) (-290.821) -- 0:00:49
588000 -- (-291.577) [-289.940] (-288.898) (-290.014) * [-290.187] (-289.494) (-296.977) (-292.606) -- 0:00:50
589000 -- [-289.554] (-290.151) (-290.701) (-294.899) * [-289.927] (-293.770) (-289.421) (-290.054) -- 0:00:50
590000 -- (-292.435) (-290.194) [-289.437] (-298.110) * (-290.235) (-294.739) [-291.058] (-290.024) -- 0:00:50
Average standard deviation of split frequencies: 0.011754
591000 -- (-293.095) (-294.024) (-292.169) [-294.442] * (-291.947) (-289.966) (-291.523) [-293.742] -- 0:00:49
592000 -- [-289.015] (-290.345) (-292.872) (-290.072) * (-296.467) [-292.656] (-289.497) (-290.978) -- 0:00:49
593000 -- [-292.805] (-290.979) (-290.052) (-290.610) * (-291.583) (-292.630) [-293.125] (-291.506) -- 0:00:49
594000 -- (-291.354) (-293.758) (-291.807) [-290.285] * (-292.229) [-292.041] (-290.612) (-292.094) -- 0:00:49
595000 -- (-291.824) [-291.128] (-291.238) (-291.271) * (-296.472) (-291.041) (-291.953) [-292.909] -- 0:00:49
Average standard deviation of split frequencies: 0.012799
596000 -- (-291.970) (-289.899) (-291.700) [-290.313] * (-293.848) (-294.481) (-290.682) [-292.355] -- 0:00:49
597000 -- [-290.542] (-295.298) (-291.501) (-292.311) * (-296.007) (-291.329) [-290.067] (-291.144) -- 0:00:49
598000 -- (-291.894) [-290.997] (-291.494) (-289.876) * (-292.871) [-293.857] (-291.113) (-291.710) -- 0:00:49
599000 -- (-290.894) [-291.271] (-291.004) (-289.002) * (-290.168) (-291.773) [-293.479] (-289.815) -- 0:00:48
600000 -- (-290.237) (-296.174) (-292.287) [-289.218] * (-293.133) (-291.134) (-293.951) [-290.369] -- 0:00:48
Average standard deviation of split frequencies: 0.013185
601000 -- (-291.089) (-291.202) [-290.968] (-290.280) * (-292.082) [-290.567] (-291.054) (-290.153) -- 0:00:48
602000 -- [-293.699] (-291.899) (-292.700) (-289.799) * (-296.879) (-290.128) [-290.233] (-290.455) -- 0:00:48
603000 -- (-290.471) (-292.182) (-295.146) [-289.376] * (-299.750) (-289.866) (-294.937) [-291.009] -- 0:00:48
604000 -- (-290.438) [-291.115] (-291.260) (-291.657) * (-290.354) (-292.390) (-292.125) [-292.511] -- 0:00:47
605000 -- [-292.888] (-289.561) (-290.432) (-289.801) * [-290.275] (-293.240) (-293.305) (-289.918) -- 0:00:48
Average standard deviation of split frequencies: 0.013302
606000 -- (-290.203) (-291.641) [-289.444] (-299.516) * (-290.097) (-290.932) (-291.291) [-289.419] -- 0:00:48
607000 -- (-291.778) [-290.277] (-289.523) (-291.545) * [-292.360] (-291.936) (-291.880) (-296.876) -- 0:00:47
608000 -- (-294.818) (-291.242) [-294.398] (-295.971) * (-292.630) (-293.590) [-294.531] (-293.474) -- 0:00:47
609000 -- (-296.053) (-289.901) (-290.827) [-292.247] * [-290.343] (-292.209) (-290.478) (-293.736) -- 0:00:47
610000 -- [-292.790] (-292.206) (-290.919) (-291.597) * (-289.314) (-290.074) (-290.034) [-291.625] -- 0:00:47
Average standard deviation of split frequencies: 0.012421
611000 -- (-289.196) [-291.144] (-291.670) (-290.141) * (-290.583) [-295.134] (-289.924) (-290.274) -- 0:00:47
612000 -- (-292.749) (-293.315) (-297.868) [-292.415] * [-290.163] (-289.021) (-296.786) (-294.145) -- 0:00:46
613000 -- (-290.860) (-291.982) [-289.735] (-292.792) * (-291.663) (-291.422) (-290.676) [-289.041] -- 0:00:46
614000 -- (-290.309) (-293.890) [-289.242] (-290.392) * [-291.137] (-297.881) (-290.654) (-294.818) -- 0:00:47
615000 -- (-291.272) [-289.310] (-289.435) (-290.081) * (-292.794) (-290.760) (-290.095) [-290.341] -- 0:00:46
Average standard deviation of split frequencies: 0.013086
616000 -- [-297.280] (-292.435) (-289.379) (-290.627) * (-290.787) [-293.654] (-292.658) (-290.778) -- 0:00:46
617000 -- (-290.430) (-290.895) [-294.770] (-293.548) * [-293.777] (-290.434) (-293.325) (-292.916) -- 0:00:46
618000 -- (-293.241) (-291.996) [-290.464] (-289.565) * [-292.769] (-290.113) (-292.422) (-293.303) -- 0:00:46
619000 -- [-291.483] (-294.407) (-289.784) (-292.329) * (-290.831) (-291.953) [-290.735] (-292.150) -- 0:00:46
620000 -- (-291.813) (-291.083) (-293.460) [-290.622] * (-290.138) (-290.715) [-290.957] (-292.201) -- 0:00:45
Average standard deviation of split frequencies: 0.012996
621000 -- [-290.090] (-291.064) (-292.030) (-289.854) * (-292.892) (-289.680) (-293.984) [-289.842] -- 0:00:45
622000 -- (-291.780) (-292.468) [-292.276] (-291.099) * (-290.442) [-289.768] (-300.680) (-290.248) -- 0:00:46
623000 -- (-294.861) (-289.690) [-291.248] (-290.387) * (-292.215) (-294.549) [-289.947] (-292.547) -- 0:00:45
624000 -- (-289.522) (-291.739) [-291.148] (-290.256) * (-290.642) [-290.493] (-291.391) (-292.961) -- 0:00:45
625000 -- [-293.922] (-291.480) (-290.419) (-292.926) * [-289.841] (-291.454) (-291.942) (-294.712) -- 0:00:45
Average standard deviation of split frequencies: 0.012551
626000 -- (-289.725) (-291.032) (-290.920) [-290.408] * (-291.358) (-290.405) (-292.987) [-289.930] -- 0:00:45
627000 -- (-292.333) (-290.444) [-290.348] (-292.486) * (-289.970) (-290.390) [-289.681] (-290.580) -- 0:00:45
628000 -- (-289.455) (-288.982) (-291.418) [-294.725] * (-293.211) (-289.234) (-291.997) [-292.720] -- 0:00:45
629000 -- (-291.186) [-289.654] (-294.678) (-294.085) * (-292.340) (-289.648) (-293.020) [-290.429] -- 0:00:44
630000 -- [-295.202] (-295.303) (-292.625) (-292.591) * [-291.141] (-290.711) (-294.133) (-289.439) -- 0:00:44
Average standard deviation of split frequencies: 0.013862
631000 -- (-293.950) (-291.738) [-291.578] (-292.996) * [-291.161] (-293.842) (-295.792) (-289.504) -- 0:00:45
632000 -- [-291.591] (-294.564) (-290.733) (-290.948) * (-293.774) [-290.518] (-291.719) (-292.009) -- 0:00:44
633000 -- (-293.540) (-289.623) [-289.774] (-289.906) * (-290.414) (-298.507) [-294.257] (-291.926) -- 0:00:44
634000 -- (-289.729) (-289.531) [-289.786] (-291.614) * [-291.104] (-290.194) (-291.180) (-291.136) -- 0:00:44
635000 -- [-289.757] (-292.763) (-289.673) (-292.092) * [-290.978] (-292.566) (-291.014) (-291.436) -- 0:00:44
Average standard deviation of split frequencies: 0.013679
636000 -- (-292.860) (-290.091) [-291.325] (-291.228) * [-289.248] (-290.224) (-292.343) (-292.792) -- 0:00:44
637000 -- [-290.477] (-292.395) (-291.487) (-294.408) * [-293.766] (-290.455) (-291.236) (-293.534) -- 0:00:43
638000 -- (-292.639) [-292.664] (-293.405) (-290.642) * [-295.651] (-293.006) (-290.967) (-290.323) -- 0:00:43
639000 -- [-290.519] (-291.601) (-290.571) (-294.988) * (-289.782) [-289.808] (-292.284) (-290.248) -- 0:00:44
640000 -- [-291.517] (-293.063) (-291.943) (-293.192) * (-290.615) (-292.431) [-290.190] (-290.815) -- 0:00:43
Average standard deviation of split frequencies: 0.013686
641000 -- (-291.787) (-292.589) (-291.918) [-289.933] * (-297.350) (-296.903) [-291.542] (-289.210) -- 0:00:43
642000 -- [-290.928] (-290.539) (-289.947) (-290.280) * (-291.179) (-294.663) (-290.582) [-290.884] -- 0:00:43
643000 -- (-292.358) (-290.957) (-292.354) [-292.073] * (-289.363) [-292.011] (-289.859) (-290.053) -- 0:00:43
644000 -- (-292.413) [-291.547] (-289.452) (-293.479) * (-290.349) (-292.155) (-292.586) [-291.941] -- 0:00:43
645000 -- (-289.286) [-290.686] (-290.803) (-290.293) * (-290.606) [-293.180] (-291.356) (-293.161) -- 0:00:42
Average standard deviation of split frequencies: 0.013533
646000 -- (-291.525) (-292.115) (-292.116) [-289.915] * (-292.441) [-290.518] (-290.001) (-296.139) -- 0:00:42
647000 -- (-291.862) (-292.796) [-292.959] (-290.272) * [-293.981] (-291.168) (-294.948) (-290.696) -- 0:00:42
648000 -- (-293.880) (-291.932) [-291.752] (-293.379) * (-292.225) (-290.622) [-290.086] (-291.674) -- 0:00:42
649000 -- (-289.236) (-292.853) (-292.651) [-290.802] * (-293.083) [-289.558] (-291.308) (-291.622) -- 0:00:42
650000 -- [-290.137] (-289.369) (-294.594) (-291.777) * (-294.365) (-294.010) (-289.665) [-290.085] -- 0:00:42
Average standard deviation of split frequencies: 0.013983
651000 -- (-292.615) [-290.266] (-289.525) (-291.121) * (-289.856) (-291.579) [-293.492] (-293.984) -- 0:00:42
652000 -- (-290.966) (-289.395) [-290.680] (-289.611) * (-289.902) (-289.917) [-290.624] (-290.347) -- 0:00:42
653000 -- (-290.389) [-291.032] (-292.171) (-289.744) * [-290.893] (-292.253) (-290.943) (-295.212) -- 0:00:41
654000 -- (-294.065) (-293.290) (-292.999) [-290.868] * [-290.863] (-291.658) (-290.180) (-291.432) -- 0:00:41
655000 -- (-293.603) (-290.734) (-289.436) [-291.038] * (-290.992) [-289.393] (-292.067) (-292.632) -- 0:00:41
Average standard deviation of split frequencies: 0.013653
656000 -- [-290.541] (-292.858) (-294.128) (-290.516) * (-290.105) (-291.164) [-295.056] (-289.944) -- 0:00:41
657000 -- (-290.824) (-289.618) (-289.808) [-289.491] * [-290.290] (-292.397) (-292.161) (-291.412) -- 0:00:41
658000 -- (-291.254) [-293.694] (-290.331) (-291.638) * [-289.649] (-290.526) (-289.898) (-290.725) -- 0:00:41
659000 -- (-291.364) (-295.601) (-292.739) [-293.489] * (-289.504) [-289.590] (-289.650) (-293.348) -- 0:00:41
660000 -- (-290.414) (-291.316) (-291.251) [-289.747] * (-289.842) (-290.317) [-289.923] (-290.001) -- 0:00:41
Average standard deviation of split frequencies: 0.013636
661000 -- [-290.619] (-290.721) (-290.785) (-290.979) * [-290.488] (-291.671) (-290.924) (-291.856) -- 0:00:41
662000 -- [-289.231] (-294.134) (-291.469) (-289.976) * (-289.385) [-290.797] (-291.143) (-295.406) -- 0:00:40
663000 -- (-292.146) [-292.529] (-291.781) (-292.986) * (-292.659) (-294.152) (-291.081) [-290.128] -- 0:00:40
664000 -- [-289.655] (-290.151) (-290.621) (-289.604) * [-292.016] (-290.193) (-292.196) (-290.149) -- 0:00:40
665000 -- (-291.199) (-294.289) [-291.205] (-290.538) * (-295.025) (-292.024) [-291.311] (-290.837) -- 0:00:40
Average standard deviation of split frequencies: 0.013384
666000 -- (-291.415) (-289.885) [-289.791] (-293.093) * (-290.729) (-291.504) [-289.622] (-289.505) -- 0:00:40
667000 -- (-291.345) (-290.294) [-290.884] (-291.178) * (-291.128) (-290.370) [-290.615] (-291.297) -- 0:00:40
668000 -- (-291.606) (-294.308) [-290.650] (-291.890) * (-289.556) [-290.038] (-289.665) (-291.241) -- 0:00:40
669000 -- [-289.606] (-293.950) (-290.260) (-290.467) * (-290.207) (-290.983) (-290.473) [-294.408] -- 0:00:40
670000 -- (-291.778) [-291.869] (-290.308) (-291.289) * (-289.827) [-291.139] (-289.994) (-290.155) -- 0:00:39
Average standard deviation of split frequencies: 0.013674
671000 -- (-296.667) (-289.868) [-291.169] (-291.090) * (-294.493) (-292.722) [-289.530] (-289.981) -- 0:00:39
672000 -- (-295.208) (-291.115) (-291.621) [-293.030] * (-293.465) [-290.268] (-290.302) (-294.181) -- 0:00:39
673000 -- [-292.289] (-289.789) (-290.612) (-289.584) * [-289.807] (-291.321) (-292.574) (-290.461) -- 0:00:39
674000 -- (-291.913) (-291.042) (-290.475) [-291.325] * (-292.602) (-294.988) [-290.050] (-292.356) -- 0:00:39
675000 -- (-290.470) [-293.453] (-291.688) (-291.676) * (-292.853) (-294.556) [-289.539] (-291.010) -- 0:00:39
Average standard deviation of split frequencies: 0.013714
676000 -- (-290.862) [-292.495] (-289.160) (-291.082) * (-290.894) [-289.558] (-290.565) (-289.098) -- 0:00:39
677000 -- [-290.359] (-291.310) (-293.581) (-291.023) * [-289.902] (-294.073) (-292.000) (-291.944) -- 0:00:39
678000 -- (-290.197) [-292.748] (-290.017) (-290.004) * (-293.291) [-291.544] (-292.064) (-293.810) -- 0:00:38
679000 -- (-297.233) [-291.361] (-290.462) (-290.765) * (-298.560) [-289.778] (-290.711) (-290.206) -- 0:00:38
680000 -- (-293.965) [-291.086] (-298.525) (-290.571) * [-290.573] (-291.909) (-292.355) (-290.152) -- 0:00:38
Average standard deviation of split frequencies: 0.013436
681000 -- (-292.679) (-290.505) (-293.120) [-291.234] * (-293.063) [-292.498] (-291.204) (-293.315) -- 0:00:38
682000 -- (-290.627) [-289.350] (-292.044) (-293.827) * (-290.383) (-292.663) (-293.787) [-289.767] -- 0:00:38
683000 -- (-292.841) (-291.915) [-295.965] (-290.435) * [-291.514] (-293.541) (-293.030) (-289.401) -- 0:00:38
684000 -- (-291.929) [-291.547] (-292.945) (-293.547) * (-290.027) (-290.540) (-289.734) [-292.930] -- 0:00:38
685000 -- (-296.097) (-288.975) [-290.459] (-294.359) * (-289.708) (-291.285) (-291.038) [-294.076] -- 0:00:38
Average standard deviation of split frequencies: 0.013263
686000 -- (-292.093) (-294.129) [-292.729] (-289.603) * (-295.539) (-290.369) [-290.949] (-295.383) -- 0:00:37
687000 -- (-291.317) (-293.702) [-291.162] (-296.813) * (-293.817) (-293.606) [-292.984] (-292.238) -- 0:00:37
688000 -- [-291.084] (-289.700) (-293.257) (-291.207) * (-290.364) (-289.841) [-293.125] (-291.437) -- 0:00:37
689000 -- [-289.459] (-291.056) (-291.103) (-289.847) * [-289.076] (-293.750) (-297.357) (-291.243) -- 0:00:37
690000 -- [-292.001] (-293.924) (-292.668) (-290.177) * (-291.039) (-290.262) (-292.139) [-290.506] -- 0:00:37
Average standard deviation of split frequencies: 0.013036
691000 -- [-293.998] (-297.978) (-291.301) (-292.165) * (-290.848) [-293.534] (-290.862) (-291.434) -- 0:00:37
692000 -- (-293.652) (-291.257) [-292.009] (-290.681) * (-291.341) (-289.959) [-290.381] (-290.752) -- 0:00:37
693000 -- (-294.187) (-291.240) (-290.634) [-292.097] * (-293.468) (-290.639) (-292.841) [-291.692] -- 0:00:37
694000 -- [-292.571] (-291.388) (-293.732) (-290.449) * (-298.689) (-290.920) (-290.707) [-290.337] -- 0:00:37
695000 -- (-291.602) [-290.851] (-293.016) (-293.114) * (-294.379) [-291.706] (-291.175) (-289.834) -- 0:00:36
Average standard deviation of split frequencies: 0.013004
696000 -- (-289.592) (-295.205) [-290.210] (-290.177) * (-290.397) (-291.059) (-292.906) [-289.897] -- 0:00:36
697000 -- (-291.376) (-290.483) [-291.607] (-294.312) * [-293.391] (-289.451) (-295.775) (-291.082) -- 0:00:36
698000 -- (-293.124) (-291.947) [-289.371] (-290.916) * (-293.077) (-291.410) [-289.280] (-290.949) -- 0:00:36
699000 -- [-292.587] (-291.837) (-292.020) (-291.378) * (-291.148) [-290.527] (-290.323) (-290.573) -- 0:00:36
700000 -- (-298.051) [-291.935] (-292.845) (-289.349) * (-293.695) (-294.425) (-294.035) [-290.655] -- 0:00:36
Average standard deviation of split frequencies: 0.012581
701000 -- (-290.412) (-290.494) [-289.075] (-290.182) * (-291.725) (-290.598) (-292.006) [-289.695] -- 0:00:36
702000 -- [-290.587] (-290.720) (-290.958) (-290.064) * (-289.759) (-293.097) (-294.250) [-290.259] -- 0:00:36
703000 -- (-289.867) (-289.746) (-292.689) [-293.079] * [-294.940] (-293.713) (-294.281) (-290.295) -- 0:00:35
704000 -- (-292.811) (-293.793) (-290.907) [-291.418] * (-290.395) [-289.829] (-293.073) (-293.690) -- 0:00:35
705000 -- (-290.977) [-290.119] (-289.990) (-290.250) * [-291.279] (-292.162) (-293.146) (-296.145) -- 0:00:35
Average standard deviation of split frequencies: 0.011574
706000 -- [-292.706] (-289.537) (-290.283) (-289.695) * (-293.509) (-295.505) (-292.774) [-292.363] -- 0:00:35
707000 -- [-291.317] (-290.870) (-289.786) (-291.363) * (-293.634) [-291.245] (-290.563) (-293.961) -- 0:00:35
708000 -- [-292.595] (-289.729) (-292.525) (-289.918) * (-293.596) (-293.711) [-293.243] (-291.922) -- 0:00:35
709000 -- [-291.458] (-289.602) (-292.424) (-296.078) * (-291.867) [-291.237] (-292.066) (-292.049) -- 0:00:35
710000 -- (-292.275) (-290.420) (-290.948) [-290.492] * (-292.472) (-294.050) [-289.729] (-291.947) -- 0:00:35
Average standard deviation of split frequencies: 0.013349
711000 -- [-292.206] (-291.688) (-293.824) (-289.606) * (-289.087) [-294.694] (-291.373) (-291.704) -- 0:00:34
712000 -- (-289.957) (-290.944) (-297.039) [-291.152] * (-293.389) [-296.278] (-289.285) (-291.291) -- 0:00:34
713000 -- (-293.302) (-293.143) (-289.825) [-292.340] * (-291.680) (-290.176) (-290.739) [-291.321] -- 0:00:34
714000 -- (-295.800) [-291.120] (-289.726) (-293.422) * (-292.272) (-289.183) (-289.776) [-291.807] -- 0:00:34
715000 -- (-290.188) [-292.579] (-290.643) (-291.168) * [-290.538] (-292.598) (-291.097) (-292.515) -- 0:00:34
Average standard deviation of split frequencies: 0.012921
716000 -- [-291.287] (-291.053) (-291.513) (-291.121) * [-289.817] (-289.614) (-291.374) (-293.909) -- 0:00:34
717000 -- [-293.057] (-293.253) (-292.505) (-290.180) * (-290.805) [-294.632] (-290.019) (-293.610) -- 0:00:34
718000 -- (-289.464) [-292.892] (-289.074) (-289.487) * (-292.879) [-290.893] (-295.210) (-291.032) -- 0:00:34
719000 -- (-291.887) (-290.442) (-289.576) [-292.432] * (-290.184) [-291.798] (-289.485) (-290.485) -- 0:00:34
720000 -- (-291.643) (-292.796) [-292.244] (-291.735) * (-292.182) (-292.825) (-292.510) [-289.616] -- 0:00:33
Average standard deviation of split frequencies: 0.012646
721000 -- (-292.804) (-292.491) [-291.757] (-291.032) * (-291.428) (-291.758) [-290.609] (-291.545) -- 0:00:33
722000 -- (-290.389) (-293.298) [-290.713] (-294.649) * (-295.494) [-290.339] (-296.768) (-295.366) -- 0:00:33
723000 -- (-291.823) (-293.010) (-289.937) [-290.862] * [-297.158] (-294.158) (-291.364) (-292.284) -- 0:00:33
724000 -- (-292.346) (-289.949) (-291.496) [-290.472] * (-290.403) [-292.650] (-290.109) (-291.510) -- 0:00:33
725000 -- (-289.905) (-290.498) (-289.793) [-290.774] * (-289.451) (-290.438) [-289.213] (-289.646) -- 0:00:33
Average standard deviation of split frequencies: 0.011806
726000 -- [-290.184] (-292.511) (-291.017) (-291.687) * (-290.135) (-291.654) (-289.267) [-289.831] -- 0:00:33
727000 -- (-289.155) (-294.094) (-292.069) [-292.413] * (-290.252) (-290.787) [-290.768] (-291.664) -- 0:00:33
728000 -- [-292.128] (-291.054) (-293.522) (-290.418) * (-292.112) (-297.135) (-292.996) [-290.283] -- 0:00:32
729000 -- (-292.092) (-290.904) [-292.959] (-294.502) * (-289.341) [-290.417] (-295.112) (-290.157) -- 0:00:32
730000 -- (-292.072) (-290.432) [-290.395] (-294.604) * (-290.182) [-290.240] (-298.464) (-293.533) -- 0:00:32
Average standard deviation of split frequencies: 0.011900
731000 -- (-294.135) [-289.036] (-293.319) (-291.609) * (-290.623) (-289.303) (-292.556) [-290.844] -- 0:00:32
732000 -- [-291.325] (-289.448) (-291.547) (-290.094) * (-290.894) (-291.916) (-293.408) [-292.127] -- 0:00:32
733000 -- (-291.716) (-290.848) [-290.208] (-289.220) * [-290.830] (-294.203) (-291.536) (-297.905) -- 0:00:32
734000 -- (-291.197) (-290.900) (-289.189) [-291.216] * [-292.114] (-291.659) (-290.180) (-291.898) -- 0:00:32
735000 -- (-291.269) [-291.686] (-291.155) (-290.191) * [-290.252] (-290.799) (-290.955) (-289.672) -- 0:00:32
Average standard deviation of split frequencies: 0.012739
736000 -- (-291.179) (-292.913) (-290.203) [-290.602] * (-291.328) (-291.748) (-291.434) [-294.723] -- 0:00:31
737000 -- (-294.928) (-290.634) [-290.734] (-293.811) * [-293.469] (-290.414) (-293.034) (-290.598) -- 0:00:31
738000 -- (-293.661) (-290.334) (-289.507) [-289.697] * [-289.535] (-290.284) (-292.613) (-292.548) -- 0:00:31
739000 -- (-290.480) [-289.417] (-292.880) (-291.225) * (-291.436) (-291.110) (-290.134) [-290.196] -- 0:00:31
740000 -- [-289.939] (-290.539) (-290.852) (-290.468) * (-290.885) (-290.606) [-290.788] (-289.642) -- 0:00:31
Average standard deviation of split frequencies: 0.012172
741000 -- (-293.755) [-293.250] (-291.900) (-292.582) * (-291.926) (-291.818) (-291.067) [-291.339] -- 0:00:31
742000 -- (-291.074) [-289.459] (-290.336) (-290.310) * (-291.496) [-292.338] (-292.540) (-295.109) -- 0:00:31
743000 -- (-290.461) [-290.282] (-290.656) (-290.022) * (-290.200) (-292.085) [-292.265] (-291.251) -- 0:00:31
744000 -- (-292.987) [-291.127] (-289.665) (-290.319) * (-292.518) (-289.764) (-291.369) [-292.366] -- 0:00:30
745000 -- (-289.979) [-289.621] (-293.180) (-289.458) * (-289.284) [-290.407] (-291.442) (-292.481) -- 0:00:30
Average standard deviation of split frequencies: 0.011259
746000 -- (-291.974) [-292.564] (-290.678) (-294.966) * (-293.384) (-296.029) [-293.509] (-290.522) -- 0:00:30
747000 -- (-292.061) [-292.883] (-294.225) (-290.092) * (-290.900) [-294.784] (-293.244) (-292.230) -- 0:00:30
748000 -- (-292.570) [-290.849] (-292.442) (-289.465) * (-294.665) (-291.641) [-290.038] (-294.934) -- 0:00:30
749000 -- (-289.680) [-290.123] (-290.893) (-294.957) * [-289.791] (-289.345) (-291.940) (-290.146) -- 0:00:30
750000 -- (-291.352) [-292.273] (-290.935) (-290.023) * (-290.497) (-291.892) (-291.419) [-292.026] -- 0:00:30
Average standard deviation of split frequencies: 0.009978
751000 -- (-290.469) [-292.748] (-296.342) (-292.019) * [-296.462] (-290.478) (-295.387) (-290.248) -- 0:00:30
752000 -- (-290.537) [-290.639] (-290.589) (-292.392) * [-292.797] (-291.359) (-297.893) (-292.056) -- 0:00:30
753000 -- (-291.194) [-291.706] (-289.734) (-289.910) * (-289.708) [-293.573] (-290.904) (-289.776) -- 0:00:29
754000 -- (-292.920) [-291.246] (-289.640) (-290.165) * [-292.741] (-292.565) (-293.562) (-293.683) -- 0:00:29
755000 -- (-291.596) [-295.472] (-289.865) (-291.467) * (-292.930) (-290.987) (-290.901) [-291.305] -- 0:00:29
Average standard deviation of split frequencies: 0.010323
756000 -- (-292.619) [-292.926] (-290.112) (-290.974) * [-293.300] (-289.452) (-290.518) (-291.678) -- 0:00:29
757000 -- (-295.983) [-290.120] (-289.455) (-290.508) * (-290.955) (-290.907) [-290.973] (-291.501) -- 0:00:29
758000 -- (-292.495) [-290.463] (-292.909) (-293.650) * (-289.617) (-294.116) [-290.607] (-289.459) -- 0:00:29
759000 -- (-290.995) [-289.904] (-292.646) (-298.251) * (-292.972) (-289.402) (-292.421) [-291.300] -- 0:00:29
760000 -- (-290.999) [-296.851] (-290.504) (-292.420) * [-291.432] (-293.878) (-292.782) (-289.893) -- 0:00:29
Average standard deviation of split frequencies: 0.011620
761000 -- (-290.063) [-290.083] (-290.161) (-291.621) * [-293.006] (-292.481) (-292.553) (-293.152) -- 0:00:28
762000 -- (-292.443) [-289.492] (-294.112) (-291.756) * [-290.741] (-293.700) (-289.551) (-292.341) -- 0:00:28
763000 -- (-290.699) [-292.132] (-291.217) (-293.223) * (-291.806) (-290.194) (-289.668) [-293.528] -- 0:00:28
764000 -- (-288.986) [-289.234] (-289.528) (-290.625) * (-291.077) (-291.326) (-290.187) [-292.739] -- 0:00:28
765000 -- (-292.315) [-291.126] (-291.209) (-290.319) * (-290.668) (-292.900) (-292.390) [-294.550] -- 0:00:28
Average standard deviation of split frequencies: 0.011324
766000 -- (-290.925) [-289.358] (-290.991) (-290.781) * [-289.476] (-292.151) (-290.954) (-290.976) -- 0:00:28
767000 -- (-293.638) [-290.050] (-290.514) (-290.415) * (-289.309) (-291.086) (-290.057) [-294.037] -- 0:00:28
768000 -- (-290.777) [-291.630] (-291.606) (-292.423) * [-290.102] (-290.003) (-290.290) (-291.193) -- 0:00:28
769000 -- (-290.695) [-293.701] (-290.783) (-289.850) * (-292.612) (-290.061) [-292.018] (-292.309) -- 0:00:27
770000 -- (-292.905) [-291.259] (-292.043) (-291.430) * (-294.078) [-289.803] (-291.777) (-292.579) -- 0:00:27
Average standard deviation of split frequencies: 0.011393
771000 -- (-294.600) [-291.523] (-294.295) (-289.558) * (-294.257) (-289.352) (-290.410) [-291.076] -- 0:00:27
772000 -- (-291.579) [-291.887] (-292.091) (-292.572) * [-290.176] (-289.773) (-289.157) (-293.882) -- 0:00:27
773000 -- (-291.088) [-290.991] (-293.873) (-291.146) * [-291.197] (-289.633) (-292.033) (-290.942) -- 0:00:27
774000 -- (-292.098) [-291.319] (-290.731) (-291.665) * (-293.140) (-293.313) (-291.033) [-291.233] -- 0:00:27
775000 -- (-293.997) [-290.208] (-289.106) (-294.115) * (-297.298) (-290.264) [-290.526] (-290.225) -- 0:00:27
Average standard deviation of split frequencies: 0.011390
776000 -- (-290.220) [-292.672] (-289.332) (-294.488) * (-294.429) [-289.647] (-292.318) (-291.204) -- 0:00:27
777000 -- [-290.767] (-298.140) (-291.112) (-294.069) * (-292.893) (-290.946) (-290.445) [-291.784] -- 0:00:26
778000 -- (-289.198) [-292.288] (-289.797) (-291.898) * (-292.881) (-293.067) [-290.762] (-293.056) -- 0:00:26
779000 -- (-292.108) [-292.025] (-292.103) (-293.872) * [-290.176] (-294.370) (-293.662) (-293.871) -- 0:00:26
780000 -- (-291.416) [-290.462] (-290.892) (-290.482) * (-291.418) (-292.219) [-291.158] (-290.822) -- 0:00:26
Average standard deviation of split frequencies: 0.010735
781000 -- (-290.865) [-290.819] (-290.804) (-297.020) * (-293.288) (-291.025) [-290.128] (-291.923) -- 0:00:26
782000 -- (-290.519) [-293.537] (-293.557) (-294.865) * (-296.274) (-292.149) [-291.478] (-292.150) -- 0:00:26
783000 -- (-290.250) [-293.041] (-290.637) (-292.902) * (-291.254) (-289.795) [-298.382] (-291.197) -- 0:00:26
784000 -- (-289.974) [-293.017] (-290.870) (-293.038) * (-290.273) [-293.251] (-289.364) (-290.794) -- 0:00:26
785000 -- (-291.064) [-290.480] (-291.764) (-290.935) * (-292.518) (-289.584) (-292.314) [-291.680] -- 0:00:26
Average standard deviation of split frequencies: 0.011928
786000 -- (-292.300) [-290.673] (-292.782) (-291.619) * (-292.009) (-290.403) (-292.204) [-289.886] -- 0:00:25
787000 -- (-294.349) [-290.492] (-290.907) (-292.895) * (-294.241) (-289.574) [-292.916] (-291.503) -- 0:00:25
788000 -- (-291.790) [-290.575] (-294.359) (-294.762) * (-289.627) (-289.824) (-290.117) [-290.204] -- 0:00:25
789000 -- (-289.512) [-289.557] (-292.781) (-296.206) * (-290.164) [-291.136] (-296.478) (-293.586) -- 0:00:25
790000 -- (-290.306) [-289.473] (-289.569) (-292.940) * (-292.996) [-292.520] (-291.326) (-292.883) -- 0:00:25
Average standard deviation of split frequencies: 0.011858
791000 -- (-290.739) [-293.643] (-293.061) (-292.137) * [-292.238] (-289.833) (-292.297) (-290.460) -- 0:00:25
792000 -- (-291.857) [-289.850] (-290.467) (-293.467) * (-290.386) [-294.326] (-290.457) (-289.380) -- 0:00:25
793000 -- (-294.256) [-291.652] (-290.059) (-289.587) * (-291.480) [-291.630] (-296.761) (-291.836) -- 0:00:25
794000 -- (-291.306) [-290.545] (-290.841) (-292.371) * (-289.305) [-289.099] (-292.515) (-290.286) -- 0:00:24
795000 -- (-294.413) [-293.417] (-297.178) (-290.542) * (-293.239) (-290.012) (-289.764) [-293.600] -- 0:00:24
Average standard deviation of split frequencies: 0.011474
796000 -- (-289.948) [-290.785] (-295.303) (-293.915) * (-290.916) (-291.621) [-292.819] (-293.573) -- 0:00:24
797000 -- (-293.151) [-289.912] (-291.855) (-293.355) * (-292.466) [-289.734] (-289.462) (-291.208) -- 0:00:24
798000 -- (-293.306) [-292.726] (-290.153) (-290.617) * (-291.388) (-289.848) (-290.426) [-294.454] -- 0:00:24
799000 -- (-290.145) [-289.509] (-291.515) (-290.369) * (-289.382) [-291.718] (-289.975) (-292.726) -- 0:00:24
800000 -- (-290.576) [-289.982] (-289.819) (-290.786) * (-290.157) [-290.965] (-290.358) (-292.202) -- 0:00:24
Average standard deviation of split frequencies: 0.012364
801000 -- (-291.959) [-291.850] (-293.497) (-290.748) * (-291.533) (-290.884) [-290.219] (-291.999) -- 0:00:24
802000 -- (-290.124) [-291.747] (-289.338) (-290.247) * (-290.834) (-292.516) [-291.732] (-292.929) -- 0:00:23
803000 -- (-290.990) [-293.765] (-289.994) (-296.598) * (-293.198) (-290.293) (-292.830) [-290.755] -- 0:00:23
804000 -- (-291.130) [-290.990] (-292.515) (-293.225) * (-291.580) [-292.000] (-293.927) (-291.371) -- 0:00:23
805000 -- (-291.604) [-291.225] (-295.645) (-292.750) * (-291.932) (-292.836) (-292.752) [-292.556] -- 0:00:23
Average standard deviation of split frequencies: 0.012355
806000 -- (-292.681) [-294.246] (-288.901) (-291.067) * (-291.132) [-289.227] (-293.136) (-290.054) -- 0:00:23
807000 -- (-294.432) [-289.147] (-290.494) (-291.676) * (-289.063) (-291.315) [-293.657] (-296.346) -- 0:00:23
808000 -- (-290.137) [-290.167] (-290.946) (-290.704) * (-291.509) (-294.078) (-292.283) [-291.064] -- 0:00:23
809000 -- (-289.804) [-290.834] (-291.356) (-289.355) * [-289.492] (-289.609) (-291.054) (-290.955) -- 0:00:23
810000 -- (-295.986) [-289.802] (-290.569) (-290.881) * (-292.377) (-293.821) [-290.054] (-290.173) -- 0:00:22
Average standard deviation of split frequencies: 0.011630
811000 -- (-291.624) [-293.815] (-291.744) (-289.676) * [-291.261] (-289.270) (-291.482) (-291.944) -- 0:00:22
812000 -- (-293.856) [-290.581] (-290.838) (-289.851) * (-291.452) (-293.520) [-289.606] (-291.288) -- 0:00:22
813000 -- (-293.814) (-290.848) [-290.430] (-290.932) * (-290.637) (-289.607) [-289.962] (-291.057) -- 0:00:22
814000 -- (-292.511) (-293.882) [-291.053] (-292.687) * (-291.368) (-291.325) (-294.659) [-289.851] -- 0:00:22
815000 -- (-291.848) (-294.055) [-293.149] (-292.787) * [-289.368] (-292.385) (-297.971) (-290.457) -- 0:00:22
Average standard deviation of split frequencies: 0.009491
816000 -- [-292.519] (-291.105) (-290.994) (-292.637) * (-293.631) (-293.304) (-297.911) [-290.005] -- 0:00:22
817000 -- (-290.731) (-290.275) [-290.274] (-291.234) * (-290.531) (-294.564) [-291.141] (-292.148) -- 0:00:22
818000 -- (-293.712) [-291.128] (-291.978) (-290.249) * (-293.640) (-293.683) [-291.959] (-293.206) -- 0:00:22
819000 -- (-291.679) [-291.463] (-294.679) (-291.784) * [-292.394] (-291.893) (-290.864) (-290.604) -- 0:00:21
820000 -- (-290.493) (-292.494) (-293.385) [-290.785] * (-290.849) [-289.386] (-290.869) (-292.620) -- 0:00:21
Average standard deviation of split frequencies: 0.011425
821000 -- (-290.669) (-292.911) [-292.027] (-290.835) * (-291.198) (-294.406) [-293.534] (-289.847) -- 0:00:21
822000 -- (-289.291) [-291.111] (-295.100) (-293.206) * (-291.501) (-292.297) [-290.870] (-289.402) -- 0:00:21
823000 -- (-290.172) [-291.131] (-289.494) (-295.158) * (-289.720) [-294.020] (-290.567) (-289.990) -- 0:00:21
824000 -- [-290.953] (-290.540) (-292.613) (-296.887) * (-289.246) (-289.977) [-293.445] (-291.667) -- 0:00:21
825000 -- (-289.767) (-291.080) (-292.874) [-291.285] * [-292.220] (-294.209) (-289.987) (-293.817) -- 0:00:21
Average standard deviation of split frequencies: 0.011541
826000 -- [-290.902] (-290.921) (-290.924) (-291.859) * (-291.526) [-291.757] (-290.038) (-293.797) -- 0:00:21
827000 -- (-291.880) (-293.447) (-290.518) [-290.870] * (-293.095) (-291.005) [-293.440] (-291.062) -- 0:00:20
828000 -- (-290.010) (-292.003) [-291.263] (-293.966) * (-292.256) [-289.714] (-292.676) (-293.659) -- 0:00:20
829000 -- (-289.738) [-290.042] (-290.848) (-289.781) * (-291.064) [-293.529] (-290.747) (-291.467) -- 0:00:20
830000 -- (-292.622) (-290.380) (-293.593) [-291.016] * [-292.800] (-292.012) (-290.640) (-291.219) -- 0:00:20
Average standard deviation of split frequencies: 0.011563
831000 -- (-292.731) [-289.749] (-297.799) (-289.677) * (-297.412) [-289.355] (-294.473) (-295.204) -- 0:00:20
832000 -- [-291.188] (-290.820) (-292.223) (-293.601) * (-291.218) (-290.536) (-290.954) [-291.856] -- 0:00:20
833000 -- (-289.773) (-290.827) (-289.954) [-291.028] * (-291.404) (-293.078) (-294.136) [-293.191] -- 0:00:20
834000 -- (-291.425) (-290.997) (-290.858) [-290.351] * (-289.444) [-289.009] (-297.734) (-292.212) -- 0:00:20
835000 -- [-290.071] (-290.367) (-292.254) (-290.518) * (-290.042) [-291.188] (-292.712) (-290.670) -- 0:00:19
Average standard deviation of split frequencies: 0.011348
836000 -- (-291.855) (-290.197) (-293.672) [-295.099] * (-290.314) [-294.285] (-291.159) (-289.312) -- 0:00:19
837000 -- (-290.395) (-291.756) [-293.864] (-294.167) * [-289.431] (-289.353) (-290.569) (-290.625) -- 0:00:19
838000 -- (-292.150) (-290.393) (-291.658) [-289.778] * (-289.915) (-292.343) [-291.112] (-290.358) -- 0:00:19
839000 -- [-294.087] (-295.363) (-291.494) (-290.631) * (-291.465) (-291.315) (-293.868) [-290.681] -- 0:00:19
840000 -- [-290.807] (-292.447) (-296.173) (-293.158) * [-291.752] (-293.928) (-291.046) (-295.148) -- 0:00:19
Average standard deviation of split frequencies: 0.011495
841000 -- (-289.566) (-289.923) (-289.664) [-292.219] * (-290.515) (-291.980) [-289.519] (-293.363) -- 0:00:19
842000 -- (-291.245) [-292.023] (-290.320) (-291.787) * (-291.273) (-290.092) (-291.796) [-289.244] -- 0:00:19
843000 -- (-291.603) (-293.036) (-294.548) [-291.005] * [-289.806] (-293.201) (-290.333) (-294.462) -- 0:00:18
844000 -- (-292.061) (-294.448) [-291.159] (-291.564) * [-290.652] (-289.064) (-291.381) (-289.917) -- 0:00:18
845000 -- (-294.818) [-292.806] (-290.117) (-291.107) * (-291.643) (-292.120) (-290.743) [-290.731] -- 0:00:18
Average standard deviation of split frequencies: 0.010339
846000 -- (-295.275) (-290.677) [-290.157] (-290.679) * (-293.561) (-293.046) (-292.839) [-296.260] -- 0:00:18
847000 -- (-292.790) (-289.693) [-290.970] (-293.492) * (-292.665) [-290.770] (-290.805) (-297.878) -- 0:00:18
848000 -- (-292.286) (-298.260) (-295.437) [-290.640] * (-297.434) [-289.884] (-289.887) (-291.044) -- 0:00:18
849000 -- (-296.081) [-293.343] (-295.913) (-289.319) * (-299.961) (-289.729) [-289.565] (-290.883) -- 0:00:18
850000 -- (-291.053) [-291.318] (-290.480) (-291.437) * (-291.477) (-291.003) (-293.294) [-290.899] -- 0:00:18
Average standard deviation of split frequencies: 0.011222
851000 -- (-293.372) (-289.413) [-290.542] (-291.620) * (-289.108) [-292.926] (-294.431) (-292.451) -- 0:00:18
852000 -- (-291.019) [-291.699] (-290.103) (-295.066) * [-291.267] (-290.102) (-296.300) (-290.775) -- 0:00:17
853000 -- [-293.896] (-292.994) (-289.942) (-290.380) * [-292.302] (-299.884) (-289.446) (-289.981) -- 0:00:17
854000 -- (-292.994) [-289.867] (-290.415) (-290.417) * (-291.549) (-291.520) [-289.491] (-293.442) -- 0:00:17
855000 -- (-291.943) (-296.111) (-290.769) [-291.080] * (-290.648) (-289.638) (-291.368) [-290.913] -- 0:00:17
Average standard deviation of split frequencies: 0.010149
856000 -- [-292.279] (-291.497) (-293.459) (-291.275) * (-291.200) [-289.130] (-291.050) (-290.254) -- 0:00:17
857000 -- [-291.309] (-291.377) (-290.622) (-290.722) * (-289.742) (-291.053) [-290.700] (-293.335) -- 0:00:17
858000 -- (-295.513) (-289.705) [-294.628] (-292.178) * [-290.083] (-293.658) (-291.594) (-292.261) -- 0:00:17
859000 -- (-290.598) (-293.126) [-290.479] (-295.885) * (-294.244) (-289.944) [-292.258] (-293.867) -- 0:00:17
860000 -- (-296.335) (-289.199) (-291.036) [-289.790] * [-289.936] (-291.380) (-298.015) (-295.527) -- 0:00:16
Average standard deviation of split frequencies: 0.009859
861000 -- (-292.217) [-290.699] (-291.244) (-290.812) * (-290.511) (-290.209) [-292.071] (-291.878) -- 0:00:16
862000 -- (-294.779) (-289.651) (-291.543) [-293.751] * (-290.638) [-293.321] (-295.792) (-291.476) -- 0:00:16
863000 -- [-289.250] (-296.080) (-290.957) (-290.097) * (-295.603) [-290.357] (-295.052) (-290.507) -- 0:00:16
864000 -- [-290.861] (-294.310) (-296.264) (-293.004) * (-289.693) (-289.947) (-292.700) [-290.582] -- 0:00:16
865000 -- (-290.655) (-290.221) (-293.080) [-289.891] * [-290.228] (-292.296) (-292.302) (-292.447) -- 0:00:16
Average standard deviation of split frequencies: 0.009556
866000 -- (-290.943) (-292.424) [-290.688] (-290.525) * (-291.063) (-295.705) [-289.887] (-289.595) -- 0:00:16
867000 -- [-289.912] (-293.566) (-295.920) (-290.771) * (-289.625) (-290.445) (-294.075) [-293.923] -- 0:00:16
868000 -- [-291.302] (-292.436) (-290.983) (-294.780) * [-289.718] (-290.039) (-293.341) (-290.746) -- 0:00:15
869000 -- [-291.601] (-293.556) (-290.020) (-290.455) * [-289.647] (-292.634) (-293.853) (-289.229) -- 0:00:15
870000 -- (-293.344) [-290.765] (-290.165) (-290.203) * (-289.745) (-290.013) (-292.444) [-290.359] -- 0:00:15
Average standard deviation of split frequencies: 0.008422
871000 -- (-292.345) [-292.194] (-290.184) (-291.514) * [-290.261] (-290.959) (-289.623) (-291.671) -- 0:00:15
872000 -- (-295.016) (-293.089) [-291.634] (-290.696) * (-295.914) (-290.628) (-291.457) [-292.093] -- 0:00:15
873000 -- (-291.083) (-290.365) (-292.464) [-291.608] * (-292.054) (-294.689) (-293.331) [-290.781] -- 0:00:15
874000 -- (-295.178) (-292.251) [-293.244] (-302.165) * [-290.312] (-291.235) (-294.266) (-295.148) -- 0:00:15
875000 -- (-292.667) [-290.818] (-294.070) (-294.797) * (-291.142) [-292.335] (-293.190) (-289.558) -- 0:00:15
Average standard deviation of split frequencies: 0.009456
876000 -- (-290.843) (-292.080) [-294.558] (-289.678) * (-294.162) [-290.581] (-292.071) (-293.773) -- 0:00:15
877000 -- (-292.215) (-290.555) [-290.208] (-291.583) * (-291.798) (-290.850) (-290.031) [-289.884] -- 0:00:14
878000 -- (-291.103) (-290.089) [-291.758] (-291.011) * [-289.757] (-291.729) (-289.320) (-290.376) -- 0:00:14
879000 -- [-301.178] (-293.293) (-292.367) (-291.604) * (-290.496) [-289.284] (-290.218) (-295.324) -- 0:00:14
880000 -- [-294.460] (-293.958) (-293.464) (-289.210) * (-290.773) (-292.808) (-290.104) [-289.610] -- 0:00:14
Average standard deviation of split frequencies: 0.010037
881000 -- (-291.170) (-292.455) [-291.994] (-290.528) * (-290.479) (-290.797) (-294.542) [-290.475] -- 0:00:14
882000 -- (-290.591) [-293.761] (-292.774) (-291.104) * (-289.753) (-292.846) (-291.674) [-291.550] -- 0:00:14
883000 -- (-295.824) (-293.756) [-289.741] (-289.642) * (-291.613) (-290.592) (-294.378) [-289.728] -- 0:00:14
884000 -- [-290.045] (-291.944) (-289.217) (-294.514) * (-291.956) (-291.493) (-293.823) [-289.758] -- 0:00:14
885000 -- (-292.552) (-292.817) (-292.020) [-293.328] * (-290.838) (-290.911) (-291.278) [-290.018] -- 0:00:13
Average standard deviation of split frequencies: 0.011173
886000 -- (-289.488) [-293.070] (-290.942) (-294.526) * (-295.000) [-291.304] (-288.975) (-291.307) -- 0:00:13
887000 -- [-289.207] (-290.704) (-293.966) (-291.569) * (-293.109) (-291.482) [-292.024] (-291.275) -- 0:00:13
888000 -- (-289.458) (-289.268) (-291.294) [-293.263] * (-293.006) (-295.193) (-294.488) [-289.110] -- 0:00:13
889000 -- [-292.198] (-294.214) (-291.997) (-291.377) * [-289.104] (-291.046) (-290.859) (-292.337) -- 0:00:13
890000 -- (-292.109) (-292.537) (-291.495) [-290.241] * (-293.542) (-291.630) [-289.792] (-291.528) -- 0:00:13
Average standard deviation of split frequencies: 0.009593
891000 -- (-289.636) (-289.710) (-292.005) [-290.215] * (-290.193) [-289.376] (-297.309) (-294.577) -- 0:00:13
892000 -- (-290.109) (-296.141) [-289.518] (-292.297) * [-290.108] (-292.300) (-291.804) (-294.708) -- 0:00:13
893000 -- (-292.339) (-304.726) [-292.011] (-290.163) * (-296.692) (-292.859) [-291.293] (-293.922) -- 0:00:12
894000 -- (-290.002) (-293.433) [-293.935] (-294.156) * (-290.740) (-289.732) [-293.436] (-292.595) -- 0:00:12
895000 -- (-296.133) (-289.258) (-290.480) [-293.462] * (-290.650) [-291.163] (-289.569) (-289.791) -- 0:00:12
Average standard deviation of split frequencies: 0.009921
896000 -- [-293.093] (-294.520) (-289.884) (-291.789) * (-292.492) (-290.014) [-293.631] (-293.197) -- 0:00:12
897000 -- (-290.262) (-289.670) (-289.497) [-291.986] * (-292.473) [-291.352] (-294.071) (-291.560) -- 0:00:12
898000 -- (-295.350) (-291.936) (-291.343) [-290.112] * (-290.148) [-290.324] (-290.402) (-291.572) -- 0:00:12
899000 -- (-292.758) [-293.117] (-289.788) (-294.159) * (-290.375) (-293.598) [-291.876] (-289.325) -- 0:00:12
900000 -- [-290.699] (-294.025) (-289.982) (-290.369) * (-291.059) (-292.352) (-292.693) [-290.700] -- 0:00:12
Average standard deviation of split frequencies: 0.009720
901000 -- (-293.584) [-290.071] (-289.959) (-294.500) * (-291.000) (-289.842) (-290.901) [-294.000] -- 0:00:11
902000 -- (-296.690) (-290.778) (-291.791) [-290.935] * (-290.255) [-290.928] (-289.954) (-292.601) -- 0:00:11
903000 -- (-291.203) [-293.089] (-292.174) (-295.840) * (-291.757) (-289.630) (-292.483) [-289.760] -- 0:00:11
904000 -- (-296.345) (-294.503) [-291.943] (-296.250) * [-290.688] (-289.058) (-291.920) (-289.678) -- 0:00:11
905000 -- (-292.546) (-290.332) [-291.509] (-293.384) * [-290.953] (-290.621) (-289.570) (-289.639) -- 0:00:11
Average standard deviation of split frequencies: 0.009366
906000 -- (-293.198) (-291.526) [-291.180] (-291.195) * (-290.796) [-291.240] (-291.971) (-290.032) -- 0:00:11
907000 -- (-289.679) (-294.996) [-295.437] (-290.025) * (-289.488) [-291.910] (-291.801) (-290.553) -- 0:00:11
908000 -- (-292.390) (-290.310) [-291.111] (-293.462) * (-291.502) (-290.111) [-293.448] (-293.742) -- 0:00:11
909000 -- (-290.956) (-290.513) [-292.512] (-291.245) * (-291.371) [-293.517] (-291.139) (-291.401) -- 0:00:11
910000 -- (-290.239) (-290.942) [-290.205] (-290.854) * (-292.679) (-290.885) (-290.417) [-291.524] -- 0:00:10
Average standard deviation of split frequencies: 0.010123
911000 -- (-291.167) (-291.354) [-290.839] (-289.729) * [-291.691] (-291.042) (-291.900) (-290.695) -- 0:00:10
912000 -- (-292.975) (-293.492) [-290.965] (-291.449) * (-293.771) (-290.889) (-291.520) [-290.752] -- 0:00:10
913000 -- (-292.642) (-292.721) [-291.185] (-295.390) * (-295.366) [-289.239] (-292.339) (-290.547) -- 0:00:10
914000 -- (-292.958) (-289.304) [-292.953] (-291.535) * (-291.752) (-290.939) (-296.934) [-291.037] -- 0:00:10
915000 -- (-290.548) (-292.118) [-291.195] (-290.478) * [-289.709] (-289.654) (-290.127) (-291.631) -- 0:00:10
Average standard deviation of split frequencies: 0.009410
916000 -- (-295.630) (-289.718) [-295.866] (-290.377) * (-292.311) (-292.833) (-293.517) [-291.518] -- 0:00:10
917000 -- (-290.277) (-291.311) [-290.473] (-291.645) * (-291.072) [-289.972] (-289.857) (-289.300) -- 0:00:10
918000 -- (-289.805) (-289.344) [-290.496] (-294.611) * (-292.696) (-291.443) (-289.154) [-293.617] -- 0:00:09
919000 -- (-290.784) (-290.612) [-292.247] (-291.403) * (-291.514) (-290.864) (-290.517) [-290.590] -- 0:00:09
920000 -- (-290.471) (-291.603) [-291.088] (-291.892) * (-291.144) (-289.640) (-291.060) [-290.581] -- 0:00:09
Average standard deviation of split frequencies: 0.007936
921000 -- (-289.548) (-292.518) [-290.952] (-292.377) * (-291.103) [-290.617] (-291.983) (-291.501) -- 0:00:09
922000 -- (-291.090) (-290.609) [-290.206] (-291.589) * [-290.395] (-291.924) (-290.716) (-292.223) -- 0:00:09
923000 -- (-290.916) (-290.660) [-290.357] (-289.675) * (-291.376) (-291.601) [-292.238] (-290.091) -- 0:00:09
924000 -- (-291.830) (-291.625) [-290.404] (-290.469) * [-289.096] (-290.887) (-294.453) (-291.012) -- 0:00:09
925000 -- (-292.328) (-291.272) [-292.645] (-291.794) * (-290.356) (-290.261) (-292.752) [-290.793] -- 0:00:09
Average standard deviation of split frequencies: 0.009899
926000 -- (-289.746) (-292.244) [-292.119] (-290.629) * (-293.759) (-290.471) (-290.869) [-290.260] -- 0:00:08
927000 -- (-290.736) (-293.248) [-291.771] (-289.427) * [-289.590] (-290.973) (-295.733) (-290.015) -- 0:00:08
928000 -- (-291.026) (-293.053) [-294.630] (-291.456) * (-289.702) (-290.756) (-292.786) [-290.365] -- 0:00:08
929000 -- (-289.442) (-291.750) [-291.372] (-291.555) * [-292.524] (-291.957) (-290.579) (-296.451) -- 0:00:08
930000 -- (-291.547) (-295.381) [-292.212] (-291.743) * (-293.010) (-291.835) (-291.350) [-288.968] -- 0:00:08
Average standard deviation of split frequencies: 0.009117
931000 -- (-292.148) (-292.020) [-291.942] (-292.969) * (-291.138) (-290.881) [-290.729] (-291.476) -- 0:00:08
932000 -- (-296.700) (-290.181) [-290.911] (-292.989) * (-292.970) (-292.000) (-289.673) [-290.829] -- 0:00:08
933000 -- (-291.499) (-289.777) [-290.533] (-291.476) * [-292.000] (-289.766) (-294.083) (-289.590) -- 0:00:08
934000 -- (-290.153) (-290.560) [-290.623] (-297.143) * (-290.367) [-292.550] (-293.551) (-291.283) -- 0:00:07
935000 -- (-289.466) (-292.761) [-289.664] (-292.564) * (-294.012) [-289.823] (-291.850) (-293.467) -- 0:00:07
Average standard deviation of split frequencies: 0.009653
936000 -- (-292.638) (-290.177) [-290.717] (-293.992) * (-296.695) [-289.963] (-291.432) (-293.426) -- 0:00:07
937000 -- (-295.503) (-293.654) [-290.341] (-291.149) * [-290.221] (-293.072) (-289.285) (-293.139) -- 0:00:07
938000 -- (-291.680) (-294.548) [-290.712] (-289.448) * (-290.610) [-289.095] (-292.653) (-292.745) -- 0:00:07
939000 -- (-294.667) (-293.218) [-292.381] (-292.267) * (-290.953) [-290.376] (-289.877) (-291.217) -- 0:00:07
940000 -- (-290.928) (-290.189) [-291.959] (-292.850) * [-291.629] (-290.734) (-291.597) (-292.303) -- 0:00:07
Average standard deviation of split frequencies: 0.009522
941000 -- (-294.734) (-290.616) [-290.636] (-290.615) * (-291.130) (-290.677) (-292.354) [-290.842] -- 0:00:07
942000 -- (-290.010) (-291.058) [-293.367] (-289.794) * (-298.621) [-291.188] (-290.234) (-290.317) -- 0:00:07
943000 -- (-294.448) (-297.210) [-290.566] (-291.735) * (-295.014) [-289.093] (-290.092) (-290.228) -- 0:00:06
944000 -- (-291.708) (-289.907) [-289.794] (-290.425) * (-294.413) (-290.262) (-289.544) [-292.162] -- 0:00:06
945000 -- (-289.820) (-290.902) [-289.005] (-292.427) * [-291.866] (-292.489) (-291.530) (-291.895) -- 0:00:06
Average standard deviation of split frequencies: 0.009468
946000 -- (-294.509) (-289.629) [-290.380] (-291.074) * (-291.299) (-293.993) (-292.962) [-291.387] -- 0:00:06
947000 -- (-293.852) (-297.967) [-294.183] (-291.637) * (-291.739) (-289.987) (-295.589) [-290.710] -- 0:00:06
948000 -- (-294.569) (-293.646) [-290.485] (-294.282) * (-290.594) (-297.350) (-289.783) [-293.455] -- 0:00:06
949000 -- (-290.843) (-289.236) [-292.897] (-290.962) * [-291.816] (-295.043) (-291.629) (-295.503) -- 0:00:06
950000 -- (-292.266) (-289.107) [-291.096] (-296.690) * (-294.916) (-294.062) (-297.543) [-292.555] -- 0:00:06
Average standard deviation of split frequencies: 0.012298
951000 -- (-292.212) (-290.974) [-290.379] (-291.665) * (-292.056) (-289.745) (-291.103) [-289.722] -- 0:00:05
952000 -- (-291.703) (-292.247) [-292.938] (-289.821) * (-290.408) (-291.417) [-291.628] (-291.827) -- 0:00:05
953000 -- (-295.165) (-290.906) [-290.967] (-290.905) * (-293.081) (-290.131) (-293.672) [-290.705] -- 0:00:05
954000 -- (-291.995) (-294.345) [-292.022] (-289.551) * (-292.036) (-291.216) [-289.265] (-292.227) -- 0:00:05
955000 -- (-293.118) (-294.650) [-289.260] (-293.176) * [-292.239] (-289.524) (-291.039) (-293.012) -- 0:00:05
Average standard deviation of split frequencies: 0.010971
956000 -- (-294.752) (-293.369) [-290.178] (-292.029) * [-290.452] (-290.600) (-290.934) (-292.741) -- 0:00:05
957000 -- (-296.700) (-292.292) [-290.336] (-292.252) * (-294.939) [-292.086] (-292.701) (-290.131) -- 0:00:05
958000 -- (-292.444) (-290.986) [-290.161] (-292.020) * (-295.159) (-293.343) [-291.227] (-290.738) -- 0:00:05
959000 -- (-289.976) (-290.220) [-293.148] (-289.964) * (-290.956) (-294.676) (-294.301) [-292.955] -- 0:00:04
960000 -- (-297.547) (-292.177) [-292.701] (-293.060) * (-290.926) (-289.674) (-293.810) [-291.327] -- 0:00:04
Average standard deviation of split frequencies: 0.011164
961000 -- (-291.488) (-294.308) [-292.498] (-291.726) * (-290.193) (-289.783) [-290.486] (-291.269) -- 0:00:04
962000 -- (-291.050) (-292.163) [-289.143] (-290.444) * (-290.106) (-292.327) [-290.325] (-293.475) -- 0:00:04
963000 -- (-293.216) (-292.188) [-291.020] (-294.019) * (-293.948) (-290.145) (-292.563) [-290.190] -- 0:00:04
964000 -- (-296.586) (-291.338) [-290.526] (-292.793) * (-290.829) (-290.599) (-291.037) [-289.285] -- 0:00:04
965000 -- (-292.864) (-289.582) [-291.569] (-291.454) * [-290.162] (-292.727) (-291.305) (-291.449) -- 0:00:04
Average standard deviation of split frequencies: 0.013420
966000 -- (-290.509) (-295.213) [-289.674] (-290.599) * (-291.332) [-291.788] (-291.292) (-292.767) -- 0:00:04
967000 -- (-291.362) (-295.766) [-292.044] (-289.242) * (-289.571) (-291.051) [-294.857] (-290.518) -- 0:00:03
968000 -- (-291.180) (-291.377) [-291.075] (-291.233) * (-291.102) (-291.132) (-290.436) [-293.805] -- 0:00:03
969000 -- (-289.980) (-293.301) [-292.239] (-291.502) * (-290.524) (-293.518) (-290.783) [-291.473] -- 0:00:03
970000 -- (-291.035) (-290.421) [-290.854] (-293.564) * (-295.262) [-292.156] (-291.027) (-290.512) -- 0:00:03
Average standard deviation of split frequencies: 0.012280
971000 -- (-293.060) (-292.522) [-290.746] (-294.438) * (-291.077) (-290.271) [-291.704] (-290.835) -- 0:00:03
972000 -- (-290.122) (-292.603) [-290.374] (-293.737) * (-292.514) [-293.393] (-292.180) (-289.752) -- 0:00:03
973000 -- (-292.341) (-289.171) [-289.533] (-289.716) * [-292.457] (-290.750) (-289.601) (-291.349) -- 0:00:03
974000 -- (-290.593) (-291.669) [-289.685] (-289.040) * (-294.040) (-293.158) [-291.325] (-290.255) -- 0:00:03
975000 -- (-294.424) (-294.130) [-292.614] (-289.955) * (-290.764) (-294.285) [-292.977] (-292.058) -- 0:00:03
Average standard deviation of split frequencies: 0.011350
976000 -- (-289.097) [-289.637] (-292.925) (-292.541) * (-289.541) [-289.806] (-291.522) (-292.512) -- 0:00:02
977000 -- (-292.292) (-293.024) (-292.299) [-293.192] * (-290.628) (-289.744) [-295.744] (-290.863) -- 0:00:02
978000 -- (-291.996) (-290.161) [-291.875] (-289.128) * [-289.446] (-290.426) (-294.098) (-290.575) -- 0:00:02
979000 -- [-291.312] (-292.572) (-292.572) (-289.877) * (-294.185) (-291.228) [-289.826] (-289.556) -- 0:00:02
980000 -- (-290.877) (-291.353) [-290.583] (-295.252) * (-289.404) [-291.820] (-290.973) (-290.732) -- 0:00:02
Average standard deviation of split frequencies: 0.012787
981000 -- (-293.980) [-289.763] (-291.645) (-293.434) * (-290.693) (-289.621) (-292.633) [-290.413] -- 0:00:02
982000 -- (-291.578) (-290.625) [-292.187] (-293.624) * (-290.677) [-292.062] (-292.549) (-289.664) -- 0:00:02
983000 -- (-292.640) (-289.101) (-291.818) [-292.386] * (-293.743) (-289.446) [-289.514] (-289.951) -- 0:00:02
984000 -- (-290.810) (-290.050) (-294.958) [-294.522] * (-294.196) [-289.612] (-291.806) (-291.212) -- 0:00:01
985000 -- (-295.774) [-293.380] (-291.092) (-290.244) * (-294.165) (-294.895) [-290.985] (-289.818) -- 0:00:01
Average standard deviation of split frequencies: 0.012431
986000 -- [-292.493] (-292.775) (-291.596) (-291.340) * (-290.128) [-290.089] (-290.989) (-290.475) -- 0:00:01
987000 -- (-290.460) (-291.898) (-291.683) [-289.870] * (-291.238) (-289.585) (-293.493) [-290.490] -- 0:00:01
988000 -- [-291.827] (-291.051) (-290.072) (-290.642) * (-292.744) (-292.651) (-291.997) [-290.111] -- 0:00:01
989000 -- [-291.593] (-289.991) (-291.213) (-291.572) * [-291.038] (-293.670) (-291.506) (-291.054) -- 0:00:01
990000 -- (-290.149) (-290.290) [-290.776] (-289.697) * (-293.924) [-292.064] (-291.203) (-292.547) -- 0:00:01
Average standard deviation of split frequencies: 0.010278
991000 -- (-294.281) [-291.515] (-290.049) (-292.598) * [-289.801] (-293.026) (-293.583) (-293.587) -- 0:00:01
992000 -- (-291.155) (-289.679) [-290.936] (-291.509) * (-293.928) [-291.795] (-288.933) (-293.736) -- 0:00:00
993000 -- (-291.332) (-292.931) (-289.563) [-290.909] * (-292.287) (-291.242) (-289.932) [-289.321] -- 0:00:00
994000 -- (-292.982) (-292.013) [-289.835] (-291.519) * [-295.046] (-291.265) (-291.338) (-291.035) -- 0:00:00
995000 -- [-290.148] (-291.865) (-292.951) (-291.985) * (-290.579) [-290.883] (-290.340) (-290.168) -- 0:00:00
Average standard deviation of split frequencies: 0.010318
996000 -- (-293.121) (-293.297) (-293.300) [-290.738] * (-290.073) (-291.304) [-291.365] (-291.673) -- 0:00:00
997000 -- (-292.901) [-293.582] (-289.304) (-292.577) * (-295.042) (-291.398) (-291.031) [-291.381] -- 0:00:00
998000 -- (-289.998) (-292.996) (-289.749) [-289.936] * (-292.188) (-292.815) (-291.771) [-291.595] -- 0:00:00
999000 -- [-293.375] (-290.178) (-290.914) (-290.372) * (-289.292) [-290.163] (-291.824) (-290.939) -- 0:00:00
1000000 -- (-290.823) (-290.339) [-291.473] (-295.876) * (-292.990) (-290.446) [-292.449] (-290.708) -- 0:00:00
Average standard deviation of split frequencies: 0.012625
Analysis completed in 2 mins 1 seconds
Analysis used 120.64 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -288.86
Likelihood of best state for "cold" chain of run 2 was -288.86
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
77.0 % ( 69 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
46.8 % ( 30 %) Dirichlet(Pi{all})
45.5 % ( 31 %) Slider(Pi{all})
81.1 % ( 62 %) Multiplier(Alpha{1,2})
79.9 % ( 55 %) Multiplier(Alpha{3})
44.3 % ( 16 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
98.3 % ( 97 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
93.0 % ( 94 %) ParsSPR(Tau{all},V{all})
27.9 % ( 29 %) Multiplier(V{all})
96.7 % ( 98 %) Nodeslider(V{all})
41.2 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
77.5 % ( 76 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
46.2 % ( 31 %) Dirichlet(Pi{all})
43.2 % ( 25 %) Slider(Pi{all})
81.5 % ( 58 %) Multiplier(Alpha{1,2})
80.3 % ( 55 %) Multiplier(Alpha{3})
34.5 % ( 26 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
98.3 % ( 98 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
93.0 % ( 99 %) ParsSPR(Tau{all},V{all})
27.9 % ( 27 %) Multiplier(V{all})
96.7 % ( 97 %) Nodeslider(V{all})
41.2 % ( 18 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.31 0.13 0.05
2 | 167096 0.57 0.32
3 | 165760 167107 0.66
4 | 166738 166773 166526
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.36 0.15 0.07
2 | 166535 0.58 0.32
3 | 167369 166827 0.66
4 | 165764 166766 166739
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -290.60
| 2 2 |
| 2 |
| 2 1 12 2 1 |
| 1 1 1 1 1 1 2 1 2 1|
| 2 1 1 1 222 2 1 *12 1 2 2 112 2 2 |
|2* 1 1 2 * 2 12 * 2|
|1 1 2 2 1 2 221 1 2 21 2 1 |
| 122 2 11 2 2 1 2 111 1 2 |
| 122 22* 1 1 2 1 1 2 2 1 12 |
| 1 1 2 1 1 |
| 1 1 1 1 |
| 1 * 2 2 |
| 2 2 2 1 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -292.25
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -290.58 -294.38
2 -290.56 -293.83
--------------------------------------
TOTAL -290.57 -294.14
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 8.113044 91.101623 0.000020 27.511600 5.081596 90.56 221.24 1.005
r(A<->C){all} 0.167070 0.018405 0.000001 0.445525 0.135062 164.00 170.47 1.004
r(A<->G){all} 0.165291 0.018416 0.000055 0.429246 0.130902 150.65 184.52 1.000
r(A<->T){all} 0.150988 0.017547 0.000009 0.413443 0.112851 148.69 154.04 1.001
r(C<->G){all} 0.168969 0.020324 0.000051 0.459527 0.131915 99.25 114.90 1.000
r(C<->T){all} 0.155924 0.017744 0.000099 0.422986 0.119494 153.34 155.73 1.000
r(G<->T){all} 0.191758 0.024170 0.000075 0.503184 0.156398 73.69 112.69 1.000
pi(A){all} 0.284419 0.000866 0.227281 0.340696 0.283987 1145.08 1230.36 1.000
pi(C){all} 0.121755 0.000461 0.079476 0.162543 0.120734 1147.02 1189.46 1.000
pi(G){all} 0.179510 0.000630 0.132105 0.231325 0.178462 1221.69 1256.11 1.000
pi(T){all} 0.414317 0.001035 0.351079 0.475096 0.413644 1047.57 1157.92 1.000
alpha{1,2} 0.916499 0.969036 0.000054 2.814643 0.599888 1062.66 1135.78 1.000
alpha{3} 0.953725 1.018574 0.000061 2.888995 0.644629 1001.48 1062.21 1.000
pinvar{all} 0.920502 0.040298 0.386673 0.999999 0.995124 14.99 17.90 1.038
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
--------------
1 -- .*******
2 -- .*......
3 -- ..*.....
4 -- ...*....
5 -- ....*...
6 -- .....*..
7 -- ......*.
8 -- .......*
9 -- ..*....*
10 -- ..******
11 -- .*.*****
12 -- .*****.*
13 -- .*....*.
--------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
9 313 0.104264 0.005182 0.100600 0.107928 2
10 293 0.097602 0.015546 0.086609 0.108594 2
11 292 0.097268 0.015075 0.086609 0.107928 2
12 292 0.097268 0.008480 0.091272 0.103264 2
13 262 0.087275 0.018844 0.073951 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.609246 1.428165 0.000000 2.572797 0.185079 1.004 2
length{all}[2] 0.603521 1.200669 0.000000 2.562450 0.196924 1.004 2
length{all}[3] 0.637889 1.442107 0.000000 2.619840 0.198434 1.002 2
length{all}[4] 0.622643 1.196790 0.000000 2.645061 0.200856 1.001 2
length{all}[5] 0.630418 1.372906 0.000000 2.765935 0.185533 1.002 2
length{all}[6] 0.646133 1.515237 0.000000 2.621958 0.207427 1.001 2
length{all}[7] 0.628221 1.502380 0.000000 2.696559 0.194066 1.000 2
length{all}[8] 0.615660 1.210075 0.000000 2.701295 0.207698 1.000 2
length{all}[9] 0.561472 0.808558 0.000000 2.444794 0.224358 1.001 2
length{all}[10] 0.577114 1.004554 0.000003 2.641202 0.124099 1.010 2
length{all}[11] 0.696048 1.355089 0.000002 2.682459 0.234037 1.011 2
length{all}[12] 0.666742 1.160664 0.000022 2.946888 0.226140 1.000 2
length{all}[13] 0.626967 1.407760 0.000001 3.058613 0.158611 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.012625
Maximum standard deviation of split frequencies = 0.018844
Average PSRF for parameter values (excluding NA and >10.0) = 1.003
Maximum PSRF for parameter values = 1.011
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
|
|------------------------------------------------------------------------ C4 (4)
+
|------------------------------------------------------------------------ C5 (5)
|
|------------------------------------------------------------------------ C6 (6)
|
|------------------------------------------------------------------------ C7 (7)
|
\------------------------------------------------------------------------ C8 (8)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
|
|---------------------------------------------------------------------- C4 (4)
+
|---------------------------------------------------------------- C5 (5)
|
|------------------------------------------------------------------------ C6 (6)
|
|------------------------------------------------------------------- C7 (7)
|
\------------------------------------------------------------------------ C8 (8)
|----------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (2571 trees sampled):
50 % credible set contains 1070 trees
90 % credible set contains 2271 trees
95 % credible set contains 2421 trees
99 % credible set contains 2541 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
Running FUBAR...
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\
***************** TYPES OF STANDARD ANALYSES *****************
(1) Selection Analyses
(2) Evolutionary Hypothesis Testing
(3) Relative evolutionary rate inference
(4) Coevolutionary analysis
(5) Basic Analyses
(6) Codon Selection Analyses
(7) Compartmentalization
(8) Data File Tools
(9) Miscellaneous
(10) Model Comparison
(11) Kernel Analysis Tools
(12) Molecular Clock
(13) Phylogeny Reconstruction
(14) Positive Selection
(15) Recombination
(16) Selection/Recombination
(17) Relative Rate
(18) Relative Ratio
(19) Substitution Rates
Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' *****************
(1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution).
(2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood).
(3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting).
(4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection).
(5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification).
(6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood).
(7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation).
Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types):
Analysis Description
--------------------
Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a
coding sequence alignment to determine whether some sites have been
subject to pervasive purifying or diversifying selection. v2.1
introduces two more methods for estimating the posterior distribution of
grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation
Bayes approximation (fastest). Please note that a FUBAR analysis
generates a cache and a results JSON file in the same directory as
directory as the original alignment. HyPhy needs to have write
privileges to this directory. For example if the original file is in
/home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there
will also exist FUBAR-generated files
/home/sergei/FUBAR/data/pol.nex.FUBAR.json,
/home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide
checkpointing so that a partially completed analysis can be restarted.
- __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree
(one per partition)
- __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring
selection (2013), Mol Biol Evol. 30(5):1196-205
- __Written by__: Sergei L Kosakovsky Pond
- __Contact Information__: spond@temple.edu
- __Analysis Version__: 2.1
####Choose Genetic Code
1. [**Universal**] Universal code. (Genebank transl_table=1).
2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2).
3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3).
4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4).
5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5).
6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6).
7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9).
8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10).
9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12).
10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13).
11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14).
12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15).
13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16).
14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21).
15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22).
16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23).
17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24).
18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25).
19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26).
>Please choose an option (or press q to cancel selection):
>Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`)
>A tree was found in the data file: `(C1,C2,C3,C4,C5,C6,C7,C8)`
>Would you like to use it (y/n)?
>Loaded a multiple sequence alignment with **8** sequences, **75** codons, and **1** partitions from `/data//pss_subsets/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna`
> FUBAR will write cache and result files to _/data//pss_subsets/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna.FUBAR.json_, respectively
> Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer):
####Posterior estimation method
1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation)
2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed)
3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default)
>Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5):
### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model
* Log(L) = -288.84, AIC-c = 609.99 (16 estimated parameters)
* Tree length (expected substitutions/site) for partition 1 : 0.000
### Computing the phylogenetic likelihood function on the grid
* Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid
* Best scaling achieved for
* synonymous rate = 0.000
* non-synonymous rate = 0.000
* Computing conditional site likelihoods on a 20 x 20 rate grid
### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights
* Using the following settings
* Dirichlet alpha : 0.5
### Tabulating site-level results
----
## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=8, Len=75
175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
183A_E_AFU92106_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
LSH5A_E_AFU92097_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
SL12A_E_AFU92080_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
TLC1310A_E_AFU92088_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
TLC1343A_E_AFU92124_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
TT3A_E_AFU92072_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
TLC1347A_E_AFU92133_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI
**************************************************
175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10 YVPVYSAYVMYKNFMQIDPCPVIDV
183A_E_AFU92106_1_2005_10_China_Bat_Bat_coronavirus_HKU10 YVPVYSAYVMYKNFMQIDPCPVIDV
LSH5A_E_AFU92097_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVPVYSAYVMYKNFMQIDPCPVIDV
SL12A_E_AFU92080_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVPVYSAYVMYKNFMQIDPCPVIDV
TLC1310A_E_AFU92088_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVPVYSAYVMYKNFMQIDPCPVIDV
TLC1343A_E_AFU92124_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVPVYSAYVMYKNFMQIDPCPVIDV
TT3A_E_AFU92072_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVPVYSAYVMYKNFMQIDPCPVIDV
TLC1347A_E_AFU92133_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVPVYSAYVMYKNFMQIDPCPVIDV
*************************
>175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ATGATGTTTACATTAGTGAATGATAATGGTATGATTGTAAGTGCAATCCTTTGGTTAGTTGTGTTGTTGTTTGTTCTACTAATTGCTGTTACTGTAATTAAATTAATTCAATTATGCTTTACATGTCACAAGCTTATGAGCAACACAATTTATGTGCCTGTTTATAGTGCTTATGTTATGTATAAAAATTTTATGCAAATAGATCCTTGCCCAGTTATAGATGTC >183A_E_AFU92106_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ATGATGTTTACATTAGTGAATGATAATGGTATGATTGTAAGTGCAATCCTTTGGTTAGTTGTGTTGTTGTTTGTTCTACTAATTGCTGTTACTGTAATTAAATTAATTCAATTATGCTTTACATGTCACAAGCTTATGAGCAACACAATTTATGTGCCTGTTTATAGTGCTTATGTTATGTATAAAAATTTTATGCAAATAGATCCTTGCCCAGTTATAGATGTC >LSH5A_E_AFU92097_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGATGTTTACATTAGTGAATGATAATGGTATGATTGTAAGTGCAATCCTTTGGTTAGTTGTGTTGTTGTTTGTTCTACTAATTGCTGTTACTGTAATTAAATTAATTCAATTATGCTTTACATGTCACAAGCTTATGAGCAACACAATTTATGTGCCTGTTTATAGTGCTTATGTTATGTATAAAAATTTTATGCAAATAGATCCTTGCCCAGTTATAGATGTC >SL12A_E_AFU92080_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGATGTTTACATTAGTGAATGATAATGGTATGATTGTAAGTGCAATCCTTTGGTTAGTTGTGTTGTTGTTTGTTCTACTAATTGCTGTTACTGTAATTAAATTAATTCAATTATGCTTTACATGTCACAAGCTTATGAGCAACACAATTTATGTGCCTGTTTATAGTGCTTATGTTATGTATAAAAATTTTATGCAAATAGATCCTTGCCCAGTTATAGATGTC >TLC1310A_E_AFU92088_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGATGTTTACATTAGTGAATGATAATGGTATGATTGTAAGTGCAATCCTTTGGTTAGTTGTGTTGTTGTTTGTTCTACTAATTGCTGTTACTGTAATTAAATTAATTCAATTATGCTTTACATGTCACAAGCTTATGAGCAACACAATTTATGTGCCTGTTTATAGTGCTTATGTTATGTATAAAAATTTTATGCAAATAGATCCTTGCCCAGTTATAGATGTC >TLC1343A_E_AFU92124_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGATGTTTACATTAGTGAATGATAATGGTATGATTGTAAGTGCAATCCTTTGGTTAGTTGTGTTGTTGTTTGTTCTACTAATTGCTGTTACTGTAATTAAATTAATTCAATTATGCTTTACATGTCACAAGCTTATGAGCAACACAATTTATGTGCCTGTTTATAGTGCTTATGTTATGTATAAAAATTTTATGCAAATAGATCCTTGCCCAGTTATAGATGTC >TT3A_E_AFU92072_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGATGTTTACATTAGTGAATGATAATGGTATGATTGTAAGTGCAATCCTTTGGTTAGTTGTGTTGTTGTTTGTTCTACTAATTGCTGTTACTGTAATTAAATTAATTCAATTATGCTTTACATGTCACAAGCTTATGAGCAACACAATTTATGTGCCTGTTTATAGTGCTTATGTTATGTATAAAAATTTTATGCAAATAGATCCTTGCCCAGTTATAGATGTC >TLC1347A_E_AFU92133_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGATGTTTACATTAGTGAATGATAATGGTATGATTGTAAGTGCAATCCTTTGGTTAGTTGTGTTGTTGTTTGTTCTACTAATTGCTGTTACTGTAATTAAATTAATTCAATTATGCTTTACATGTCACAAGCTTATGAGCAACACAATTTATGTGCCTGTTTATAGTGCTTATGTTATGTATAAAAATTTTATGCAAATAGATCCTTGCCCAGTTATAGATGTC
>175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI YVPVYSAYVMYKNFMQIDPCPVIDV >183A_E_AFU92106_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI YVPVYSAYVMYKNFMQIDPCPVIDV >LSH5A_E_AFU92097_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI YVPVYSAYVMYKNFMQIDPCPVIDV >SL12A_E_AFU92080_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI YVPVYSAYVMYKNFMQIDPCPVIDV >TLC1310A_E_AFU92088_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI YVPVYSAYVMYKNFMQIDPCPVIDV >TLC1343A_E_AFU92124_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI YVPVYSAYVMYKNFMQIDPCPVIDV >TT3A_E_AFU92072_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI YVPVYSAYVMYKNFMQIDPCPVIDV >TLC1347A_E_AFU92133_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MMFTLVNDNGMIVSAILWLVVLLFVLLIAVTVIKLIQLCFTCHKLMSNTI YVPVYSAYVMYKNFMQIDPCPVIDV
Reading sequence file /data//pss_subsets/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/fasta/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1 Found 8 sequences of length 225 Alignment looks like a valid DNA alignment. Estimated diversity is (pairwise deletion - ignoring missing/ambig): 0.0% Found 0 informative sites. Writing alignment of informative sites to: Phi.inf.sites Writing list of informative sites to: Phi.inf.list Calculating all pairwise incompatibilities... 100.0% Using a window size of 80 with k as 1 Too few informative sites to use normal approximation. Try doing a permutation test or increasing alignment length Can also try decreasing windowsize.
#NEXUS
[ID: 5579049873]
begin taxa;
dimensions ntax=8;
taxlabels
175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10
183A_E_AFU92106_1_2005_10_China_Bat_Bat_coronavirus_HKU10
LSH5A_E_AFU92097_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
SL12A_E_AFU92080_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1310A_E_AFU92088_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1343A_E_AFU92124_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10
TT3A_E_AFU92072_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1347A_E_AFU92133_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10
;
end;
begin trees;
translate
1 175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10,
2 183A_E_AFU92106_1_2005_10_China_Bat_Bat_coronavirus_HKU10,
3 LSH5A_E_AFU92097_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10,
4 SL12A_E_AFU92080_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10,
5 TLC1310A_E_AFU92088_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10,
6 TLC1343A_E_AFU92124_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10,
7 TT3A_E_AFU92072_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10,
8 TLC1347A_E_AFU92133_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:1.850792e-01,2:1.969236e-01,3:1.984341e-01,4:2.008560e-01,5:1.855329e-01,6:2.074267e-01,7:1.940656e-01,8:2.076981e-01);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:1.850792e-01,2:1.969236e-01,3:1.984341e-01,4:2.008560e-01,5:1.855329e-01,6:2.074267e-01,7:1.940656e-01,8:2.076981e-01);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -290.58 -294.71
2 -290.55 -293.07
--------------------------------------
TOTAL -290.57 -294.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 8.803618 97.945221 0.000004 28.539790 5.756821 243.91 381.41 1.000
r(A<->C){all} 0.155064 0.016987 0.000004 0.419258 0.122201 191.94 239.33 1.000
r(A<->G){all} 0.161628 0.018658 0.000103 0.432568 0.125444 101.82 150.70 1.000
r(A<->T){all} 0.178465 0.023202 0.000001 0.486067 0.134419 105.69 123.61 1.005
r(C<->G){all} 0.163775 0.019277 0.000006 0.440523 0.124338 131.07 185.38 1.003
r(C<->T){all} 0.174810 0.021618 0.000313 0.470862 0.138058 109.91 174.30 1.000
r(G<->T){all} 0.166259 0.018852 0.000046 0.430731 0.133882 139.48 192.46 1.002
pi(A){all} 0.283943 0.000843 0.224475 0.339072 0.283198 1091.33 1282.11 1.001
pi(C){all} 0.122505 0.000448 0.082847 0.164546 0.121574 1231.58 1298.53 1.000
pi(G){all} 0.178791 0.000650 0.127935 0.229106 0.178006 1084.02 1170.00 1.001
pi(T){all} 0.414761 0.001030 0.350167 0.474762 0.414714 1005.24 1068.80 1.000
alpha{1,2} 0.914205 0.990830 0.000316 2.812838 0.601827 1016.32 1108.77 1.000
alpha{3} 0.960329 1.011446 0.000666 3.012459 0.641850 1106.19 1137.09 1.002
pinvar{all} 0.966101 0.011349 0.711975 0.999996 0.995926 15.69 31.20 1.003
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C2,C3,C4,C5,C6,C7,C8)` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **8** sequences, **75** codons, and **1** partitions from `/data//pss_subsets/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_E_AFU92115_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -288.84, AIC-c = 609.99 (16 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.000 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 0.000 * non-synonymous rate = 0.000 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results ---- ## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
