--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1939.39 -1951.79
2 -1939.65 -1950.64
--------------------------------------
TOTAL -1939.51 -1951.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 9.359770 17.346309 3.801414 17.337440 8.299917 1042.03 1042.74 1.000
r(A<->C){all} 0.095462 0.001593 0.018056 0.172554 0.092652 574.10 606.93 1.007
r(A<->G){all} 0.289586 0.003011 0.184123 0.391569 0.287680 633.07 761.77 1.003
r(A<->T){all} 0.124411 0.001055 0.061570 0.188272 0.122730 750.69 756.81 1.000
r(C<->G){all} 0.215149 0.002679 0.117893 0.319172 0.212132 499.42 575.51 1.001
r(C<->T){all} 0.221506 0.001744 0.144979 0.303931 0.218476 653.69 790.97 1.000
r(G<->T){all} 0.053886 0.000855 0.001834 0.108546 0.050386 675.80 706.99 1.000
pi(A){all} 0.257980 0.000226 0.230808 0.289110 0.257683 1181.37 1245.02 1.000
pi(C){all} 0.224931 0.000208 0.198144 0.253001 0.224249 957.58 1049.73 1.000
pi(G){all} 0.169224 0.000170 0.143341 0.194449 0.168816 885.14 1080.63 1.000
pi(T){all} 0.347865 0.000292 0.313205 0.379268 0.347720 1020.78 1126.36 1.001
alpha{1,2} 0.449771 0.011952 0.262566 0.662106 0.437718 891.02 934.64 1.000
alpha{3} 3.548336 1.840352 1.231004 6.214059 3.342433 1045.30 1208.60 1.000
pinvar{all} 0.027413 0.000468 0.000003 0.069589 0.022549 1225.54 1292.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
-- Starting log on Thu Oct 27 00:04:00 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=6, Len=131
C1 MKIILFSILIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFH
C2 MRVVALLLLISPVFS--RQVFHYIDCVAGSSTTFGLPC-EGLIQTQSSVQ
C3 MRVILLLAVLYVALATSREVHHYIDCVRGTSRTLQLPC-DGTVESTTPVQ
C4 MRVLILLSLLSVALTAAPEIHHYIDCVRGTSTTILQPC-DGVIESTSPVQ
C5 MRVLLLLSLCAFALS--KEIHYYVDCISGTSTTVNQPC-DGVIESTSPVQ
C6 MKIILFLTLIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFH
*::: : : . ::.:* :*: *:: . ** .* : :..:
C1 PLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQE
C2 FVPDQQYGRVGVLCISNYVQTFRISCPHGN-HTFIIR-----STTYRTNV
C3 FTPDYAYGSIAVPC--NVVFQMRISCPLGN-YTYHVR-----PVSFRTHT
C4 FTPNTQYGSLAVSC--SLVTQIRISCPHGN-HTFHVR-----PVSFRTHT
C5 FTPNYAYGSLAVAC--NSVVQIRILCPRGN-YTFHIR-----PVSFRTHT
C6 PLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQE
.: : .: * : : *. *. :*: :* . : :
C1 KVYQELYSPLFLIVIALVFIILCFTIKRKIE
C2 RVTQPQSGDLMMLILCFLIILVLYVCLWR--
C3 RYSQPQGNELQCLIVFLLILIVFYLVFRRR-
C4 RYSQPQGNELQCLIVTLLIVIVLYLFFRRR-
C5 RYSQPQGNEVQCLVVTLLLVILLILLFRRR-
C6 KVYQELYSPLFLIVAALVFIILCFTIKRKIE
: * . : :: :::::: :
-- Starting log on Thu Oct 27 00:04:20 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=731, Nseq=6, Len=131
C1 MKIILFSILIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFH
C2 MRVVALLLLISPVFS--RQVFHYIDCVAGSSTTFGLPC-EGLIQTQSSVQ
C3 MRVILLLAVLYVALATSREVHHYIDCVRGTSRTLQLPC-DGTVESTTPVQ
C4 MRVLILLSLLSVALTAAPEIHHYIDCVRGTSTTILQPC-DGVIESTSPVQ
C5 MRVLLLLSLCAFALS--KEIHYYVDCISGTSTTVNQPC-DGVIESTSPVQ
C6 MKIILFLTLIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFH
*::: : : . ::.:* :*: *:: . ** .* : :..:
C1 PLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQE
C2 FVPDQQYGRVGVLCISNYVQTFRISCPHGN-HTFIIR-----STTYRTNV
C3 FTPDYAYGSIAVPC--NVVFQMRISCPLGN-YTYHVR-----PVSFRTHT
C4 FTPNTQYGSLAVSC--SLVTQIRISCPHGN-HTFHVR-----PVSFRTHT
C5 FTPNYAYGSLAVAC--NSVVQIRILCPRGN-YTFHIR-----PVSFRTHT
C6 PLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQE
.: : .: * : : *. *. :*: :* . : :
C1 KVYQELYSPLFLIVIALVFIILCFTIKRKIE
C2 RVTQPQSGDLMMLILCFLIILVLYVCLWR--
C3 RYSQPQGNELQCLIVFLLILIVFYLVFRRR-
C4 RYSQPQGNELQCLIVTLLIVIVLYLFFRRR-
C5 RYSQPQGNEVQCLVVTLLLVILLILLFRRR-
C6 KVYQELYSPLFLIVAALVFIILCFTIKRKIE
: * . : :: :::::: :
-- Starting log on Thu Oct 27 00:04:00 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=6, Len=131
C1 MKIILFSILIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFH
C2 MRVVALLLLISPVFS--RQVFHYIDCVAGSSTTFGLPC-EGLIQTQSSVQ
C3 MRVILLLAVLYVALATSREVHHYIDCVRGTSRTLQLPC-DGTVESTTPVQ
C4 MRVLILLSLLSVALTAAPEIHHYIDCVRGTSTTILQPC-DGVIESTSPVQ
C5 MRVLLLLSLCAFALS--KEIHYYVDCISGTSTTVNQPC-DGVIESTSPVQ
C6 MKIILFLTLIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFH
*::: : : . ::.:* :*: *:: . ** .* : :..:
C1 PLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQE
C2 FVPDQQYGRVGVLCISNYVQTFRISCPHGN-HTFIIR-----STTYRTNV
C3 FTPDYAYGSIAVPC--NVVFQMRISCPLGN-YTYHVR-----PVSFRTHT
C4 FTPNTQYGSLAVSC--SLVTQIRISCPHGN-HTFHVR-----PVSFRTHT
C5 FTPNYAYGSLAVAC--NSVVQIRILCPRGN-YTFHIR-----PVSFRTHT
C6 PLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQE
.: : .: * : : *. *. :*: :* . : :
C1 KVYQELYSPLFLIVIALVFIILCFTIKRKIE
C2 RVTQPQSGDLMMLILCFLIILVLYVCLWR--
C3 RYSQPQGNELQCLIVFLLILIVFYLVFRRR-
C4 RYSQPQGNELQCLIVTLLIVIVLYLFFRRR-
C5 RYSQPQGNEVQCLVVTLLLVILLILLFRRR-
C6 KVYQELYSPLFLIVAALVFIILCFTIKRKIE
: * . : :: :::::: :
-- Starting log on Thu Oct 27 01:04:19 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result/gapped_alignment/fubar,JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 393 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666832661
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 856176891
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 2488018479
Seed = 2137303108
Swapseed = 1666832661
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 80 unique site patterns
Division 2 has 57 unique site patterns
Division 3 has 103 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -3269.336385 -- 21.927696
Chain 2 -- -3119.074897 -- 21.927696
Chain 3 -- -3359.214610 -- 21.927696
Chain 4 -- -3145.555647 -- 21.927696
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -3153.597219 -- 21.927696
Chain 2 -- -3349.217257 -- 21.927696
Chain 3 -- -2762.842366 -- 21.927696
Chain 4 -- -3210.793311 -- 21.927696
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-3269.336] (-3119.075) (-3359.215) (-3145.556) * [-3153.597] (-3349.217) (-2762.842) (-3210.793)
1000 -- (-1956.994) (-1950.727) (-1971.615) [-1954.439] * [-1946.993] (-1962.905) (-1962.327) (-1953.098) -- 0:00:00
2000 -- (-1942.293) (-1944.417) [-1946.086] (-1948.938) * [-1945.626] (-1945.154) (-1956.390) (-1951.093) -- 0:08:19
3000 -- (-1947.693) (-1942.014) (-1956.544) [-1942.337] * (-1951.903) (-1951.682) [-1947.695] (-1940.364) -- 0:05:32
4000 -- (-1938.581) (-1941.452) (-1943.650) [-1946.626] * (-1946.475) (-1946.451) [-1944.740] (-1945.297) -- 0:08:18
5000 -- (-1942.018) (-1951.923) (-1949.455) [-1943.826] * [-1941.413] (-1956.758) (-1947.088) (-1948.015) -- 0:06:38
Average standard deviation of split frequencies: 0.125708
6000 -- (-1944.641) (-1945.602) (-1942.576) [-1945.191] * (-1944.728) [-1946.660] (-1944.303) (-1940.831) -- 0:08:17
7000 -- [-1942.584] (-1941.211) (-1943.401) (-1947.954) * (-1937.103) (-1947.555) (-1940.623) [-1942.086] -- 0:07:05
8000 -- (-1945.917) (-1948.509) [-1943.364] (-1951.176) * (-1949.789) [-1943.777] (-1941.368) (-1950.216) -- 0:06:12
9000 -- [-1946.787] (-1939.989) (-1941.642) (-1946.367) * (-1942.148) (-1949.241) [-1942.413] (-1942.492) -- 0:07:20
10000 -- (-1943.870) (-1945.583) (-1937.869) [-1947.351] * (-1942.453) (-1946.950) [-1939.887] (-1957.540) -- 0:06:36
Average standard deviation of split frequencies: 0.110485
11000 -- [-1941.742] (-1946.146) (-1939.173) (-1939.423) * [-1939.940] (-1945.353) (-1944.315) (-1940.641) -- 0:07:29
12000 -- (-1943.328) [-1946.497] (-1939.935) (-1940.851) * (-1940.103) [-1943.095] (-1942.859) (-1944.635) -- 0:06:51
13000 -- [-1942.983] (-1952.167) (-1942.646) (-1941.497) * (-1938.983) (-1942.630) (-1941.623) [-1942.062] -- 0:07:35
14000 -- (-1948.259) [-1948.244] (-1944.343) (-1941.039) * (-1946.382) (-1951.613) (-1941.018) [-1944.689] -- 0:07:02
15000 -- [-1945.123] (-1945.521) (-1947.754) (-1943.783) * [-1945.387] (-1952.436) (-1942.073) (-1947.509) -- 0:07:39
Average standard deviation of split frequencies: 0.104757
16000 -- [-1946.803] (-1943.141) (-1943.739) (-1943.542) * [-1939.915] (-1946.052) (-1948.471) (-1945.962) -- 0:07:10
17000 -- (-1945.248) (-1940.549) (-1943.589) [-1943.523] * (-1949.537) [-1948.368] (-1944.203) (-1943.860) -- 0:07:42
18000 -- (-1946.299) (-1937.278) (-1945.443) [-1943.519] * (-1940.281) (-1937.787) [-1941.856] (-1946.579) -- 0:07:16
19000 -- [-1949.214] (-1941.393) (-1942.880) (-1943.564) * [-1939.994] (-1950.905) (-1942.475) (-1945.255) -- 0:07:44
20000 -- (-1942.129) [-1943.698] (-1939.475) (-1942.901) * (-1946.703) (-1952.742) [-1945.288] (-1937.174) -- 0:07:21
Average standard deviation of split frequencies: 0.087981
21000 -- (-1944.135) (-1937.287) [-1943.695] (-1950.098) * (-1950.014) (-1938.863) [-1944.922] (-1939.202) -- 0:07:46
22000 -- [-1946.345] (-1943.093) (-1940.359) (-1938.936) * (-1950.667) [-1939.262] (-1940.968) (-1953.631) -- 0:07:24
23000 -- (-1937.771) (-1946.923) [-1942.874] (-1949.188) * [-1945.271] (-1940.321) (-1941.793) (-1950.230) -- 0:07:47
24000 -- (-1942.591) (-1948.690) [-1942.372] (-1942.615) * (-1943.691) (-1946.305) [-1939.072] (-1940.835) -- 0:07:27
25000 -- [-1943.482] (-1952.110) (-1943.365) (-1942.551) * (-1946.956) [-1944.433] (-1941.809) (-1948.992) -- 0:07:09
Average standard deviation of split frequencies: 0.061192
26000 -- (-1948.078) [-1943.436] (-1939.810) (-1944.965) * [-1944.108] (-1948.433) (-1946.735) (-1944.271) -- 0:07:29
27000 -- (-1940.468) (-1947.105) [-1941.138] (-1947.497) * (-1948.229) (-1936.828) (-1952.953) [-1948.009] -- 0:07:12
28000 -- (-1941.249) (-1934.442) (-1953.067) [-1938.716] * (-1939.045) (-1944.031) [-1939.889] (-1953.368) -- 0:07:31
29000 -- (-1944.577) (-1943.839) (-1945.077) [-1946.642] * (-1943.850) [-1942.146] (-1944.722) (-1950.695) -- 0:07:15
30000 -- (-1946.155) (-1948.141) (-1945.769) [-1947.628] * (-1943.510) (-1945.588) (-1943.618) [-1938.583] -- 0:07:32
Average standard deviation of split frequencies: 0.040351
31000 -- (-1946.926) (-1945.456) (-1943.086) [-1946.130] * (-1942.808) (-1943.136) (-1942.414) [-1947.371] -- 0:07:17
32000 -- [-1951.176] (-1938.800) (-1939.546) (-1942.272) * (-1945.343) (-1944.737) [-1942.848] (-1948.153) -- 0:07:33
33000 -- (-1946.418) (-1937.242) (-1944.722) [-1940.277] * (-1941.999) [-1941.479] (-1946.864) (-1940.928) -- 0:07:19
34000 -- (-1942.030) (-1937.115) (-1952.184) [-1937.535] * (-1946.924) (-1946.110) (-1942.060) [-1939.732] -- 0:07:34
35000 -- (-1945.128) (-1943.433) (-1943.890) [-1943.727] * (-1946.700) (-1947.128) [-1944.327] (-1947.397) -- 0:07:21
Average standard deviation of split frequencies: 0.032736
36000 -- (-1947.462) (-1944.452) (-1954.099) [-1945.086] * (-1950.507) (-1947.623) (-1940.129) [-1949.794] -- 0:07:35
37000 -- [-1936.576] (-1941.086) (-1945.027) (-1948.376) * (-1939.273) (-1941.815) (-1940.728) [-1943.673] -- 0:07:22
38000 -- [-1946.281] (-1941.063) (-1945.304) (-1944.665) * (-1946.399) [-1943.255] (-1950.464) (-1941.266) -- 0:07:35
39000 -- (-1940.752) [-1944.180] (-1942.496) (-1951.715) * (-1942.927) (-1946.439) [-1944.700] (-1946.369) -- 0:07:23
40000 -- (-1938.884) (-1950.520) (-1940.820) [-1937.304] * (-1952.392) (-1946.137) [-1943.282] (-1938.474) -- 0:07:36
Average standard deviation of split frequencies: 0.028980
41000 -- (-1942.376) (-1946.784) [-1946.844] (-1945.798) * (-1947.806) (-1946.110) (-1946.598) [-1939.741] -- 0:07:24
42000 -- [-1949.099] (-1944.156) (-1947.351) (-1940.203) * (-1952.471) (-1943.802) [-1950.394] (-1941.582) -- 0:07:36
43000 -- [-1938.198] (-1946.740) (-1947.353) (-1937.866) * (-1951.373) [-1941.967] (-1942.693) (-1939.712) -- 0:07:25
44000 -- (-1943.654) (-1948.141) (-1946.066) [-1943.927] * (-1944.496) (-1944.145) (-1946.972) [-1942.584] -- 0:07:14
45000 -- [-1945.628] (-1942.522) (-1952.228) (-1946.300) * (-1943.924) [-1941.251] (-1953.158) (-1943.969) -- 0:07:25
Average standard deviation of split frequencies: 0.029463
46000 -- [-1942.310] (-1940.194) (-1946.332) (-1950.423) * [-1944.903] (-1943.570) (-1942.889) (-1946.344) -- 0:07:15
47000 -- (-1942.974) [-1945.746] (-1945.351) (-1953.417) * (-1944.947) (-1941.690) [-1943.511] (-1944.864) -- 0:07:26
48000 -- (-1943.912) (-1939.364) [-1939.325] (-1938.270) * (-1951.331) [-1941.327] (-1945.911) (-1937.975) -- 0:07:16
49000 -- (-1941.329) (-1944.339) (-1943.657) [-1940.338] * [-1939.062] (-1938.830) (-1948.427) (-1941.069) -- 0:07:26
50000 -- (-1946.962) (-1949.958) [-1945.348] (-1950.129) * [-1945.468] (-1942.372) (-1945.201) (-1942.941) -- 0:07:17
Average standard deviation of split frequencies: 0.029075
51000 -- (-1945.451) (-1939.046) [-1942.140] (-1941.912) * [-1941.640] (-1938.015) (-1954.033) (-1940.339) -- 0:07:26
52000 -- (-1943.116) [-1939.541] (-1947.645) (-1945.008) * (-1945.592) [-1943.152] (-1947.712) (-1954.600) -- 0:07:17
53000 -- (-1944.361) (-1941.548) (-1948.954) [-1938.927] * (-1940.411) [-1943.121] (-1950.391) (-1943.216) -- 0:07:26
54000 -- (-1951.838) [-1940.689] (-1942.734) (-1945.902) * (-1941.801) (-1942.670) (-1948.989) [-1943.814] -- 0:07:17
55000 -- (-1942.707) (-1939.191) [-1943.032] (-1939.974) * (-1950.394) (-1953.687) (-1938.282) [-1934.656] -- 0:07:26
Average standard deviation of split frequencies: 0.019993
56000 -- (-1947.655) (-1939.291) (-1954.809) [-1940.696] * (-1940.756) (-1950.851) [-1943.679] (-1938.439) -- 0:07:18
57000 -- (-1943.731) (-1945.610) [-1941.516] (-1944.143) * [-1943.321] (-1951.106) (-1949.391) (-1944.774) -- 0:07:26
58000 -- (-1943.893) (-1957.437) [-1945.568] (-1934.318) * (-1947.072) (-1944.938) [-1950.075] (-1943.226) -- 0:07:18
59000 -- [-1937.783] (-1949.628) (-1942.840) (-1945.521) * (-1950.867) [-1940.150] (-1944.026) (-1944.370) -- 0:07:26
60000 -- (-1941.191) (-1950.594) (-1946.845) [-1944.701] * (-1948.426) [-1939.695] (-1949.514) (-1939.317) -- 0:07:18
Average standard deviation of split frequencies: 0.022340
61000 -- (-1941.658) (-1941.965) [-1941.488] (-1939.596) * (-1954.272) (-1945.409) [-1946.561] (-1942.295) -- 0:07:26
62000 -- [-1943.108] (-1943.870) (-1948.194) (-1945.527) * (-1956.764) (-1945.317) (-1942.056) [-1941.831] -- 0:07:18
63000 -- [-1946.951] (-1949.026) (-1951.353) (-1937.725) * (-1940.375) (-1940.118) [-1939.947] (-1949.279) -- 0:07:11
64000 -- (-1942.939) [-1945.375] (-1943.949) (-1949.295) * (-1946.169) (-1941.209) [-1945.042] (-1948.769) -- 0:07:18
65000 -- (-1948.566) (-1939.756) (-1949.857) [-1944.789] * (-1941.478) (-1945.105) [-1949.236] (-1944.341) -- 0:07:11
Average standard deviation of split frequencies: 0.024999
66000 -- (-1938.548) (-1942.745) (-1946.585) [-1944.874] * (-1939.420) (-1943.675) (-1943.498) [-1941.788] -- 0:07:18
67000 -- (-1957.945) [-1938.210] (-1946.809) (-1944.162) * (-1941.384) (-1942.355) (-1946.670) [-1940.709] -- 0:07:11
68000 -- [-1950.596] (-1943.779) (-1939.766) (-1952.007) * [-1945.446] (-1948.180) (-1940.144) (-1950.237) -- 0:07:18
69000 -- (-1942.946) [-1941.257] (-1945.413) (-1940.426) * (-1941.026) [-1939.874] (-1944.192) (-1946.625) -- 0:07:11
70000 -- [-1940.892] (-1944.749) (-1946.216) (-1947.671) * (-1942.409) [-1943.336] (-1943.512) (-1950.796) -- 0:07:18
Average standard deviation of split frequencies: 0.020846
71000 -- (-1941.119) [-1945.393] (-1950.156) (-1945.107) * [-1940.252] (-1939.318) (-1948.787) (-1952.805) -- 0:07:11
72000 -- (-1944.752) (-1948.142) [-1940.392] (-1939.452) * (-1948.578) (-1945.956) [-1947.182] (-1951.382) -- 0:07:18
73000 -- [-1944.326] (-1942.987) (-1947.872) (-1944.145) * (-1945.150) [-1941.371] (-1947.880) (-1950.627) -- 0:07:11
74000 -- (-1943.640) (-1951.728) [-1941.310] (-1952.680) * [-1943.139] (-1951.884) (-1945.108) (-1947.936) -- 0:07:17
75000 -- (-1949.939) [-1942.638] (-1949.405) (-1945.464) * (-1942.240) (-1940.249) (-1949.066) [-1942.493] -- 0:07:11
Average standard deviation of split frequencies: 0.021709
76000 -- (-1942.222) [-1946.432] (-1942.051) (-1940.527) * (-1951.207) (-1942.698) [-1947.433] (-1949.758) -- 0:07:17
77000 -- (-1943.718) [-1942.795] (-1947.860) (-1946.855) * (-1944.923) (-1952.476) (-1951.251) [-1946.689] -- 0:07:11
78000 -- (-1942.603) [-1942.958] (-1944.087) (-1946.298) * (-1943.544) (-1945.602) (-1940.672) [-1940.919] -- 0:07:17
79000 -- (-1942.114) [-1944.168] (-1947.033) (-1949.813) * (-1953.116) (-1945.081) [-1942.906] (-1946.177) -- 0:07:11
80000 -- (-1943.723) [-1942.189] (-1945.625) (-1947.277) * (-1943.668) (-1945.225) [-1947.360] (-1936.518) -- 0:07:05
Average standard deviation of split frequencies: 0.026297
81000 -- (-1944.865) (-1942.786) (-1944.784) [-1939.336] * (-1940.902) (-1947.719) [-1936.944] (-1944.137) -- 0:07:11
82000 -- (-1955.264) [-1946.657] (-1943.796) (-1942.990) * (-1937.598) (-1947.318) [-1941.664] (-1941.894) -- 0:07:05
83000 -- (-1941.955) [-1938.133] (-1942.028) (-1940.764) * (-1942.240) (-1949.632) [-1940.338] (-1956.004) -- 0:07:10
84000 -- [-1941.327] (-1939.453) (-1941.549) (-1941.313) * (-1940.357) (-1945.506) [-1938.736] (-1949.880) -- 0:07:05
85000 -- [-1948.072] (-1945.316) (-1953.700) (-1945.779) * (-1945.443) (-1942.261) [-1941.033] (-1952.756) -- 0:07:10
Average standard deviation of split frequencies: 0.029234
86000 -- (-1944.000) (-1956.203) (-1951.358) [-1943.153] * (-1945.764) (-1946.560) (-1953.147) [-1940.814] -- 0:07:05
87000 -- (-1948.535) (-1944.112) (-1955.381) [-1944.488] * (-1948.422) (-1943.754) (-1947.228) [-1941.625] -- 0:07:10
88000 -- (-1942.252) (-1944.820) [-1948.638] (-1947.343) * (-1944.603) (-1937.769) (-1948.441) [-1944.483] -- 0:07:04
89000 -- [-1945.832] (-1944.027) (-1944.255) (-1949.368) * (-1953.442) [-1944.493] (-1942.341) (-1940.173) -- 0:07:09
90000 -- [-1942.501] (-1946.395) (-1948.532) (-1951.420) * (-1944.219) [-1939.484] (-1942.022) (-1943.041) -- 0:07:04
Average standard deviation of split frequencies: 0.023108
91000 -- [-1944.471] (-1938.126) (-1942.038) (-1945.258) * [-1947.342] (-1950.428) (-1940.046) (-1940.087) -- 0:07:09
92000 -- (-1946.804) (-1946.096) [-1949.138] (-1944.214) * [-1944.932] (-1944.713) (-1945.373) (-1945.470) -- 0:07:04
93000 -- (-1941.086) (-1943.599) (-1939.613) [-1940.203] * [-1946.443] (-1939.489) (-1941.853) (-1938.816) -- 0:07:09
94000 -- (-1944.198) (-1944.302) (-1942.723) [-1942.560] * (-1943.868) (-1947.698) [-1941.919] (-1943.328) -- 0:07:04
95000 -- [-1940.107] (-1940.552) (-1944.848) (-1938.515) * (-1945.730) (-1944.221) [-1939.824] (-1946.475) -- 0:07:08
Average standard deviation of split frequencies: 0.022915
96000 -- (-1941.179) (-1946.528) [-1941.566] (-1947.257) * (-1945.267) (-1946.286) [-1942.448] (-1947.518) -- 0:07:03
97000 -- (-1942.122) [-1944.175] (-1941.231) (-1948.141) * (-1942.466) (-1943.791) [-1941.261] (-1949.121) -- 0:06:58
98000 -- (-1945.968) [-1941.034] (-1944.108) (-1943.065) * (-1939.245) (-1946.345) (-1940.281) [-1942.767] -- 0:07:03
99000 -- (-1941.756) (-1950.663) [-1945.473] (-1943.610) * (-1940.231) (-1942.152) [-1944.184] (-1940.470) -- 0:06:58
100000 -- (-1936.114) [-1941.872] (-1945.983) (-1941.436) * (-1948.574) [-1946.484] (-1940.362) (-1942.592) -- 0:07:03
Average standard deviation of split frequencies: 0.026341
101000 -- [-1942.744] (-1940.735) (-1942.132) (-1944.287) * (-1940.459) [-1943.396] (-1940.590) (-1941.036) -- 0:06:58
102000 -- [-1946.239] (-1946.388) (-1942.518) (-1943.343) * (-1943.886) [-1937.719] (-1944.950) (-1948.110) -- 0:07:02
103000 -- [-1935.806] (-1944.143) (-1947.732) (-1947.938) * (-1941.774) [-1940.469] (-1939.307) (-1948.886) -- 0:06:58
104000 -- (-1952.938) (-1943.148) (-1943.212) [-1941.148] * [-1945.189] (-1944.211) (-1943.100) (-1944.032) -- 0:07:02
105000 -- (-1936.474) [-1939.986] (-1940.228) (-1942.559) * (-1951.587) [-1940.844] (-1941.126) (-1943.819) -- 0:06:57
Average standard deviation of split frequencies: 0.026189
106000 -- (-1941.321) (-1943.689) (-1944.214) [-1941.017] * (-1943.706) (-1940.515) [-1942.842] (-1944.589) -- 0:07:01
107000 -- [-1939.251] (-1939.160) (-1942.865) (-1945.261) * (-1940.620) [-1944.538] (-1949.229) (-1945.333) -- 0:06:57
108000 -- (-1947.694) (-1945.738) (-1940.563) [-1942.300] * (-1943.910) (-1940.965) (-1943.355) [-1942.332] -- 0:07:01
109000 -- (-1944.506) (-1948.435) (-1947.172) [-1947.013] * (-1952.998) (-1944.670) [-1942.147] (-1939.861) -- 0:06:56
110000 -- (-1946.683) [-1940.432] (-1942.619) (-1946.347) * (-1941.198) (-1943.976) (-1940.673) [-1946.734] -- 0:07:00
Average standard deviation of split frequencies: 0.029344
111000 -- (-1948.503) (-1944.280) [-1945.672] (-1943.547) * (-1943.115) [-1944.760] (-1940.286) (-1948.155) -- 0:06:56
112000 -- [-1943.203] (-1938.175) (-1946.257) (-1947.307) * (-1945.045) (-1941.576) (-1945.602) [-1944.031] -- 0:07:00
113000 -- (-1947.557) (-1940.143) (-1946.080) [-1942.368] * (-1939.935) (-1944.860) (-1949.447) [-1946.834] -- 0:06:56
114000 -- (-1946.924) (-1946.307) (-1941.051) [-1942.334] * [-1943.999] (-1946.116) (-1942.198) (-1947.735) -- 0:06:59
115000 -- [-1941.820] (-1949.420) (-1943.940) (-1944.099) * [-1946.288] (-1948.892) (-1940.213) (-1948.609) -- 0:06:55
Average standard deviation of split frequencies: 0.027544
116000 -- (-1946.571) (-1942.058) [-1943.379] (-1942.785) * [-1944.792] (-1943.668) (-1945.938) (-1943.149) -- 0:06:51
117000 -- (-1943.242) (-1953.205) [-1943.630] (-1940.602) * [-1943.966] (-1947.133) (-1951.744) (-1939.877) -- 0:06:55
118000 -- (-1942.865) (-1946.050) [-1939.006] (-1946.005) * (-1947.591) [-1947.640] (-1940.210) (-1941.900) -- 0:06:51
119000 -- (-1938.558) (-1949.447) [-1946.672] (-1946.092) * [-1941.125] (-1953.709) (-1942.814) (-1941.379) -- 0:06:54
120000 -- (-1944.360) [-1945.849] (-1939.678) (-1954.919) * [-1942.162] (-1942.377) (-1944.010) (-1940.674) -- 0:06:50
Average standard deviation of split frequencies: 0.029517
121000 -- [-1944.224] (-1947.811) (-1947.483) (-1945.101) * (-1944.473) (-1945.879) (-1943.252) [-1938.028] -- 0:06:54
122000 -- (-1943.291) (-1944.846) [-1941.859] (-1945.265) * (-1941.552) (-1944.156) (-1945.413) [-1941.033] -- 0:06:50
123000 -- [-1940.991] (-1941.588) (-1944.436) (-1953.330) * [-1942.368] (-1952.527) (-1938.056) (-1945.955) -- 0:06:53
124000 -- (-1939.435) [-1942.191] (-1945.564) (-1951.578) * (-1940.141) (-1940.556) (-1942.403) [-1942.709] -- 0:06:49
125000 -- (-1948.835) (-1943.812) (-1942.679) [-1940.793] * (-1943.562) [-1945.599] (-1940.123) (-1939.523) -- 0:06:53
Average standard deviation of split frequencies: 0.028268
126000 -- (-1940.008) [-1943.069] (-1945.122) (-1940.982) * (-1940.751) (-1949.271) [-1937.842] (-1940.960) -- 0:06:49
127000 -- (-1944.548) [-1943.155] (-1946.708) (-1949.405) * [-1943.401] (-1945.959) (-1945.054) (-1941.004) -- 0:06:52
128000 -- (-1951.734) (-1957.094) (-1944.941) [-1941.034] * (-1944.517) [-1945.839] (-1944.328) (-1943.565) -- 0:06:48
129000 -- (-1945.460) (-1957.903) [-1949.070] (-1947.207) * (-1939.643) [-1941.921] (-1944.275) (-1944.047) -- 0:06:51
130000 -- (-1938.533) (-1947.262) (-1943.081) [-1938.038] * (-1951.664) (-1937.946) (-1947.488) [-1943.571] -- 0:06:48
Average standard deviation of split frequencies: 0.030866
131000 -- (-1942.023) (-1942.273) (-1947.958) [-1942.447] * (-1941.560) (-1943.819) [-1946.718] (-1944.108) -- 0:06:51
132000 -- [-1943.278] (-1946.066) (-1946.743) (-1948.378) * (-1943.615) [-1937.020] (-1939.966) (-1943.441) -- 0:06:47
133000 -- [-1942.301] (-1945.535) (-1941.694) (-1942.098) * (-1945.772) (-1943.359) (-1941.286) [-1939.916] -- 0:06:50
134000 -- (-1947.101) (-1940.829) [-1940.183] (-1944.953) * (-1944.996) [-1947.237] (-1943.187) (-1945.421) -- 0:06:47
135000 -- (-1942.277) [-1952.750] (-1941.335) (-1938.886) * (-1945.989) [-1940.202] (-1946.149) (-1940.807) -- 0:06:50
Average standard deviation of split frequencies: 0.031581
136000 -- (-1946.738) (-1947.932) [-1939.906] (-1942.323) * (-1943.927) [-1942.443] (-1945.007) (-1945.527) -- 0:06:46
137000 -- [-1944.057] (-1949.518) (-1940.095) (-1949.889) * (-1941.111) (-1948.907) (-1946.039) [-1939.709] -- 0:06:49
138000 -- (-1944.842) [-1939.833] (-1945.503) (-1942.503) * (-1946.051) (-1937.516) [-1947.539] (-1946.503) -- 0:06:46
139000 -- (-1941.916) (-1951.604) (-1943.675) [-1940.311] * (-1953.840) [-1942.903] (-1954.641) (-1945.113) -- 0:06:48
140000 -- [-1940.818] (-1950.598) (-1945.957) (-1938.266) * (-1940.614) (-1944.965) [-1945.161] (-1944.289) -- 0:06:45
Average standard deviation of split frequencies: 0.031650
141000 -- [-1941.527] (-1941.991) (-1947.644) (-1942.368) * (-1947.466) (-1941.641) (-1947.329) [-1942.532] -- 0:06:42
142000 -- (-1951.563) (-1940.526) [-1943.060] (-1944.947) * [-1943.985] (-1951.517) (-1941.155) (-1943.329) -- 0:06:44
143000 -- (-1941.500) (-1941.844) (-1944.472) [-1942.444] * (-1940.468) (-1941.880) (-1940.710) [-1942.149] -- 0:06:41
144000 -- (-1943.848) [-1948.131] (-1948.970) (-1946.449) * (-1942.347) (-1948.326) [-1942.462] (-1941.918) -- 0:06:44
145000 -- (-1938.651) (-1942.110) [-1942.923] (-1940.398) * (-1941.382) (-1942.218) (-1946.901) [-1948.909] -- 0:06:40
Average standard deviation of split frequencies: 0.026907
146000 -- (-1940.711) (-1940.668) (-1942.824) [-1940.924] * (-1946.429) [-1944.475] (-1942.076) (-1940.487) -- 0:06:43
147000 -- (-1945.239) (-1941.101) [-1948.058] (-1946.800) * (-1938.662) (-1942.331) (-1944.620) [-1952.134] -- 0:06:40
148000 -- (-1938.228) [-1944.138] (-1943.356) (-1947.059) * (-1943.526) (-1942.753) [-1940.431] (-1949.510) -- 0:06:42
149000 -- (-1941.658) [-1938.655] (-1945.839) (-1948.225) * (-1938.508) (-1950.308) [-1944.520] (-1954.706) -- 0:06:39
150000 -- [-1938.724] (-1947.166) (-1945.716) (-1950.480) * (-1947.454) (-1943.236) (-1946.004) [-1944.633] -- 0:06:42
Average standard deviation of split frequencies: 0.028159
151000 -- [-1939.792] (-1943.879) (-1945.757) (-1956.200) * (-1941.425) (-1945.990) (-1949.899) [-1939.310] -- 0:06:39
152000 -- (-1941.007) (-1949.835) [-1943.000] (-1943.326) * (-1942.509) (-1941.847) (-1942.119) [-1940.467] -- 0:06:41
153000 -- (-1946.336) (-1937.751) (-1947.461) [-1944.653] * (-1947.142) (-1945.065) [-1949.780] (-1944.815) -- 0:06:38
154000 -- (-1940.332) (-1936.708) (-1944.062) [-1940.122] * [-1944.566] (-1948.181) (-1938.996) (-1955.657) -- 0:06:41
155000 -- (-1939.295) (-1945.489) [-1945.777] (-1944.762) * [-1947.106] (-1937.534) (-1945.573) (-1946.015) -- 0:06:37
Average standard deviation of split frequencies: 0.024930
156000 -- (-1943.148) (-1949.132) (-1954.216) [-1939.988] * (-1945.411) [-1943.313] (-1945.673) (-1949.701) -- 0:06:40
157000 -- (-1943.572) (-1947.472) (-1943.110) [-1945.790] * (-1936.132) [-1940.665] (-1950.133) (-1954.097) -- 0:06:37
158000 -- (-1944.264) (-1943.217) [-1948.177] (-1944.725) * (-1936.846) [-1948.973] (-1944.834) (-1954.218) -- 0:06:34
159000 -- (-1941.576) (-1946.513) (-1938.791) [-1943.319] * (-1946.306) [-1943.275] (-1947.499) (-1943.079) -- 0:06:36
160000 -- (-1946.869) (-1949.833) (-1941.035) [-1944.124] * (-1937.451) [-1943.665] (-1940.529) (-1945.857) -- 0:06:33
Average standard deviation of split frequencies: 0.017971
161000 -- (-1946.832) (-1945.139) (-1943.682) [-1941.771] * [-1943.534] (-1947.486) (-1946.098) (-1944.614) -- 0:06:36
162000 -- [-1939.668] (-1949.624) (-1944.642) (-1943.636) * (-1945.007) (-1949.122) [-1937.143] (-1942.660) -- 0:06:33
163000 -- [-1944.013] (-1947.692) (-1944.413) (-1940.603) * [-1940.577] (-1940.481) (-1942.569) (-1940.598) -- 0:06:35
164000 -- (-1942.583) (-1950.526) [-1945.974] (-1948.948) * (-1942.365) (-1943.084) (-1939.753) [-1944.145] -- 0:06:32
165000 -- (-1943.597) (-1948.743) (-1943.980) [-1946.244] * [-1950.106] (-1941.707) (-1949.941) (-1947.351) -- 0:06:34
Average standard deviation of split frequencies: 0.015264
166000 -- (-1945.937) [-1944.548] (-1939.976) (-1944.218) * [-1942.240] (-1945.573) (-1946.181) (-1941.009) -- 0:06:31
167000 -- (-1946.332) [-1949.635] (-1951.568) (-1939.491) * (-1938.636) (-1947.520) (-1945.639) [-1944.210] -- 0:06:34
168000 -- [-1946.194] (-1939.532) (-1946.099) (-1946.982) * [-1943.957] (-1957.320) (-1949.453) (-1941.910) -- 0:06:31
169000 -- [-1944.114] (-1945.770) (-1949.582) (-1938.060) * [-1942.039] (-1943.053) (-1943.459) (-1947.355) -- 0:06:33
170000 -- [-1938.169] (-1937.428) (-1945.279) (-1940.920) * (-1941.556) (-1942.519) (-1943.145) [-1949.561] -- 0:06:30
Average standard deviation of split frequencies: 0.015537
171000 -- (-1943.424) (-1943.227) [-1949.563] (-1943.617) * [-1945.340] (-1946.242) (-1945.750) (-1945.686) -- 0:06:32
172000 -- (-1942.634) (-1942.767) (-1947.023) [-1943.299] * (-1948.621) (-1946.680) [-1940.966] (-1940.935) -- 0:06:29
173000 -- (-1940.915) (-1942.125) (-1942.008) [-1949.724] * (-1941.714) (-1944.727) [-1943.040] (-1941.110) -- 0:06:31
174000 -- [-1941.420] (-1939.989) (-1939.315) (-1941.705) * (-1937.839) [-1942.842] (-1948.420) (-1941.195) -- 0:06:29
175000 -- [-1941.715] (-1941.873) (-1951.500) (-1939.072) * [-1943.166] (-1941.987) (-1937.196) (-1952.738) -- 0:06:31
Average standard deviation of split frequencies: 0.017075
176000 -- (-1947.667) [-1945.454] (-1941.877) (-1948.578) * (-1944.467) [-1947.915] (-1937.722) (-1940.225) -- 0:06:28
177000 -- (-1939.241) (-1941.740) (-1950.164) [-1941.542] * (-1940.926) (-1939.860) (-1946.364) [-1947.432] -- 0:06:30
178000 -- (-1943.784) (-1937.684) [-1942.128] (-1942.297) * [-1943.984] (-1942.502) (-1950.177) (-1951.143) -- 0:06:27
179000 -- (-1947.378) (-1943.349) (-1943.937) [-1937.403] * (-1941.247) [-1940.312] (-1944.333) (-1940.652) -- 0:06:25
180000 -- [-1943.610] (-1937.467) (-1953.002) (-1944.997) * [-1942.318] (-1942.265) (-1944.886) (-1943.841) -- 0:06:27
Average standard deviation of split frequencies: 0.017612
181000 -- (-1943.091) (-1947.504) (-1944.249) [-1942.043] * [-1945.668] (-1942.669) (-1942.390) (-1943.653) -- 0:06:24
182000 -- (-1944.973) [-1935.545] (-1951.196) (-1945.374) * (-1942.553) (-1944.157) (-1947.990) [-1943.072] -- 0:06:26
183000 -- (-1945.243) (-1942.062) (-1953.024) [-1944.703] * [-1954.495] (-1948.335) (-1946.539) (-1947.066) -- 0:06:23
184000 -- [-1941.177] (-1942.802) (-1941.632) (-1939.731) * (-1947.362) (-1951.613) (-1945.970) [-1946.565] -- 0:06:25
185000 -- (-1944.426) (-1935.961) [-1938.210] (-1947.403) * (-1948.692) (-1940.396) [-1942.347] (-1943.375) -- 0:06:23
Average standard deviation of split frequencies: 0.013623
186000 -- (-1945.302) [-1943.236] (-1941.041) (-1950.283) * (-1949.049) [-1941.010] (-1945.788) (-1947.004) -- 0:06:25
187000 -- (-1944.580) [-1939.340] (-1935.328) (-1958.876) * (-1947.657) (-1940.533) [-1938.787] (-1939.860) -- 0:06:22
188000 -- (-1946.434) (-1939.359) (-1948.564) [-1945.886] * (-1944.313) (-1938.316) [-1948.579] (-1941.156) -- 0:06:24
189000 -- (-1945.569) [-1937.410] (-1953.402) (-1943.907) * (-1942.702) (-1941.614) [-1945.064] (-1946.542) -- 0:06:21
190000 -- (-1954.276) [-1939.618] (-1943.600) (-1940.151) * (-1944.353) (-1946.571) [-1942.759] (-1945.179) -- 0:06:23
Average standard deviation of split frequencies: 0.014216
191000 -- (-1940.808) (-1941.372) (-1943.494) [-1948.133] * (-1943.177) (-1948.610) [-1949.052] (-1948.163) -- 0:06:21
192000 -- (-1949.760) (-1945.833) [-1940.167] (-1938.940) * (-1942.248) [-1940.636] (-1949.986) (-1949.680) -- 0:06:22
193000 -- (-1941.477) (-1949.290) [-1941.489] (-1950.233) * (-1945.858) (-1937.177) (-1950.713) [-1945.569] -- 0:06:20
194000 -- (-1941.993) (-1948.488) (-1941.400) [-1940.027] * (-1948.069) (-1941.935) (-1946.590) [-1953.078] -- 0:06:22
195000 -- (-1944.895) [-1938.618] (-1948.313) (-1945.039) * (-1939.327) [-1940.117] (-1946.033) (-1941.217) -- 0:06:19
Average standard deviation of split frequencies: 0.014431
196000 -- (-1942.219) (-1947.517) (-1945.002) [-1945.601] * (-1941.352) (-1940.699) [-1939.816] (-1947.862) -- 0:06:21
197000 -- (-1951.175) (-1948.991) [-1948.123] (-1942.797) * (-1949.613) (-1945.862) [-1941.646] (-1946.066) -- 0:06:19
198000 -- (-1944.383) (-1941.228) [-1942.316] (-1945.939) * (-1941.577) (-1943.018) (-1951.483) [-1941.692] -- 0:06:20
199000 -- (-1946.942) (-1941.788) [-1939.184] (-1942.659) * [-1949.036] (-1953.013) (-1945.673) (-1938.578) -- 0:06:18
200000 -- (-1940.752) (-1946.233) (-1945.472) [-1943.016] * (-1943.409) (-1941.281) (-1943.229) [-1943.428] -- 0:06:20
Average standard deviation of split frequencies: 0.013802
201000 -- (-1953.339) [-1948.209] (-1946.281) (-1944.937) * [-1944.741] (-1946.066) (-1943.832) (-1948.963) -- 0:06:17
202000 -- (-1947.947) (-1942.563) [-1941.270] (-1945.925) * (-1941.308) (-1944.920) (-1948.321) [-1938.465] -- 0:06:15
203000 -- (-1950.692) (-1947.161) [-1938.696] (-1943.755) * (-1941.424) [-1941.310] (-1945.388) (-1937.249) -- 0:06:16
204000 -- (-1945.890) [-1939.181] (-1944.471) (-1941.423) * (-1945.653) (-1946.557) [-1948.808] (-1942.665) -- 0:06:14
205000 -- (-1944.950) (-1944.144) (-1941.397) [-1950.037] * (-1939.694) (-1943.809) [-1937.813] (-1954.543) -- 0:06:16
Average standard deviation of split frequencies: 0.012300
206000 -- (-1949.860) (-1942.078) (-1947.095) [-1948.322] * (-1946.430) (-1951.842) (-1942.460) [-1942.696] -- 0:06:13
207000 -- (-1947.984) [-1940.113] (-1947.138) (-1944.278) * (-1948.481) [-1941.179] (-1948.145) (-1947.678) -- 0:06:15
208000 -- (-1946.504) (-1939.789) [-1944.518] (-1953.861) * [-1940.250] (-1939.701) (-1950.188) (-1950.875) -- 0:06:13
209000 -- [-1955.240] (-1939.628) (-1948.964) (-1946.311) * (-1943.328) (-1940.494) (-1944.033) [-1939.785] -- 0:06:14
210000 -- (-1943.715) (-1948.336) [-1948.621] (-1948.075) * (-1945.319) [-1937.839] (-1948.340) (-1942.055) -- 0:06:12
Average standard deviation of split frequencies: 0.012028
211000 -- (-1947.769) (-1939.293) (-1946.296) [-1941.829] * (-1942.418) (-1944.788) [-1939.349] (-1944.797) -- 0:06:13
212000 -- (-1940.813) [-1937.611] (-1942.057) (-1940.367) * (-1944.471) [-1945.257] (-1938.342) (-1947.495) -- 0:06:11
213000 -- [-1946.138] (-1943.375) (-1940.525) (-1948.651) * (-1946.064) (-1945.368) (-1952.334) [-1942.144] -- 0:06:13
214000 -- (-1937.960) [-1945.071] (-1941.138) (-1948.348) * (-1945.127) (-1943.588) (-1946.964) [-1944.621] -- 0:06:10
215000 -- (-1943.314) [-1948.061] (-1944.156) (-1947.271) * (-1942.590) [-1940.618] (-1954.036) (-1942.193) -- 0:06:12
Average standard deviation of split frequencies: 0.015550
216000 -- (-1946.995) (-1949.749) (-1945.228) [-1939.233] * (-1945.146) [-1945.224] (-1943.574) (-1942.276) -- 0:06:10
217000 -- [-1953.828] (-1948.659) (-1943.949) (-1945.282) * (-1938.945) (-1942.892) (-1953.373) [-1943.950] -- 0:06:11
218000 -- (-1960.499) (-1949.511) (-1949.278) [-1940.576] * [-1942.870] (-1949.101) (-1941.473) (-1947.503) -- 0:06:09
219000 -- [-1940.700] (-1958.572) (-1940.944) (-1938.057) * (-1944.620) (-1947.206) [-1939.900] (-1942.498) -- 0:06:10
220000 -- (-1941.855) (-1947.861) (-1948.635) [-1940.362] * (-1943.784) (-1942.642) (-1939.169) [-1937.411] -- 0:06:08
Average standard deviation of split frequencies: 0.014687
221000 -- (-1950.791) [-1950.457] (-1942.379) (-1947.718) * [-1939.334] (-1950.521) (-1949.292) (-1941.173) -- 0:06:06
222000 -- [-1938.407] (-1952.341) (-1943.501) (-1944.284) * (-1947.106) (-1949.585) (-1943.196) [-1945.193] -- 0:06:07
223000 -- [-1952.941] (-1948.609) (-1946.580) (-1942.834) * (-1946.050) [-1944.914] (-1938.196) (-1943.709) -- 0:06:05
224000 -- (-1954.235) (-1941.219) (-1948.506) [-1943.739] * (-1946.103) (-1942.566) [-1941.577] (-1943.804) -- 0:06:07
225000 -- (-1946.651) (-1943.297) [-1945.714] (-1942.033) * [-1949.969] (-1935.850) (-1949.226) (-1949.349) -- 0:06:05
Average standard deviation of split frequencies: 0.011733
226000 -- (-1954.065) (-1937.218) [-1939.094] (-1948.064) * (-1940.020) [-1943.788] (-1947.125) (-1942.981) -- 0:06:06
227000 -- (-1955.641) (-1943.188) [-1942.456] (-1941.213) * [-1940.239] (-1935.463) (-1939.069) (-1938.612) -- 0:06:04
228000 -- (-1957.221) (-1954.418) (-1943.394) [-1939.114] * (-1946.329) (-1951.858) (-1942.667) [-1945.556] -- 0:06:05
229000 -- (-1940.578) (-1943.264) [-1948.232] (-1946.540) * [-1947.532] (-1947.696) (-1942.716) (-1941.868) -- 0:06:03
230000 -- (-1944.113) (-1944.415) (-1942.014) [-1938.010] * (-1936.623) (-1939.576) [-1939.257] (-1948.486) -- 0:06:04
Average standard deviation of split frequencies: 0.010985
231000 -- (-1941.433) (-1941.427) (-1940.346) [-1943.928] * [-1947.094] (-1953.494) (-1937.655) (-1951.208) -- 0:06:02
232000 -- (-1950.295) [-1942.369] (-1939.860) (-1939.057) * [-1941.500] (-1941.340) (-1945.489) (-1944.517) -- 0:06:04
233000 -- (-1939.501) [-1940.364] (-1952.222) (-1941.454) * (-1944.510) [-1945.969] (-1945.492) (-1945.699) -- 0:06:02
234000 -- [-1939.607] (-1949.452) (-1948.518) (-1939.895) * (-1949.210) [-1946.079] (-1947.036) (-1954.991) -- 0:06:03
235000 -- [-1938.972] (-1945.249) (-1938.085) (-1941.750) * (-1943.267) [-1942.848] (-1942.321) (-1946.988) -- 0:06:01
Average standard deviation of split frequencies: 0.010487
236000 -- (-1940.940) (-1940.580) (-1939.478) [-1944.378] * (-1939.724) (-1946.530) [-1942.292] (-1949.404) -- 0:06:02
237000 -- (-1941.177) [-1945.576] (-1943.708) (-1946.134) * [-1943.622] (-1950.558) (-1944.682) (-1946.892) -- 0:06:00
238000 -- [-1941.834] (-1944.923) (-1945.510) (-1943.419) * (-1945.168) (-1945.314) [-1950.847] (-1950.112) -- 0:05:58
239000 -- [-1941.798] (-1942.988) (-1944.202) (-1952.572) * [-1941.401] (-1943.789) (-1954.075) (-1944.339) -- 0:05:59
240000 -- (-1943.990) [-1942.247] (-1946.215) (-1945.141) * [-1943.867] (-1944.368) (-1944.573) (-1942.178) -- 0:05:57
Average standard deviation of split frequencies: 0.011018
241000 -- (-1940.290) (-1944.031) (-1949.925) [-1942.832] * (-1939.708) (-1941.277) (-1944.698) [-1941.655] -- 0:05:59
242000 -- (-1947.281) [-1941.734] (-1943.085) (-1946.245) * (-1945.056) (-1947.762) [-1945.932] (-1940.718) -- 0:05:57
243000 -- [-1941.043] (-1943.805) (-1944.662) (-1949.554) * (-1946.229) (-1946.952) [-1944.635] (-1938.049) -- 0:05:58
244000 -- (-1941.902) [-1938.029] (-1945.111) (-1945.843) * (-1938.079) [-1943.556] (-1941.404) (-1950.164) -- 0:05:56
245000 -- (-1946.647) (-1935.766) (-1942.335) [-1944.460] * (-1948.518) (-1945.973) [-1936.399] (-1943.169) -- 0:05:57
Average standard deviation of split frequencies: 0.011019
246000 -- (-1950.103) [-1938.343] (-1942.904) (-1946.334) * [-1951.043] (-1942.144) (-1945.559) (-1946.373) -- 0:05:55
247000 -- (-1941.334) [-1942.332] (-1954.624) (-1947.622) * (-1936.569) (-1942.745) [-1941.697] (-1947.658) -- 0:05:56
248000 -- (-1935.778) (-1939.300) (-1954.527) [-1948.285] * (-1946.163) (-1944.841) (-1944.392) [-1942.440] -- 0:05:54
249000 -- (-1942.692) [-1942.188] (-1950.237) (-1945.912) * [-1944.716] (-1946.617) (-1945.613) (-1945.293) -- 0:05:55
250000 -- (-1941.554) (-1938.254) [-1943.136] (-1944.062) * (-1945.066) [-1946.423] (-1949.554) (-1941.811) -- 0:05:54
Average standard deviation of split frequencies: 0.012929
251000 -- (-1946.002) (-1943.026) [-1946.532] (-1942.253) * (-1940.792) (-1948.348) (-1941.867) [-1943.050] -- 0:05:55
252000 -- (-1940.710) (-1945.395) (-1945.531) [-1941.099] * (-1942.837) [-1951.941] (-1946.704) (-1944.511) -- 0:05:53
253000 -- (-1938.540) (-1939.229) [-1939.371] (-1940.468) * [-1944.033] (-1944.670) (-1943.298) (-1952.820) -- 0:05:54
254000 -- (-1944.493) [-1939.345] (-1945.868) (-1951.658) * (-1947.221) (-1940.256) (-1946.679) [-1943.264] -- 0:05:52
255000 -- (-1944.473) (-1945.936) (-1941.264) [-1942.179] * (-1943.596) (-1943.693) (-1950.951) [-1944.946] -- 0:05:53
Average standard deviation of split frequencies: 0.013299
256000 -- (-1939.498) [-1938.131] (-1939.196) (-1943.811) * (-1945.931) [-1938.778] (-1946.428) (-1944.009) -- 0:05:51
257000 -- [-1947.916] (-1948.965) (-1948.662) (-1948.478) * (-1944.660) [-1944.259] (-1945.910) (-1943.154) -- 0:05:49
258000 -- (-1956.295) (-1952.616) (-1937.430) [-1947.119] * (-1943.577) (-1940.801) (-1946.754) [-1945.054] -- 0:05:50
259000 -- (-1946.944) (-1942.428) [-1949.084] (-1947.281) * [-1944.119] (-1948.858) (-1939.256) (-1939.138) -- 0:05:49
260000 -- (-1943.034) (-1942.395) (-1943.240) [-1947.958] * (-1944.740) (-1948.974) (-1938.041) [-1944.822] -- 0:05:50
Average standard deviation of split frequencies: 0.013262
261000 -- (-1941.224) (-1941.003) [-1941.845] (-1946.341) * (-1942.639) [-1950.163] (-1944.542) (-1950.116) -- 0:05:48
262000 -- (-1947.543) (-1944.352) [-1943.178] (-1943.898) * (-1946.023) (-1945.137) (-1939.721) [-1947.457] -- 0:05:49
263000 -- [-1946.186] (-1945.467) (-1942.690) (-1946.160) * [-1947.262] (-1943.764) (-1942.755) (-1951.261) -- 0:05:47
264000 -- (-1942.827) (-1947.777) [-1950.451] (-1949.777) * [-1940.209] (-1941.970) (-1942.742) (-1945.641) -- 0:05:48
265000 -- (-1942.195) [-1944.560] (-1947.628) (-1942.972) * (-1945.454) (-1941.001) (-1939.180) [-1942.064] -- 0:05:46
Average standard deviation of split frequencies: 0.010830
266000 -- (-1943.480) [-1946.787] (-1946.358) (-1942.650) * (-1949.722) [-1943.125] (-1946.390) (-1942.625) -- 0:05:47
267000 -- (-1943.433) (-1945.540) [-1948.433] (-1946.059) * (-1943.912) (-1939.506) [-1940.863] (-1941.489) -- 0:05:45
268000 -- [-1947.283] (-1940.271) (-1946.920) (-1939.968) * (-1944.692) [-1943.913] (-1940.320) (-1941.066) -- 0:05:46
269000 -- [-1947.761] (-1947.239) (-1949.395) (-1950.081) * [-1944.020] (-1949.469) (-1944.420) (-1952.186) -- 0:05:45
270000 -- [-1943.496] (-1947.793) (-1952.534) (-1948.116) * (-1943.083) (-1942.170) [-1939.173] (-1943.204) -- 0:05:46
Average standard deviation of split frequencies: 0.010014
271000 -- [-1953.099] (-1941.063) (-1952.878) (-1948.561) * (-1945.113) [-1941.598] (-1943.796) (-1941.363) -- 0:05:44
272000 -- (-1942.340) [-1942.363] (-1953.901) (-1940.603) * [-1943.426] (-1945.766) (-1951.844) (-1935.884) -- 0:05:45
273000 -- (-1947.043) (-1943.809) [-1943.285] (-1946.091) * (-1948.819) [-1941.926] (-1948.114) (-1936.959) -- 0:05:43
274000 -- (-1950.253) (-1942.170) [-1944.382] (-1942.337) * (-1952.609) [-1937.658] (-1954.618) (-1943.214) -- 0:05:44
275000 -- (-1943.744) (-1947.883) (-1948.542) [-1947.511] * (-1938.966) [-1944.780] (-1940.941) (-1950.045) -- 0:05:42
Average standard deviation of split frequencies: 0.007899
276000 -- [-1940.914] (-1947.607) (-1942.374) (-1944.093) * (-1939.991) [-1938.931] (-1946.444) (-1942.538) -- 0:05:41
277000 -- (-1943.011) (-1948.589) [-1946.510] (-1942.432) * (-1947.227) (-1946.844) (-1950.743) [-1939.522] -- 0:05:41
278000 -- (-1939.291) (-1951.288) [-1942.803] (-1940.788) * (-1943.795) (-1940.929) (-1942.631) [-1944.838] -- 0:05:40
279000 -- [-1936.958] (-1950.200) (-1938.632) (-1938.566) * (-1949.694) [-1939.490] (-1944.707) (-1949.069) -- 0:05:41
280000 -- (-1947.305) (-1952.866) [-1944.607] (-1946.828) * (-1953.075) [-1949.796] (-1941.528) (-1960.256) -- 0:05:39
Average standard deviation of split frequencies: 0.011197
281000 -- (-1946.491) (-1951.241) [-1943.173] (-1943.548) * (-1951.368) [-1944.333] (-1946.222) (-1946.728) -- 0:05:40
282000 -- (-1940.697) (-1941.908) [-1939.847] (-1941.769) * (-1945.024) [-1950.275] (-1945.928) (-1941.537) -- 0:05:38
283000 -- [-1942.420] (-1948.402) (-1942.505) (-1938.875) * (-1944.608) (-1947.053) [-1939.643] (-1948.562) -- 0:05:39
284000 -- (-1944.305) (-1940.820) (-1945.218) [-1941.039] * (-1949.360) (-1943.530) (-1943.626) [-1943.733] -- 0:05:37
285000 -- [-1947.544] (-1945.658) (-1943.077) (-1949.695) * (-1953.162) (-1939.113) [-1938.057] (-1945.818) -- 0:05:38
Average standard deviation of split frequencies: 0.010073
286000 -- (-1943.247) (-1942.820) [-1943.455] (-1944.162) * (-1949.952) (-1942.023) [-1944.812] (-1945.226) -- 0:05:37
287000 -- (-1944.988) (-1947.356) [-1942.929] (-1945.111) * [-1952.146] (-1945.281) (-1941.899) (-1943.875) -- 0:05:37
288000 -- [-1938.823] (-1944.342) (-1946.687) (-1945.928) * [-1947.930] (-1941.412) (-1946.094) (-1952.041) -- 0:05:36
289000 -- (-1941.275) [-1947.446] (-1943.171) (-1941.579) * (-1946.766) (-1944.588) (-1943.259) [-1941.467] -- 0:05:37
290000 -- [-1947.995] (-1945.279) (-1950.938) (-1955.100) * [-1949.088] (-1950.999) (-1945.909) (-1943.967) -- 0:05:35
Average standard deviation of split frequencies: 0.010452
291000 -- (-1939.781) [-1942.846] (-1953.484) (-1947.205) * [-1942.609] (-1945.124) (-1943.340) (-1939.930) -- 0:05:36
292000 -- [-1942.346] (-1944.741) (-1949.967) (-1950.759) * (-1943.197) [-1939.937] (-1946.316) (-1940.682) -- 0:05:34
293000 -- [-1944.365] (-1943.818) (-1950.461) (-1942.178) * (-1943.544) [-1936.813] (-1956.032) (-1939.637) -- 0:05:32
294000 -- (-1943.942) (-1947.092) [-1948.227] (-1947.166) * [-1946.919] (-1946.964) (-1940.917) (-1940.778) -- 0:05:33
295000 -- (-1949.835) [-1944.329] (-1944.389) (-1951.778) * [-1939.169] (-1947.408) (-1943.282) (-1947.416) -- 0:05:32
Average standard deviation of split frequencies: 0.009732
296000 -- (-1939.823) [-1942.684] (-1944.061) (-1948.720) * (-1942.723) [-1942.769] (-1940.980) (-1948.961) -- 0:05:32
297000 -- (-1943.411) (-1946.244) [-1943.738] (-1950.200) * (-1946.475) (-1947.109) (-1944.121) [-1943.532] -- 0:05:31
298000 -- (-1941.804) (-1939.751) (-1947.669) [-1941.806] * (-1947.223) (-1943.367) [-1946.195] (-1945.895) -- 0:05:32
299000 -- (-1943.453) [-1942.129] (-1937.172) (-1936.877) * (-1945.515) (-1944.043) (-1943.128) [-1943.403] -- 0:05:30
300000 -- (-1944.981) (-1944.502) (-1950.978) [-1946.624] * [-1940.364] (-1944.252) (-1943.742) (-1950.117) -- 0:05:31
Average standard deviation of split frequencies: 0.010801
301000 -- (-1939.865) (-1947.511) (-1948.545) [-1943.466] * [-1944.475] (-1945.052) (-1943.796) (-1949.150) -- 0:05:29
302000 -- [-1943.251] (-1952.418) (-1950.170) (-1942.303) * (-1946.169) (-1952.111) [-1939.840] (-1944.940) -- 0:05:30
303000 -- (-1939.553) (-1944.788) (-1953.158) [-1940.687] * (-1945.027) (-1950.479) (-1943.515) [-1942.726] -- 0:05:28
304000 -- (-1946.624) [-1941.958] (-1946.473) (-1939.950) * (-1946.592) (-1947.434) (-1946.543) [-1943.101] -- 0:05:29
305000 -- (-1954.185) (-1943.978) (-1944.811) [-1943.168] * (-1942.266) (-1941.943) (-1948.655) [-1941.551] -- 0:05:28
Average standard deviation of split frequencies: 0.010441
306000 -- [-1940.186] (-1937.854) (-1947.670) (-1946.179) * (-1939.134) [-1949.418] (-1941.466) (-1943.150) -- 0:05:28
307000 -- (-1941.987) (-1954.157) (-1949.714) [-1942.639] * (-1949.675) (-1948.309) [-1952.893] (-1941.456) -- 0:05:27
308000 -- [-1942.037] (-1939.908) (-1953.838) (-1942.732) * [-1944.049] (-1949.061) (-1948.186) (-1943.599) -- 0:05:28
309000 -- (-1944.375) [-1943.059] (-1945.275) (-1944.413) * [-1941.637] (-1941.984) (-1946.425) (-1939.862) -- 0:05:26
310000 -- [-1942.264] (-1950.688) (-1946.924) (-1941.642) * [-1945.539] (-1944.328) (-1941.592) (-1941.816) -- 0:05:24
Average standard deviation of split frequencies: 0.010453
311000 -- [-1945.963] (-1939.596) (-1942.657) (-1943.151) * (-1941.080) (-1950.169) (-1948.328) [-1943.055] -- 0:05:25
312000 -- [-1942.863] (-1939.855) (-1943.177) (-1936.950) * (-1948.995) [-1942.570] (-1942.831) (-1941.830) -- 0:05:24
313000 -- (-1939.832) (-1944.557) [-1939.320] (-1943.772) * (-1943.477) (-1942.920) (-1939.066) [-1940.736] -- 0:05:24
314000 -- (-1945.989) (-1946.427) [-1943.239] (-1945.715) * (-1945.105) [-1943.514] (-1941.355) (-1941.427) -- 0:05:23
315000 -- (-1941.524) (-1942.129) [-1946.438] (-1940.824) * (-1946.479) (-1942.960) [-1940.856] (-1940.721) -- 0:05:24
Average standard deviation of split frequencies: 0.009448
316000 -- (-1941.911) (-1940.108) (-1941.799) [-1948.122] * (-1945.188) [-1941.823] (-1940.193) (-1944.505) -- 0:05:22
317000 -- (-1946.759) (-1946.537) (-1944.026) [-1952.784] * [-1943.647] (-1951.020) (-1940.613) (-1942.469) -- 0:05:23
318000 -- (-1940.638) (-1944.940) [-1942.876] (-1942.320) * (-1943.405) [-1939.456] (-1946.145) (-1949.962) -- 0:05:21
319000 -- (-1939.265) (-1944.066) (-1950.640) [-1940.262] * (-1942.851) [-1944.844] (-1944.452) (-1944.039) -- 0:05:22
320000 -- [-1941.444] (-1937.520) (-1941.684) (-1947.104) * (-1944.127) (-1945.495) [-1946.940] (-1945.708) -- 0:05:20
Average standard deviation of split frequencies: 0.010454
321000 -- (-1947.265) [-1943.346] (-1937.556) (-1948.339) * (-1939.111) [-1944.166] (-1941.855) (-1938.130) -- 0:05:21
322000 -- (-1946.915) [-1941.226] (-1942.080) (-1943.435) * [-1943.850] (-1944.967) (-1943.277) (-1945.423) -- 0:05:20
323000 -- [-1936.769] (-1957.008) (-1950.705) (-1942.137) * (-1937.114) (-1944.304) [-1942.828] (-1945.740) -- 0:05:20
324000 -- (-1940.076) (-1949.165) [-1944.661] (-1938.435) * (-1950.005) [-1944.459] (-1941.089) (-1949.141) -- 0:05:19
325000 -- (-1940.973) (-1945.532) (-1944.731) [-1943.418] * (-1942.397) (-1949.485) (-1946.831) [-1944.607] -- 0:05:19
Average standard deviation of split frequencies: 0.011568
326000 -- [-1944.261] (-1944.341) (-1940.482) (-1949.071) * [-1942.220] (-1939.646) (-1951.290) (-1944.984) -- 0:05:18
327000 -- (-1945.569) [-1955.563] (-1941.171) (-1951.863) * [-1943.444] (-1939.125) (-1950.986) (-1939.606) -- 0:05:19
328000 -- (-1953.721) (-1940.851) (-1942.906) [-1940.737] * (-1942.716) [-1941.598] (-1945.474) (-1939.067) -- 0:05:17
329000 -- (-1942.349) [-1937.624] (-1948.345) (-1936.575) * (-1940.095) (-1941.173) [-1939.165] (-1945.005) -- 0:05:18
330000 -- (-1947.223) [-1944.572] (-1939.758) (-1939.041) * (-1953.825) [-1937.109] (-1942.700) (-1944.403) -- 0:05:16
Average standard deviation of split frequencies: 0.012039
331000 -- (-1949.833) (-1946.232) (-1943.232) [-1939.814] * (-1938.370) (-1949.101) (-1940.200) [-1941.992] -- 0:05:15
332000 -- (-1946.202) (-1949.662) (-1938.173) [-1940.000] * (-1947.727) [-1941.614] (-1942.793) (-1946.375) -- 0:05:15
333000 -- (-1947.852) (-1945.626) [-1941.543] (-1942.947) * (-1940.751) (-1944.100) (-1948.019) [-1949.064] -- 0:05:14
334000 -- (-1943.169) (-1944.609) (-1944.019) [-1944.935] * (-1946.859) (-1940.994) [-1945.599] (-1946.422) -- 0:05:15
335000 -- (-1938.344) (-1948.554) (-1940.609) [-1944.907] * (-1941.416) [-1946.147] (-1942.111) (-1945.729) -- 0:05:13
Average standard deviation of split frequencies: 0.011692
336000 -- (-1943.771) [-1944.243] (-1948.165) (-1947.119) * [-1942.735] (-1943.368) (-1944.431) (-1947.323) -- 0:05:14
337000 -- [-1941.803] (-1943.609) (-1950.128) (-1945.377) * (-1952.622) (-1939.168) (-1941.265) [-1941.596] -- 0:05:12
338000 -- (-1939.462) [-1937.425] (-1941.295) (-1944.460) * (-1947.733) (-1942.493) (-1943.826) [-1942.306] -- 0:05:13
339000 -- [-1942.855] (-1936.386) (-1946.216) (-1945.718) * (-1946.968) (-1941.436) [-1936.236] (-1940.523) -- 0:05:11
340000 -- [-1950.709] (-1945.253) (-1941.325) (-1945.121) * (-1945.653) (-1945.476) [-1942.347] (-1947.358) -- 0:05:12
Average standard deviation of split frequencies: 0.012454
341000 -- [-1956.722] (-1954.096) (-1950.711) (-1943.327) * (-1942.526) (-1944.184) (-1945.008) [-1945.284] -- 0:05:11
342000 -- (-1943.953) (-1945.790) [-1943.647] (-1948.506) * (-1943.113) (-1949.300) [-1941.436] (-1941.527) -- 0:05:11
343000 -- [-1940.690] (-1946.930) (-1953.962) (-1942.355) * (-1940.420) [-1943.409] (-1946.153) (-1954.604) -- 0:05:10
344000 -- (-1945.518) (-1946.178) (-1941.281) [-1945.013] * [-1945.928] (-1938.528) (-1941.374) (-1956.328) -- 0:05:10
345000 -- (-1941.550) [-1943.871] (-1939.507) (-1939.561) * [-1948.786] (-1943.857) (-1943.421) (-1950.483) -- 0:05:09
Average standard deviation of split frequencies: 0.012565
346000 -- [-1941.738] (-1944.338) (-1949.021) (-1946.734) * (-1941.933) [-1940.850] (-1950.141) (-1941.116) -- 0:05:09
347000 -- (-1950.085) [-1942.590] (-1943.016) (-1945.597) * [-1938.821] (-1944.597) (-1942.950) (-1940.394) -- 0:05:08
348000 -- (-1946.979) (-1947.835) [-1943.878] (-1944.872) * (-1942.626) [-1943.422] (-1945.707) (-1941.422) -- 0:05:09
349000 -- [-1953.931] (-1943.891) (-1943.908) (-1939.188) * (-1939.486) (-1942.931) (-1943.462) [-1945.733] -- 0:05:07
350000 -- (-1939.561) (-1941.903) [-1945.344] (-1943.206) * (-1947.121) [-1944.122] (-1946.201) (-1944.527) -- 0:05:06
Average standard deviation of split frequencies: 0.012939
351000 -- (-1939.996) (-1944.695) [-1947.710] (-1950.887) * [-1943.390] (-1942.029) (-1942.329) (-1944.574) -- 0:05:06
352000 -- (-1944.993) [-1951.548] (-1941.883) (-1953.284) * [-1945.623] (-1943.085) (-1941.997) (-1942.044) -- 0:05:05
353000 -- [-1940.204] (-1943.194) (-1936.399) (-1946.194) * [-1938.737] (-1939.055) (-1939.411) (-1941.982) -- 0:05:06
354000 -- (-1940.680) (-1942.948) (-1946.875) [-1942.032] * (-1949.904) (-1945.349) [-1941.782] (-1950.282) -- 0:05:04
355000 -- (-1941.796) (-1942.478) (-1939.781) [-1937.750] * (-1945.085) [-1940.468] (-1947.931) (-1943.388) -- 0:05:05
Average standard deviation of split frequencies: 0.012580
356000 -- [-1946.097] (-1939.444) (-1942.427) (-1943.789) * (-1953.871) [-1942.857] (-1950.559) (-1944.011) -- 0:05:03
357000 -- (-1943.512) [-1940.147] (-1943.981) (-1950.338) * (-1943.158) [-1944.094] (-1944.425) (-1942.161) -- 0:05:04
358000 -- (-1938.601) [-1939.147] (-1946.370) (-1944.670) * (-1938.342) [-1940.505] (-1953.927) (-1946.183) -- 0:05:03
359000 -- (-1943.228) [-1942.495] (-1941.362) (-1943.280) * (-1943.323) [-1941.534] (-1945.570) (-1938.305) -- 0:05:03
360000 -- (-1944.424) (-1940.969) (-1943.330) [-1948.157] * [-1939.639] (-1947.297) (-1942.073) (-1942.196) -- 0:05:02
Average standard deviation of split frequencies: 0.011110
361000 -- (-1949.622) (-1942.412) (-1952.862) [-1947.894] * (-1940.994) [-1941.685] (-1945.304) (-1944.458) -- 0:05:02
362000 -- (-1953.797) (-1938.021) (-1943.727) [-1939.194] * [-1941.933] (-1943.010) (-1938.476) (-1941.912) -- 0:05:01
363000 -- (-1942.921) [-1941.334] (-1948.241) (-1948.307) * (-1948.808) (-1946.008) [-1940.818] (-1941.493) -- 0:05:01
364000 -- (-1944.081) (-1947.379) (-1940.431) [-1941.711] * (-1948.015) [-1945.251] (-1942.676) (-1947.980) -- 0:05:00
365000 -- [-1946.140] (-1945.770) (-1945.349) (-1946.438) * (-1947.086) (-1944.351) [-1940.599] (-1937.861) -- 0:05:00
Average standard deviation of split frequencies: 0.012880
366000 -- (-1940.083) [-1942.019] (-1950.669) (-1939.655) * (-1952.244) (-1946.086) (-1940.602) [-1939.958] -- 0:04:59
367000 -- (-1942.625) (-1938.320) [-1942.683] (-1947.926) * (-1949.809) (-1944.502) (-1947.542) [-1950.029] -- 0:05:00
368000 -- (-1943.304) [-1942.191] (-1952.342) (-1942.311) * (-1952.101) (-1945.917) (-1947.776) [-1939.476] -- 0:04:58
369000 -- (-1945.911) (-1944.301) [-1945.277] (-1944.144) * (-1949.520) (-1947.831) [-1946.969] (-1941.826) -- 0:04:59
370000 -- (-1945.178) [-1940.276] (-1941.233) (-1950.678) * (-1947.172) [-1948.142] (-1941.836) (-1946.817) -- 0:04:57
Average standard deviation of split frequencies: 0.012718
371000 -- (-1951.986) (-1940.648) [-1944.335] (-1942.643) * (-1949.195) [-1942.448] (-1937.487) (-1941.541) -- 0:04:58
372000 -- (-1959.078) [-1943.652] (-1940.418) (-1938.651) * (-1953.996) [-1943.081] (-1942.807) (-1940.238) -- 0:04:57
373000 -- [-1955.870] (-1943.027) (-1950.212) (-1939.831) * (-1941.619) [-1942.922] (-1939.811) (-1942.056) -- 0:04:55
374000 -- (-1946.368) [-1944.634] (-1944.736) (-1945.870) * (-1943.050) (-1945.219) (-1941.233) [-1943.114] -- 0:04:56
375000 -- [-1947.762] (-1951.443) (-1942.617) (-1950.871) * [-1942.966] (-1936.413) (-1948.692) (-1944.362) -- 0:04:55
Average standard deviation of split frequencies: 0.012067
376000 -- (-1948.380) (-1951.044) (-1941.692) [-1947.172] * (-1941.908) (-1942.935) [-1941.174] (-1941.030) -- 0:04:55
377000 -- (-1948.397) [-1946.865] (-1939.185) (-1946.088) * (-1944.333) (-1942.422) [-1938.476] (-1944.338) -- 0:04:54
378000 -- (-1949.684) (-1941.140) (-1943.771) [-1939.033] * (-1945.514) (-1942.035) [-1943.064] (-1941.588) -- 0:04:54
379000 -- (-1948.860) (-1943.547) (-1953.459) [-1944.218] * (-1946.992) (-1945.539) [-1943.310] (-1943.673) -- 0:04:53
380000 -- (-1945.959) [-1947.407] (-1956.188) (-1946.041) * (-1939.891) [-1943.421] (-1955.454) (-1944.054) -- 0:04:53
Average standard deviation of split frequencies: 0.008823
381000 -- (-1940.486) (-1941.681) [-1951.750] (-1943.847) * (-1946.649) (-1938.903) [-1942.480] (-1949.089) -- 0:04:52
382000 -- (-1944.370) [-1944.471] (-1941.606) (-1945.379) * (-1947.874) (-1940.162) [-1953.206] (-1958.354) -- 0:04:52
383000 -- [-1938.819] (-1942.168) (-1952.413) (-1944.305) * (-1945.762) (-1947.827) [-1955.506] (-1953.204) -- 0:04:51
384000 -- [-1942.406] (-1942.512) (-1942.152) (-1944.699) * (-1948.249) (-1955.176) (-1945.929) [-1941.613] -- 0:04:51
385000 -- (-1942.663) (-1943.044) [-1941.587] (-1946.940) * (-1939.695) [-1937.305] (-1946.752) (-1946.802) -- 0:04:50
Average standard deviation of split frequencies: 0.010839
386000 -- (-1942.368) (-1941.101) [-1941.276] (-1943.410) * (-1953.892) (-1940.713) (-1942.078) [-1943.204] -- 0:04:51
387000 -- (-1943.707) [-1942.081] (-1938.422) (-1943.470) * [-1944.353] (-1946.828) (-1940.482) (-1946.959) -- 0:04:49
388000 -- (-1942.808) (-1942.226) [-1945.087] (-1938.921) * (-1941.406) (-1941.990) (-1942.435) [-1941.388] -- 0:04:50
389000 -- (-1946.830) (-1940.728) (-1943.557) [-1942.440] * (-1939.105) [-1942.063] (-1941.991) (-1947.638) -- 0:04:49
390000 -- (-1945.786) (-1945.345) [-1946.143] (-1941.333) * [-1944.484] (-1942.127) (-1944.741) (-1945.061) -- 0:04:49
Average standard deviation of split frequencies: 0.009503
391000 -- (-1942.094) [-1940.648] (-1945.669) (-1942.289) * (-1941.507) (-1938.945) [-1944.377] (-1950.506) -- 0:04:48
392000 -- (-1953.091) [-1943.735] (-1938.767) (-1941.759) * [-1942.221] (-1952.820) (-1940.993) (-1941.083) -- 0:04:46
393000 -- (-1949.383) (-1943.930) (-1947.694) [-1941.071] * [-1941.610] (-1948.139) (-1940.718) (-1942.650) -- 0:04:47
394000 -- (-1939.906) [-1941.591] (-1940.679) (-1947.800) * (-1952.084) (-1946.430) [-1944.163] (-1954.772) -- 0:04:46
395000 -- (-1944.335) (-1948.051) [-1943.919] (-1948.852) * [-1946.532] (-1941.401) (-1946.794) (-1946.842) -- 0:04:46
Average standard deviation of split frequencies: 0.010267
396000 -- [-1939.545] (-1946.492) (-1946.111) (-1943.290) * [-1942.851] (-1960.119) (-1945.363) (-1953.910) -- 0:04:45
397000 -- (-1943.006) (-1945.908) (-1945.268) [-1943.382] * [-1947.210] (-1944.912) (-1945.908) (-1953.219) -- 0:04:45
398000 -- (-1944.219) (-1946.982) (-1940.473) [-1948.095] * [-1943.940] (-1950.647) (-1943.260) (-1943.329) -- 0:04:44
399000 -- [-1942.406] (-1955.458) (-1940.504) (-1946.292) * [-1947.312] (-1943.650) (-1944.162) (-1940.422) -- 0:04:44
400000 -- (-1939.321) (-1943.496) [-1938.046] (-1941.959) * (-1947.117) (-1944.030) (-1945.752) [-1940.258] -- 0:04:43
Average standard deviation of split frequencies: 0.012060
401000 -- (-1942.237) [-1945.860] (-1940.528) (-1943.783) * (-1941.193) [-1941.178] (-1944.423) (-1942.653) -- 0:04:43
402000 -- (-1937.855) (-1944.602) [-1942.918] (-1949.075) * (-1951.710) (-1940.867) (-1950.277) [-1946.474] -- 0:04:42
403000 -- (-1942.850) (-1945.997) (-1945.435) [-1938.345] * (-1939.476) [-1937.400] (-1947.548) (-1943.712) -- 0:04:42
404000 -- (-1945.469) (-1941.379) (-1942.028) [-1938.459] * [-1942.841] (-1949.200) (-1955.322) (-1947.045) -- 0:04:41
405000 -- (-1944.824) [-1939.507] (-1944.557) (-1945.270) * (-1940.210) (-1941.646) (-1941.731) [-1945.583] -- 0:04:42
Average standard deviation of split frequencies: 0.011869
406000 -- [-1940.940] (-1947.021) (-1936.315) (-1942.477) * [-1942.209] (-1945.492) (-1941.429) (-1946.320) -- 0:04:40
407000 -- (-1941.563) [-1942.500] (-1941.671) (-1946.671) * (-1944.363) (-1942.613) [-1942.736] (-1946.063) -- 0:04:41
408000 -- (-1942.239) (-1948.445) [-1943.803] (-1946.478) * (-1942.169) (-1943.676) (-1941.800) [-1945.918] -- 0:04:40
409000 -- (-1939.872) (-1939.006) (-1943.608) [-1940.028] * (-1940.561) (-1953.251) (-1942.469) [-1941.894] -- 0:04:40
410000 -- (-1946.862) (-1944.339) [-1946.870] (-1947.709) * (-1944.905) [-1945.662] (-1946.215) (-1951.384) -- 0:04:39
Average standard deviation of split frequencies: 0.012117
411000 -- [-1943.945] (-1943.460) (-1949.002) (-1945.506) * (-1941.573) [-1946.348] (-1943.803) (-1941.451) -- 0:04:38
412000 -- (-1946.730) [-1945.018] (-1940.431) (-1940.801) * (-1942.000) [-1944.684] (-1938.049) (-1942.923) -- 0:04:38
413000 -- (-1946.428) (-1947.636) (-1942.659) [-1939.015] * (-1943.493) [-1944.829] (-1939.056) (-1940.273) -- 0:04:37
414000 -- (-1944.699) (-1952.437) [-1944.738] (-1937.789) * [-1945.421] (-1947.055) (-1936.138) (-1947.226) -- 0:04:37
415000 -- [-1942.433] (-1945.787) (-1942.027) (-1948.920) * (-1937.652) [-1947.195] (-1950.084) (-1947.639) -- 0:04:36
Average standard deviation of split frequencies: 0.011332
416000 -- [-1937.957] (-1944.490) (-1944.358) (-1940.631) * (-1942.451) (-1950.124) [-1944.961] (-1939.208) -- 0:04:36
417000 -- (-1942.933) (-1941.271) [-1943.259] (-1946.622) * [-1941.702] (-1944.762) (-1942.427) (-1948.028) -- 0:04:35
418000 -- [-1950.647] (-1947.232) (-1956.581) (-1944.246) * (-1943.298) [-1942.547] (-1949.052) (-1946.595) -- 0:04:35
419000 -- (-1942.722) (-1945.131) [-1939.775] (-1942.014) * (-1938.815) (-1941.145) [-1947.064] (-1952.666) -- 0:04:34
420000 -- (-1942.355) (-1948.549) [-1944.952] (-1939.881) * (-1944.217) (-1942.146) (-1943.430) [-1942.677] -- 0:04:34
Average standard deviation of split frequencies: 0.010786
421000 -- (-1944.111) (-1941.002) (-1952.426) [-1947.766] * [-1946.360] (-1944.016) (-1950.221) (-1953.385) -- 0:04:33
422000 -- (-1944.700) [-1944.132] (-1944.097) (-1952.438) * (-1953.101) (-1944.450) [-1944.198] (-1947.064) -- 0:04:33
423000 -- (-1944.208) (-1948.078) [-1941.222] (-1945.822) * [-1938.707] (-1947.358) (-1945.561) (-1947.838) -- 0:04:32
424000 -- [-1941.189] (-1947.100) (-1943.478) (-1946.734) * (-1947.251) [-1949.868] (-1945.400) (-1944.544) -- 0:04:33
425000 -- [-1939.643] (-1943.652) (-1942.901) (-1945.090) * (-1952.303) (-1951.458) [-1943.932] (-1948.008) -- 0:04:31
Average standard deviation of split frequencies: 0.010513
426000 -- (-1943.396) (-1941.921) (-1947.654) [-1944.602] * (-1942.376) [-1942.500] (-1945.110) (-1944.044) -- 0:04:32
427000 -- (-1942.377) (-1944.121) [-1943.005] (-1945.392) * (-1939.150) (-1947.834) [-1938.823] (-1944.823) -- 0:04:31
428000 -- (-1953.626) (-1942.603) [-1950.044] (-1938.442) * (-1941.079) [-1940.602] (-1945.636) (-1947.517) -- 0:04:31
429000 -- (-1947.499) (-1944.971) [-1944.604] (-1939.206) * (-1943.711) [-1940.754] (-1947.339) (-1947.252) -- 0:04:30
430000 -- [-1940.271] (-1944.959) (-1947.841) (-1943.243) * (-1943.958) (-1952.053) [-1949.247] (-1944.679) -- 0:04:30
Average standard deviation of split frequencies: 0.012892
431000 -- (-1945.684) [-1941.734] (-1938.477) (-1942.739) * (-1953.330) (-1942.593) (-1945.458) [-1943.819] -- 0:04:29
432000 -- (-1944.806) (-1951.961) [-1940.811] (-1953.107) * [-1943.592] (-1947.716) (-1946.220) (-1949.803) -- 0:04:28
433000 -- (-1941.460) [-1945.636] (-1941.617) (-1951.584) * (-1950.000) (-1940.750) [-1940.440] (-1948.426) -- 0:04:28
434000 -- (-1943.824) (-1942.609) [-1941.897] (-1945.425) * (-1944.606) (-1943.002) [-1942.280] (-1944.298) -- 0:04:27
435000 -- (-1943.281) (-1944.794) [-1943.677] (-1941.397) * (-1943.002) (-1944.604) [-1942.469] (-1948.852) -- 0:04:27
Average standard deviation of split frequencies: 0.012974
436000 -- (-1937.328) (-1949.594) [-1938.756] (-1939.740) * (-1947.520) (-1942.821) [-1943.701] (-1947.247) -- 0:04:26
437000 -- [-1944.548] (-1946.645) (-1943.028) (-1943.986) * (-1942.366) (-1947.434) (-1947.513) [-1946.825] -- 0:04:26
438000 -- [-1938.782] (-1945.003) (-1939.919) (-1939.679) * (-1945.142) (-1944.860) [-1946.179] (-1942.964) -- 0:04:25
439000 -- (-1939.767) [-1941.215] (-1939.450) (-1941.726) * (-1942.710) (-1941.052) (-1943.615) [-1945.744] -- 0:04:25
440000 -- (-1950.066) (-1941.574) (-1944.345) [-1940.831] * [-1945.163] (-1942.545) (-1944.739) (-1948.780) -- 0:04:24
Average standard deviation of split frequencies: 0.011173
441000 -- [-1952.021] (-1947.830) (-1942.441) (-1943.693) * (-1939.762) (-1939.181) [-1941.268] (-1943.694) -- 0:04:24
442000 -- (-1945.468) [-1943.058] (-1944.130) (-1938.182) * [-1941.659] (-1943.221) (-1945.308) (-1944.199) -- 0:04:23
443000 -- (-1945.994) [-1942.590] (-1939.741) (-1953.112) * [-1940.677] (-1943.408) (-1942.500) (-1946.880) -- 0:04:24
444000 -- (-1945.185) [-1943.594] (-1942.994) (-1953.533) * (-1942.352) (-1949.184) [-1941.655] (-1947.015) -- 0:04:22
445000 -- (-1939.171) (-1953.750) (-1941.716) [-1945.641] * (-1940.573) [-1942.857] (-1942.753) (-1949.287) -- 0:04:23
Average standard deviation of split frequencies: 0.011509
446000 -- (-1944.036) (-1944.669) [-1938.127] (-1938.777) * (-1947.583) (-1939.432) [-1943.521] (-1949.818) -- 0:04:22
447000 -- (-1952.520) (-1947.225) [-1944.150] (-1945.207) * (-1939.953) (-1946.556) [-1947.267] (-1945.299) -- 0:04:22
448000 -- (-1938.741) (-1945.038) (-1945.202) [-1943.053] * [-1947.144] (-1943.064) (-1942.689) (-1945.625) -- 0:04:21
449000 -- (-1946.854) (-1937.239) (-1945.014) [-1944.062] * [-1944.296] (-1946.119) (-1957.123) (-1939.735) -- 0:04:21
450000 -- (-1943.866) [-1942.915] (-1949.841) (-1945.710) * (-1942.522) (-1945.182) [-1945.993] (-1944.025) -- 0:04:20
Average standard deviation of split frequencies: 0.011971
451000 -- (-1949.074) (-1946.826) [-1938.059] (-1941.438) * [-1937.967] (-1946.897) (-1942.655) (-1937.559) -- 0:04:19
452000 -- (-1940.957) (-1942.773) (-1940.183) [-1943.214] * (-1943.487) (-1951.287) [-1945.470] (-1943.791) -- 0:04:19
453000 -- (-1941.419) (-1947.038) [-1939.729] (-1942.606) * (-1943.547) (-1949.554) (-1946.022) [-1936.737] -- 0:04:18
454000 -- (-1942.940) (-1944.257) (-1940.840) [-1940.834] * (-1941.038) (-1946.661) (-1942.222) [-1944.931] -- 0:04:18
455000 -- (-1942.319) [-1939.844] (-1939.343) (-1943.583) * (-1940.831) [-1940.323] (-1940.334) (-1948.433) -- 0:04:17
Average standard deviation of split frequencies: 0.011831
456000 -- [-1942.767] (-1940.718) (-1941.949) (-1942.383) * (-1943.390) (-1946.451) (-1945.854) [-1944.798] -- 0:04:17
457000 -- (-1944.478) (-1941.194) [-1945.985] (-1940.027) * (-1943.750) (-1942.880) (-1944.429) [-1945.148] -- 0:04:16
458000 -- (-1942.436) [-1942.417] (-1945.897) (-1943.720) * (-1943.548) (-1937.107) (-1940.641) [-1939.887] -- 0:04:16
459000 -- [-1939.395] (-1940.549) (-1942.011) (-1940.783) * [-1945.067] (-1940.809) (-1946.997) (-1938.768) -- 0:04:15
460000 -- (-1945.999) [-1943.072] (-1945.766) (-1943.298) * (-1952.588) (-1941.030) [-1944.907] (-1955.468) -- 0:04:15
Average standard deviation of split frequencies: 0.010233
461000 -- [-1938.764] (-1943.982) (-1942.912) (-1944.923) * [-1946.803] (-1942.143) (-1948.794) (-1948.926) -- 0:04:14
462000 -- [-1935.654] (-1953.877) (-1947.924) (-1950.176) * [-1942.062] (-1947.577) (-1948.608) (-1951.769) -- 0:04:15
463000 -- (-1952.952) [-1953.767] (-1945.586) (-1948.711) * (-1956.575) [-1938.403] (-1944.803) (-1943.805) -- 0:04:14
464000 -- [-1944.140] (-1954.467) (-1945.477) (-1944.098) * [-1939.466] (-1944.795) (-1942.137) (-1948.963) -- 0:04:14
465000 -- [-1944.081] (-1953.855) (-1940.054) (-1938.020) * (-1945.276) [-1941.166] (-1939.341) (-1942.627) -- 0:04:13
Average standard deviation of split frequencies: 0.010748
466000 -- (-1953.984) [-1947.884] (-1941.866) (-1942.901) * (-1940.529) (-1943.749) (-1944.315) [-1947.242] -- 0:04:13
467000 -- (-1944.977) (-1938.229) (-1949.165) [-1946.272] * (-1941.344) (-1947.406) (-1950.355) [-1941.358] -- 0:04:12
468000 -- (-1941.870) (-1940.980) (-1943.294) [-1945.120] * (-1945.004) [-1943.799] (-1951.842) (-1937.438) -- 0:04:11
469000 -- (-1942.210) (-1942.600) [-1940.752] (-1940.687) * (-1944.325) (-1939.154) [-1944.823] (-1944.580) -- 0:04:11
470000 -- (-1941.113) (-1948.711) (-1945.405) [-1946.700] * (-1939.785) (-1937.236) [-1937.765] (-1940.152) -- 0:04:10
Average standard deviation of split frequencies: 0.008889
471000 -- (-1947.723) (-1949.242) (-1943.413) [-1948.838] * [-1942.694] (-1949.259) (-1949.378) (-1945.265) -- 0:04:10
472000 -- (-1951.494) (-1938.760) [-1942.483] (-1940.351) * (-1941.255) (-1938.646) [-1944.461] (-1953.377) -- 0:04:09
473000 -- (-1943.305) (-1944.740) (-1945.784) [-1942.497] * [-1939.441] (-1939.872) (-1937.844) (-1946.399) -- 0:04:09
474000 -- [-1942.935] (-1937.324) (-1946.951) (-1945.519) * (-1946.522) [-1948.516] (-1942.915) (-1946.123) -- 0:04:08
475000 -- (-1945.156) [-1941.368] (-1949.796) (-1949.666) * (-1949.531) [-1942.330] (-1939.292) (-1944.832) -- 0:04:08
Average standard deviation of split frequencies: 0.008789
476000 -- (-1950.330) [-1941.905] (-1949.703) (-1954.724) * (-1946.244) [-1941.757] (-1943.764) (-1946.238) -- 0:04:07
477000 -- (-1947.736) (-1946.821) [-1948.101] (-1941.167) * [-1947.561] (-1939.196) (-1942.528) (-1944.045) -- 0:04:07
478000 -- (-1942.397) (-1942.096) [-1941.871] (-1942.928) * [-1943.462] (-1940.139) (-1937.711) (-1944.705) -- 0:04:06
479000 -- (-1935.324) (-1952.170) [-1946.964] (-1939.625) * (-1939.976) (-1946.105) [-1941.653] (-1947.294) -- 0:04:06
480000 -- (-1943.949) (-1940.341) [-1945.879] (-1940.341) * (-1944.483) (-1950.640) (-1936.390) [-1944.381] -- 0:04:05
Average standard deviation of split frequencies: 0.007968
481000 -- (-1941.748) (-1940.104) (-1943.955) [-1941.660] * (-1953.713) (-1947.566) [-1944.407] (-1941.919) -- 0:04:06
482000 -- (-1951.589) (-1945.554) [-1942.938] (-1947.906) * (-1944.419) (-1938.887) (-1946.860) [-1944.211] -- 0:04:05
483000 -- (-1944.431) (-1941.937) (-1941.174) [-1942.950] * (-1944.083) (-1952.927) (-1942.253) [-1942.123] -- 0:04:05
484000 -- (-1940.609) (-1939.152) [-1943.466] (-1946.433) * (-1951.654) (-1953.247) [-1948.969] (-1948.794) -- 0:04:04
485000 -- (-1941.405) (-1954.737) [-1940.755] (-1944.858) * [-1947.473] (-1950.089) (-1938.134) (-1942.205) -- 0:04:03
Average standard deviation of split frequencies: 0.008002
486000 -- [-1941.554] (-1947.820) (-1936.567) (-1943.740) * [-1944.245] (-1945.445) (-1940.269) (-1938.491) -- 0:04:03
487000 -- [-1944.284] (-1950.659) (-1951.177) (-1945.521) * (-1943.748) (-1941.828) [-1938.705] (-1939.400) -- 0:04:02
488000 -- (-1947.225) (-1953.888) [-1942.619] (-1941.300) * (-1945.841) (-1946.691) [-1941.523] (-1945.382) -- 0:04:02
489000 -- (-1944.604) (-1954.434) [-1942.577] (-1942.661) * (-1944.757) (-1948.232) [-1942.581] (-1939.508) -- 0:04:01
490000 -- (-1951.185) (-1953.894) [-1945.221] (-1943.601) * [-1942.311] (-1951.232) (-1942.674) (-1944.161) -- 0:04:01
Average standard deviation of split frequencies: 0.008407
491000 -- (-1953.961) (-1951.152) [-1946.320] (-1949.775) * (-1944.985) [-1942.524] (-1938.352) (-1942.705) -- 0:04:00
492000 -- (-1946.810) (-1944.461) [-1943.393] (-1943.105) * (-1938.206) (-1942.897) [-1944.112] (-1941.878) -- 0:04:00
493000 -- (-1945.604) [-1943.671] (-1941.905) (-1943.825) * (-1945.473) [-1947.490] (-1943.962) (-1941.127) -- 0:03:59
494000 -- [-1942.631] (-1939.978) (-1940.432) (-1948.760) * (-1944.558) (-1940.267) [-1942.266] (-1945.809) -- 0:03:59
495000 -- (-1947.437) [-1945.715] (-1947.526) (-1944.433) * [-1942.363] (-1948.587) (-1948.783) (-1943.806) -- 0:03:58
Average standard deviation of split frequencies: 0.007841
496000 -- [-1940.265] (-1942.079) (-1942.488) (-1943.291) * (-1942.983) (-1954.476) [-1942.380] (-1940.096) -- 0:03:58
497000 -- (-1949.495) (-1941.811) (-1943.951) [-1944.120] * (-1937.462) (-1941.470) (-1945.672) [-1941.021] -- 0:03:57
498000 -- [-1949.787] (-1946.277) (-1945.025) (-1943.436) * (-1946.320) (-1950.636) [-1942.405] (-1941.998) -- 0:03:57
499000 -- (-1943.120) [-1939.259] (-1941.341) (-1950.977) * (-1945.541) (-1939.543) [-1948.418] (-1947.145) -- 0:03:56
500000 -- (-1941.608) (-1949.511) (-1946.669) [-1944.430] * [-1945.834] (-1945.675) (-1949.726) (-1942.943) -- 0:03:57
Average standard deviation of split frequencies: 0.006826
501000 -- [-1953.469] (-1953.220) (-1943.809) (-1941.149) * (-1941.620) (-1941.853) (-1943.168) [-1944.081] -- 0:03:56
502000 -- (-1946.499) [-1947.547] (-1941.226) (-1940.735) * [-1940.494] (-1941.702) (-1944.433) (-1937.966) -- 0:03:56
503000 -- (-1943.505) [-1945.364] (-1939.473) (-1941.465) * (-1942.669) (-1947.313) [-1950.943] (-1945.000) -- 0:03:55
504000 -- (-1953.728) [-1943.044] (-1946.937) (-1938.683) * (-1944.468) (-1940.475) (-1953.415) [-1945.865] -- 0:03:55
505000 -- [-1939.137] (-1944.424) (-1956.051) (-1940.697) * (-1947.289) (-1945.200) (-1946.263) [-1941.088] -- 0:03:54
Average standard deviation of split frequencies: 0.007220
506000 -- (-1941.742) [-1939.146] (-1939.192) (-1939.113) * (-1947.782) (-1941.524) (-1945.087) [-1943.468] -- 0:03:54
507000 -- (-1951.139) (-1951.895) [-1945.242] (-1937.864) * [-1950.013] (-1942.921) (-1949.421) (-1945.617) -- 0:03:53
508000 -- (-1944.220) [-1944.627] (-1948.662) (-1941.255) * (-1954.621) (-1945.755) (-1946.376) [-1944.174] -- 0:03:53
509000 -- (-1945.400) (-1954.469) (-1942.554) [-1940.014] * [-1938.311] (-1938.499) (-1950.673) (-1945.505) -- 0:03:52
510000 -- (-1944.066) (-1941.884) (-1954.807) [-1942.959] * (-1944.281) (-1941.676) (-1944.280) [-1941.746] -- 0:03:52
Average standard deviation of split frequencies: 0.008193
511000 -- (-1947.842) (-1944.839) (-1950.457) [-1940.558] * (-1943.424) (-1943.831) (-1951.616) [-1942.364] -- 0:03:51
512000 -- [-1943.853] (-1948.357) (-1947.898) (-1941.346) * (-1948.978) (-1950.383) [-1939.374] (-1945.082) -- 0:03:50
513000 -- [-1942.744] (-1942.703) (-1940.768) (-1943.893) * (-1947.128) [-1941.321] (-1948.985) (-1949.901) -- 0:03:50
514000 -- (-1944.852) [-1946.029] (-1941.136) (-1943.315) * (-1942.030) (-1939.498) [-1942.256] (-1943.930) -- 0:03:49
515000 -- [-1944.651] (-1940.032) (-1940.017) (-1943.475) * (-1959.168) (-1940.681) (-1939.092) [-1940.951] -- 0:03:49
Average standard deviation of split frequencies: 0.008222
516000 -- (-1945.475) [-1945.902] (-1939.826) (-1944.394) * (-1953.936) [-1945.409] (-1939.201) (-1941.456) -- 0:03:48
517000 -- (-1944.633) (-1947.236) [-1944.132] (-1940.960) * [-1942.580] (-1946.442) (-1943.576) (-1941.115) -- 0:03:48
518000 -- (-1944.055) (-1949.449) (-1941.451) [-1946.632] * (-1957.176) [-1943.530] (-1944.266) (-1942.284) -- 0:03:47
519000 -- (-1941.827) [-1943.181] (-1947.783) (-1944.810) * (-1941.800) [-1941.340] (-1938.941) (-1945.160) -- 0:03:47
520000 -- [-1937.538] (-1941.734) (-1949.471) (-1942.358) * (-1947.862) [-1947.401] (-1941.644) (-1945.941) -- 0:03:47
Average standard deviation of split frequencies: 0.009620
521000 -- (-1942.495) (-1938.938) (-1956.551) [-1943.566] * (-1938.718) (-1941.403) (-1942.622) [-1945.110] -- 0:03:47
522000 -- (-1945.721) [-1942.387] (-1942.366) (-1942.538) * (-1940.795) (-1945.072) [-1944.371] (-1943.025) -- 0:03:46
523000 -- (-1945.315) (-1943.178) [-1942.825] (-1943.356) * (-1946.411) (-1945.789) (-1944.031) [-1943.970] -- 0:03:46
524000 -- (-1941.616) (-1949.498) (-1940.551) [-1945.342] * [-1953.157] (-1943.562) (-1945.745) (-1943.956) -- 0:03:45
525000 -- (-1943.498) [-1940.224] (-1947.175) (-1945.523) * (-1942.176) [-1940.855] (-1951.951) (-1940.513) -- 0:03:45
Average standard deviation of split frequencies: 0.009634
526000 -- (-1942.377) (-1950.141) (-1946.896) [-1939.842] * [-1939.118] (-1944.944) (-1949.954) (-1938.581) -- 0:03:44
527000 -- (-1947.147) (-1944.956) [-1944.472] (-1942.689) * (-1954.859) [-1945.162] (-1953.058) (-1947.064) -- 0:03:44
528000 -- (-1943.687) [-1941.320] (-1944.553) (-1938.522) * (-1947.500) (-1942.011) (-1952.791) [-1943.402] -- 0:03:43
529000 -- (-1940.995) (-1939.009) (-1939.519) [-1940.275] * (-1944.101) (-1940.194) (-1946.547) [-1945.722] -- 0:03:43
530000 -- (-1938.148) (-1944.933) (-1941.614) [-1943.893] * [-1945.296] (-1950.026) (-1945.755) (-1942.013) -- 0:03:42
Average standard deviation of split frequencies: 0.009772
531000 -- (-1942.532) (-1938.847) [-1937.322] (-1948.029) * (-1940.571) (-1946.043) (-1940.004) [-1943.257] -- 0:03:41
532000 -- (-1947.648) (-1941.838) [-1945.477] (-1951.569) * (-1953.413) (-1946.812) (-1947.962) [-1945.258] -- 0:03:41
533000 -- [-1945.820] (-1945.851) (-1944.995) (-1941.846) * (-1958.445) (-1948.138) (-1946.298) [-1944.756] -- 0:03:40
534000 -- (-1943.137) (-1942.965) (-1943.722) [-1946.484] * (-1950.086) [-1943.123] (-1948.457) (-1940.267) -- 0:03:40
535000 -- (-1943.523) (-1941.675) (-1943.123) [-1943.979] * (-1948.138) (-1941.027) [-1943.961] (-1944.407) -- 0:03:39
Average standard deviation of split frequencies: 0.009345
536000 -- (-1949.226) (-1943.043) [-1943.387] (-1941.002) * [-1942.595] (-1943.608) (-1947.583) (-1942.843) -- 0:03:39
537000 -- (-1947.451) (-1945.500) (-1942.854) [-1937.517] * [-1941.526] (-1944.500) (-1952.994) (-1946.449) -- 0:03:38
538000 -- (-1946.941) (-1941.222) (-1941.136) [-1942.276] * (-1941.313) [-1940.376] (-1943.524) (-1941.682) -- 0:03:38
539000 -- (-1947.509) [-1937.448] (-1940.295) (-1951.023) * [-1944.685] (-1941.890) (-1954.559) (-1947.728) -- 0:03:38
540000 -- (-1944.116) [-1944.141] (-1937.845) (-1944.087) * (-1942.140) (-1944.610) [-1944.268] (-1944.973) -- 0:03:38
Average standard deviation of split frequencies: 0.011819
541000 -- (-1942.315) [-1942.823] (-1943.683) (-1943.342) * [-1947.071] (-1942.011) (-1944.053) (-1947.508) -- 0:03:37
542000 -- (-1938.081) [-1945.477] (-1949.919) (-1953.960) * (-1946.381) (-1947.128) (-1941.935) [-1942.094] -- 0:03:37
543000 -- (-1945.471) [-1943.650] (-1943.754) (-1938.125) * (-1953.447) (-1941.681) [-1938.148] (-1946.193) -- 0:03:36
544000 -- (-1948.330) (-1939.970) (-1941.976) [-1941.245] * (-1943.401) [-1942.903] (-1943.012) (-1944.596) -- 0:03:36
545000 -- (-1951.108) (-1942.724) [-1943.059] (-1948.487) * (-1945.955) (-1944.631) [-1942.515] (-1944.892) -- 0:03:35
Average standard deviation of split frequencies: 0.008742
546000 -- [-1948.211] (-1943.413) (-1940.079) (-1940.404) * [-1942.544] (-1942.979) (-1939.368) (-1946.327) -- 0:03:35
547000 -- (-1941.811) (-1952.499) (-1941.001) [-1944.051] * [-1937.201] (-1944.512) (-1947.284) (-1951.751) -- 0:03:34
548000 -- (-1942.778) [-1943.769] (-1941.330) (-1941.988) * [-1943.567] (-1946.328) (-1945.186) (-1941.061) -- 0:03:34
549000 -- (-1942.740) [-1941.449] (-1942.289) (-1951.113) * (-1947.749) [-1939.813] (-1941.446) (-1943.856) -- 0:03:33
550000 -- (-1947.116) [-1940.342] (-1951.901) (-1946.671) * (-1956.264) [-1947.070] (-1942.863) (-1944.567) -- 0:03:33
Average standard deviation of split frequencies: 0.008989
551000 -- (-1948.804) (-1946.912) [-1943.804] (-1949.205) * (-1943.864) (-1946.525) (-1948.110) [-1942.008] -- 0:03:32
552000 -- (-1943.257) [-1943.726] (-1941.153) (-1945.169) * (-1946.096) (-1945.772) [-1946.570] (-1939.994) -- 0:03:31
553000 -- (-1946.623) (-1948.076) [-1945.365] (-1951.564) * [-1942.428] (-1939.404) (-1943.224) (-1948.217) -- 0:03:31
554000 -- (-1953.909) (-1942.350) [-1943.664] (-1941.761) * (-1946.147) (-1945.236) (-1940.389) [-1940.257] -- 0:03:30
555000 -- (-1946.020) (-1943.021) (-1944.306) [-1946.597] * [-1944.914] (-1940.475) (-1939.778) (-1946.292) -- 0:03:30
Average standard deviation of split frequencies: 0.010174
556000 -- [-1944.943] (-1948.427) (-1943.321) (-1941.675) * [-1942.527] (-1944.981) (-1943.983) (-1940.371) -- 0:03:30
557000 -- [-1944.227] (-1941.662) (-1939.553) (-1943.961) * (-1946.613) (-1938.267) [-1943.525] (-1946.216) -- 0:03:29
558000 -- [-1946.162] (-1944.526) (-1939.478) (-1944.697) * (-1945.071) [-1943.748] (-1944.564) (-1947.690) -- 0:03:29
559000 -- (-1945.354) (-1943.296) [-1940.101] (-1944.702) * (-1944.911) (-1941.558) [-1941.344] (-1944.904) -- 0:03:29
560000 -- (-1943.506) [-1941.120] (-1941.530) (-1943.925) * (-1942.738) (-1946.554) (-1943.947) [-1946.765] -- 0:03:28
Average standard deviation of split frequencies: 0.009774
561000 -- (-1946.610) (-1938.255) (-1945.796) [-1944.102] * [-1939.476] (-1943.878) (-1948.534) (-1942.645) -- 0:03:28
562000 -- (-1946.670) [-1947.355] (-1951.418) (-1951.289) * (-1935.822) [-1940.315] (-1944.558) (-1943.911) -- 0:03:27
563000 -- [-1944.140] (-1938.111) (-1945.474) (-1941.199) * (-1940.009) (-1945.492) [-1942.261] (-1945.601) -- 0:03:27
564000 -- (-1948.291) (-1943.664) (-1942.543) [-1944.601] * (-1946.572) (-1938.611) [-1948.314] (-1937.166) -- 0:03:26
565000 -- (-1952.751) [-1944.644] (-1947.918) (-1948.585) * (-1945.651) (-1947.401) (-1945.219) [-1940.384] -- 0:03:26
Average standard deviation of split frequencies: 0.011105
566000 -- (-1953.931) (-1951.252) (-1944.310) [-1942.559] * (-1945.323) (-1953.159) (-1948.925) [-1939.631] -- 0:03:25
567000 -- (-1938.118) (-1953.599) (-1946.168) [-1947.391] * (-1940.912) (-1948.074) (-1949.754) [-1944.451] -- 0:03:25
568000 -- [-1944.002] (-1949.527) (-1948.259) (-1947.684) * (-1943.123) (-1943.807) (-1947.296) [-1945.009] -- 0:03:24
569000 -- (-1947.272) (-1949.707) [-1943.188] (-1943.849) * (-1952.011) [-1949.912] (-1945.515) (-1943.821) -- 0:03:23
570000 -- (-1944.138) (-1952.118) (-1946.238) [-1943.282] * (-1949.032) (-1946.831) [-1946.020] (-1938.729) -- 0:03:23
Average standard deviation of split frequencies: 0.011014
571000 -- [-1946.144] (-1941.696) (-1941.157) (-1936.696) * (-1942.721) (-1943.436) (-1947.321) [-1939.645] -- 0:03:22
572000 -- (-1939.279) [-1940.453] (-1947.304) (-1944.903) * [-1943.185] (-1942.604) (-1949.884) (-1947.514) -- 0:03:22
573000 -- [-1947.378] (-1944.385) (-1939.838) (-1940.672) * (-1946.278) (-1941.619) [-1944.915] (-1946.743) -- 0:03:21
574000 -- [-1943.831] (-1943.557) (-1939.939) (-1944.259) * (-1942.260) (-1943.385) [-1937.281] (-1949.114) -- 0:03:21
575000 -- (-1944.639) [-1945.851] (-1948.142) (-1946.742) * (-1950.969) (-1938.217) [-1939.754] (-1946.907) -- 0:03:21
Average standard deviation of split frequencies: 0.011731
576000 -- [-1941.185] (-1942.738) (-1944.730) (-1956.186) * (-1943.717) (-1942.361) (-1940.397) [-1953.016] -- 0:03:20
577000 -- [-1945.408] (-1942.287) (-1943.229) (-1942.130) * (-1943.352) (-1958.942) (-1943.521) [-1945.353] -- 0:03:20
578000 -- (-1946.039) [-1945.059] (-1947.301) (-1942.710) * (-1943.438) (-1951.156) (-1943.506) [-1950.096] -- 0:03:20
579000 -- (-1953.675) (-1942.621) (-1945.063) [-1942.283] * (-1959.528) (-1940.514) [-1938.144] (-1945.322) -- 0:03:19
580000 -- (-1944.612) (-1945.132) (-1948.239) [-1941.384] * (-1947.970) (-1939.460) [-1945.931] (-1941.560) -- 0:03:19
Average standard deviation of split frequencies: 0.009843
581000 -- [-1951.864] (-1946.925) (-1943.014) (-1947.688) * (-1951.843) [-1937.806] (-1942.665) (-1943.455) -- 0:03:18
582000 -- (-1941.542) [-1947.106] (-1943.800) (-1949.880) * [-1946.485] (-1944.212) (-1945.860) (-1942.285) -- 0:03:18
583000 -- (-1942.859) [-1939.581] (-1948.593) (-1944.817) * [-1950.233] (-1955.510) (-1944.339) (-1942.134) -- 0:03:17
584000 -- (-1942.160) (-1950.773) [-1943.485] (-1942.653) * (-1942.829) [-1945.320] (-1943.807) (-1943.211) -- 0:03:17
585000 -- (-1942.602) (-1942.234) [-1942.609] (-1950.748) * [-1939.665] (-1947.915) (-1949.091) (-1949.182) -- 0:03:16
Average standard deviation of split frequencies: 0.010257
586000 -- [-1947.601] (-1941.544) (-1947.809) (-1948.643) * (-1947.830) (-1951.229) (-1944.981) [-1948.099] -- 0:03:16
587000 -- [-1941.381] (-1943.345) (-1947.328) (-1951.746) * (-1944.273) (-1949.945) [-1946.116] (-1946.712) -- 0:03:15
588000 -- (-1941.824) [-1944.095] (-1948.753) (-1941.542) * (-1945.845) (-1945.559) (-1950.479) [-1943.760] -- 0:03:14
589000 -- (-1954.533) (-1946.543) (-1946.585) [-1943.361] * (-1942.181) (-1941.293) (-1952.158) [-1941.583] -- 0:03:14
590000 -- (-1959.662) (-1954.088) [-1937.509] (-1942.563) * (-1942.652) (-1947.040) [-1940.657] (-1945.873) -- 0:03:13
Average standard deviation of split frequencies: 0.012592
591000 -- (-1943.199) (-1944.309) (-1951.423) [-1942.291] * (-1939.513) (-1941.373) (-1943.426) [-1940.608] -- 0:03:13
592000 -- [-1939.626] (-1940.957) (-1940.968) (-1940.962) * (-1945.299) (-1941.266) (-1945.383) [-1941.459] -- 0:03:12
593000 -- (-1940.547) (-1940.320) (-1942.455) [-1942.802] * (-1950.191) [-1938.007] (-1948.461) (-1942.764) -- 0:03:12
594000 -- (-1940.545) (-1949.580) [-1949.014] (-1938.805) * (-1946.261) [-1949.426] (-1947.528) (-1943.329) -- 0:03:12
595000 -- (-1960.296) (-1951.491) [-1943.205] (-1937.174) * [-1943.102] (-1953.527) (-1944.082) (-1943.732) -- 0:03:11
Average standard deviation of split frequencies: 0.012743
596000 -- (-1944.955) (-1946.370) [-1943.573] (-1945.676) * [-1946.341] (-1944.461) (-1950.838) (-1939.902) -- 0:03:11
597000 -- (-1941.470) (-1946.994) [-1938.153] (-1940.293) * (-1945.583) [-1943.919] (-1947.810) (-1940.637) -- 0:03:11
598000 -- [-1941.353] (-1946.077) (-1946.284) (-1943.605) * (-1948.053) (-1952.425) [-1949.129] (-1944.028) -- 0:03:10
599000 -- (-1942.242) (-1942.770) (-1951.714) [-1942.164] * (-1940.040) [-1945.457] (-1948.838) (-1946.001) -- 0:03:10
600000 -- (-1940.493) (-1944.902) (-1942.366) [-1940.845] * (-1935.973) (-1943.042) [-1943.672] (-1943.386) -- 0:03:09
Average standard deviation of split frequencies: 0.012470
601000 -- (-1942.235) (-1944.815) [-1947.371] (-1946.774) * (-1937.065) (-1943.986) (-1945.964) [-1938.096] -- 0:03:09
602000 -- (-1949.028) (-1946.155) (-1941.224) [-1944.637] * (-1938.738) (-1944.830) (-1943.802) [-1940.641] -- 0:03:08
603000 -- (-1942.250) (-1945.254) (-1941.208) [-1942.391] * (-1951.244) [-1942.834] (-1946.605) (-1946.983) -- 0:03:08
604000 -- [-1945.627] (-1943.658) (-1941.210) (-1937.132) * (-1941.680) [-1945.110] (-1950.470) (-1945.625) -- 0:03:07
605000 -- (-1944.855) (-1946.128) (-1946.458) [-1938.844] * (-1950.949) (-1955.964) (-1946.024) [-1941.821] -- 0:03:07
Average standard deviation of split frequencies: 0.011236
606000 -- (-1942.567) (-1944.314) [-1938.192] (-1947.651) * (-1957.009) (-1946.462) [-1940.132] (-1941.954) -- 0:03:06
607000 -- (-1941.820) (-1944.635) (-1949.737) [-1950.830] * (-1947.972) (-1939.809) (-1944.802) [-1941.020] -- 0:03:06
608000 -- (-1942.598) (-1941.996) [-1943.423] (-1950.326) * (-1939.577) (-1950.338) [-1943.736] (-1944.062) -- 0:03:05
609000 -- (-1944.108) (-1946.840) [-1943.235] (-1945.960) * (-1947.709) (-1940.902) (-1940.534) [-1941.782] -- 0:03:04
610000 -- [-1943.203] (-1947.004) (-1952.104) (-1949.226) * (-1955.583) (-1944.982) [-1941.935] (-1946.282) -- 0:03:04
Average standard deviation of split frequencies: 0.009553
611000 -- (-1946.687) (-1944.704) (-1937.899) [-1944.398] * (-1965.114) (-1949.409) [-1940.713] (-1950.108) -- 0:03:03
612000 -- [-1943.787] (-1938.629) (-1945.764) (-1943.157) * (-1951.103) (-1951.131) (-1950.965) [-1940.305] -- 0:03:03
613000 -- (-1944.135) [-1942.458] (-1938.026) (-1935.228) * (-1942.231) (-1946.695) (-1947.143) [-1938.130] -- 0:03:03
614000 -- [-1938.835] (-1947.674) (-1943.124) (-1945.444) * (-1946.745) (-1942.208) [-1937.051] (-1947.535) -- 0:03:02
615000 -- (-1944.802) [-1938.529] (-1942.612) (-1946.621) * (-1946.718) (-1949.623) (-1941.447) [-1948.156] -- 0:03:02
Average standard deviation of split frequencies: 0.009088
616000 -- (-1942.809) (-1950.050) [-1941.382] (-1945.498) * [-1941.410] (-1953.286) (-1946.436) (-1941.602) -- 0:03:02
617000 -- (-1947.529) [-1950.229] (-1946.677) (-1942.964) * [-1943.618] (-1940.991) (-1942.851) (-1945.669) -- 0:03:01
618000 -- (-1939.438) [-1944.876] (-1940.475) (-1942.067) * (-1942.389) [-1943.120] (-1947.233) (-1945.710) -- 0:03:01
619000 -- (-1946.933) [-1941.768] (-1948.242) (-1944.305) * (-1944.295) [-1943.062] (-1943.643) (-1947.117) -- 0:03:00
620000 -- (-1943.594) [-1942.352] (-1944.619) (-1941.699) * (-1950.829) [-1938.429] (-1957.555) (-1949.021) -- 0:03:00
Average standard deviation of split frequencies: 0.009304
621000 -- [-1943.321] (-1943.426) (-1947.581) (-1938.084) * [-1943.915] (-1946.603) (-1950.434) (-1945.550) -- 0:02:59
622000 -- [-1944.109] (-1941.988) (-1941.300) (-1946.114) * (-1943.052) (-1948.777) [-1949.206] (-1951.467) -- 0:02:59
623000 -- (-1941.327) (-1945.590) [-1942.005] (-1955.776) * [-1942.105] (-1941.183) (-1944.298) (-1947.995) -- 0:02:58
624000 -- (-1943.384) (-1950.997) [-1950.204] (-1945.290) * [-1945.197] (-1942.172) (-1949.683) (-1944.178) -- 0:02:58
625000 -- (-1947.520) (-1946.801) [-1946.921] (-1945.801) * [-1944.808] (-1943.920) (-1941.938) (-1942.440) -- 0:02:57
Average standard deviation of split frequencies: 0.008754
626000 -- (-1955.169) [-1940.880] (-1938.772) (-1951.508) * (-1944.597) (-1945.734) (-1946.499) [-1941.647] -- 0:02:56
627000 -- [-1941.586] (-1943.355) (-1942.643) (-1944.606) * (-1947.408) (-1941.850) [-1942.772] (-1948.464) -- 0:02:56
628000 -- (-1943.776) (-1942.852) [-1957.554] (-1952.445) * [-1947.956] (-1940.452) (-1947.507) (-1950.716) -- 0:02:55
629000 -- (-1948.406) [-1938.181] (-1947.866) (-1944.875) * (-1941.468) (-1944.330) (-1943.726) [-1944.520] -- 0:02:55
630000 -- (-1939.821) (-1946.237) (-1946.705) [-1943.318] * [-1954.372] (-1945.116) (-1940.740) (-1941.115) -- 0:02:55
Average standard deviation of split frequencies: 0.009063
631000 -- (-1939.825) (-1947.629) [-1945.817] (-1946.250) * (-1951.742) [-1942.081] (-1943.725) (-1941.150) -- 0:02:54
632000 -- (-1944.092) (-1945.520) [-1937.942] (-1944.295) * [-1941.895] (-1946.432) (-1952.555) (-1942.546) -- 0:02:54
633000 -- (-1945.204) (-1941.413) [-1942.549] (-1942.267) * (-1946.426) (-1944.882) (-1942.770) [-1939.656] -- 0:02:53
634000 -- (-1940.813) (-1952.307) [-1940.018] (-1942.191) * (-1938.748) (-1938.785) (-1951.152) [-1943.605] -- 0:02:53
635000 -- [-1945.701] (-1942.596) (-1942.725) (-1942.273) * (-1947.481) (-1949.035) (-1941.629) [-1945.019] -- 0:02:53
Average standard deviation of split frequencies: 0.009450
636000 -- (-1942.131) [-1939.487] (-1942.582) (-1940.462) * [-1938.719] (-1945.481) (-1942.167) (-1936.048) -- 0:02:52
637000 -- (-1945.836) (-1941.366) (-1942.781) [-1939.650] * (-1943.531) (-1947.170) (-1956.434) [-1942.908] -- 0:02:52
638000 -- (-1943.450) (-1942.761) [-1939.902] (-1942.732) * (-1939.721) [-1941.398] (-1939.907) (-1944.731) -- 0:02:51
639000 -- (-1939.620) (-1946.916) [-1938.395] (-1943.726) * (-1938.194) (-1943.093) (-1946.755) [-1949.318] -- 0:02:51
640000 -- (-1947.847) (-1945.232) (-1944.752) [-1940.651] * (-1945.892) (-1950.331) [-1949.899] (-1940.500) -- 0:02:50
Average standard deviation of split frequencies: 0.008646
641000 -- [-1935.800] (-1959.090) (-1944.411) (-1941.578) * (-1940.430) (-1951.309) (-1937.705) [-1938.619] -- 0:02:50
642000 -- (-1946.376) [-1940.741] (-1942.592) (-1942.245) * (-1942.078) (-1945.408) (-1942.234) [-1941.114] -- 0:02:49
643000 -- (-1938.107) [-1939.497] (-1944.780) (-1943.505) * [-1941.941] (-1951.076) (-1943.641) (-1940.667) -- 0:02:49
644000 -- (-1939.882) (-1944.295) (-1942.698) [-1938.467] * (-1942.300) (-1944.378) [-1944.031] (-1944.167) -- 0:02:48
645000 -- (-1938.900) [-1946.535] (-1940.972) (-1949.390) * (-1944.984) (-1950.664) (-1941.282) [-1950.163] -- 0:02:47
Average standard deviation of split frequencies: 0.008209
646000 -- [-1943.329] (-1943.510) (-1950.535) (-1939.984) * (-1938.120) (-1949.632) (-1954.687) [-1942.637] -- 0:02:47
647000 -- (-1942.138) [-1937.642] (-1944.785) (-1945.197) * (-1943.722) [-1944.951] (-1943.874) (-1941.664) -- 0:02:46
648000 -- [-1946.046] (-1945.521) (-1952.744) (-1946.419) * (-1940.625) (-1946.951) [-1942.554] (-1942.437) -- 0:02:46
649000 -- [-1947.358] (-1944.071) (-1956.730) (-1943.257) * [-1951.820] (-1944.737) (-1951.771) (-1951.798) -- 0:02:46
650000 -- (-1940.585) (-1948.132) [-1946.315] (-1942.813) * (-1941.979) (-1945.594) (-1945.973) [-1942.493] -- 0:02:45
Average standard deviation of split frequencies: 0.008603
651000 -- (-1941.302) (-1952.725) [-1942.368] (-1943.049) * (-1943.940) (-1945.778) (-1941.032) [-1938.256] -- 0:02:45
652000 -- [-1944.058] (-1942.479) (-1940.727) (-1945.394) * (-1942.335) (-1941.491) (-1947.413) [-1948.157] -- 0:02:44
653000 -- (-1937.532) (-1946.668) [-1946.167] (-1950.028) * [-1942.583] (-1945.041) (-1945.469) (-1942.344) -- 0:02:44
654000 -- [-1941.349] (-1951.681) (-1944.092) (-1939.260) * [-1944.118] (-1949.374) (-1945.667) (-1940.314) -- 0:02:44
655000 -- (-1940.565) (-1942.180) (-1946.891) [-1940.371] * (-1945.987) (-1944.933) [-1943.438] (-1944.264) -- 0:02:43
Average standard deviation of split frequencies: 0.008444
656000 -- [-1942.227] (-1940.818) (-1941.899) (-1944.209) * (-1945.560) [-1939.027] (-1951.490) (-1944.123) -- 0:02:43
657000 -- (-1942.693) (-1947.480) (-1948.074) [-1941.690] * [-1940.754] (-1950.419) (-1954.683) (-1945.997) -- 0:02:42
658000 -- (-1948.060) [-1943.702] (-1952.974) (-1941.080) * (-1942.891) (-1947.234) (-1947.583) [-1946.721] -- 0:02:42
659000 -- (-1945.660) (-1937.896) (-1947.139) [-1945.016] * (-1942.795) [-1944.630] (-1948.816) (-1940.122) -- 0:02:41
660000 -- (-1948.651) (-1942.171) (-1943.925) [-1952.922] * [-1950.034] (-1940.866) (-1949.031) (-1947.500) -- 0:02:41
Average standard deviation of split frequencies: 0.007849
661000 -- (-1938.366) [-1945.331] (-1949.612) (-1939.227) * (-1941.510) (-1951.053) [-1944.321] (-1942.831) -- 0:02:40
662000 -- [-1948.289] (-1945.213) (-1943.346) (-1947.526) * (-1940.929) (-1947.413) (-1942.793) [-1946.598] -- 0:02:40
663000 -- [-1940.828] (-1944.637) (-1943.055) (-1950.502) * [-1941.729] (-1941.690) (-1943.222) (-1942.801) -- 0:02:39
664000 -- [-1946.025] (-1945.821) (-1946.738) (-1938.636) * (-1943.837) (-1944.057) (-1942.261) [-1943.668] -- 0:02:38
665000 -- [-1941.022] (-1943.002) (-1946.665) (-1943.309) * (-1942.790) (-1951.995) (-1940.077) [-1943.060] -- 0:02:38
Average standard deviation of split frequencies: 0.006990
666000 -- [-1945.740] (-1950.637) (-1939.561) (-1948.053) * [-1945.265] (-1942.707) (-1941.355) (-1945.293) -- 0:02:37
667000 -- (-1961.005) [-1936.751] (-1941.857) (-1939.817) * (-1939.872) (-1943.388) (-1940.206) [-1950.554] -- 0:02:37
668000 -- (-1940.691) (-1948.908) (-1942.781) [-1940.211] * (-1941.046) [-1948.171] (-1959.258) (-1938.709) -- 0:02:37
669000 -- [-1943.064] (-1949.482) (-1956.514) (-1943.016) * [-1941.861] (-1947.061) (-1942.452) (-1950.385) -- 0:02:36
670000 -- [-1938.160] (-1945.106) (-1948.990) (-1941.018) * (-1951.797) (-1947.272) [-1939.568] (-1945.990) -- 0:02:36
Average standard deviation of split frequencies: 0.007820
671000 -- [-1947.678] (-1946.709) (-1942.548) (-1938.721) * (-1949.396) (-1944.330) (-1944.049) [-1939.993] -- 0:02:35
672000 -- [-1942.441] (-1949.281) (-1943.569) (-1941.353) * (-1945.523) (-1951.767) (-1941.504) [-1942.072] -- 0:02:35
673000 -- [-1948.568] (-1952.475) (-1942.527) (-1945.938) * (-1941.327) [-1943.546] (-1944.469) (-1943.086) -- 0:02:34
674000 -- [-1951.121] (-1949.141) (-1944.969) (-1942.029) * (-1946.879) (-1940.973) (-1939.866) [-1939.865] -- 0:02:34
675000 -- (-1943.587) (-1944.399) (-1944.659) [-1943.411] * [-1940.832] (-1942.983) (-1938.820) (-1948.158) -- 0:02:34
Average standard deviation of split frequencies: 0.006450
676000 -- (-1946.599) (-1942.185) (-1951.230) [-1944.103] * [-1948.725] (-1938.495) (-1945.598) (-1953.090) -- 0:02:33
677000 -- (-1940.028) (-1948.412) (-1941.231) [-1944.389] * (-1940.163) (-1940.134) (-1942.306) [-1944.501] -- 0:02:33
678000 -- (-1946.566) (-1944.840) [-1938.258] (-1947.191) * (-1944.953) (-1942.117) (-1941.593) [-1945.026] -- 0:02:32
679000 -- (-1945.663) (-1944.812) (-1943.571) [-1945.450] * (-1943.192) (-1946.781) (-1949.487) [-1940.486] -- 0:02:32
680000 -- (-1958.822) (-1940.990) [-1945.843] (-1943.924) * (-1939.545) (-1948.124) [-1941.706] (-1946.361) -- 0:02:31
Average standard deviation of split frequencies: 0.007964
681000 -- (-1949.676) (-1944.762) (-1945.979) [-1936.813] * (-1945.690) [-1944.711] (-1950.908) (-1940.845) -- 0:02:30
682000 -- (-1942.819) [-1947.217] (-1937.254) (-1938.832) * (-1947.323) [-1937.455] (-1947.225) (-1940.822) -- 0:02:30
683000 -- (-1940.968) (-1944.107) [-1947.887] (-1950.738) * (-1951.818) [-1945.688] (-1954.669) (-1941.584) -- 0:02:29
684000 -- (-1942.000) [-1941.650] (-1942.698) (-1943.893) * (-1947.376) (-1947.489) [-1944.953] (-1948.340) -- 0:02:29
685000 -- [-1943.803] (-1944.596) (-1943.758) (-1943.193) * [-1940.714] (-1946.025) (-1946.276) (-1949.245) -- 0:02:28
Average standard deviation of split frequencies: 0.007473
686000 -- (-1944.196) (-1942.627) (-1943.618) [-1937.151] * (-1943.617) [-1946.472] (-1948.038) (-1952.628) -- 0:02:28
687000 -- (-1944.775) (-1947.198) (-1942.953) [-1942.080] * [-1948.092] (-1946.863) (-1946.023) (-1943.841) -- 0:02:28
688000 -- (-1945.531) (-1942.289) [-1940.963] (-1938.183) * (-1951.408) [-1943.336] (-1941.042) (-1940.283) -- 0:02:27
689000 -- (-1947.940) (-1942.059) (-1947.921) [-1937.245] * [-1946.963] (-1950.109) (-1949.313) (-1943.555) -- 0:02:27
690000 -- (-1941.654) (-1940.953) (-1947.466) [-1938.309] * (-1950.378) (-1938.919) (-1946.063) [-1940.267] -- 0:02:26
Average standard deviation of split frequencies: 0.006228
691000 -- (-1941.940) (-1946.440) [-1945.559] (-1938.664) * (-1937.047) (-1944.669) [-1943.518] (-1938.458) -- 0:02:26
692000 -- [-1946.980] (-1940.081) (-1941.611) (-1943.155) * (-1948.138) (-1942.389) (-1939.457) [-1939.072] -- 0:02:25
693000 -- [-1945.043] (-1944.595) (-1946.134) (-1950.708) * (-1948.122) (-1942.627) (-1950.122) [-1948.328] -- 0:02:25
694000 -- (-1942.370) (-1944.824) [-1949.363] (-1936.964) * [-1948.751] (-1940.991) (-1944.715) (-1939.588) -- 0:02:25
695000 -- [-1943.784] (-1944.890) (-1942.541) (-1941.596) * [-1942.190] (-1943.744) (-1942.109) (-1941.152) -- 0:02:24
Average standard deviation of split frequencies: 0.005926
696000 -- (-1944.630) [-1945.373] (-1947.300) (-1948.585) * (-1949.280) (-1938.873) (-1941.160) [-1945.252] -- 0:02:24
697000 -- [-1942.655] (-1941.822) (-1946.800) (-1937.720) * [-1947.110] (-1944.183) (-1947.265) (-1943.105) -- 0:02:23
698000 -- [-1945.398] (-1946.089) (-1947.544) (-1941.484) * (-1943.624) [-1943.796] (-1948.865) (-1945.207) -- 0:02:23
699000 -- (-1946.464) (-1940.190) [-1943.051] (-1948.396) * [-1938.059] (-1948.901) (-1943.647) (-1943.186) -- 0:02:22
700000 -- (-1954.413) [-1939.594] (-1942.102) (-1940.596) * (-1936.929) (-1947.442) [-1944.129] (-1942.815) -- 0:02:21
Average standard deviation of split frequencies: 0.005887
701000 -- (-1957.252) [-1941.749] (-1940.431) (-1944.494) * (-1942.305) [-1945.967] (-1941.611) (-1946.744) -- 0:02:21
702000 -- (-1949.114) (-1943.933) [-1942.790] (-1942.084) * (-1948.191) [-1943.189] (-1943.759) (-1949.455) -- 0:02:20
703000 -- (-1947.469) (-1949.210) (-1944.326) [-1945.907] * (-1944.950) (-1941.427) [-1941.866] (-1945.043) -- 0:02:20
704000 -- (-1944.770) [-1946.347] (-1948.907) (-1942.009) * [-1943.317] (-1941.103) (-1946.715) (-1947.525) -- 0:02:20
705000 -- (-1943.319) (-1947.083) (-1942.263) [-1945.261] * (-1942.648) (-1944.686) [-1945.922] (-1950.101) -- 0:02:19
Average standard deviation of split frequencies: 0.006093
706000 -- (-1944.322) [-1945.583] (-1948.347) (-1945.582) * (-1947.866) (-1942.971) [-1943.375] (-1941.189) -- 0:02:19
707000 -- (-1938.906) [-1942.092] (-1940.733) (-1943.177) * [-1948.799] (-1945.816) (-1938.213) (-1941.325) -- 0:02:18
708000 -- (-1946.736) (-1943.113) (-1943.270) [-1946.940] * (-1941.950) (-1943.258) [-1942.738] (-1940.594) -- 0:02:18
709000 -- (-1945.866) (-1944.082) (-1942.336) [-1940.591] * (-1943.610) (-1944.737) (-1941.156) [-1945.247] -- 0:02:17
710000 -- (-1946.026) [-1943.461] (-1944.309) (-1947.103) * (-1940.042) (-1942.362) [-1938.192] (-1936.445) -- 0:02:17
Average standard deviation of split frequencies: 0.006550
711000 -- (-1941.741) (-1943.033) (-1949.216) [-1946.434] * (-1944.382) (-1943.330) [-1939.562] (-1948.649) -- 0:02:16
712000 -- (-1944.994) (-1938.760) (-1943.076) [-1943.304] * (-1950.344) [-1942.715] (-1940.153) (-1945.606) -- 0:02:16
713000 -- (-1950.932) [-1942.210] (-1952.881) (-1941.891) * (-1936.209) (-1940.293) (-1941.576) [-1938.163] -- 0:02:16
714000 -- (-1943.528) [-1940.625] (-1947.280) (-1943.862) * (-1945.712) (-1945.685) [-1940.438] (-1944.032) -- 0:02:15
715000 -- (-1944.527) (-1945.076) (-1943.524) [-1940.057] * [-1947.793] (-1942.463) (-1943.534) (-1948.748) -- 0:02:15
Average standard deviation of split frequencies: 0.007078
716000 -- (-1945.878) (-1942.422) (-1956.755) [-1940.666] * (-1945.863) (-1941.666) (-1943.466) [-1943.396] -- 0:02:14
717000 -- (-1941.076) (-1938.307) [-1947.230] (-1942.763) * (-1949.051) (-1946.168) (-1938.883) [-1943.373] -- 0:02:14
718000 -- (-1943.576) [-1938.897] (-1941.269) (-1946.273) * (-1949.469) (-1947.193) [-1940.281] (-1945.758) -- 0:02:13
719000 -- (-1946.616) [-1939.515] (-1944.433) (-1942.456) * [-1941.976] (-1944.565) (-1941.357) (-1944.693) -- 0:02:12
720000 -- (-1938.451) (-1942.093) (-1943.294) [-1942.491] * (-1941.363) (-1949.066) [-1942.931] (-1945.323) -- 0:02:12
Average standard deviation of split frequencies: 0.006623
721000 -- (-1943.388) (-1944.076) (-1943.528) [-1943.760] * (-1941.428) [-1938.973] (-1940.062) (-1944.091) -- 0:02:11
722000 -- (-1944.150) (-1953.829) [-1943.641] (-1938.914) * (-1940.572) [-1940.882] (-1936.274) (-1946.515) -- 0:02:11
723000 -- (-1941.749) (-1949.397) (-1942.224) [-1940.453] * [-1941.611] (-1945.908) (-1943.245) (-1941.745) -- 0:02:11
724000 -- (-1939.604) [-1944.479] (-1943.765) (-1943.990) * (-1949.677) (-1943.747) (-1940.916) [-1937.959] -- 0:02:10
725000 -- [-1942.069] (-1940.608) (-1943.848) (-1947.057) * (-1957.240) (-1946.635) [-1944.542] (-1953.753) -- 0:02:10
Average standard deviation of split frequencies: 0.007629
726000 -- (-1947.284) (-1945.810) [-1951.415] (-1943.029) * (-1947.399) (-1948.014) (-1943.004) [-1942.967] -- 0:02:09
727000 -- [-1941.351] (-1943.924) (-1949.934) (-1950.144) * (-1944.301) (-1946.492) [-1938.811] (-1944.508) -- 0:02:09
728000 -- (-1948.179) [-1949.607] (-1941.885) (-1947.612) * (-1947.018) (-1944.808) [-1947.585] (-1949.901) -- 0:02:08
729000 -- (-1942.308) (-1947.034) [-1946.741] (-1943.614) * (-1941.023) [-1943.504] (-1946.542) (-1939.496) -- 0:02:08
730000 -- (-1950.475) [-1946.425] (-1942.992) (-1944.768) * (-1941.857) (-1944.431) [-1940.257] (-1940.619) -- 0:02:07
Average standard deviation of split frequencies: 0.008387
731000 -- [-1941.239] (-1947.051) (-1946.224) (-1944.864) * (-1940.762) (-1939.973) (-1939.951) [-1944.862] -- 0:02:07
732000 -- [-1939.185] (-1948.508) (-1945.271) (-1941.289) * (-1941.645) [-1944.316] (-1945.898) (-1940.773) -- 0:02:07
733000 -- [-1942.214] (-1949.498) (-1940.801) (-1949.410) * (-1943.537) (-1947.337) (-1943.404) [-1943.708] -- 0:02:06
734000 -- (-1941.021) (-1944.723) [-1948.333] (-1950.414) * (-1946.847) [-1940.743] (-1948.203) (-1939.114) -- 0:02:06
735000 -- (-1941.934) (-1942.787) (-1940.937) [-1937.321] * (-1945.190) (-1943.753) (-1942.140) [-1940.787] -- 0:02:05
Average standard deviation of split frequencies: 0.008407
736000 -- [-1941.540] (-1940.493) (-1941.750) (-1941.662) * [-1946.992] (-1941.803) (-1943.168) (-1945.785) -- 0:02:05
737000 -- (-1951.657) [-1943.914] (-1942.806) (-1949.396) * (-1943.361) [-1946.653] (-1943.502) (-1945.067) -- 0:02:04
738000 -- (-1939.055) (-1949.381) (-1944.932) [-1950.308] * (-1947.169) (-1941.164) (-1953.092) [-1944.597] -- 0:02:03
739000 -- (-1948.626) [-1939.473] (-1952.390) (-1944.882) * (-1940.324) [-1946.864] (-1941.219) (-1942.635) -- 0:02:03
740000 -- (-1941.715) [-1937.676] (-1947.324) (-1937.538) * [-1942.090] (-1943.792) (-1938.705) (-1940.301) -- 0:02:02
Average standard deviation of split frequencies: 0.008513
741000 -- [-1947.041] (-1945.264) (-1952.552) (-1943.924) * (-1946.883) (-1946.919) (-1940.418) [-1947.460] -- 0:02:02
742000 -- (-1943.635) (-1946.308) (-1947.396) [-1944.569] * (-1951.054) [-1945.486] (-1942.769) (-1954.450) -- 0:02:02
743000 -- (-1947.466) [-1942.813] (-1948.108) (-1954.615) * (-1944.600) (-1939.412) [-1944.572] (-1942.046) -- 0:02:01
744000 -- (-1946.966) (-1941.735) [-1948.269] (-1947.613) * (-1948.440) (-1945.612) [-1938.879] (-1947.279) -- 0:02:01
745000 -- (-1940.124) (-1942.646) (-1937.398) [-1944.354] * [-1943.126] (-1949.253) (-1938.545) (-1942.308) -- 0:02:00
Average standard deviation of split frequencies: 0.008215
746000 -- (-1940.199) [-1942.884] (-1942.360) (-1939.084) * (-1944.270) (-1943.828) (-1940.732) [-1943.724] -- 0:02:00
747000 -- (-1948.381) [-1946.218] (-1945.231) (-1941.380) * (-1945.310) [-1945.651] (-1945.361) (-1942.308) -- 0:01:59
748000 -- (-1944.592) (-1950.033) (-1944.468) [-1949.727] * (-1946.607) [-1939.654] (-1942.148) (-1945.461) -- 0:01:59
749000 -- (-1945.251) (-1941.168) (-1944.233) [-1944.819] * [-1939.939] (-1941.495) (-1949.706) (-1948.270) -- 0:01:58
750000 -- [-1945.175] (-1941.413) (-1950.229) (-1944.739) * [-1945.852] (-1943.449) (-1944.304) (-1942.813) -- 0:01:58
Average standard deviation of split frequencies: 0.008635
751000 -- (-1945.990) (-1943.878) (-1947.660) [-1944.026] * [-1944.518] (-1945.368) (-1948.561) (-1946.693) -- 0:01:58
752000 -- (-1944.075) [-1943.046] (-1948.470) (-1947.207) * (-1950.111) (-1946.213) (-1944.995) [-1948.233] -- 0:01:57
753000 -- [-1948.016] (-1939.418) (-1944.001) (-1948.816) * (-1941.798) [-1937.372] (-1944.171) (-1939.264) -- 0:01:57
754000 -- (-1947.739) (-1944.396) [-1940.865] (-1946.590) * (-1942.427) [-1945.702] (-1943.915) (-1941.162) -- 0:01:56
755000 -- (-1944.140) [-1947.043] (-1941.931) (-1944.131) * (-1942.302) (-1947.437) (-1938.860) [-1943.732] -- 0:01:56
Average standard deviation of split frequencies: 0.008028
756000 -- (-1948.429) (-1940.835) [-1944.540] (-1943.487) * [-1938.345] (-1952.315) (-1940.708) (-1942.366) -- 0:01:55
757000 -- (-1942.116) [-1948.434] (-1949.736) (-1939.604) * (-1937.517) [-1944.737] (-1947.613) (-1949.917) -- 0:01:55
758000 -- [-1942.305] (-1943.427) (-1966.041) (-1943.728) * [-1944.981] (-1949.276) (-1937.484) (-1949.355) -- 0:01:54
759000 -- (-1948.638) (-1946.151) (-1948.042) [-1945.149] * (-1948.129) (-1940.999) [-1938.987] (-1946.788) -- 0:01:53
760000 -- [-1949.617] (-1945.207) (-1951.343) (-1939.576) * [-1938.991] (-1942.933) (-1941.648) (-1945.279) -- 0:01:53
Average standard deviation of split frequencies: 0.007437
761000 -- [-1943.589] (-1943.938) (-1946.913) (-1952.099) * (-1945.152) (-1949.818) (-1940.683) [-1946.539] -- 0:01:53
762000 -- (-1947.281) [-1942.770] (-1948.623) (-1944.575) * (-1940.184) (-1945.143) [-1944.679] (-1944.532) -- 0:01:52
763000 -- (-1945.388) (-1946.667) [-1940.282] (-1944.798) * (-1949.838) (-1951.831) (-1938.989) [-1945.016] -- 0:01:52
764000 -- (-1948.493) [-1951.135] (-1943.961) (-1942.644) * (-1940.910) (-1946.408) [-1943.259] (-1943.309) -- 0:01:51
765000 -- [-1945.642] (-1944.670) (-1946.855) (-1944.082) * (-1941.504) [-1946.553] (-1944.725) (-1949.427) -- 0:01:51
Average standard deviation of split frequencies: 0.007385
766000 -- [-1948.596] (-1939.946) (-1947.586) (-1943.005) * (-1951.326) [-1944.497] (-1953.096) (-1945.048) -- 0:01:50
767000 -- [-1936.921] (-1948.081) (-1945.837) (-1937.293) * (-1942.942) (-1943.381) (-1946.393) [-1940.835] -- 0:01:50
768000 -- [-1941.861] (-1946.757) (-1941.311) (-1936.272) * (-1952.512) [-1942.723] (-1944.147) (-1948.358) -- 0:01:49
769000 -- [-1939.244] (-1946.323) (-1938.118) (-1944.472) * (-1943.842) [-1950.413] (-1944.345) (-1948.929) -- 0:01:49
770000 -- (-1940.715) (-1944.627) [-1939.724] (-1941.604) * (-1943.161) (-1941.096) (-1940.672) [-1938.689] -- 0:01:49
Average standard deviation of split frequencies: 0.006881
771000 -- (-1950.602) (-1946.925) (-1948.248) [-1943.511] * (-1942.771) [-1942.543] (-1944.213) (-1947.585) -- 0:01:48
772000 -- (-1941.038) [-1948.616] (-1949.324) (-1946.449) * (-1958.365) (-1947.880) (-1946.601) [-1944.753] -- 0:01:48
773000 -- [-1937.915] (-1943.129) (-1946.365) (-1943.204) * (-1948.892) (-1945.323) [-1941.317] (-1939.120) -- 0:01:47
774000 -- (-1944.348) (-1942.323) [-1938.861] (-1943.525) * (-1946.714) [-1940.383] (-1942.115) (-1943.671) -- 0:01:47
775000 -- [-1943.287] (-1945.246) (-1947.359) (-1941.954) * (-1945.119) (-1944.425) [-1943.683] (-1945.504) -- 0:01:46
Average standard deviation of split frequencies: 0.006834
776000 -- [-1942.582] (-1943.363) (-1947.587) (-1940.114) * (-1948.230) (-1939.885) (-1942.373) [-1941.202] -- 0:01:46
777000 -- (-1945.209) (-1943.263) [-1945.747] (-1942.219) * [-1949.705] (-1944.932) (-1940.018) (-1945.852) -- 0:01:45
778000 -- (-1944.512) (-1939.265) (-1945.054) [-1946.219] * (-1949.263) (-1949.846) (-1945.067) [-1938.301] -- 0:01:45
779000 -- [-1945.045] (-1949.288) (-1953.433) (-1942.524) * (-1944.815) [-1942.376] (-1939.481) (-1941.967) -- 0:01:44
780000 -- [-1942.213] (-1944.040) (-1953.415) (-1939.706) * [-1949.029] (-1946.729) (-1943.247) (-1941.036) -- 0:01:44
Average standard deviation of split frequencies: 0.007095
781000 -- (-1946.946) [-1943.614] (-1946.998) (-1934.467) * (-1944.897) (-1946.079) (-1940.957) [-1941.626] -- 0:01:43
782000 -- [-1945.899] (-1947.461) (-1943.756) (-1949.160) * [-1945.210] (-1950.970) (-1945.220) (-1944.181) -- 0:01:43
783000 -- (-1941.201) (-1948.046) [-1945.197] (-1947.115) * (-1944.372) (-1943.283) [-1945.932] (-1951.887) -- 0:01:42
784000 -- [-1947.843] (-1940.479) (-1947.335) (-1954.523) * (-1939.398) (-1946.047) (-1942.262) [-1945.275] -- 0:01:42
785000 -- [-1950.292] (-1936.789) (-1943.517) (-1948.828) * (-1950.487) (-1946.401) [-1955.980] (-1945.560) -- 0:01:41
Average standard deviation of split frequencies: 0.006972
786000 -- (-1943.626) (-1944.878) [-1941.688] (-1942.066) * [-1944.529] (-1944.783) (-1943.407) (-1945.821) -- 0:01:41
787000 -- [-1941.121] (-1938.020) (-1944.745) (-1944.025) * (-1943.594) [-1943.787] (-1942.604) (-1949.360) -- 0:01:40
788000 -- (-1949.871) (-1942.388) [-1938.210] (-1946.925) * (-1947.641) [-1939.722] (-1943.668) (-1937.466) -- 0:01:40
789000 -- (-1942.668) (-1939.984) (-1943.980) [-1940.924] * (-1939.272) (-1955.996) [-1944.197] (-1942.770) -- 0:01:40
790000 -- [-1940.132] (-1944.012) (-1947.532) (-1950.163) * [-1944.482] (-1951.624) (-1943.975) (-1950.021) -- 0:01:39
Average standard deviation of split frequencies: 0.007378
791000 -- [-1940.856] (-1941.300) (-1945.725) (-1942.066) * [-1944.064] (-1949.483) (-1942.852) (-1943.498) -- 0:01:39
792000 -- (-1945.714) (-1939.958) [-1945.618] (-1942.229) * (-1944.941) [-1945.183] (-1944.717) (-1949.333) -- 0:01:38
793000 -- (-1949.189) (-1944.297) [-1942.180] (-1941.217) * (-1946.904) (-1944.975) (-1943.453) [-1946.499] -- 0:01:38
794000 -- (-1945.537) (-1944.106) [-1952.920] (-1946.396) * (-1945.324) (-1946.707) [-1942.766] (-1942.549) -- 0:01:37
795000 -- (-1936.694) [-1943.532] (-1939.879) (-1943.744) * (-1942.166) [-1947.285] (-1952.072) (-1947.824) -- 0:01:37
Average standard deviation of split frequencies: 0.007773
796000 -- (-1947.476) (-1947.167) (-1943.150) [-1942.208] * (-1948.026) (-1951.865) (-1946.262) [-1939.718] -- 0:01:36
797000 -- [-1939.384] (-1940.883) (-1939.430) (-1948.052) * (-1944.020) (-1943.462) [-1944.076] (-1943.503) -- 0:01:36
798000 -- [-1943.823] (-1945.497) (-1944.796) (-1950.745) * (-1941.849) [-1947.552] (-1946.529) (-1946.271) -- 0:01:35
799000 -- (-1951.254) [-1940.068] (-1950.094) (-1943.833) * (-1945.250) (-1946.480) (-1947.531) [-1951.734] -- 0:01:35
800000 -- [-1940.060] (-1943.886) (-1940.564) (-1946.737) * (-1949.056) (-1944.451) [-1948.288] (-1941.372) -- 0:01:34
Average standard deviation of split frequencies: 0.006992
801000 -- [-1941.591] (-1942.340) (-1941.602) (-1949.904) * [-1943.648] (-1944.935) (-1947.798) (-1947.998) -- 0:01:34
802000 -- (-1947.841) [-1946.832] (-1940.815) (-1954.788) * (-1943.143) (-1942.955) (-1945.562) [-1944.037] -- 0:01:33
803000 -- (-1947.769) [-1946.804] (-1946.463) (-1950.658) * (-1938.073) (-1943.787) [-1944.682] (-1940.951) -- 0:01:33
804000 -- [-1942.908] (-1948.714) (-1939.892) (-1941.719) * (-1944.375) (-1938.146) [-1943.847] (-1942.966) -- 0:01:32
805000 -- (-1946.227) [-1944.073] (-1947.078) (-1944.680) * [-1943.989] (-1947.971) (-1948.956) (-1944.073) -- 0:01:32
Average standard deviation of split frequencies: 0.007092
806000 -- (-1945.353) (-1948.320) (-1947.137) [-1939.594] * [-1945.904] (-1944.665) (-1942.343) (-1945.350) -- 0:01:31
807000 -- (-1943.538) (-1942.907) [-1939.197] (-1943.232) * (-1947.209) (-1941.096) (-1949.627) [-1944.848] -- 0:01:31
808000 -- (-1944.227) (-1948.515) (-1941.650) [-1938.778] * [-1945.341] (-1947.750) (-1942.381) (-1952.087) -- 0:01:31
809000 -- (-1946.952) (-1948.834) [-1944.296] (-1942.625) * (-1940.692) (-1947.725) (-1940.796) [-1941.732] -- 0:01:30
810000 -- [-1940.884] (-1941.763) (-1951.415) (-1943.540) * [-1944.328] (-1942.073) (-1947.333) (-1948.528) -- 0:01:30
Average standard deviation of split frequencies: 0.007123
811000 -- (-1941.857) [-1948.205] (-1942.226) (-1942.703) * [-1951.468] (-1945.515) (-1948.041) (-1940.778) -- 0:01:29
812000 -- (-1944.917) (-1945.566) [-1938.221] (-1948.207) * (-1943.889) (-1944.914) (-1950.285) [-1942.232] -- 0:01:29
813000 -- (-1949.243) (-1950.744) [-1948.100] (-1946.537) * (-1946.372) (-1947.084) (-1945.578) [-1946.451] -- 0:01:28
814000 -- [-1944.157] (-1945.577) (-1944.785) (-1941.866) * (-1947.243) (-1948.724) [-1940.571] (-1943.995) -- 0:01:28
815000 -- (-1951.596) (-1939.561) [-1943.082] (-1936.290) * (-1942.053) (-1947.393) [-1944.327] (-1944.595) -- 0:01:27
Average standard deviation of split frequencies: 0.006427
816000 -- (-1943.861) [-1951.428] (-1939.424) (-1951.329) * (-1943.830) (-1941.646) [-1939.445] (-1940.555) -- 0:01:27
817000 -- (-1969.234) (-1940.070) (-1943.773) [-1939.443] * (-1941.462) (-1942.448) (-1943.479) [-1940.401] -- 0:01:26
818000 -- (-1949.867) (-1941.465) [-1950.512] (-1942.563) * (-1943.382) [-1945.230] (-1940.061) (-1945.985) -- 0:01:26
819000 -- (-1943.960) (-1942.806) (-1946.070) [-1946.252] * (-1945.721) (-1943.385) (-1938.712) [-1942.307] -- 0:01:25
820000 -- (-1951.953) (-1941.127) (-1942.569) [-1940.060] * (-1944.126) (-1947.283) (-1942.463) [-1941.478] -- 0:01:25
Average standard deviation of split frequencies: 0.007539
821000 -- (-1952.168) (-1951.535) (-1948.897) [-1942.161] * (-1946.793) (-1942.708) (-1944.237) [-1944.201] -- 0:01:24
822000 -- (-1943.881) [-1945.738] (-1951.482) (-1943.098) * [-1942.112] (-1943.917) (-1947.529) (-1942.220) -- 0:01:24
823000 -- [-1944.282] (-1944.774) (-1946.505) (-1941.323) * [-1946.557] (-1942.976) (-1942.606) (-1941.413) -- 0:01:23
824000 -- (-1941.351) (-1943.217) [-1942.816] (-1944.795) * (-1948.669) (-1944.364) (-1943.323) [-1944.156] -- 0:01:23
825000 -- (-1944.644) (-1943.318) [-1947.522] (-1945.115) * (-1940.589) (-1948.364) (-1946.132) [-1940.784] -- 0:01:22
Average standard deviation of split frequencies: 0.006349
826000 -- (-1953.622) (-1942.728) (-1947.305) [-1944.552] * [-1941.938] (-1951.780) (-1941.436) (-1952.195) -- 0:01:22
827000 -- (-1940.012) (-1946.077) [-1945.996] (-1942.902) * (-1943.095) [-1942.683] (-1940.461) (-1942.978) -- 0:01:22
828000 -- (-1940.067) (-1938.304) (-1939.475) [-1940.526] * [-1946.375] (-1942.616) (-1940.842) (-1945.116) -- 0:01:21
829000 -- [-1937.730] (-1944.727) (-1947.049) (-1939.163) * (-1941.486) (-1944.853) (-1945.472) [-1949.973] -- 0:01:21
830000 -- (-1943.993) (-1942.635) (-1941.883) [-1940.111] * (-1949.449) [-1937.794] (-1945.260) (-1946.153) -- 0:01:20
Average standard deviation of split frequencies: 0.007094
831000 -- (-1950.205) (-1945.488) (-1946.286) [-1944.617] * (-1942.467) [-1941.203] (-1946.343) (-1955.517) -- 0:01:20
832000 -- (-1944.349) [-1944.040] (-1942.024) (-1943.427) * (-1942.552) [-1947.296] (-1942.790) (-1947.262) -- 0:01:19
833000 -- (-1945.836) (-1943.147) (-1946.852) [-1944.565] * [-1942.847] (-1938.666) (-1950.121) (-1945.951) -- 0:01:19
834000 -- [-1941.813] (-1940.647) (-1950.352) (-1942.179) * (-1942.452) (-1950.772) [-1940.197] (-1942.022) -- 0:01:18
835000 -- (-1941.103) (-1949.605) [-1950.301] (-1943.527) * (-1950.870) (-1952.386) [-1943.093] (-1943.704) -- 0:01:18
Average standard deviation of split frequencies: 0.007401
836000 -- (-1947.431) (-1949.494) (-1946.490) [-1941.915] * [-1946.271] (-1942.523) (-1942.876) (-1949.281) -- 0:01:17
837000 -- (-1948.603) (-1945.720) [-1941.561] (-1941.524) * [-1944.464] (-1944.092) (-1941.736) (-1945.349) -- 0:01:17
838000 -- (-1946.013) (-1947.782) (-1945.021) [-1946.805] * (-1941.506) [-1939.047] (-1940.365) (-1942.388) -- 0:01:16
839000 -- [-1937.597] (-1939.213) (-1942.049) (-1944.929) * (-1945.572) (-1939.438) [-1937.405] (-1954.430) -- 0:01:16
840000 -- (-1949.540) (-1945.597) (-1942.031) [-1943.141] * (-1949.390) (-1941.755) [-1944.572] (-1940.818) -- 0:01:15
Average standard deviation of split frequencies: 0.007780
841000 -- (-1943.219) (-1940.790) (-1946.751) [-1936.978] * (-1947.939) [-1939.905] (-1947.664) (-1941.645) -- 0:01:15
842000 -- (-1946.488) [-1943.103] (-1941.919) (-1942.791) * [-1939.416] (-1944.585) (-1947.427) (-1940.575) -- 0:01:14
843000 -- (-1943.764) (-1936.692) (-1942.734) [-1944.466] * (-1943.897) (-1947.014) [-1939.914] (-1947.284) -- 0:01:14
844000 -- (-1946.293) (-1943.168) (-1942.988) [-1945.942] * (-1945.965) (-1943.089) (-1942.057) [-1940.642] -- 0:01:13
845000 -- (-1946.028) [-1940.795] (-1949.781) (-1945.679) * (-1953.064) (-1948.652) [-1936.836] (-1939.917) -- 0:01:13
Average standard deviation of split frequencies: 0.007940
846000 -- (-1948.796) (-1948.047) (-1947.055) [-1946.795] * (-1945.146) [-1944.963] (-1939.376) (-1943.112) -- 0:01:12
847000 -- (-1946.186) (-1940.532) [-1945.384] (-1951.976) * [-1937.608] (-1947.105) (-1945.554) (-1949.796) -- 0:01:12
848000 -- [-1941.479] (-1941.381) (-1937.546) (-1942.233) * (-1946.292) (-1950.135) (-1938.784) [-1942.512] -- 0:01:12
849000 -- (-1943.501) (-1944.034) (-1946.591) [-1941.134] * (-1940.052) (-1946.660) (-1942.964) [-1947.703] -- 0:01:11
850000 -- (-1945.081) (-1939.636) (-1942.750) [-1943.353] * [-1943.663] (-1946.081) (-1941.211) (-1944.143) -- 0:01:11
Average standard deviation of split frequencies: 0.006858
851000 -- (-1937.612) [-1940.626] (-1941.016) (-1945.092) * (-1948.847) (-1945.570) (-1942.408) [-1945.455] -- 0:01:10
852000 -- [-1942.020] (-1947.994) (-1940.891) (-1947.860) * (-1937.915) [-1943.079] (-1950.263) (-1942.317) -- 0:01:10
853000 -- (-1948.825) (-1945.371) [-1943.495] (-1939.311) * (-1941.318) (-1947.383) (-1952.850) [-1944.063] -- 0:01:09
854000 -- (-1943.612) (-1947.697) (-1943.508) [-1942.075] * (-1944.567) (-1944.250) [-1943.164] (-1943.102) -- 0:01:09
855000 -- [-1945.445] (-1949.648) (-1945.238) (-1944.716) * (-1941.580) [-1943.037] (-1945.069) (-1945.818) -- 0:01:08
Average standard deviation of split frequencies: 0.006746
856000 -- [-1945.161] (-1944.621) (-1940.887) (-1940.156) * [-1942.970] (-1942.556) (-1945.861) (-1947.287) -- 0:01:08
857000 -- [-1941.007] (-1943.993) (-1946.679) (-1938.757) * (-1941.131) (-1941.398) (-1941.730) [-1942.889] -- 0:01:07
858000 -- [-1946.158] (-1945.049) (-1946.776) (-1939.309) * (-1941.371) (-1945.311) (-1942.139) [-1943.324] -- 0:01:07
859000 -- (-1943.898) (-1945.257) (-1941.230) [-1938.855] * (-1946.660) [-1941.388] (-1944.115) (-1950.328) -- 0:01:06
860000 -- [-1941.327] (-1945.437) (-1946.672) (-1943.248) * [-1945.284] (-1942.073) (-1946.157) (-1941.278) -- 0:01:06
Average standard deviation of split frequencies: 0.007052
861000 -- (-1941.879) (-1946.615) (-1945.094) [-1941.808] * (-1943.008) (-1941.303) (-1942.522) [-1942.147] -- 0:01:05
862000 -- [-1943.736] (-1941.201) (-1943.206) (-1948.693) * [-1939.779] (-1949.206) (-1946.458) (-1943.789) -- 0:01:05
863000 -- (-1947.506) (-1944.254) (-1936.134) [-1940.219] * (-1944.811) (-1943.992) [-1940.389] (-1941.024) -- 0:01:04
864000 -- (-1942.789) (-1944.294) [-1946.303] (-1940.049) * (-1939.972) [-1941.954] (-1936.471) (-1941.171) -- 0:01:04
865000 -- (-1943.913) (-1936.586) (-1938.472) [-1948.683] * (-1951.119) [-1944.797] (-1945.552) (-1941.915) -- 0:01:03
Average standard deviation of split frequencies: 0.006940
866000 -- (-1948.371) [-1941.443] (-1946.788) (-1951.557) * (-1952.015) (-1945.481) (-1942.708) [-1938.788] -- 0:01:03
867000 -- [-1945.311] (-1945.870) (-1948.248) (-1946.059) * (-1943.793) [-1945.460] (-1948.492) (-1946.386) -- 0:01:03
868000 -- (-1953.424) [-1941.444] (-1940.218) (-1945.409) * (-1941.214) [-1949.697] (-1946.690) (-1946.285) -- 0:01:02
869000 -- (-1946.004) (-1943.636) (-1939.150) [-1944.661] * (-1943.887) (-1941.107) (-1941.822) [-1944.626] -- 0:01:02
870000 -- (-1945.525) [-1943.782] (-1938.423) (-1944.933) * (-1939.638) [-1950.149] (-1943.703) (-1953.610) -- 0:01:01
Average standard deviation of split frequencies: 0.006836
871000 -- (-1943.773) (-1947.362) (-1946.515) [-1939.352] * (-1943.287) (-1942.197) (-1943.321) [-1938.985] -- 0:01:01
872000 -- (-1939.760) [-1939.951] (-1948.437) (-1944.499) * [-1938.770] (-1946.734) (-1947.984) (-1940.005) -- 0:01:00
873000 -- [-1945.449] (-1947.435) (-1939.901) (-1945.808) * (-1944.682) (-1942.466) (-1943.424) [-1946.512] -- 0:01:00
874000 -- (-1945.725) (-1943.576) [-1946.881] (-1943.805) * (-1947.812) (-1947.169) (-1946.853) [-1943.109] -- 0:00:59
875000 -- [-1949.839] (-1945.044) (-1945.264) (-1942.085) * (-1948.319) (-1940.066) (-1942.811) [-1947.977] -- 0:00:59
Average standard deviation of split frequencies: 0.006861
876000 -- (-1941.991) (-1943.831) (-1940.620) [-1939.373] * (-1945.909) (-1950.182) (-1941.270) [-1941.992] -- 0:00:58
877000 -- (-1943.663) [-1945.575] (-1938.922) (-1949.122) * (-1946.350) (-1943.551) (-1948.596) [-1944.666] -- 0:00:58
878000 -- [-1943.398] (-1936.674) (-1939.470) (-1947.147) * [-1941.818] (-1943.934) (-1951.745) (-1947.444) -- 0:00:57
879000 -- (-1949.276) (-1939.621) [-1942.581] (-1954.593) * [-1944.443] (-1947.666) (-1944.859) (-1942.444) -- 0:00:57
880000 -- (-1950.036) (-1952.894) (-1948.032) [-1937.628] * (-1941.813) (-1935.847) [-1945.632] (-1939.972) -- 0:00:56
Average standard deviation of split frequencies: 0.007427
881000 -- (-1943.262) (-1943.976) (-1944.587) [-1938.705] * (-1946.947) [-1949.206] (-1943.143) (-1946.054) -- 0:00:56
882000 -- (-1942.064) (-1948.153) [-1941.029] (-1940.151) * (-1941.903) (-1940.268) [-1939.931] (-1938.783) -- 0:00:55
883000 -- (-1943.705) [-1944.717] (-1945.407) (-1939.305) * (-1943.417) [-1944.952] (-1942.060) (-1938.504) -- 0:00:55
884000 -- (-1944.034) (-1939.553) [-1946.126] (-1936.883) * (-1943.501) [-1944.936] (-1942.457) (-1943.654) -- 0:00:54
885000 -- (-1951.199) (-1945.823) (-1940.543) [-1939.876] * (-1941.774) (-1942.919) [-1939.510] (-1948.068) -- 0:00:54
Average standard deviation of split frequencies: 0.007316
886000 -- (-1946.031) [-1950.304] (-1945.975) (-1943.982) * (-1940.211) [-1939.614] (-1940.656) (-1942.945) -- 0:00:54
887000 -- (-1940.939) (-1949.389) [-1949.649] (-1940.260) * (-1942.497) (-1941.043) (-1943.115) [-1946.053] -- 0:00:53
888000 -- (-1943.079) (-1948.361) [-1945.623] (-1943.489) * (-1945.935) (-1937.505) [-1945.883] (-1938.281) -- 0:00:53
889000 -- (-1947.905) [-1941.513] (-1948.720) (-1943.141) * (-1954.178) (-1944.835) [-1945.439] (-1941.452) -- 0:00:52
890000 -- (-1950.318) (-1943.353) (-1943.614) [-1950.308] * (-1946.416) (-1944.104) (-1943.486) [-1939.507] -- 0:00:52
Average standard deviation of split frequencies: 0.007674
891000 -- (-1943.293) (-1943.531) (-1942.239) [-1940.051] * (-1951.049) [-1936.854] (-1944.223) (-1956.960) -- 0:00:51
892000 -- [-1942.709] (-1940.875) (-1944.136) (-1948.192) * (-1941.703) (-1946.938) (-1950.154) [-1946.483] -- 0:00:51
893000 -- (-1940.116) [-1947.850] (-1948.361) (-1945.718) * [-1944.624] (-1942.992) (-1944.158) (-1951.810) -- 0:00:50
894000 -- (-1936.244) [-1941.655] (-1944.669) (-1941.629) * (-1938.834) (-1945.298) (-1944.201) [-1946.443] -- 0:00:50
895000 -- [-1940.934] (-1946.510) (-1951.911) (-1948.478) * (-1942.251) [-1940.716] (-1944.616) (-1953.773) -- 0:00:49
Average standard deviation of split frequencies: 0.007366
896000 -- [-1942.001] (-1946.759) (-1948.236) (-1950.000) * (-1942.998) (-1945.619) (-1945.474) [-1946.079] -- 0:00:49
897000 -- (-1946.558) (-1940.776) [-1941.088] (-1944.607) * [-1939.641] (-1945.162) (-1943.851) (-1943.116) -- 0:00:48
898000 -- (-1941.514) (-1945.980) [-1938.813] (-1940.649) * (-1946.025) (-1945.897) [-1945.764] (-1941.961) -- 0:00:48
899000 -- (-1959.340) (-1949.795) [-1948.044] (-1942.293) * [-1947.681] (-1940.303) (-1944.910) (-1941.981) -- 0:00:47
900000 -- (-1944.685) (-1946.928) (-1949.389) [-1942.940] * (-1941.824) (-1945.274) [-1943.884] (-1941.703) -- 0:00:47
Average standard deviation of split frequencies: 0.006739
901000 -- (-1943.844) (-1948.523) (-1947.417) [-1937.982] * (-1941.373) (-1951.044) [-1945.780] (-1942.416) -- 0:00:46
902000 -- [-1948.357] (-1941.546) (-1949.437) (-1945.125) * (-1945.145) (-1942.140) [-1946.555] (-1948.302) -- 0:00:46
903000 -- (-1951.372) (-1954.922) (-1947.245) [-1944.259] * (-1940.049) (-1938.616) (-1944.633) [-1937.365] -- 0:00:45
904000 -- [-1947.835] (-1947.180) (-1942.729) (-1946.009) * (-1937.986) (-1943.323) [-1942.994] (-1947.788) -- 0:00:45
905000 -- (-1938.689) (-1947.229) (-1947.981) [-1943.868] * [-1947.649] (-1948.001) (-1945.857) (-1943.609) -- 0:00:45
Average standard deviation of split frequencies: 0.007024
906000 -- [-1942.257] (-1944.017) (-1940.967) (-1945.903) * (-1947.463) (-1947.665) [-1937.691] (-1944.004) -- 0:00:44
907000 -- [-1941.822] (-1942.960) (-1946.423) (-1941.577) * (-1937.742) (-1949.881) (-1946.391) [-1938.280] -- 0:00:44
908000 -- [-1943.751] (-1953.215) (-1940.924) (-1941.184) * (-1944.407) (-1945.348) [-1944.005] (-1944.864) -- 0:00:43
909000 -- [-1943.830] (-1946.975) (-1938.864) (-1944.979) * (-1940.494) (-1943.273) (-1947.916) [-1942.158] -- 0:00:43
910000 -- (-1946.439) [-1942.879] (-1942.975) (-1944.328) * (-1942.913) [-1942.420] (-1944.985) (-1945.565) -- 0:00:42
Average standard deviation of split frequencies: 0.007959
911000 -- (-1944.330) (-1947.791) (-1943.855) [-1941.567] * (-1939.999) (-1944.764) [-1941.161] (-1950.336) -- 0:00:42
912000 -- [-1942.998] (-1938.114) (-1942.307) (-1947.212) * (-1938.518) [-1945.988] (-1943.719) (-1951.292) -- 0:00:41
913000 -- (-1942.125) [-1942.515] (-1942.422) (-1943.517) * (-1943.421) [-1943.686] (-1953.953) (-1943.278) -- 0:00:41
914000 -- (-1946.066) (-1947.816) [-1951.182] (-1946.909) * (-1951.254) [-1944.154] (-1947.359) (-1940.148) -- 0:00:40
915000 -- (-1945.259) (-1945.710) [-1946.275] (-1944.665) * (-1942.857) (-1944.630) [-1943.756] (-1946.972) -- 0:00:40
Average standard deviation of split frequencies: 0.008041
916000 -- (-1944.543) (-1941.153) [-1941.928] (-1942.630) * [-1942.784] (-1950.477) (-1943.689) (-1945.208) -- 0:00:39
917000 -- [-1947.663] (-1944.278) (-1950.046) (-1940.410) * (-1942.861) (-1938.453) (-1943.031) [-1940.866] -- 0:00:39
918000 -- (-1942.025) [-1942.022] (-1958.805) (-1947.671) * (-1946.890) (-1941.828) (-1946.728) [-1941.892] -- 0:00:38
919000 -- (-1944.523) [-1942.276] (-1945.339) (-1949.649) * [-1937.964] (-1944.499) (-1940.939) (-1937.361) -- 0:00:38
920000 -- [-1944.163] (-1943.477) (-1938.874) (-1944.162) * (-1941.382) (-1939.166) [-1937.204] (-1945.008) -- 0:00:37
Average standard deviation of split frequencies: 0.007616
921000 -- [-1943.860] (-1952.773) (-1943.058) (-1947.766) * (-1949.740) (-1950.198) [-1946.646] (-1949.894) -- 0:00:37
922000 -- (-1946.461) (-1946.706) (-1945.093) [-1945.093] * (-1944.084) (-1946.268) [-1941.226] (-1942.778) -- 0:00:36
923000 -- (-1949.769) [-1942.966] (-1948.008) (-1942.292) * (-1941.246) [-1941.506] (-1942.796) (-1947.533) -- 0:00:36
924000 -- [-1941.496] (-1941.868) (-1942.844) (-1946.318) * [-1943.484] (-1937.771) (-1949.385) (-1945.685) -- 0:00:36
925000 -- [-1942.454] (-1937.229) (-1945.245) (-1945.502) * (-1944.034) (-1945.428) [-1943.408] (-1943.297) -- 0:00:35
Average standard deviation of split frequencies: 0.007318
926000 -- (-1944.031) [-1939.216] (-1951.952) (-1946.515) * (-1945.343) (-1943.483) (-1951.878) [-1937.349] -- 0:00:35
927000 -- [-1940.620] (-1940.983) (-1948.527) (-1946.844) * (-1948.616) [-1942.116] (-1946.202) (-1941.706) -- 0:00:34
928000 -- (-1944.462) [-1947.689] (-1945.266) (-1937.225) * (-1944.463) (-1945.926) [-1946.210] (-1942.430) -- 0:00:34
929000 -- (-1944.342) (-1941.984) (-1946.777) [-1945.344] * [-1940.023] (-1948.231) (-1949.102) (-1950.113) -- 0:00:33
930000 -- (-1951.477) (-1947.583) (-1939.182) [-1946.607] * (-1943.752) (-1946.181) (-1947.577) [-1937.718] -- 0:00:33
Average standard deviation of split frequencies: 0.007155
931000 -- (-1941.554) (-1944.757) [-1949.679] (-1939.369) * [-1943.491] (-1943.792) (-1940.799) (-1949.709) -- 0:00:32
932000 -- (-1942.633) [-1941.062] (-1944.025) (-1943.685) * (-1941.306) (-1936.367) (-1945.770) [-1942.373] -- 0:00:32
933000 -- (-1938.149) (-1939.414) [-1952.512] (-1953.247) * (-1945.020) [-1944.170] (-1947.845) (-1943.400) -- 0:00:31
934000 -- (-1942.672) (-1950.612) (-1941.794) [-1939.891] * (-1944.515) (-1944.843) (-1941.333) [-1941.443] -- 0:00:31
935000 -- [-1946.156] (-1938.925) (-1945.950) (-1938.826) * (-1944.729) (-1947.534) [-1940.942] (-1939.398) -- 0:00:30
Average standard deviation of split frequencies: 0.006610
936000 -- [-1943.754] (-1949.214) (-1942.375) (-1949.992) * (-1944.717) (-1948.378) [-1946.442] (-1939.278) -- 0:00:30
937000 -- (-1945.505) (-1946.865) [-1946.563] (-1944.522) * (-1939.149) (-1942.238) [-1942.772] (-1946.417) -- 0:00:29
938000 -- (-1938.462) [-1942.173] (-1942.389) (-1943.763) * [-1945.223] (-1948.087) (-1943.457) (-1939.222) -- 0:00:29
939000 -- (-1939.410) (-1944.579) (-1942.019) [-1948.860] * (-1939.415) (-1943.550) [-1941.927] (-1947.955) -- 0:00:28
940000 -- (-1943.073) (-1946.391) (-1945.366) [-1945.139] * (-1945.839) (-1947.375) (-1941.914) [-1944.078] -- 0:00:28
Average standard deviation of split frequencies: 0.005826
941000 -- [-1940.079] (-1940.807) (-1940.829) (-1943.926) * (-1945.568) [-1941.013] (-1941.125) (-1946.964) -- 0:00:27
942000 -- (-1943.479) [-1941.308] (-1942.014) (-1943.952) * (-1944.249) (-1942.448) (-1945.420) [-1940.500] -- 0:00:27
943000 -- (-1944.190) (-1943.424) (-1956.803) [-1943.212] * (-1948.939) (-1941.235) [-1943.037] (-1938.264) -- 0:00:27
944000 -- [-1943.457] (-1946.112) (-1942.046) (-1939.205) * (-1947.060) (-1952.815) (-1941.707) [-1941.822] -- 0:00:26
945000 -- (-1940.803) [-1944.137] (-1948.727) (-1939.403) * (-1939.194) (-1943.149) [-1946.350] (-1944.275) -- 0:00:26
Average standard deviation of split frequencies: 0.006416
946000 -- (-1944.650) (-1944.832) [-1946.713] (-1944.560) * (-1940.031) [-1936.656] (-1942.263) (-1941.725) -- 0:00:25
947000 -- (-1942.743) [-1940.329] (-1945.899) (-1942.671) * (-1938.965) (-1944.464) (-1942.637) [-1943.608] -- 0:00:25
948000 -- [-1938.893] (-1943.561) (-1938.398) (-1945.167) * [-1938.132] (-1942.954) (-1942.192) (-1944.682) -- 0:00:24
949000 -- [-1941.938] (-1947.187) (-1945.217) (-1943.907) * [-1940.974] (-1953.381) (-1944.819) (-1943.691) -- 0:00:24
950000 -- (-1941.974) (-1943.541) (-1949.065) [-1940.164] * (-1945.095) (-1943.927) (-1939.874) [-1942.878] -- 0:00:23
Average standard deviation of split frequencies: 0.005826
951000 -- (-1939.481) (-1948.772) [-1941.732] (-1949.310) * (-1945.480) [-1946.758] (-1943.290) (-1938.597) -- 0:00:23
952000 -- (-1939.134) [-1944.440] (-1947.749) (-1948.436) * (-1942.864) (-1943.339) (-1943.635) [-1943.799] -- 0:00:22
953000 -- (-1938.788) [-1943.304] (-1945.691) (-1941.860) * [-1939.846] (-1941.960) (-1941.750) (-1935.114) -- 0:00:22
954000 -- (-1958.244) (-1940.093) [-1951.319] (-1946.180) * [-1942.833] (-1949.696) (-1950.440) (-1942.132) -- 0:00:21
955000 -- (-1945.861) (-1941.633) [-1936.742] (-1951.488) * [-1943.376] (-1938.312) (-1950.760) (-1945.426) -- 0:00:21
Average standard deviation of split frequencies: 0.005424
956000 -- [-1945.351] (-1945.836) (-1941.229) (-1941.735) * (-1936.964) (-1946.198) [-1941.469] (-1944.829) -- 0:00:20
957000 -- (-1944.422) [-1939.518] (-1941.545) (-1946.770) * (-1947.130) [-1939.738] (-1947.683) (-1941.991) -- 0:00:20
958000 -- (-1949.308) (-1944.013) [-1942.257] (-1954.890) * (-1938.260) (-1941.801) (-1944.034) [-1944.948] -- 0:00:19
959000 -- [-1941.238] (-1944.696) (-1951.215) (-1948.124) * [-1947.503] (-1951.858) (-1935.701) (-1947.236) -- 0:00:19
960000 -- [-1935.896] (-1943.713) (-1940.915) (-1940.228) * (-1937.582) (-1945.390) (-1948.792) [-1947.062] -- 0:00:18
Average standard deviation of split frequencies: 0.005704
961000 -- [-1942.026] (-1945.609) (-1944.615) (-1953.451) * [-1946.045] (-1945.309) (-1944.285) (-1944.341) -- 0:00:18
962000 -- [-1942.677] (-1945.507) (-1943.104) (-1939.680) * (-1941.201) (-1942.644) [-1944.935] (-1952.944) -- 0:00:18
963000 -- (-1946.234) (-1949.725) [-1944.952] (-1952.442) * (-1945.389) (-1945.955) [-1945.006] (-1950.340) -- 0:00:17
964000 -- (-1949.741) (-1938.399) (-1939.912) [-1942.173] * [-1939.559] (-1949.353) (-1945.389) (-1942.572) -- 0:00:17
965000 -- (-1944.669) (-1942.311) [-1942.187] (-1946.202) * (-1942.305) [-1944.206] (-1942.093) (-1946.415) -- 0:00:16
Average standard deviation of split frequencies: 0.005856
966000 -- (-1949.521) (-1945.564) (-1945.842) [-1943.162] * (-1943.126) [-1948.631] (-1942.595) (-1943.023) -- 0:00:16
967000 -- (-1943.143) (-1954.474) [-1942.735] (-1950.728) * (-1944.045) (-1946.916) (-1940.887) [-1945.396] -- 0:00:15
968000 -- [-1944.910] (-1942.637) (-1941.333) (-1946.662) * (-1943.737) [-1943.928] (-1939.345) (-1943.564) -- 0:00:15
969000 -- (-1946.580) (-1941.287) (-1948.872) [-1946.052] * (-1945.767) (-1942.559) [-1944.314] (-1944.508) -- 0:00:14
970000 -- (-1947.396) (-1948.906) (-1951.109) [-1945.516] * (-1942.255) (-1942.278) (-1943.140) [-1947.747] -- 0:00:14
Average standard deviation of split frequencies: 0.006071
971000 -- (-1944.973) [-1948.734] (-1941.465) (-1943.616) * [-1946.582] (-1940.802) (-1945.634) (-1946.288) -- 0:00:13
972000 -- (-1942.992) (-1940.794) [-1947.095] (-1948.078) * (-1952.175) [-1950.406] (-1942.430) (-1943.128) -- 0:00:13
973000 -- [-1941.338] (-1947.207) (-1941.711) (-1948.274) * (-1941.082) (-1948.290) [-1946.593] (-1943.655) -- 0:00:12
974000 -- (-1945.410) (-1950.488) [-1949.306] (-1947.274) * (-1946.014) [-1940.490] (-1947.716) (-1942.462) -- 0:00:12
975000 -- (-1945.058) (-1943.033) [-1943.174] (-1947.422) * (-1943.312) [-1943.060] (-1941.231) (-1952.099) -- 0:00:11
Average standard deviation of split frequencies: 0.006883
976000 -- [-1945.541] (-1949.436) (-1945.382) (-1944.397) * (-1947.051) (-1948.109) [-1943.942] (-1945.836) -- 0:00:11
977000 -- [-1948.629] (-1948.625) (-1942.187) (-1942.696) * (-1946.359) [-1946.525] (-1950.120) (-1944.099) -- 0:00:10
978000 -- [-1943.064] (-1938.578) (-1944.333) (-1946.668) * [-1942.448] (-1946.756) (-1942.093) (-1942.258) -- 0:00:10
979000 -- (-1940.690) (-1944.700) (-1945.273) [-1940.541] * (-1939.825) (-1939.620) [-1944.770] (-1939.804) -- 0:00:09
980000 -- (-1951.441) (-1938.247) (-1943.162) [-1939.922] * (-1945.150) (-1943.735) (-1948.116) [-1938.142] -- 0:00:09
Average standard deviation of split frequencies: 0.007451
981000 -- [-1944.111] (-1949.121) (-1946.227) (-1939.500) * [-1943.525] (-1943.013) (-1951.986) (-1944.239) -- 0:00:09
982000 -- (-1948.085) (-1943.973) (-1946.349) [-1941.426] * (-1944.676) [-1945.974] (-1942.841) (-1951.375) -- 0:00:08
983000 -- (-1941.797) (-1943.498) [-1939.468] (-1950.325) * (-1945.031) [-1938.447] (-1950.996) (-1944.803) -- 0:00:08
984000 -- (-1946.377) (-1948.133) (-1943.925) [-1940.128] * (-1944.212) (-1938.658) [-1951.610] (-1943.483) -- 0:00:07
985000 -- (-1940.337) (-1947.058) [-1940.736] (-1945.655) * (-1947.975) [-1940.711] (-1940.260) (-1946.136) -- 0:00:07
Average standard deviation of split frequencies: 0.007889
986000 -- (-1942.002) (-1948.480) [-1944.133] (-1943.725) * (-1942.218) (-1939.677) [-1945.182] (-1943.854) -- 0:00:06
987000 -- (-1943.734) (-1945.276) [-1943.466] (-1946.188) * (-1942.258) (-1940.523) (-1948.486) [-1938.404] -- 0:00:06
988000 -- (-1942.782) (-1942.835) (-1942.437) [-1940.776] * [-1947.199] (-1944.252) (-1943.623) (-1950.454) -- 0:00:05
989000 -- (-1941.390) (-1945.117) (-1937.928) [-1939.254] * [-1940.728] (-1944.249) (-1945.655) (-1946.031) -- 0:00:05
990000 -- (-1944.690) (-1945.534) (-1948.022) [-1940.839] * (-1942.135) [-1943.546] (-1956.424) (-1951.618) -- 0:00:04
Average standard deviation of split frequencies: 0.008089
991000 -- (-1947.240) (-1944.308) [-1940.457] (-1946.152) * (-1943.372) [-1938.792] (-1938.325) (-1949.652) -- 0:00:04
992000 -- (-1949.773) [-1943.718] (-1944.502) (-1937.557) * [-1943.497] (-1948.909) (-1942.260) (-1941.060) -- 0:00:03
993000 -- (-1943.049) [-1942.016] (-1943.218) (-1937.388) * (-1946.252) [-1937.289] (-1945.197) (-1941.273) -- 0:00:03
994000 -- (-1942.790) [-1942.444] (-1945.931) (-1945.905) * [-1938.942] (-1945.384) (-1954.145) (-1948.670) -- 0:00:02
995000 -- (-1942.630) (-1940.408) (-1957.287) [-1942.870] * (-1939.251) (-1940.749) [-1940.813] (-1952.010) -- 0:00:02
Average standard deviation of split frequencies: 0.007454
996000 -- [-1949.893] (-1937.843) (-1942.370) (-1944.945) * (-1941.418) [-1941.839] (-1945.807) (-1945.952) -- 0:00:01
997000 -- (-1939.934) (-1940.292) (-1940.129) [-1955.692] * (-1940.057) (-1940.815) (-1946.626) [-1944.453] -- 0:00:01
998000 -- (-1947.337) [-1944.808] (-1947.534) (-1947.255) * [-1946.816] (-1947.621) (-1946.109) (-1947.425) -- 0:00:00
999000 -- (-1936.448) (-1943.491) [-1943.072] (-1946.266) * [-1945.109] (-1947.610) (-1945.036) (-1953.740) -- 0:00:00
1000000 -- (-1941.032) (-1946.015) [-1939.357] (-1946.798) * [-1946.691] (-1958.765) (-1942.046) (-1952.079) -- 0:00:00
Average standard deviation of split frequencies: 0.006831
Analysis completed in 7 mins 54 seconds
Analysis used 473.70 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1933.21
Likelihood of best state for "cold" chain of run 2 was -1933.29
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
58.5 % ( 54 %) Dirichlet(Revmat{all})
73.4 % ( 65 %) Slider(Revmat{all})
25.5 % ( 25 %) Dirichlet(Pi{all})
28.0 % ( 21 %) Slider(Pi{all})
30.3 % ( 33 %) Multiplier(Alpha{1,2})
53.1 % ( 28 %) Multiplier(Alpha{3})
42.3 % ( 32 %) Slider(Pinvar{all})
16.4 % ( 8 %) ExtSPR(Tau{all},V{all})
18.8 % ( 21 %) ExtTBR(Tau{all},V{all})
19.7 % ( 25 %) NNI(Tau{all},V{all})
13.2 % ( 16 %) ParsSPR(Tau{all},V{all})
26.3 % ( 23 %) Multiplier(V{all})
31.9 % ( 34 %) Nodeslider(V{all})
25.6 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
57.2 % ( 38 %) Dirichlet(Revmat{all})
73.4 % ( 64 %) Slider(Revmat{all})
25.3 % ( 24 %) Dirichlet(Pi{all})
27.4 % ( 25 %) Slider(Pi{all})
30.2 % ( 19 %) Multiplier(Alpha{1,2})
53.1 % ( 27 %) Multiplier(Alpha{3})
42.2 % ( 26 %) Slider(Pinvar{all})
16.4 % ( 21 %) ExtSPR(Tau{all},V{all})
19.0 % ( 23 %) ExtTBR(Tau{all},V{all})
19.9 % ( 24 %) NNI(Tau{all},V{all})
13.1 % ( 16 %) ParsSPR(Tau{all},V{all})
26.3 % ( 21 %) Multiplier(V{all})
31.9 % ( 29 %) Nodeslider(V{all})
25.7 % ( 18 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.48
2 | 166960 0.81 0.65
3 | 166495 166336 0.83
4 | 166795 166814 166600
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 167134 0.82 0.65
3 | 166582 166098 0.83
4 | 167214 166715 166257
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1941.37
| 2 |
| |
| 2 2 |
| 1 2 |
| 2 1 2 21 |
| 1 2 2 1 2 11 2 1 2 |
|1 2 2 2111 1 2 11 2 1 1* 1 1 1 |
| 22 1 111 2 2 2 22 1 * 21*211* 1 122 21 2|
| 1 * 1 2 111 22 12 22 1 22 2 1 2 1|
| 2 2 2 1 2 1 1 |
| 22 11 1 1 1 |
| 2 22 1 11 2 |
| 1 1 |
|2 2 2 |
| 1 1 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1945.33
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1939.92 -1953.61
2 -1939.76 -1950.65
--------------------------------------
TOTAL -1939.84 -1952.97
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 9.277584 15.795643 3.967375 16.986490 8.384008 878.35 971.59 1.001
r(A<->C){all} 0.093656 0.001477 0.021387 0.170040 0.092525 612.73 723.13 1.000
r(A<->G){all} 0.289378 0.002987 0.192224 0.402609 0.287201 666.79 868.40 1.000
r(A<->T){all} 0.125172 0.000984 0.067553 0.188962 0.122818 647.57 757.96 1.000
r(C<->G){all} 0.216308 0.002523 0.117658 0.311810 0.215146 551.42 602.67 1.000
r(C<->T){all} 0.220828 0.001739 0.142562 0.304063 0.217743 804.02 838.31 1.000
r(G<->T){all} 0.054659 0.000879 0.000019 0.107731 0.051842 708.10 738.69 1.000
pi(A){all} 0.257421 0.000232 0.228906 0.288338 0.257613 928.14 1040.16 1.001
pi(C){all} 0.225523 0.000196 0.199229 0.253429 0.225041 989.50 1039.62 1.000
pi(G){all} 0.169347 0.000160 0.144877 0.193623 0.169069 832.79 991.66 1.000
pi(T){all} 0.347710 0.000288 0.314246 0.380280 0.347202 1114.56 1218.39 1.000
alpha{1,2} 0.449247 0.011527 0.251792 0.648820 0.436885 795.43 868.61 1.000
alpha{3} 3.574764 2.149316 1.167707 6.462226 3.299310 1310.16 1405.58 1.000
pinvar{all} 0.027838 0.000474 0.000005 0.069096 0.023299 1323.92 1359.23 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .****.
8 -- ..*.*.
9 -- ..***.
10 -- .*.*..
11 -- .*.**.
12 -- .***..
13 -- .**.*.
14 -- ...**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 3002 1.000000 0.000000 1.000000 1.000000 2
8 1244 0.414390 0.013191 0.405063 0.423718 2
9 1127 0.375416 0.012719 0.366422 0.384410 2
10 1091 0.363424 0.006124 0.359094 0.367755 2
11 648 0.215856 0.010364 0.208528 0.223185 2
12 595 0.198201 0.004240 0.195203 0.201199 2
13 371 0.123584 0.001413 0.122585 0.124584 2
14 370 0.123251 0.006595 0.118588 0.127915 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.014950 0.000110 0.000000 0.034525 0.013146 1.001 2
length{all}[2] 1.774511 0.450445 0.737308 3.259601 1.663430 1.000 2
length{all}[3] 0.307467 0.016887 0.000458 0.512374 0.316206 1.000 2
length{all}[4] 0.189295 0.014463 0.000087 0.398975 0.180240 1.000 2
length{all}[5] 0.368036 0.017428 0.058388 0.607431 0.373151 1.000 2
length{all}[6] 0.014022 0.000107 0.000009 0.033661 0.012061 1.000 2
length{all}[7] 6.172454 11.264521 1.877318 12.602170 5.350899 1.001 2
length{all}[8] 0.174266 0.011573 0.001328 0.362762 0.164440 0.999 2
length{all}[9] 0.460817 0.216908 0.000247 1.358006 0.336724 1.000 2
length{all}[10] 0.164728 0.011799 0.001509 0.369349 0.148509 1.002 2
length{all}[11] 0.201431 0.015641 0.000207 0.425889 0.193032 0.999 2
length{all}[12] 0.198807 0.016747 0.000158 0.431053 0.182636 1.000 2
length{all}[13] 0.126368 0.008896 0.000087 0.307547 0.105484 0.998 2
length{all}[14] 0.124329 0.010483 0.001077 0.341458 0.100524 1.005 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006831
Maximum standard deviation of split frequencies = 0.013191
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C6 (6)
|
+ /------------------------------------ C2 (2)
| |
| |------------------------------------ C3 (3)
\----------------100----------------+
|------------------------------------ C4 (4)
|
\------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/ C1 (1)
|
| C6 (6)
|
+ /----------------- C2 (2)
| |
| |--- C3 (3)
\------------------------------------------------------+
|-- C4 (4)
|
\---- C5 (5)
|---------| 1.000 expected changes per site
Calculating tree probabilities...
Credible sets of trees (15 trees sampled):
50 % credible set contains 3 trees
90 % credible set contains 10 trees
95 % credible set contains 12 trees
99 % credible set contains 14 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
Running FUBAR...
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\
***************** TYPES OF STANDARD ANALYSES *****************
(1) Selection Analyses
(2) Evolutionary Hypothesis Testing
(3) Relative evolutionary rate inference
(4) Coevolutionary analysis
(5) Basic Analyses
(6) Codon Selection Analyses
(7) Compartmentalization
(8) Data File Tools
(9) Miscellaneous
(10) Model Comparison
(11) Kernel Analysis Tools
(12) Molecular Clock
(13) Phylogeny Reconstruction
(14) Positive Selection
(15) Recombination
(16) Selection/Recombination
(17) Relative Rate
(18) Relative Ratio
(19) Substitution Rates
Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' *****************
(1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution).
(2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood).
(3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting).
(4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection).
(5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification).
(6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood).
(7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation).
Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types):
Analysis Description
--------------------
Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a
coding sequence alignment to determine whether some sites have been
subject to pervasive purifying or diversifying selection. v2.1
introduces two more methods for estimating the posterior distribution of
grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation
Bayes approximation (fastest). Please note that a FUBAR analysis
generates a cache and a results JSON file in the same directory as
directory as the original alignment. HyPhy needs to have write
privileges to this directory. For example if the original file is in
/home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there
will also exist FUBAR-generated files
/home/sergei/FUBAR/data/pol.nex.FUBAR.json,
/home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide
checkpointing so that a partially completed analysis can be restarted.
- __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree
(one per partition)
- __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring
selection (2013), Mol Biol Evol. 30(5):1196-205
- __Written by__: Sergei L Kosakovsky Pond
- __Contact Information__: spond@temple.edu
- __Analysis Version__: 2.1
####Choose Genetic Code
1. [**Universal**] Universal code. (Genebank transl_table=1).
2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2).
3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3).
4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4).
5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5).
6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6).
7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9).
8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10).
9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12).
10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13).
11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14).
12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15).
13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16).
14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21).
15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22).
16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23).
17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24).
18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25).
19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26).
>Please choose an option (or press q to cancel selection):
>Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`)
>A tree was found in the data file: `(C1,C6,(C2,C3,C4,C5))`
>Would you like to use it (y/n)?
>Loaded a multiple sequence alignment with **6** sequences, **131** codons, and **1** partitions from `/data//pss_subsets/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result/original_alignment/fubar/results/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1.fna`
> FUBAR will write cache and result files to _/data//pss_subsets/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result/original_alignment/fubar/results/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result/original_alignment/fubar/results/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1.fna.FUBAR.json_, respectively
> Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer):
####Posterior estimation method
1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation)
2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed)
3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default)
>Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5):
### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model
* Log(L) = -2029.93, AIC-c = 4090.07 (15 estimated parameters)
* Tree length (expected substitutions/site) for partition 1 : 2.174
### Computing the phylogenetic likelihood function on the grid
* Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid
* Best scaling achieved for
* synonymous rate = 7.125
* non-synonymous rate = 0.643
* Computing conditional site likelihoods on a 20 x 20 rate grid
### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights
* Using the following settings
* Dirichlet alpha : 0.5
### Tabulating site-level results
----
## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=6, Len=131
16BO133_NA_ASO66814_1_2016_04_17_South_Korea_Unknown_Bat_coronavirus MKIILFSILIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFH
BtCoV_Rh_YN2012_Ra13591_orf9_QBP43298_1_2013_06_01_China_Unknown_Bat_coronavirus MRVVALLLLISPVFS--RQVFHYIDCVAGSSTTFGLPC-EGLIQTQSSVQ
BtCoV_Rh_YN2012_Rs3376_orf9_QBP43265_1_2012_05_19_China_Unknown_Bat_coronavirus MRVILLLAVLYVALATSREVHHYIDCVRGTSRTLQLPC-DGTVESTTPVQ
BtCoV_Rh_YN2012_Rs4125_orf9_QBP43276_1_2012_09_16_China_Unknown_Bat_coronavirus MRVLILLSLLSVALTAAPEIHHYIDCVRGTSTTILQPC-DGVIESTSPVQ
BtCoV_Rh_YN2012_Rs4259_orf9_QBP43287_1_2013_04_17_China_Unknown_Bat_coronavirus MRVLLLLSLCAFALS--KEIHYYVDCISGTSTTVNQPC-DGVIESTSPVQ
JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus MKIILFLTLIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFH
*::: : : . ::.:* :*: *:: . ** .* : :..:
16BO133_NA_ASO66814_1_2016_04_17_South_Korea_Unknown_Bat_coronavirus PLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQE
BtCoV_Rh_YN2012_Ra13591_orf9_QBP43298_1_2013_06_01_China_Unknown_Bat_coronavirus FVPDQQYGRVGVLCISNYVQTFRISCPHGN-HTFIIR-----STTYRTNV
BtCoV_Rh_YN2012_Rs3376_orf9_QBP43265_1_2012_05_19_China_Unknown_Bat_coronavirus FTPDYAYGSIAVPC--NVVFQMRISCPLGN-YTYHVR-----PVSFRTHT
BtCoV_Rh_YN2012_Rs4125_orf9_QBP43276_1_2012_09_16_China_Unknown_Bat_coronavirus FTPNTQYGSLAVSC--SLVTQIRISCPHGN-HTFHVR-----PVSFRTHT
BtCoV_Rh_YN2012_Rs4259_orf9_QBP43287_1_2013_04_17_China_Unknown_Bat_coronavirus FTPNYAYGSLAVAC--NSVVQIRILCPRGN-YTFHIR-----PVSFRTHT
JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus PLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQE
.: : .: * : : *. *. :*: :* . : :
16BO133_NA_ASO66814_1_2016_04_17_South_Korea_Unknown_Bat_coronavirus KVYQELYSPLFLIVIALVFIILCFTIKRKIE
BtCoV_Rh_YN2012_Ra13591_orf9_QBP43298_1_2013_06_01_China_Unknown_Bat_coronavirus RVTQPQSGDLMMLILCFLIILVLYVCLWR--
BtCoV_Rh_YN2012_Rs3376_orf9_QBP43265_1_2012_05_19_China_Unknown_Bat_coronavirus RYSQPQGNELQCLIVFLLILIVFYLVFRRR-
BtCoV_Rh_YN2012_Rs4125_orf9_QBP43276_1_2012_09_16_China_Unknown_Bat_coronavirus RYSQPQGNELQCLIVTLLIVIVLYLFFRRR-
BtCoV_Rh_YN2012_Rs4259_orf9_QBP43287_1_2013_04_17_China_Unknown_Bat_coronavirus RYSQPQGNEVQCLVVTLLLVILLILLFRRR-
JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus KVYQELYSPLFLIVAALVFIILCFTIKRKIE
: * . : :: :::::: :
>16BO133_NA_ASO66814_1_2016_04_17_South_Korea_Unknown_Bat_coronavirus ATGAAAATTATTCTCTTCTCGATATTGATTGTACTTGCAACTTGC---------GAGTTATATCACTATCAAGAGTGTGTTAGAGGTACTACTGTACTATTAGAGGAACCTTGCCCATCAGGAACTTACGAGGGCAATTCACCATTTCATCCTCTTGCTGATAACAAATTT---------GCACTAACTTGC---------ATTAGCACACATTTTGCTTTTGCTTGTGCTGACGGTACTAGACATACCTATCAGCTTCGTGCAAGATCAGTTTCACCTAAACTTTTCACCAGACAAGAGAAAGTTTACCAAGAGCTCTATTCGCCGCTTTTTCTCATTGTTATTGCTTTAGTATTTATAATACTTTGCTTCACCATTAAGAGGAAGATAGAA >BtCoV_Rh_YN2012_Ra13591_orf9_QBP43298_1_2013_06_01_China_Unknown_Bat_coronavirus ATGCGAGTCGTTGCACTACTCTTGCTAATTTCACCCGTTTTTTCA------AGACAAGTCTTCCACTATATTGATTGTGTAGCTGGCAGTTCAACTACATTTGGTTTACCCTGT---GAAGGGCTTATTCAAACCCAATCTAGTGTACAATTTGTCCCAGACCAACAATATGGTCGTGTAGGTGTTTTATGCATTAGTAATTATGTGCAGACTTTTCGCATTTCTTGTCCACATGGCAAC---CACACTTTTATCATAAGA---------------TCAACCACTTACAGAACTAATGTCAGAGTCACACAACCCCAAAGTGGTGACTTAATGATGTTAATCTTGTGTTTTCTTATTATATTAGTCCTTTATGTTTGCCTCTGGCGT------ >BtCoV_Rh_YN2012_Rs3376_orf9_QBP43265_1_2012_05_19_China_Unknown_Bat_coronavirus ATGCGTGTCATTTTGCTCCTTGCTGTTCTCTATGTAGCACTTGCTACATCTCGCGAAGTACATCATTACATTGATTGTGTTCGCGGTACATCCAGGACCCTACAACTTCCCTGT---GATGGAACAGTAGAGAGTACTACACCTGTCCAGTTTACACCGGACTATGCTTATGGTAGTATTGCTGTACCATGT------AATGTGGTCTTTCAGATGCGCATTTCTTGTCCACTTGGTAAT---TATACTTATCATGTTAGA---------------CCTGTCAGCTTCAGGACTCACACTCGCTACTCACAACCCCAGGGAAATGAGTTGCAGTGCCTGATAGTCTTTCTTCTAATTCTGATTGTTTTCTACCTTGTTTTCCGCAGACGC--- >BtCoV_Rh_YN2012_Rs4125_orf9_QBP43276_1_2012_09_16_China_Unknown_Bat_coronavirus ATGCGTGTGCTAATTCTACTTTCACTGTTGTCAGTGGCGCTTACAGCTGCGCCAGAGATACATCATTATATTGATTGTGTCCGTGGGACATCTACCACCATCTTACAACCATGT---GATGGTGTTATAGAAAGTACAAGCCCAGTGCAGTTCACACCTAATACCCAGTATGGTAGTTTGGCAGTGTCTTGC------AGCTTGGTGACACAAATTCGCATTTCTTGTCCTCATGGTAAT---CACACATTTCATGTTAGA---------------CCTGTTAGTTTCAGAACACATACACGCTACTCCCAGCCGCAAGGTAATGAGTTGCAGTGCCTGATTGTCACTCTTCTAATTGTAATTGTTCTTTACCTGTTCTTTCGCAGACGT--- >BtCoV_Rh_YN2012_Rs4259_orf9_QBP43287_1_2013_04_17_China_Unknown_Bat_coronavirus ATGCGTGTGTTGCTTCTGCTTTCGCTTTGTGCCTTTGCACTATCT------AAGGAGATACACTACTATGTAGATTGTATTTCTGGCACTTCCACCACTGTTAACCAACCTTGT---GATGGAGTAATAGAAAGCACTAGCCCTGTACAATTTACACCAAACTATGCATATGGCAGTTTGGCTGTCGCCTGC------AATAGTGTTGTACAAATTCGCATTCTGTGTCCCCGTGGTAAT---TACACTTTTCACATTAGA---------------CCTGTAAGCTTTAGGACGCACACTCGTTATTCTCAACCCCAGGGAAACGAGGTGCAATGTCTTGTAGTAACTCTTCTACTTGTGATTCTTCTCATCCTGCTGTTTCGCAGGCGC--- >JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus ATGAAAATTATTCTCTTCTTGACATTGATTGTACTTGCAACTTGC---------GAGTTATATCACTATCAAGAGTGTGTTAGAGGTACCACTGTACTATTAGAAGAACCTTGCCCATCAGGAACTTACGAGGGCAATTCACCATTTCATCCTCTTGCTGATAACAAATTT---------GCACTAACTTGC---------ATTAGCACACATTTTGCTTTTGCTTGTGCTGACGGTACTAGACATACCTATCAGCTTCGTGCAAGATCAGTTTCACCTAAACTTTTCACCAGACAAGAGAAAGTTTACCAAGAGCTCTATTCGCCGCTTTTTCTCATTGTTGCTGCTTTAGTATTTATAATACTTTGCTTCACCATTAAGAGGAAGATAGAA
>16BO133_NA_ASO66814_1_2016_04_17_South_Korea_Unknown_Bat_coronavirus MKIILFSILIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFH PLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQE KVYQELYSPLFLIVIALVFIILCFTIKRKIE >BtCoV_Rh_YN2012_Ra13591_orf9_QBP43298_1_2013_06_01_China_Unknown_Bat_coronavirus MRVVALLLLISPVFS--RQVFHYIDCVAGSSTTFGLPC-EGLIQTQSSVQ FVPDQQYGRVGVLCISNYVQTFRISCPHGN-HTFIIR-----STTYRTNV RVTQPQSGDLMMLILCFLIILVLYVCLWR-- >BtCoV_Rh_YN2012_Rs3376_orf9_QBP43265_1_2012_05_19_China_Unknown_Bat_coronavirus MRVILLLAVLYVALATSREVHHYIDCVRGTSRTLQLPC-DGTVESTTPVQ FTPDYAYGSIAVPC--NVVFQMRISCPLGN-YTYHVR-----PVSFRTHT RYSQPQGNELQCLIVFLLILIVFYLVFRRR- >BtCoV_Rh_YN2012_Rs4125_orf9_QBP43276_1_2012_09_16_China_Unknown_Bat_coronavirus MRVLILLSLLSVALTAAPEIHHYIDCVRGTSTTILQPC-DGVIESTSPVQ FTPNTQYGSLAVSC--SLVTQIRISCPHGN-HTFHVR-----PVSFRTHT RYSQPQGNELQCLIVTLLIVIVLYLFFRRR- >BtCoV_Rh_YN2012_Rs4259_orf9_QBP43287_1_2013_04_17_China_Unknown_Bat_coronavirus MRVLLLLSLCAFALS--KEIHYYVDCISGTSTTVNQPC-DGVIESTSPVQ FTPNYAYGSLAVAC--NSVVQIRILCPRGN-YTFHIR-----PVSFRTHT RYSQPQGNEVQCLVVTLLLVILLILLFRRR- >JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus MKIILFLTLIVLATC---ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFH PLADNKF---ALTC---ISTHFAFACADGTRHTYQLRARSVSPKLFTRQE KVYQELYSPLFLIVAALVFIILCFTIKRKIE
Reading sequence file /data//pss_subsets/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result/original_alignment/fubar/fasta/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1
Found 6 sequences of length 393
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 45.2%
Found 191 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0% 77.4%100.0%
Using a window size of 80 with k as 39
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 173 polymorphic sites
**p-Value(s)**
----------
NSS: 3.50e-01 (1000 permutations)
Max Chi^2: 2.60e-02 (1000 permutations)
PHI (Permutation): 1.97e-01 (1000 permutations)
PHI (Normal): 2.27e-01
#NEXUS
[ID: 2488018479]
begin taxa;
dimensions ntax=6;
taxlabels
16BO133_NA_ASO66814_1_2016_04_17_South_Korea_Unknown_Bat_coronavirus
BtCoV_Rh_YN2012_Ra13591_orf9_QBP43298_1_2013_06_01_China_Unknown_Bat_coronavirus
BtCoV_Rh_YN2012_Rs3376_orf9_QBP43265_1_2012_05_19_China_Unknown_Bat_coronavirus
BtCoV_Rh_YN2012_Rs4125_orf9_QBP43276_1_2012_09_16_China_Unknown_Bat_coronavirus
BtCoV_Rh_YN2012_Rs4259_orf9_QBP43287_1_2013_04_17_China_Unknown_Bat_coronavirus
JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus
;
end;
begin trees;
translate
1 16BO133_NA_ASO66814_1_2016_04_17_South_Korea_Unknown_Bat_coronavirus,
2 BtCoV_Rh_YN2012_Ra13591_orf9_QBP43298_1_2013_06_01_China_Unknown_Bat_coronavirus,
3 BtCoV_Rh_YN2012_Rs3376_orf9_QBP43265_1_2012_05_19_China_Unknown_Bat_coronavirus,
4 BtCoV_Rh_YN2012_Rs4125_orf9_QBP43276_1_2012_09_16_China_Unknown_Bat_coronavirus,
5 BtCoV_Rh_YN2012_Rs4259_orf9_QBP43287_1_2013_04_17_China_Unknown_Bat_coronavirus,
6 JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:1.314588e-02,6:1.206135e-02,(2:1.663430e+00,3:3.162059e-01,4:1.802402e-01,5:3.731514e-01)1.000:5.350899e+00);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:1.314588e-02,6:1.206135e-02,(2:1.663430e+00,3:3.162059e-01,4:1.802402e-01,5:3.731514e-01):5.350899e+00);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1939.39 -1951.79
2 -1939.65 -1950.64
--------------------------------------
TOTAL -1939.51 -1951.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 9.359770 17.346309 3.801414 17.337440 8.299917 1042.03 1042.74 1.000
r(A<->C){all} 0.095462 0.001593 0.018056 0.172554 0.092652 574.10 606.93 1.007
r(A<->G){all} 0.289586 0.003011 0.184123 0.391569 0.287680 633.07 761.77 1.003
r(A<->T){all} 0.124411 0.001055 0.061570 0.188272 0.122730 750.69 756.81 1.000
r(C<->G){all} 0.215149 0.002679 0.117893 0.319172 0.212132 499.42 575.51 1.001
r(C<->T){all} 0.221506 0.001744 0.144979 0.303931 0.218476 653.69 790.97 1.000
r(G<->T){all} 0.053886 0.000855 0.001834 0.108546 0.050386 675.80 706.99 1.000
pi(A){all} 0.257980 0.000226 0.230808 0.289110 0.257683 1181.37 1245.02 1.000
pi(C){all} 0.224931 0.000208 0.198144 0.253001 0.224249 957.58 1049.73 1.000
pi(G){all} 0.169224 0.000170 0.143341 0.194449 0.168816 885.14 1080.63 1.000
pi(T){all} 0.347865 0.000292 0.313205 0.379268 0.347720 1020.78 1126.36 1.001
alpha{1,2} 0.449771 0.011952 0.262566 0.662106 0.437718 891.02 934.64 1.000
alpha{3} 3.548336 1.840352 1.231004 6.214059 3.342433 1045.30 1208.60 1.000
pinvar{all} 0.027413 0.000468 0.000003 0.069589 0.022549 1225.54 1292.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C6,(C2,C3,C4,C5))` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **6** sequences, **131** codons, and **1** partitions from `/data//pss_subsets/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result/original_alignment/fubar/results/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result/original_alignment/fubar/results/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result/original_alignment/fubar/results/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1/JTMC15_ORF7a_ANA96033_1_2013_08_China_Bat_Bat_coronavirus.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -2029.93, AIC-c = 4090.07 (15 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 2.174 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 7.125 * non-synonymous rate = 0.643 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results ---- ## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
