-- Starting log on Wed Oct 26 22:52:38 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_NS3c_ABN10851_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=10, Len=285
C1 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDYSMEWSSDSVVLPPTSSDK
C2 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDYSMEWSSDSVVLPPTSSDK
C3 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDYSMEWSSDSVVLPPTSSDK
C4 -----------------MQPELSVSNCRLLDSSMEWSSSSVAALLTSSEK
C5 MSIVLRLLSVLKLQQNKMQPELYVH-CMLLDSSMEWSSSSVAALLTSSEK
C6 MSIVLRLLSVLKLQQNKMQPELYVH-CMLLDSSMEWSSSSVAALLTSSEK
C7 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDYSMEWSSDSVVLPPTSSDK
C8 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDSSMEWSSDSVVLPSTSSDK
C9 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDSSMEWSSDSVVLPSTSSDK
C10 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDSSMEWSSDSVVLLSTSSDK
** :* * *** ******.**. ***:*
C1 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C2 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C3 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C4 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVRQEPTHCVRLVF
C5 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVRQEPTHCVRLVF
C6 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVRQEPTHCVRLVF
C7 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C8 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C9 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C10 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
**************************************:***********
C1 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIYAPEAGECFGNFLHLC
C2 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIYAPEAGECFGNFLHLC
C3 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIYAPEAGECFGNFLHLC
C4 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIHAPEAGECFGNLLHLT
C5 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIHAPEAGECFGNLLHLT
C6 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIHAPEAGECFGNLLHLT
C7 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIYAPEAGECFGNFLHLC
C8 PLTKRWIHFDGLVYSLARLNVSMTVDYHVTLALIYAPEAGECFGNFLHLC
C9 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIHAPDAGECFGNLLHLS
C10 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIHAPDAGECFGNLLHLS
**:*******************************:**:*******:***
C1 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C2 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C3 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C4 PLLKDCLLEFKKLCILGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C5 PLLKDCLLEFKKLCILGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C6 PLLKDCLLEFKKLCILGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C7 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C8 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C9 PLLKDCLLEFKKLFVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C10 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
************* :***********************************
C1 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
C2 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
C3 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
C4 EHGYEIYSSQLPLHMSLAKLHDLPQAQFTEAAGLCHYFDPREFALPSALE
C5 EHGYEIYSSQLPLHMSLAKLHDLPQAQFTEAAGLCHYFDPREFALPSALE
C6 EHGYEIYSSQLPLHMSLAKLHDLPQAQFTEAAGLCHYFDPREFALPSALE
C7 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
C8 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
C9 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPQEFALPCALE
C10 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
*******.********************:***********:*****.***
C1 VVKIGGGKVNGRSIPLARFPINNEFKFIPYLYQCV
C2 VVKIGGGKVNGRSIPLARFPINNEFKFIPYLYQCV
C3 VVKIGGGKVNGRSIPLARFPINNEFKFIPYLYQCV
C4 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCA
C5 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCA
C6 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCA
C7 VVKIGGGKVNGRSIPLARFPINNEFKFIPYLYQCV
C8 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCV
C9 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCV
C10 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCV
****************.*****************.
-- Starting log on Wed Oct 26 22:53:09 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_NS3c_ABN10851_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.09 sec, SCORE=997, Nseq=10, Len=285
C1 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDYSMEWSSDSVVLPPTSSDK
C2 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDYSMEWSSDSVVLPPTSSDK
C3 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDYSMEWSSDSVVLPPTSSDK
C4 -----------------MQPELSVSNCRLLDSSMEWSSSSVAALLTSSEK
C5 MSIVLRLLSVLKLQQNKMQPELYVH-CMLLDSSMEWSSSSVAALLTSSEK
C6 MSIVLRLLSVLKLQQNKMQPELYVH-CMLLDSSMEWSSSSVAALLTSSEK
C7 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDYSMEWSSDSVVLPPTSSDK
C8 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDSSMEWSSDSVVLPSTSSDK
C9 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDSSMEWSSDSVVLPSTSSDK
C10 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDSSMEWSSDSVVLLSTSSDK
** :* * *** ******.**. ***:*
C1 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C2 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C3 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C4 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVRQEPTHCVRLVF
C5 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVRQEPTHCVRLVF
C6 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVRQEPTHCVRLVF
C7 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C8 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C9 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C10 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
**************************************:***********
C1 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIYAPEAGECFGNFLHLC
C2 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIYAPEAGECFGNFLHLC
C3 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIYAPEAGECFGNFLHLC
C4 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIHAPEAGECFGNLLHLT
C5 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIHAPEAGECFGNLLHLT
C6 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIHAPEAGECFGNLLHLT
C7 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIYAPEAGECFGNFLHLC
C8 PLTKRWIHFDGLVYSLARLNVSMTVDYHVTLALIYAPEAGECFGNFLHLC
C9 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIHAPDAGECFGNLLHLS
C10 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIHAPDAGECFGNLLHLS
**:*******************************:**:*******:***
C1 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C2 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C3 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C4 PLLKDCLLEFKKLCILGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C5 PLLKDCLLEFKKLCILGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C6 PLLKDCLLEFKKLCILGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C7 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C8 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C9 PLLKDCLLEFKKLFVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C10 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
************* :***********************************
C1 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
C2 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
C3 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
C4 EHGYEIYSSQLPLHMSLAKLHDLPQAQFTEAAGLCHYFDPREFALPSALE
C5 EHGYEIYSSQLPLHMSLAKLHDLPQAQFTEAAGLCHYFDPREFALPSALE
C6 EHGYEIYSSQLPLHMSLAKLHDLPQAQFTEAAGLCHYFDPREFALPSALE
C7 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
C8 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
C9 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPQEFALPCALE
C10 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
*******.********************:***********:*****.***
C1 VVKIGGGKVNGRSIPLARFPINNEFKFIPYLYQCV
C2 VVKIGGGKVNGRSIPLARFPINNEFKFIPYLYQCV
C3 VVKIGGGKVNGRSIPLARFPINNEFKFIPYLYQCV
C4 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCA
C5 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCA
C6 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCA
C7 VVKIGGGKVNGRSIPLARFPINNEFKFIPYLYQCV
C8 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCV
C9 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCV
C10 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCV
****************.*****************.
-- Starting log on Wed Oct 26 23:09:46 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/B05f_NS3c_ABN10851_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/gapped_alignment/codeml,B05f_NS3c_ABN10851_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 10 taxa and 855 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C10
Taxon 3 -> C2
Taxon 4 -> C3
Taxon 5 -> C4
Taxon 6 -> C5
Taxon 7 -> C6
Taxon 8 -> C7
Taxon 9 -> C8
Taxon 10 -> C9
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666825788
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1160092855
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1355324698
Seed = 1327025772
Swapseed = 1666825788
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 15 unique site patterns
Division 2 has 22 unique site patterns
Division 3 has 29 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2323.708737 -- 35.653401
Chain 2 -- -2282.139701 -- 35.653401
Chain 3 -- -2093.407410 -- 35.653401
Chain 4 -- -2335.995300 -- 35.653401
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2336.316604 -- 35.653401
Chain 2 -- -2349.185395 -- 35.653401
Chain 3 -- -2127.399754 -- 35.653401
Chain 4 -- -2336.363025 -- 35.653401
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2323.709] (-2282.140) (-2093.407) (-2335.995) * [-2336.317] (-2349.185) (-2127.400) (-2336.363)
1000 -- (-1612.133) [-1605.214] (-1615.220) (-1617.110) * (-1609.693) (-1603.833) (-1606.575) [-1610.170] -- 0:00:00
2000 -- (-1606.195) (-1597.851) (-1591.978) [-1594.266] * (-1611.312) (-1596.187) [-1595.920] (-1607.971) -- 0:00:00
3000 -- (-1603.137) (-1596.807) [-1603.075] (-1604.154) * (-1605.640) (-1602.368) (-1594.866) [-1595.493] -- 0:00:00
4000 -- (-1595.504) (-1607.658) (-1596.054) [-1592.765] * (-1599.632) (-1603.663) [-1593.009] (-1602.247) -- 0:04:09
5000 -- (-1590.799) (-1600.105) [-1590.519] (-1597.129) * (-1609.281) (-1595.681) (-1600.903) [-1602.711] -- 0:03:19
Average standard deviation of split frequencies: 0.052378
6000 -- (-1589.635) [-1588.341] (-1590.582) (-1598.758) * (-1602.482) (-1600.968) [-1604.659] (-1606.245) -- 0:02:45
7000 -- (-1595.255) [-1594.813] (-1589.867) (-1597.811) * (-1594.363) (-1591.328) [-1589.535] (-1602.158) -- 0:04:43
8000 -- (-1595.456) (-1603.229) [-1586.474] (-1606.038) * (-1602.392) (-1590.308) (-1595.555) [-1593.432] -- 0:04:08
9000 -- [-1591.069] (-1594.757) (-1589.398) (-1605.507) * (-1594.621) (-1599.350) [-1595.228] (-1594.822) -- 0:03:40
10000 -- (-1591.604) [-1593.210] (-1594.910) (-1600.180) * (-1590.762) (-1601.036) (-1600.198) [-1591.510] -- 0:03:18
Average standard deviation of split frequencies: 0.041248
11000 -- (-1594.826) (-1596.140) (-1591.844) [-1591.545] * (-1590.796) (-1589.145) [-1589.953] (-1602.775) -- 0:04:29
12000 -- [-1595.703] (-1601.916) (-1590.783) (-1618.396) * (-1598.617) [-1588.298] (-1592.200) (-1598.372) -- 0:04:07
13000 -- (-1601.333) (-1594.891) (-1590.347) [-1592.440] * (-1608.377) (-1599.256) (-1595.627) [-1587.073] -- 0:03:47
14000 -- [-1596.426] (-1590.852) (-1598.767) (-1597.531) * [-1600.358] (-1586.277) (-1596.810) (-1593.129) -- 0:04:41
15000 -- (-1591.993) (-1604.820) [-1589.736] (-1597.361) * (-1596.552) (-1594.228) (-1593.234) [-1587.160] -- 0:04:22
Average standard deviation of split frequencies: 0.043212
16000 -- (-1588.158) [-1588.502] (-1593.386) (-1585.985) * (-1591.691) (-1594.754) [-1595.816] (-1591.234) -- 0:04:06
17000 -- (-1600.301) (-1593.932) [-1591.308] (-1595.897) * (-1593.228) (-1601.260) [-1590.292] (-1597.375) -- 0:04:49
18000 -- (-1595.908) (-1589.190) (-1588.594) [-1594.622] * [-1593.020] (-1589.689) (-1597.597) (-1592.617) -- 0:04:32
19000 -- (-1599.186) (-1597.666) (-1600.907) [-1592.789] * [-1590.122] (-1591.825) (-1594.505) (-1590.164) -- 0:04:18
20000 -- (-1602.482) (-1602.000) (-1596.635) [-1593.776] * [-1589.899] (-1589.762) (-1592.834) (-1591.379) -- 0:04:05
Average standard deviation of split frequencies: 0.033455
21000 -- (-1593.972) (-1592.347) (-1608.181) [-1588.432] * (-1590.727) [-1592.747] (-1592.769) (-1597.006) -- 0:04:39
22000 -- (-1599.728) (-1595.368) [-1602.006] (-1594.797) * [-1595.073] (-1593.514) (-1594.196) (-1597.407) -- 0:04:26
23000 -- [-1588.551] (-1600.121) (-1593.082) (-1597.201) * (-1593.015) [-1592.278] (-1600.206) (-1594.757) -- 0:04:14
24000 -- (-1595.995) (-1598.998) [-1593.856] (-1583.592) * (-1596.207) (-1593.971) (-1597.488) [-1588.888] -- 0:04:44
25000 -- [-1589.365] (-1591.716) (-1593.459) (-1595.459) * (-1594.106) (-1597.893) (-1595.539) [-1592.300] -- 0:04:33
Average standard deviation of split frequencies: 0.024175
26000 -- (-1588.586) (-1597.805) (-1592.035) [-1596.399] * (-1593.048) (-1598.692) (-1600.085) [-1595.131] -- 0:04:22
27000 -- (-1590.996) (-1597.115) [-1589.818] (-1589.441) * (-1592.209) (-1601.277) [-1595.830] (-1592.989) -- 0:04:12
28000 -- (-1600.952) [-1591.375] (-1596.270) (-1591.886) * (-1589.137) (-1601.260) [-1594.612] (-1597.878) -- 0:04:37
29000 -- (-1595.484) (-1595.388) (-1592.910) [-1600.193] * [-1592.049] (-1600.415) (-1599.061) (-1593.025) -- 0:04:27
30000 -- (-1590.848) (-1594.022) [-1593.151] (-1596.967) * (-1592.534) (-1599.274) [-1598.181] (-1597.174) -- 0:04:18
Average standard deviation of split frequencies: 0.030744
31000 -- [-1591.826] (-1601.050) (-1591.491) (-1600.843) * (-1600.881) (-1599.440) [-1603.901] (-1591.806) -- 0:04:41
32000 -- (-1595.866) (-1594.927) (-1595.691) [-1591.868] * (-1592.945) (-1595.969) (-1601.545) [-1592.319] -- 0:04:32
33000 -- (-1587.340) [-1592.342] (-1591.950) (-1589.681) * (-1586.368) (-1588.357) [-1587.229] (-1591.494) -- 0:04:23
34000 -- (-1596.148) [-1597.362] (-1594.370) (-1592.276) * (-1600.329) (-1591.202) [-1589.147] (-1596.378) -- 0:04:44
35000 -- (-1592.154) (-1608.287) [-1589.315] (-1591.454) * (-1598.970) (-1598.164) (-1601.284) [-1594.066] -- 0:04:35
Average standard deviation of split frequencies: 0.016586
36000 -- (-1596.052) (-1591.895) [-1596.704] (-1596.755) * (-1591.175) [-1592.109] (-1603.489) (-1591.452) -- 0:04:27
37000 -- (-1595.193) (-1591.234) [-1588.936] (-1590.908) * (-1595.014) [-1590.336] (-1591.646) (-1597.151) -- 0:04:46
38000 -- [-1590.303] (-1601.636) (-1590.641) (-1592.822) * (-1593.607) [-1587.881] (-1594.241) (-1598.246) -- 0:04:38
39000 -- [-1593.993] (-1593.280) (-1587.692) (-1598.350) * (-1604.969) (-1600.274) [-1596.265] (-1596.952) -- 0:04:31
40000 -- (-1598.504) (-1602.055) (-1593.891) [-1594.317] * [-1596.612] (-1597.871) (-1599.977) (-1594.314) -- 0:04:24
Average standard deviation of split frequencies: 0.014683
41000 -- [-1593.898] (-1596.006) (-1591.690) (-1595.042) * (-1596.082) (-1592.173) (-1598.689) [-1593.305] -- 0:04:40
42000 -- (-1597.496) (-1593.550) (-1599.784) [-1598.952] * [-1593.921] (-1600.675) (-1589.174) (-1594.524) -- 0:04:33
43000 -- (-1587.882) [-1589.327] (-1607.546) (-1595.488) * (-1590.995) (-1591.334) [-1587.924] (-1591.743) -- 0:04:27
44000 -- [-1591.456] (-1596.345) (-1599.467) (-1609.759) * (-1590.888) (-1589.097) [-1586.681] (-1599.702) -- 0:04:42
45000 -- [-1587.545] (-1590.511) (-1618.085) (-1592.506) * (-1598.165) [-1590.369] (-1592.515) (-1597.128) -- 0:04:35
Average standard deviation of split frequencies: 0.013664
46000 -- (-1594.249) (-1600.131) (-1610.084) [-1600.534] * (-1593.632) (-1600.137) [-1591.726] (-1596.730) -- 0:04:29
47000 -- (-1583.736) (-1597.254) (-1595.245) [-1596.507] * (-1594.999) [-1590.806] (-1596.004) (-1597.925) -- 0:04:43
48000 -- (-1594.916) [-1594.490] (-1601.447) (-1597.290) * [-1591.284] (-1596.905) (-1603.154) (-1592.394) -- 0:04:37
49000 -- (-1594.634) (-1593.791) [-1588.202] (-1599.405) * (-1597.621) [-1587.737] (-1601.823) (-1592.202) -- 0:04:31
50000 -- (-1594.670) (-1594.089) [-1590.580] (-1597.798) * (-1596.908) (-1590.948) (-1608.507) [-1591.065] -- 0:04:26
Average standard deviation of split frequencies: 0.016127
51000 -- (-1593.439) [-1596.152] (-1598.273) (-1592.491) * (-1599.749) [-1592.078] (-1594.714) (-1605.075) -- 0:04:39
52000 -- [-1592.381] (-1600.982) (-1598.520) (-1597.108) * [-1586.939] (-1596.373) (-1598.652) (-1589.392) -- 0:04:33
53000 -- (-1602.254) (-1595.673) (-1588.211) [-1592.008] * (-1603.396) (-1590.891) (-1605.954) [-1590.323] -- 0:04:28
54000 -- [-1593.968] (-1597.812) (-1594.701) (-1591.947) * (-1595.533) (-1592.822) [-1593.048] (-1597.178) -- 0:04:40
55000 -- (-1590.824) [-1590.094] (-1592.085) (-1596.864) * (-1596.429) [-1601.221] (-1596.101) (-1592.853) -- 0:04:34
Average standard deviation of split frequencies: 0.021325
56000 -- [-1592.242] (-1595.492) (-1593.754) (-1594.389) * (-1597.875) (-1590.044) [-1592.330] (-1590.396) -- 0:04:29
57000 -- (-1591.292) (-1601.497) (-1598.222) [-1593.982] * (-1590.435) (-1597.896) (-1593.299) [-1595.675] -- 0:04:41
58000 -- (-1603.236) (-1588.396) (-1598.718) [-1592.778] * [-1588.568] (-1602.318) (-1595.330) (-1596.075) -- 0:04:36
59000 -- [-1589.418] (-1588.707) (-1593.404) (-1594.953) * (-1588.940) (-1595.517) (-1595.283) [-1601.233] -- 0:04:31
60000 -- (-1590.993) (-1599.353) [-1596.529] (-1602.135) * [-1593.741] (-1588.938) (-1604.333) (-1608.491) -- 0:04:26
Average standard deviation of split frequencies: 0.022793
61000 -- (-1598.467) (-1592.462) [-1600.504] (-1594.758) * [-1592.813] (-1592.136) (-1593.610) (-1596.055) -- 0:04:37
62000 -- (-1589.240) [-1592.986] (-1595.269) (-1604.336) * (-1594.666) [-1592.468] (-1590.835) (-1601.954) -- 0:04:32
63000 -- (-1593.572) (-1598.770) (-1598.542) [-1590.024] * (-1589.899) (-1592.161) [-1589.841] (-1600.137) -- 0:04:27
64000 -- (-1596.936) [-1588.985] (-1591.582) (-1596.536) * (-1588.761) (-1593.603) [-1596.688] (-1598.850) -- 0:04:37
65000 -- (-1599.310) (-1588.127) (-1598.567) [-1591.729] * (-1608.447) [-1593.322] (-1601.509) (-1597.304) -- 0:04:33
Average standard deviation of split frequencies: 0.021904
66000 -- (-1596.410) (-1591.891) [-1594.548] (-1591.319) * (-1607.004) (-1594.745) (-1597.266) [-1591.026] -- 0:04:28
67000 -- (-1589.520) [-1585.557] (-1596.939) (-1602.154) * (-1600.731) (-1594.688) [-1596.863] (-1590.139) -- 0:04:38
68000 -- [-1589.131] (-1591.649) (-1591.287) (-1604.908) * [-1594.757] (-1592.765) (-1590.904) (-1591.398) -- 0:04:34
69000 -- (-1594.452) (-1604.167) (-1598.757) [-1593.353] * [-1590.579] (-1597.572) (-1594.581) (-1590.173) -- 0:04:29
70000 -- (-1597.176) [-1593.835] (-1601.366) (-1591.960) * (-1601.159) (-1599.162) [-1594.862] (-1587.570) -- 0:04:25
Average standard deviation of split frequencies: 0.019568
71000 -- (-1595.761) (-1589.312) (-1595.774) [-1601.606] * (-1595.524) (-1595.062) [-1593.007] (-1599.705) -- 0:04:34
72000 -- (-1601.838) (-1598.030) (-1590.441) [-1596.074] * [-1588.206] (-1590.259) (-1593.783) (-1599.878) -- 0:04:30
73000 -- (-1598.517) (-1598.131) (-1596.607) [-1596.711] * (-1591.647) (-1589.150) [-1591.738] (-1596.185) -- 0:04:26
74000 -- (-1596.372) (-1601.100) [-1594.191] (-1591.527) * [-1593.619] (-1592.625) (-1606.903) (-1603.631) -- 0:04:35
75000 -- [-1596.457] (-1597.517) (-1593.319) (-1589.759) * (-1590.289) (-1599.284) (-1600.010) [-1589.812] -- 0:04:31
Average standard deviation of split frequencies: 0.017368
76000 -- (-1597.204) (-1596.203) (-1599.565) [-1600.052] * [-1589.761] (-1594.839) (-1591.715) (-1599.198) -- 0:04:27
77000 -- (-1598.545) (-1594.972) [-1601.179] (-1594.793) * (-1591.582) [-1593.061] (-1593.806) (-1608.057) -- 0:04:23
78000 -- (-1591.016) (-1590.522) [-1599.497] (-1593.258) * [-1598.705] (-1588.139) (-1598.975) (-1595.717) -- 0:04:31
79000 -- (-1592.300) (-1596.186) (-1615.426) [-1589.980] * (-1599.131) [-1585.146] (-1604.064) (-1593.012) -- 0:04:28
80000 -- (-1596.558) (-1607.718) (-1600.704) [-1590.855] * (-1596.049) [-1591.670] (-1596.264) (-1591.772) -- 0:04:24
Average standard deviation of split frequencies: 0.017921
81000 -- (-1592.516) (-1590.322) (-1604.127) [-1592.110] * (-1594.550) (-1587.619) [-1589.843] (-1594.914) -- 0:04:32
82000 -- [-1589.106] (-1594.421) (-1600.125) (-1591.034) * (-1596.900) [-1596.074] (-1588.577) (-1593.513) -- 0:04:28
83000 -- (-1605.878) [-1589.601] (-1597.954) (-1596.792) * (-1597.764) (-1596.420) [-1601.502] (-1591.541) -- 0:04:25
84000 -- (-1593.025) [-1593.061] (-1597.235) (-1593.535) * (-1598.149) [-1597.483] (-1599.301) (-1591.216) -- 0:04:32
85000 -- [-1594.118] (-1589.957) (-1604.321) (-1606.794) * (-1593.042) (-1604.628) (-1594.527) [-1597.008] -- 0:04:29
Average standard deviation of split frequencies: 0.021560
86000 -- (-1594.690) (-1600.199) (-1600.992) [-1594.120] * (-1598.614) (-1590.991) (-1593.092) [-1591.010] -- 0:04:25
87000 -- (-1600.269) (-1595.865) [-1591.369] (-1595.760) * [-1595.010] (-1598.145) (-1602.811) (-1593.237) -- 0:04:22
88000 -- (-1597.629) (-1597.248) (-1592.994) [-1584.959] * [-1594.013] (-1590.756) (-1594.277) (-1592.572) -- 0:04:29
89000 -- (-1592.653) (-1593.917) (-1588.215) [-1593.965] * (-1597.903) (-1599.981) [-1593.517] (-1590.364) -- 0:04:26
90000 -- (-1600.289) (-1596.275) (-1594.592) [-1596.689] * (-1602.899) (-1598.174) [-1589.726] (-1600.593) -- 0:04:22
Average standard deviation of split frequencies: 0.022877
91000 -- (-1589.651) [-1600.975] (-1587.686) (-1604.360) * (-1591.783) (-1597.791) [-1596.505] (-1600.973) -- 0:04:29
92000 -- [-1590.226] (-1592.771) (-1602.406) (-1596.288) * (-1599.832) (-1600.017) (-1591.746) [-1597.301] -- 0:04:26
93000 -- (-1601.289) [-1592.526] (-1591.013) (-1601.355) * (-1588.799) (-1608.243) [-1590.966] (-1593.389) -- 0:04:23
94000 -- (-1590.547) (-1596.930) [-1590.893] (-1591.957) * (-1594.696) (-1591.236) [-1593.545] (-1597.179) -- 0:04:20
95000 -- [-1597.739] (-1596.092) (-1593.503) (-1600.438) * (-1595.431) [-1587.447] (-1596.445) (-1606.465) -- 0:04:26
Average standard deviation of split frequencies: 0.022261
96000 -- (-1591.278) [-1594.543] (-1598.617) (-1605.650) * (-1591.206) [-1592.677] (-1602.713) (-1595.846) -- 0:04:23
97000 -- (-1589.616) [-1592.022] (-1598.553) (-1591.428) * (-1590.016) [-1591.640] (-1597.449) (-1593.587) -- 0:04:20
98000 -- (-1601.421) [-1588.191] (-1607.228) (-1595.709) * (-1595.021) [-1592.341] (-1589.743) (-1589.727) -- 0:04:26
99000 -- (-1600.226) [-1585.725] (-1595.261) (-1593.654) * (-1599.906) [-1586.242] (-1597.911) (-1591.109) -- 0:04:23
100000 -- [-1595.569] (-1591.120) (-1587.916) (-1600.292) * (-1592.218) (-1597.078) (-1596.705) [-1594.482] -- 0:04:21
Average standard deviation of split frequencies: 0.024039
101000 -- [-1593.777] (-1583.784) (-1608.398) (-1603.529) * [-1593.396] (-1603.316) (-1595.426) (-1592.820) -- 0:04:18
102000 -- [-1596.545] (-1592.566) (-1603.866) (-1598.512) * (-1607.630) (-1600.869) [-1593.755] (-1596.357) -- 0:04:24
103000 -- (-1597.147) (-1600.949) [-1591.387] (-1598.614) * (-1598.453) (-1602.100) (-1594.907) [-1591.373] -- 0:04:21
104000 -- [-1590.859] (-1590.311) (-1594.299) (-1593.791) * [-1593.051] (-1608.047) (-1601.233) (-1588.783) -- 0:04:18
105000 -- (-1588.270) (-1592.568) [-1591.432] (-1595.024) * (-1590.195) [-1593.532] (-1601.516) (-1589.505) -- 0:04:24
Average standard deviation of split frequencies: 0.023422
106000 -- (-1592.485) (-1599.575) [-1589.214] (-1597.705) * (-1589.921) (-1589.959) [-1597.462] (-1596.621) -- 0:04:21
107000 -- (-1592.035) (-1592.988) [-1592.607] (-1598.840) * [-1589.167] (-1597.012) (-1605.441) (-1597.983) -- 0:04:18
108000 -- [-1588.887] (-1592.775) (-1596.560) (-1594.773) * (-1591.374) (-1586.666) [-1600.685] (-1611.240) -- 0:04:24
109000 -- (-1599.171) (-1598.869) (-1599.690) [-1588.012] * (-1600.557) (-1591.801) (-1589.273) [-1596.744] -- 0:04:21
110000 -- [-1594.973] (-1595.393) (-1592.943) (-1595.245) * (-1602.838) (-1597.752) [-1596.433] (-1598.902) -- 0:04:18
Average standard deviation of split frequencies: 0.022434
111000 -- [-1589.493] (-1596.380) (-1602.796) (-1598.270) * (-1602.563) (-1597.581) (-1603.634) [-1592.782] -- 0:04:24
112000 -- (-1596.668) [-1596.334] (-1600.390) (-1592.530) * (-1597.235) (-1596.995) (-1597.407) [-1592.293] -- 0:04:21
113000 -- (-1605.382) (-1600.141) [-1597.632] (-1590.282) * (-1596.409) (-1599.349) (-1593.599) [-1593.734] -- 0:04:19
114000 -- (-1597.494) [-1591.538] (-1599.425) (-1588.817) * (-1596.492) (-1603.358) (-1588.802) [-1594.409] -- 0:04:16
115000 -- (-1597.920) (-1601.449) [-1590.358] (-1611.073) * (-1593.936) (-1596.657) [-1593.930] (-1587.936) -- 0:04:21
Average standard deviation of split frequencies: 0.021403
116000 -- [-1599.625] (-1590.828) (-1590.629) (-1591.214) * (-1593.436) (-1597.426) [-1586.306] (-1595.974) -- 0:04:19
117000 -- (-1591.573) (-1595.365) (-1597.436) [-1591.963] * (-1598.009) (-1587.951) [-1593.859] (-1589.226) -- 0:04:16
118000 -- (-1595.652) [-1590.684] (-1603.359) (-1589.535) * (-1596.007) [-1601.685] (-1588.481) (-1594.519) -- 0:04:21
119000 -- [-1596.674] (-1600.611) (-1594.787) (-1592.047) * (-1588.994) (-1598.644) [-1587.871] (-1590.536) -- 0:04:19
120000 -- (-1584.589) [-1586.788] (-1603.780) (-1589.697) * (-1584.036) [-1590.359] (-1589.542) (-1601.440) -- 0:04:16
Average standard deviation of split frequencies: 0.023440
121000 -- (-1599.008) [-1592.193] (-1597.387) (-1595.662) * (-1587.650) (-1591.445) [-1596.744] (-1600.348) -- 0:04:21
122000 -- (-1606.994) [-1587.258] (-1592.937) (-1599.178) * (-1591.179) (-1591.078) (-1594.481) [-1590.496] -- 0:04:19
123000 -- (-1602.013) (-1600.583) [-1598.685] (-1587.151) * (-1597.701) (-1598.343) [-1595.215] (-1595.171) -- 0:04:16
124000 -- (-1589.407) [-1587.692] (-1591.323) (-1593.471) * (-1586.871) [-1592.204] (-1597.887) (-1599.879) -- 0:04:14
125000 -- (-1604.103) (-1589.161) [-1590.218] (-1597.943) * [-1594.090] (-1593.689) (-1595.622) (-1596.106) -- 0:04:19
Average standard deviation of split frequencies: 0.023196
126000 -- [-1595.477] (-1591.384) (-1602.470) (-1591.460) * (-1593.209) (-1597.824) [-1592.726] (-1603.721) -- 0:04:16
127000 -- (-1589.091) [-1591.357] (-1594.743) (-1596.525) * [-1590.923] (-1588.606) (-1600.511) (-1605.356) -- 0:04:14
128000 -- (-1598.956) [-1587.913] (-1600.550) (-1599.483) * [-1602.784] (-1593.991) (-1596.641) (-1606.070) -- 0:04:18
129000 -- (-1593.128) (-1593.012) [-1592.094] (-1605.989) * (-1592.052) (-1588.217) [-1594.630] (-1604.422) -- 0:04:16
130000 -- [-1591.907] (-1615.777) (-1590.766) (-1589.175) * [-1589.528] (-1602.001) (-1596.322) (-1601.550) -- 0:04:14
Average standard deviation of split frequencies: 0.021406
131000 -- [-1594.030] (-1594.632) (-1596.523) (-1590.879) * (-1602.946) (-1589.878) [-1594.623] (-1591.769) -- 0:04:18
132000 -- (-1598.722) [-1591.088] (-1605.056) (-1601.245) * [-1589.191] (-1588.133) (-1591.835) (-1602.452) -- 0:04:16
133000 -- (-1593.020) (-1591.621) [-1598.981] (-1601.235) * (-1593.202) [-1594.466] (-1593.193) (-1587.936) -- 0:04:14
134000 -- (-1589.768) [-1593.557] (-1592.239) (-1590.763) * (-1591.155) [-1592.903] (-1586.365) (-1589.926) -- 0:04:12
135000 -- [-1592.418] (-1589.727) (-1584.136) (-1597.179) * [-1591.251] (-1599.719) (-1590.507) (-1591.830) -- 0:04:16
Average standard deviation of split frequencies: 0.017793
136000 -- (-1591.401) (-1599.128) (-1599.729) [-1591.834] * [-1590.894] (-1599.969) (-1589.985) (-1591.112) -- 0:04:14
137000 -- (-1586.414) (-1601.508) [-1589.560] (-1593.505) * (-1595.426) (-1602.933) [-1598.514] (-1596.931) -- 0:04:11
138000 -- [-1600.485] (-1603.081) (-1589.204) (-1601.057) * (-1599.335) (-1600.105) (-1593.650) [-1601.749] -- 0:04:16
139000 -- (-1592.130) [-1593.779] (-1595.162) (-1588.889) * [-1599.154] (-1592.020) (-1591.991) (-1598.566) -- 0:04:13
140000 -- (-1603.749) (-1599.961) (-1600.309) [-1592.510] * [-1593.064] (-1588.736) (-1595.738) (-1592.237) -- 0:04:11
Average standard deviation of split frequencies: 0.017203
141000 -- (-1611.150) [-1591.046] (-1596.399) (-1590.059) * (-1597.379) (-1601.642) (-1596.363) [-1594.598] -- 0:04:09
142000 -- (-1602.757) (-1598.910) [-1592.751] (-1596.358) * (-1595.390) (-1598.707) (-1597.962) [-1601.487] -- 0:04:13
143000 -- (-1592.172) [-1603.339] (-1595.772) (-1596.191) * (-1593.199) (-1599.021) [-1589.185] (-1592.806) -- 0:04:11
144000 -- [-1594.050] (-1604.704) (-1592.739) (-1598.014) * (-1598.003) (-1602.052) (-1593.250) [-1590.373] -- 0:04:09
145000 -- [-1590.783] (-1600.722) (-1597.630) (-1598.892) * (-1607.231) [-1593.134] (-1586.954) (-1594.983) -- 0:04:13
Average standard deviation of split frequencies: 0.016359
146000 -- (-1599.454) (-1600.968) [-1589.431] (-1609.068) * (-1599.840) (-1602.728) (-1595.960) [-1590.320] -- 0:04:11
147000 -- (-1599.765) (-1599.088) [-1592.185] (-1599.935) * (-1606.315) [-1591.023] (-1591.683) (-1594.492) -- 0:04:09
148000 -- (-1597.436) [-1591.233] (-1590.655) (-1605.992) * (-1595.779) [-1596.185] (-1588.613) (-1595.409) -- 0:04:13
149000 -- (-1610.384) (-1596.936) (-1598.809) [-1592.938] * (-1591.065) (-1602.564) (-1593.324) [-1592.280] -- 0:04:11
150000 -- (-1598.068) (-1587.682) (-1598.300) [-1592.657] * (-1593.153) (-1599.232) [-1592.554] (-1598.615) -- 0:04:09
Average standard deviation of split frequencies: 0.016687
151000 -- (-1600.469) (-1591.011) [-1598.970] (-1600.978) * [-1593.806] (-1592.034) (-1597.296) (-1589.234) -- 0:04:07
152000 -- (-1592.534) (-1598.022) [-1589.083] (-1599.040) * (-1599.433) [-1590.416] (-1593.694) (-1601.510) -- 0:04:11
153000 -- (-1591.476) (-1592.749) (-1595.554) [-1589.449] * [-1589.503] (-1594.682) (-1590.592) (-1591.002) -- 0:04:09
154000 -- (-1592.627) (-1604.694) (-1587.798) [-1590.449] * [-1591.315] (-1594.580) (-1590.654) (-1589.913) -- 0:04:07
155000 -- (-1593.156) (-1599.570) (-1603.946) [-1594.414] * (-1598.367) [-1588.542] (-1591.486) (-1586.759) -- 0:04:10
Average standard deviation of split frequencies: 0.018534
156000 -- [-1593.553] (-1605.633) (-1601.457) (-1595.575) * (-1596.043) (-1593.202) [-1589.804] (-1588.535) -- 0:04:08
157000 -- (-1596.102) (-1595.419) [-1589.595] (-1603.972) * (-1587.950) [-1589.210] (-1593.235) (-1595.092) -- 0:04:06
158000 -- (-1604.168) (-1600.109) [-1594.042] (-1594.390) * (-1584.528) [-1597.055] (-1597.544) (-1585.782) -- 0:04:10
159000 -- [-1593.891] (-1604.922) (-1597.071) (-1595.756) * (-1592.268) (-1596.748) [-1597.409] (-1590.613) -- 0:04:08
160000 -- (-1599.815) [-1598.243] (-1597.240) (-1598.144) * [-1591.325] (-1596.620) (-1595.794) (-1600.965) -- 0:04:06
Average standard deviation of split frequencies: 0.018974
161000 -- (-1609.212) (-1594.568) [-1593.422] (-1590.836) * (-1596.411) (-1597.362) [-1596.665] (-1595.577) -- 0:04:04
162000 -- [-1589.488] (-1602.990) (-1596.464) (-1590.908) * [-1599.076] (-1590.624) (-1593.231) (-1597.968) -- 0:04:08
163000 -- (-1601.633) (-1594.182) [-1589.436] (-1599.714) * [-1589.446] (-1601.250) (-1590.730) (-1595.482) -- 0:04:06
164000 -- (-1595.498) (-1591.609) (-1592.756) [-1590.936] * [-1589.937] (-1591.171) (-1591.615) (-1605.995) -- 0:04:04
165000 -- (-1596.251) (-1601.869) (-1599.330) [-1597.637] * (-1602.116) [-1587.791] (-1599.279) (-1609.038) -- 0:04:07
Average standard deviation of split frequencies: 0.019311
166000 -- [-1587.608] (-1596.328) (-1602.548) (-1593.064) * (-1591.891) [-1593.236] (-1598.188) (-1593.650) -- 0:04:06
167000 -- (-1600.531) (-1593.800) (-1602.744) [-1591.313] * (-1593.491) [-1590.232] (-1599.485) (-1595.035) -- 0:04:04
168000 -- (-1598.390) (-1598.730) (-1605.221) [-1589.193] * (-1593.982) (-1599.189) [-1584.240] (-1590.810) -- 0:04:02
169000 -- (-1601.932) (-1594.879) (-1596.166) [-1596.045] * [-1594.216] (-1599.638) (-1590.247) (-1596.297) -- 0:04:05
170000 -- (-1598.068) [-1596.208] (-1596.053) (-1592.589) * (-1593.684) [-1595.396] (-1599.965) (-1594.792) -- 0:04:04
Average standard deviation of split frequencies: 0.019887
171000 -- (-1609.201) (-1598.337) [-1589.044] (-1590.090) * (-1596.079) (-1591.087) [-1593.580] (-1594.213) -- 0:04:02
172000 -- (-1593.627) (-1596.859) (-1585.859) [-1588.176] * [-1591.096] (-1591.109) (-1605.105) (-1595.608) -- 0:04:05
173000 -- (-1593.605) (-1592.219) (-1596.901) [-1594.777] * [-1594.008] (-1600.993) (-1591.343) (-1607.146) -- 0:04:03
174000 -- (-1604.661) (-1592.124) [-1592.520] (-1592.618) * [-1585.076] (-1601.621) (-1592.527) (-1593.902) -- 0:04:02
175000 -- [-1588.564] (-1605.496) (-1588.543) (-1595.595) * (-1600.011) [-1598.005] (-1591.359) (-1601.309) -- 0:04:00
Average standard deviation of split frequencies: 0.017678
176000 -- (-1595.715) (-1591.957) [-1596.122] (-1593.039) * (-1593.762) (-1607.180) [-1589.870] (-1590.764) -- 0:04:03
177000 -- [-1591.176] (-1600.776) (-1585.799) (-1590.888) * (-1597.431) (-1600.598) (-1591.947) [-1596.568] -- 0:04:01
178000 -- (-1600.307) [-1595.696] (-1593.326) (-1597.890) * [-1597.124] (-1600.130) (-1588.978) (-1592.953) -- 0:04:00
179000 -- (-1594.276) (-1600.582) (-1599.677) [-1591.041] * (-1603.482) (-1596.935) [-1594.409] (-1597.544) -- 0:04:03
180000 -- (-1600.703) [-1596.706] (-1593.137) (-1592.055) * (-1597.239) (-1596.042) (-1590.013) [-1593.184] -- 0:04:01
Average standard deviation of split frequencies: 0.016873
181000 -- (-1594.216) [-1590.895] (-1596.217) (-1591.125) * [-1591.832] (-1597.169) (-1592.808) (-1597.456) -- 0:03:59
182000 -- (-1589.446) (-1592.806) [-1595.575] (-1595.980) * (-1592.907) [-1593.687] (-1590.103) (-1588.388) -- 0:04:02
183000 -- (-1598.758) (-1598.543) (-1604.675) [-1600.293] * (-1598.397) [-1594.419] (-1602.725) (-1598.706) -- 0:04:01
184000 -- [-1591.799] (-1602.029) (-1600.448) (-1592.932) * (-1596.248) [-1588.298] (-1592.922) (-1598.178) -- 0:03:59
185000 -- [-1593.250] (-1597.665) (-1599.197) (-1589.833) * (-1595.067) [-1597.335] (-1586.649) (-1589.296) -- 0:04:02
Average standard deviation of split frequencies: 0.016220
186000 -- (-1591.616) (-1596.173) (-1596.298) [-1591.649] * (-1603.014) (-1598.801) (-1598.276) [-1589.186] -- 0:04:00
187000 -- (-1595.769) (-1599.785) [-1592.971] (-1589.573) * (-1596.485) [-1596.232] (-1593.984) (-1587.035) -- 0:03:59
188000 -- [-1586.222] (-1601.626) (-1599.993) (-1601.322) * (-1598.160) (-1595.103) (-1596.044) [-1587.908] -- 0:04:01
189000 -- (-1590.795) (-1594.035) [-1589.134] (-1595.862) * (-1593.799) [-1606.409] (-1592.398) (-1591.875) -- 0:04:00
190000 -- [-1598.921] (-1593.466) (-1601.145) (-1585.509) * (-1591.235) [-1593.956] (-1607.462) (-1598.784) -- 0:03:58
Average standard deviation of split frequencies: 0.017636
191000 -- (-1595.098) [-1591.491] (-1609.025) (-1599.927) * [-1590.233] (-1591.884) (-1596.145) (-1591.304) -- 0:03:57
192000 -- [-1589.755] (-1600.265) (-1604.172) (-1597.626) * (-1594.325) (-1590.793) (-1595.519) [-1597.884] -- 0:03:59
193000 -- (-1596.022) (-1600.268) (-1599.378) [-1597.986] * [-1586.784] (-1593.253) (-1604.869) (-1597.534) -- 0:03:58
194000 -- (-1585.091) [-1600.067] (-1594.687) (-1600.384) * (-1600.302) [-1587.123] (-1593.233) (-1601.555) -- 0:03:56
195000 -- (-1592.304) [-1592.540] (-1595.639) (-1608.554) * (-1589.271) [-1593.333] (-1599.204) (-1596.611) -- 0:03:59
Average standard deviation of split frequencies: 0.014912
196000 -- (-1596.124) [-1591.339] (-1593.287) (-1595.072) * [-1590.503] (-1598.892) (-1596.350) (-1594.316) -- 0:03:57
197000 -- [-1591.982] (-1600.466) (-1587.015) (-1601.579) * (-1595.889) (-1598.520) [-1594.885] (-1595.323) -- 0:03:56
198000 -- (-1594.403) [-1587.610] (-1595.569) (-1596.549) * (-1598.913) [-1592.471] (-1590.656) (-1592.940) -- 0:03:54
199000 -- (-1597.307) [-1587.133] (-1591.362) (-1601.161) * (-1591.974) (-1593.315) [-1598.888] (-1594.182) -- 0:03:57
200000 -- (-1597.507) (-1598.604) (-1595.387) [-1591.616] * (-1594.936) (-1594.657) [-1597.492] (-1595.613) -- 0:03:56
Average standard deviation of split frequencies: 0.012686
201000 -- [-1592.022] (-1597.072) (-1603.020) (-1592.453) * (-1604.237) (-1597.970) [-1592.386] (-1598.684) -- 0:03:54
202000 -- [-1596.820] (-1593.449) (-1593.104) (-1592.772) * [-1591.804] (-1593.998) (-1597.107) (-1600.968) -- 0:03:57
203000 -- (-1598.395) (-1601.221) [-1598.149] (-1593.572) * (-1589.686) (-1603.734) (-1588.098) [-1593.037] -- 0:03:55
204000 -- (-1596.791) (-1597.044) (-1599.605) [-1593.783] * (-1590.525) [-1587.795] (-1592.324) (-1591.505) -- 0:03:54
205000 -- [-1588.578] (-1593.939) (-1591.072) (-1597.416) * [-1591.210] (-1603.979) (-1590.354) (-1593.417) -- 0:03:56
Average standard deviation of split frequencies: 0.012205
206000 -- (-1594.157) (-1593.840) [-1586.628] (-1593.133) * [-1594.009] (-1590.504) (-1598.476) (-1599.301) -- 0:03:55
207000 -- (-1592.154) (-1592.573) (-1598.142) [-1589.672] * (-1593.509) [-1589.765] (-1608.995) (-1592.216) -- 0:03:53
208000 -- (-1598.821) (-1603.052) (-1596.442) [-1586.802] * (-1593.393) [-1593.012] (-1609.920) (-1590.095) -- 0:03:52
209000 -- (-1596.793) (-1602.844) [-1594.259] (-1588.974) * (-1590.250) [-1592.697] (-1597.359) (-1593.517) -- 0:03:54
210000 -- (-1592.089) (-1595.173) (-1607.308) [-1599.814] * (-1597.924) (-1591.178) (-1597.603) [-1586.108] -- 0:03:53
Average standard deviation of split frequencies: 0.011487
211000 -- (-1594.882) (-1595.358) (-1602.044) [-1591.243] * [-1593.832] (-1598.301) (-1598.514) (-1589.824) -- 0:03:51
212000 -- [-1590.101] (-1600.200) (-1606.059) (-1594.625) * (-1600.215) [-1591.921] (-1598.945) (-1592.034) -- 0:03:54
213000 -- (-1602.818) (-1595.509) (-1594.358) [-1592.757] * [-1589.823] (-1590.425) (-1591.849) (-1597.738) -- 0:03:52
214000 -- (-1606.393) [-1592.755] (-1598.271) (-1598.351) * [-1592.248] (-1590.118) (-1594.250) (-1595.603) -- 0:03:51
215000 -- (-1595.431) [-1593.569] (-1600.422) (-1597.656) * [-1591.875] (-1595.473) (-1592.865) (-1597.334) -- 0:03:53
Average standard deviation of split frequencies: 0.010621
216000 -- (-1591.077) (-1595.882) (-1596.763) [-1591.968] * (-1606.811) (-1593.888) (-1592.113) [-1588.405] -- 0:03:52
217000 -- (-1603.405) [-1597.540] (-1590.070) (-1602.360) * (-1591.075) (-1592.203) (-1600.464) [-1584.054] -- 0:03:50
218000 -- (-1594.682) (-1592.689) [-1594.943] (-1604.428) * (-1606.243) (-1597.683) (-1594.590) [-1593.178] -- 0:03:49
219000 -- (-1597.743) [-1592.452] (-1598.816) (-1599.961) * [-1595.933] (-1592.273) (-1593.917) (-1593.608) -- 0:03:51
220000 -- (-1596.998) (-1605.862) [-1590.876] (-1591.662) * (-1587.833) [-1597.335] (-1594.258) (-1596.018) -- 0:03:50
Average standard deviation of split frequencies: 0.011821
221000 -- (-1592.745) (-1600.124) [-1589.406] (-1597.838) * (-1591.532) (-1593.669) [-1592.739] (-1590.922) -- 0:03:49
222000 -- (-1597.042) (-1592.197) (-1601.401) [-1591.072] * (-1601.544) (-1590.943) (-1593.659) [-1589.067] -- 0:03:51
223000 -- (-1592.149) (-1604.059) [-1594.939] (-1593.011) * (-1599.298) (-1602.428) (-1595.028) [-1586.430] -- 0:03:49
224000 -- (-1597.927) [-1596.462] (-1598.111) (-1601.409) * (-1595.083) (-1593.269) [-1591.373] (-1595.668) -- 0:03:48
225000 -- [-1596.610] (-1593.246) (-1594.926) (-1595.869) * [-1601.712] (-1601.284) (-1592.937) (-1597.257) -- 0:03:47
Average standard deviation of split frequencies: 0.010707
226000 -- [-1597.275] (-1593.868) (-1595.842) (-1595.390) * (-1599.033) [-1591.942] (-1602.594) (-1595.563) -- 0:03:49
227000 -- (-1601.287) (-1595.564) (-1598.463) [-1589.775] * [-1597.053] (-1595.960) (-1586.430) (-1603.398) -- 0:03:48
228000 -- (-1604.234) [-1597.125] (-1596.811) (-1610.838) * [-1590.117] (-1596.996) (-1594.331) (-1607.291) -- 0:03:46
229000 -- [-1589.643] (-1590.243) (-1592.169) (-1601.471) * (-1586.591) (-1597.672) [-1593.992] (-1596.311) -- 0:03:48
230000 -- [-1590.758] (-1597.670) (-1593.493) (-1603.646) * [-1587.673] (-1597.391) (-1590.828) (-1604.364) -- 0:03:47
Average standard deviation of split frequencies: 0.008583
231000 -- (-1603.474) [-1593.122] (-1599.519) (-1595.893) * [-1588.497] (-1597.924) (-1592.560) (-1597.513) -- 0:03:46
232000 -- (-1603.771) (-1596.295) (-1604.003) [-1594.324] * [-1592.155] (-1599.731) (-1592.219) (-1593.650) -- 0:03:45
233000 -- (-1599.376) [-1588.645] (-1604.585) (-1590.355) * (-1607.257) (-1598.144) (-1596.899) [-1594.975] -- 0:03:47
234000 -- (-1602.957) (-1590.701) (-1591.381) [-1589.678] * (-1590.148) (-1596.261) [-1588.674] (-1592.592) -- 0:03:45
235000 -- (-1601.195) [-1593.341] (-1597.802) (-1600.808) * (-1604.442) (-1595.408) [-1585.570] (-1599.188) -- 0:03:44
Average standard deviation of split frequencies: 0.008256
236000 -- (-1599.316) [-1584.800] (-1591.399) (-1601.767) * (-1597.470) [-1591.491] (-1603.980) (-1590.577) -- 0:03:46
237000 -- (-1590.657) (-1586.307) (-1596.433) [-1590.347] * (-1599.019) (-1595.319) [-1587.900] (-1595.732) -- 0:03:45
238000 -- [-1590.118] (-1595.837) (-1605.176) (-1590.461) * (-1593.044) [-1594.075] (-1593.870) (-1593.517) -- 0:03:44
239000 -- (-1594.039) (-1595.789) (-1605.412) [-1588.941] * (-1591.158) [-1589.196] (-1596.527) (-1595.672) -- 0:03:46
240000 -- (-1601.858) (-1601.018) [-1591.111] (-1593.945) * [-1592.958] (-1596.856) (-1591.663) (-1593.751) -- 0:03:44
Average standard deviation of split frequencies: 0.008096
241000 -- [-1597.284] (-1591.647) (-1591.757) (-1588.599) * (-1589.272) (-1595.224) [-1594.568] (-1595.903) -- 0:03:43
242000 -- (-1606.955) [-1595.753] (-1595.846) (-1593.357) * (-1597.123) (-1595.752) (-1592.431) [-1593.439] -- 0:03:42
243000 -- (-1598.542) (-1595.287) [-1594.136] (-1594.509) * (-1607.011) (-1589.112) [-1588.976] (-1593.523) -- 0:03:44
244000 -- (-1591.167) (-1595.788) (-1590.064) [-1588.241] * [-1598.299] (-1590.782) (-1586.537) (-1600.203) -- 0:03:43
245000 -- (-1596.630) (-1595.847) (-1597.247) [-1591.221] * (-1596.460) [-1588.116] (-1594.244) (-1593.054) -- 0:03:41
Average standard deviation of split frequencies: 0.008815
246000 -- (-1603.293) (-1592.414) (-1589.871) [-1591.743] * [-1594.323] (-1598.528) (-1602.073) (-1591.761) -- 0:03:43
247000 -- [-1587.996] (-1599.386) (-1596.532) (-1599.753) * [-1599.768] (-1594.500) (-1590.741) (-1589.739) -- 0:03:42
248000 -- [-1594.466] (-1597.840) (-1590.784) (-1590.498) * (-1597.023) (-1591.383) (-1600.741) [-1597.081] -- 0:03:41
249000 -- [-1588.562] (-1590.332) (-1588.335) (-1594.150) * (-1600.713) (-1602.122) [-1588.518] (-1591.799) -- 0:03:43
250000 -- [-1591.946] (-1595.915) (-1591.383) (-1591.598) * (-1588.404) [-1591.645] (-1598.697) (-1590.035) -- 0:03:42
Average standard deviation of split frequencies: 0.007272
251000 -- [-1594.545] (-1607.378) (-1604.786) (-1595.122) * [-1589.900] (-1595.522) (-1606.709) (-1594.256) -- 0:03:40
252000 -- (-1592.818) (-1592.446) [-1592.330] (-1585.365) * (-1588.724) (-1595.225) (-1595.730) [-1594.102] -- 0:03:39
253000 -- (-1588.073) (-1591.359) [-1591.552] (-1595.198) * (-1595.982) [-1595.540] (-1594.700) (-1598.015) -- 0:03:41
254000 -- (-1593.997) (-1592.521) (-1596.910) [-1591.279] * (-1595.652) (-1593.434) [-1597.886] (-1594.298) -- 0:03:40
255000 -- (-1593.570) (-1593.730) (-1598.788) [-1589.177] * (-1588.374) (-1590.892) [-1602.004] (-1597.604) -- 0:03:39
Average standard deviation of split frequencies: 0.007857
256000 -- (-1593.505) (-1592.402) [-1598.206] (-1590.131) * (-1592.575) (-1590.238) [-1591.922] (-1596.495) -- 0:03:40
257000 -- (-1591.383) (-1596.546) [-1585.631] (-1593.582) * [-1590.647] (-1586.809) (-1600.995) (-1590.082) -- 0:03:39
258000 -- (-1595.584) (-1598.322) [-1599.505] (-1594.493) * [-1591.808] (-1595.697) (-1606.844) (-1602.511) -- 0:03:38
259000 -- (-1592.891) (-1595.242) [-1593.023] (-1597.075) * [-1588.436] (-1590.499) (-1596.254) (-1605.841) -- 0:03:40
260000 -- (-1594.990) (-1617.337) [-1598.447] (-1597.839) * [-1598.203] (-1595.483) (-1590.400) (-1597.481) -- 0:03:39
Average standard deviation of split frequencies: 0.007234
261000 -- (-1590.592) [-1592.393] (-1590.714) (-1593.127) * (-1588.217) [-1596.938] (-1600.948) (-1597.746) -- 0:03:38
262000 -- (-1595.975) (-1591.120) [-1600.329] (-1594.734) * (-1595.912) [-1596.766] (-1590.910) (-1596.202) -- 0:03:36
263000 -- (-1593.773) [-1588.907] (-1590.965) (-1595.875) * (-1593.078) (-1593.690) [-1589.287] (-1593.782) -- 0:03:38
264000 -- (-1590.892) (-1601.761) (-1601.288) [-1591.964] * (-1592.048) (-1597.555) (-1598.111) [-1598.572] -- 0:03:37
265000 -- (-1593.346) [-1586.708] (-1593.676) (-1605.904) * [-1591.959] (-1591.559) (-1597.800) (-1596.966) -- 0:03:36
Average standard deviation of split frequencies: 0.008270
266000 -- (-1596.449) [-1598.562] (-1596.514) (-1592.803) * [-1595.226] (-1601.307) (-1593.233) (-1599.461) -- 0:03:37
267000 -- (-1597.077) (-1596.605) [-1596.985] (-1597.623) * (-1586.876) (-1602.962) [-1598.140] (-1599.517) -- 0:03:36
268000 -- (-1605.444) (-1594.681) [-1597.322] (-1603.339) * (-1596.566) [-1591.622] (-1597.656) (-1598.408) -- 0:03:35
269000 -- (-1595.918) (-1595.596) (-1604.060) [-1597.541] * (-1606.169) (-1601.378) [-1595.591] (-1590.598) -- 0:03:37
270000 -- (-1590.279) [-1591.464] (-1592.869) (-1612.873) * (-1588.203) (-1596.855) (-1605.985) [-1593.446] -- 0:03:36
Average standard deviation of split frequencies: 0.008128
271000 -- (-1590.205) (-1601.433) (-1595.774) [-1599.859] * [-1588.306] (-1591.471) (-1599.808) (-1599.109) -- 0:03:35
272000 -- (-1597.509) [-1591.497] (-1592.364) (-1600.375) * [-1592.431] (-1597.670) (-1598.715) (-1605.639) -- 0:03:34
273000 -- (-1591.715) (-1600.041) [-1599.064] (-1596.593) * (-1592.746) [-1592.033] (-1609.052) (-1590.936) -- 0:03:35
274000 -- (-1591.821) (-1606.745) (-1600.911) [-1594.322] * (-1595.688) (-1602.699) (-1596.227) [-1594.713] -- 0:03:34
275000 -- (-1592.503) (-1601.893) [-1592.386] (-1588.512) * (-1593.340) (-1593.275) (-1607.574) [-1588.316] -- 0:03:33
Average standard deviation of split frequencies: 0.008540
276000 -- (-1595.826) (-1597.633) (-1594.058) [-1597.327] * (-1596.640) [-1588.327] (-1595.759) (-1593.377) -- 0:03:35
277000 -- (-1597.528) (-1598.835) (-1591.822) [-1586.540] * (-1599.030) (-1596.944) [-1596.045] (-1595.650) -- 0:03:34
278000 -- [-1596.322] (-1598.523) (-1591.244) (-1597.607) * (-1602.745) [-1592.495] (-1602.339) (-1588.538) -- 0:03:32
279000 -- [-1586.439] (-1608.376) (-1601.375) (-1598.306) * (-1600.168) (-1591.050) [-1605.429] (-1600.716) -- 0:03:34
280000 -- (-1597.635) (-1598.973) (-1594.975) [-1593.990] * (-1596.590) [-1589.591] (-1595.562) (-1596.865) -- 0:03:33
Average standard deviation of split frequencies: 0.008846
281000 -- (-1599.281) (-1599.796) (-1600.644) [-1594.409] * (-1599.215) (-1587.853) (-1600.055) [-1588.546] -- 0:03:32
282000 -- (-1593.276) [-1596.409] (-1593.114) (-1605.285) * (-1594.410) [-1591.322] (-1592.860) (-1591.026) -- 0:03:33
283000 -- (-1599.285) [-1593.353] (-1586.197) (-1592.404) * (-1591.474) [-1591.105] (-1589.295) (-1596.456) -- 0:03:32
284000 -- (-1604.427) (-1598.561) [-1591.136] (-1600.253) * (-1589.672) [-1596.901] (-1604.658) (-1602.210) -- 0:03:31
285000 -- (-1593.837) (-1597.299) (-1601.546) [-1594.485] * (-1593.912) (-1596.083) [-1588.382] (-1594.829) -- 0:03:30
Average standard deviation of split frequencies: 0.009450
286000 -- (-1588.019) (-1592.429) [-1593.515] (-1592.269) * [-1591.857] (-1590.856) (-1595.434) (-1599.745) -- 0:03:32
287000 -- (-1602.210) (-1602.737) [-1600.129] (-1592.913) * (-1594.455) [-1592.237] (-1597.030) (-1596.315) -- 0:03:31
288000 -- (-1600.714) (-1599.006) (-1594.170) [-1594.880] * [-1593.506] (-1594.727) (-1591.350) (-1599.013) -- 0:03:30
289000 -- (-1596.412) [-1593.203] (-1597.767) (-1595.588) * (-1596.592) (-1590.639) [-1596.584] (-1590.090) -- 0:03:31
290000 -- (-1599.541) (-1587.416) [-1587.259] (-1603.109) * (-1599.650) (-1594.122) [-1592.831] (-1593.569) -- 0:03:30
Average standard deviation of split frequencies: 0.008433
291000 -- (-1602.072) [-1592.851] (-1590.943) (-1590.201) * (-1592.261) (-1592.766) [-1596.933] (-1596.828) -- 0:03:29
292000 -- (-1596.526) [-1591.827] (-1593.728) (-1598.573) * (-1595.303) (-1601.863) (-1588.756) [-1594.084] -- 0:03:30
293000 -- (-1602.485) (-1592.039) [-1597.970] (-1591.031) * (-1593.519) (-1595.950) (-1600.360) [-1592.182] -- 0:03:29
294000 -- (-1596.230) (-1594.534) [-1595.030] (-1590.510) * [-1593.584] (-1588.447) (-1595.495) (-1598.699) -- 0:03:28
295000 -- (-1595.642) [-1587.304] (-1592.402) (-1587.642) * [-1589.470] (-1590.355) (-1601.740) (-1590.276) -- 0:03:27
Average standard deviation of split frequencies: 0.008706
296000 -- (-1604.162) [-1593.351] (-1598.804) (-1591.627) * (-1595.531) (-1591.627) [-1593.641] (-1595.270) -- 0:03:29
297000 -- (-1594.420) (-1597.077) [-1590.759] (-1592.982) * (-1596.366) [-1594.226] (-1598.760) (-1598.257) -- 0:03:28
298000 -- [-1595.432] (-1607.562) (-1595.217) (-1595.242) * (-1588.688) (-1594.361) [-1590.621] (-1597.048) -- 0:03:27
299000 -- [-1600.290] (-1598.027) (-1592.373) (-1595.134) * (-1597.820) (-1602.548) [-1592.725] (-1594.483) -- 0:03:28
300000 -- (-1605.254) [-1592.141] (-1594.406) (-1595.906) * (-1594.135) (-1601.622) (-1594.120) [-1594.535] -- 0:03:27
Average standard deviation of split frequencies: 0.009303
301000 -- [-1591.204] (-1592.218) (-1594.685) (-1595.037) * [-1598.529] (-1604.216) (-1596.224) (-1590.546) -- 0:03:26
302000 -- (-1602.432) (-1594.919) (-1593.069) [-1586.329] * (-1597.732) [-1592.988] (-1600.458) (-1603.153) -- 0:03:25
303000 -- (-1603.673) [-1592.079] (-1601.816) (-1595.159) * (-1599.697) (-1593.292) [-1598.044] (-1604.692) -- 0:03:27
304000 -- (-1592.249) [-1599.399] (-1588.754) (-1597.893) * [-1591.339] (-1590.847) (-1591.844) (-1590.982) -- 0:03:26
305000 -- (-1601.525) (-1588.580) [-1591.220] (-1602.358) * [-1593.772] (-1597.484) (-1604.655) (-1605.726) -- 0:03:25
Average standard deviation of split frequencies: 0.008627
306000 -- (-1594.331) [-1595.472] (-1596.590) (-1599.319) * (-1591.016) [-1588.190] (-1599.687) (-1597.643) -- 0:03:26
307000 -- [-1590.871] (-1598.033) (-1598.997) (-1599.171) * (-1599.800) [-1589.202] (-1593.700) (-1599.322) -- 0:03:25
308000 -- (-1596.557) [-1588.220] (-1591.155) (-1588.425) * (-1592.911) (-1613.455) (-1591.177) [-1591.984] -- 0:03:24
309000 -- (-1590.785) [-1587.947] (-1595.748) (-1599.015) * [-1593.834] (-1600.400) (-1596.781) (-1597.140) -- 0:03:23
310000 -- [-1588.850] (-1599.488) (-1599.853) (-1598.197) * [-1589.698] (-1601.895) (-1596.326) (-1600.711) -- 0:03:24
Average standard deviation of split frequencies: 0.007890
311000 -- (-1596.955) (-1594.879) (-1595.019) [-1597.492] * (-1601.816) [-1594.197] (-1600.417) (-1602.436) -- 0:03:23
312000 -- (-1596.274) [-1593.440] (-1601.357) (-1594.514) * [-1595.714] (-1590.482) (-1595.949) (-1587.571) -- 0:03:22
313000 -- (-1592.690) (-1591.543) (-1598.700) [-1591.664] * (-1600.285) (-1591.518) [-1593.727] (-1589.247) -- 0:03:24
314000 -- (-1593.654) (-1601.487) (-1593.505) [-1592.853] * [-1597.441] (-1590.250) (-1591.982) (-1602.830) -- 0:03:23
315000 -- (-1597.687) [-1594.431] (-1589.741) (-1600.825) * (-1595.364) (-1587.430) (-1587.546) [-1591.542] -- 0:03:22
Average standard deviation of split frequencies: 0.007558
316000 -- (-1605.183) [-1590.674] (-1594.777) (-1596.100) * (-1596.334) (-1598.863) [-1589.241] (-1599.486) -- 0:03:23
317000 -- (-1596.661) [-1587.556] (-1597.383) (-1595.017) * [-1592.416] (-1590.876) (-1593.585) (-1599.630) -- 0:03:22
318000 -- (-1599.419) [-1594.918] (-1592.173) (-1597.150) * (-1590.612) (-1592.858) [-1596.847] (-1602.164) -- 0:03:21
319000 -- (-1595.090) (-1599.948) (-1597.452) [-1604.096] * (-1596.006) [-1584.299] (-1592.025) (-1597.865) -- 0:03:20
320000 -- (-1602.285) (-1594.972) [-1591.161] (-1595.917) * (-1591.802) (-1590.206) [-1590.490] (-1593.439) -- 0:03:21
Average standard deviation of split frequencies: 0.007840
321000 -- (-1598.065) (-1597.364) [-1597.181] (-1601.123) * (-1600.678) (-1594.047) (-1595.697) [-1589.617] -- 0:03:20
322000 -- (-1595.340) (-1598.774) (-1593.433) [-1595.892] * (-1592.132) [-1590.860] (-1600.338) (-1597.870) -- 0:03:20
323000 -- (-1592.740) (-1601.067) (-1594.546) [-1597.507] * (-1600.344) (-1586.258) (-1601.448) [-1595.160] -- 0:03:21
324000 -- (-1593.463) (-1594.877) (-1588.719) [-1592.567] * (-1593.633) [-1587.838] (-1599.825) (-1590.887) -- 0:03:20
325000 -- [-1593.839] (-1591.852) (-1596.501) (-1594.852) * (-1594.619) (-1597.353) [-1591.143] (-1594.647) -- 0:03:19
Average standard deviation of split frequencies: 0.007134
326000 -- (-1589.319) [-1593.827] (-1600.977) (-1595.310) * (-1590.451) [-1600.989] (-1599.489) (-1586.430) -- 0:03:20
327000 -- (-1593.223) [-1590.091] (-1596.746) (-1596.665) * (-1591.095) (-1596.363) [-1597.350] (-1594.558) -- 0:03:19
328000 -- (-1595.877) (-1601.406) (-1599.218) [-1593.406] * [-1589.765] (-1598.278) (-1602.105) (-1592.633) -- 0:03:18
329000 -- (-1597.811) (-1596.070) (-1597.995) [-1586.056] * [-1592.899] (-1598.950) (-1585.875) (-1603.007) -- 0:03:17
330000 -- [-1593.384] (-1589.396) (-1598.155) (-1593.373) * (-1596.490) [-1592.329] (-1592.427) (-1592.766) -- 0:03:18
Average standard deviation of split frequencies: 0.006273
331000 -- (-1593.816) (-1600.929) (-1593.823) [-1596.844] * (-1597.085) (-1592.843) (-1589.990) [-1589.141] -- 0:03:18
332000 -- (-1601.310) (-1594.787) [-1594.234] (-1599.328) * [-1588.574] (-1601.019) (-1588.921) (-1590.088) -- 0:03:17
333000 -- [-1594.890] (-1594.242) (-1592.427) (-1599.886) * (-1599.051) (-1595.264) (-1592.264) [-1590.648] -- 0:03:18
334000 -- [-1590.899] (-1598.609) (-1601.571) (-1599.780) * (-1596.908) [-1598.157] (-1594.526) (-1604.652) -- 0:03:17
335000 -- (-1600.420) (-1607.911) [-1593.300] (-1599.068) * (-1593.378) (-1597.939) [-1601.838] (-1597.134) -- 0:03:16
Average standard deviation of split frequencies: 0.006267
336000 -- (-1592.512) (-1595.539) (-1594.915) [-1589.425] * [-1591.621] (-1600.927) (-1591.540) (-1598.286) -- 0:03:15
337000 -- (-1591.574) (-1600.794) [-1592.058] (-1592.980) * (-1597.763) (-1598.516) (-1594.586) [-1592.183] -- 0:03:16
338000 -- [-1592.587] (-1590.053) (-1600.516) (-1603.684) * (-1602.240) [-1592.217] (-1593.101) (-1592.567) -- 0:03:15
339000 -- [-1594.233] (-1599.388) (-1593.751) (-1591.128) * (-1598.211) (-1595.966) (-1598.557) [-1598.071] -- 0:03:14
340000 -- (-1591.098) (-1595.430) [-1593.323] (-1594.260) * (-1597.882) (-1597.418) (-1600.528) [-1595.187] -- 0:03:16
Average standard deviation of split frequencies: 0.005720
341000 -- (-1599.979) (-1590.475) (-1599.849) [-1592.964] * (-1589.681) [-1594.798] (-1601.716) (-1600.837) -- 0:03:15
342000 -- (-1591.828) (-1594.472) (-1591.091) [-1589.801] * (-1606.915) (-1589.982) [-1595.565] (-1593.300) -- 0:03:14
343000 -- (-1593.681) [-1600.270] (-1595.830) (-1593.048) * (-1604.281) (-1592.753) (-1590.406) [-1596.955] -- 0:03:13
344000 -- (-1601.578) (-1606.174) (-1593.654) [-1598.701] * (-1595.214) [-1606.634] (-1599.057) (-1596.077) -- 0:03:14
345000 -- (-1601.146) (-1593.388) [-1591.488] (-1590.499) * (-1601.080) (-1599.140) [-1598.455] (-1593.040) -- 0:03:13
Average standard deviation of split frequencies: 0.005813
346000 -- (-1586.455) (-1591.817) (-1593.343) [-1585.059] * (-1608.160) (-1601.419) (-1589.807) [-1595.222] -- 0:03:12
347000 -- [-1589.952] (-1595.093) (-1606.122) (-1587.072) * (-1593.616) (-1607.927) (-1593.398) [-1598.438] -- 0:03:13
348000 -- [-1597.346] (-1596.192) (-1599.542) (-1596.880) * (-1604.280) (-1595.581) (-1593.037) [-1589.337] -- 0:03:12
349000 -- (-1599.434) [-1590.153] (-1603.681) (-1588.151) * (-1596.043) (-1594.043) (-1594.012) [-1594.886] -- 0:03:12
350000 -- (-1600.188) (-1594.667) (-1600.309) [-1594.039] * (-1612.915) [-1594.040] (-1595.628) (-1591.433) -- 0:03:13
Average standard deviation of split frequencies: 0.006184
351000 -- (-1594.299) (-1596.139) (-1588.179) [-1585.823] * (-1601.603) (-1596.667) [-1593.643] (-1598.059) -- 0:03:12
352000 -- (-1598.109) (-1595.396) (-1605.701) [-1593.066] * (-1590.981) (-1599.159) (-1594.003) [-1588.039] -- 0:03:11
353000 -- (-1591.752) (-1595.871) (-1591.960) [-1589.207] * (-1592.689) (-1596.634) (-1594.666) [-1585.748] -- 0:03:10
354000 -- (-1594.219) (-1592.464) (-1598.821) [-1591.830] * [-1588.659] (-1596.875) (-1595.786) (-1587.234) -- 0:03:11
355000 -- (-1599.132) (-1600.765) [-1595.298] (-1591.513) * [-1593.573] (-1590.395) (-1598.736) (-1597.498) -- 0:03:10
Average standard deviation of split frequencies: 0.006621
356000 -- (-1599.887) (-1591.218) [-1596.499] (-1592.573) * [-1590.849] (-1596.767) (-1593.745) (-1590.678) -- 0:03:09
357000 -- [-1592.142] (-1610.751) (-1603.002) (-1602.569) * (-1598.873) (-1594.477) (-1599.122) [-1600.659] -- 0:03:10
358000 -- (-1599.938) (-1596.304) [-1594.722] (-1590.202) * (-1592.751) (-1596.819) [-1595.865] (-1588.977) -- 0:03:10
359000 -- (-1591.505) [-1595.606] (-1595.717) (-1597.193) * (-1591.058) [-1599.124] (-1607.325) (-1588.090) -- 0:03:09
360000 -- (-1595.245) (-1589.570) [-1598.014] (-1599.601) * (-1594.822) (-1594.714) [-1599.948] (-1590.863) -- 0:03:10
Average standard deviation of split frequencies: 0.006884
361000 -- [-1591.837] (-1599.389) (-1595.355) (-1591.423) * (-1589.144) (-1611.405) (-1599.236) [-1590.974] -- 0:03:09
362000 -- [-1591.439] (-1595.136) (-1598.181) (-1595.467) * (-1606.525) (-1596.055) [-1590.667] (-1596.325) -- 0:03:08
363000 -- (-1589.797) [-1589.235] (-1602.625) (-1595.100) * (-1601.418) (-1595.153) [-1585.553] (-1603.690) -- 0:03:07
364000 -- (-1599.842) (-1589.806) (-1598.658) [-1592.159] * (-1593.455) [-1593.038] (-1591.342) (-1599.731) -- 0:03:08
365000 -- (-1602.339) (-1594.413) (-1593.567) [-1595.518] * (-1596.022) (-1591.028) (-1592.847) [-1591.468] -- 0:03:07
Average standard deviation of split frequencies: 0.007041
366000 -- [-1599.612] (-1597.966) (-1594.182) (-1595.166) * (-1595.190) [-1588.067] (-1591.068) (-1593.534) -- 0:03:07
367000 -- [-1594.765] (-1594.416) (-1603.882) (-1595.351) * [-1600.718] (-1595.501) (-1596.906) (-1600.221) -- 0:03:08
368000 -- (-1594.765) (-1597.698) [-1592.472] (-1606.071) * [-1591.414] (-1597.092) (-1585.323) (-1590.673) -- 0:03:07
369000 -- (-1591.397) (-1610.839) (-1595.235) [-1592.789] * (-1594.029) (-1588.003) (-1597.971) [-1593.269] -- 0:03:06
370000 -- (-1594.165) [-1595.076] (-1596.779) (-1601.467) * (-1592.405) (-1588.702) [-1597.168] (-1598.502) -- 0:03:07
Average standard deviation of split frequencies: 0.006698
371000 -- (-1605.716) (-1601.396) [-1595.543] (-1602.664) * (-1596.850) (-1591.497) (-1587.822) [-1591.946] -- 0:03:06
372000 -- (-1595.302) (-1606.320) (-1598.926) [-1594.534] * (-1595.326) [-1597.415] (-1598.947) (-1592.696) -- 0:03:05
373000 -- (-1603.069) (-1604.978) [-1588.294] (-1610.686) * (-1597.369) (-1601.038) (-1588.455) [-1589.885] -- 0:03:04
374000 -- (-1598.416) (-1602.116) (-1602.220) [-1591.087] * (-1594.198) (-1596.152) [-1587.397] (-1591.904) -- 0:03:05
375000 -- (-1608.754) (-1589.653) [-1596.016] (-1592.830) * (-1587.422) [-1600.858] (-1597.734) (-1596.645) -- 0:03:05
Average standard deviation of split frequencies: 0.007355
376000 -- (-1601.551) (-1598.232) [-1598.615] (-1593.025) * (-1599.094) [-1600.744] (-1594.410) (-1593.982) -- 0:03:04
377000 -- (-1599.026) [-1597.428] (-1596.262) (-1590.956) * [-1596.657] (-1596.844) (-1602.279) (-1589.626) -- 0:03:05
378000 -- [-1596.057] (-1596.507) (-1594.544) (-1592.108) * (-1591.664) (-1598.190) (-1602.099) [-1591.430] -- 0:03:04
379000 -- (-1594.044) (-1593.450) (-1592.897) [-1597.633] * (-1596.328) (-1591.242) (-1600.097) [-1594.366] -- 0:03:03
380000 -- (-1601.603) (-1597.802) [-1593.093] (-1594.355) * (-1599.278) (-1594.751) (-1587.792) [-1592.145] -- 0:03:02
Average standard deviation of split frequencies: 0.007017
381000 -- (-1590.195) [-1590.100] (-1592.618) (-1592.325) * (-1603.590) (-1596.045) [-1583.624] (-1599.800) -- 0:03:03
382000 -- (-1592.092) (-1596.570) (-1597.196) [-1590.325] * [-1587.882] (-1595.258) (-1593.417) (-1593.790) -- 0:03:02
383000 -- (-1591.123) (-1595.318) [-1599.085] (-1590.842) * [-1590.651] (-1595.382) (-1595.361) (-1589.822) -- 0:03:02
384000 -- (-1592.402) [-1591.458] (-1593.031) (-1603.672) * (-1594.204) (-1584.900) [-1597.084] (-1594.537) -- 0:03:02
385000 -- (-1598.091) (-1598.497) (-1607.377) [-1596.594] * [-1597.416] (-1593.699) (-1598.627) (-1601.839) -- 0:03:02
Average standard deviation of split frequencies: 0.006595
386000 -- (-1590.032) (-1594.427) [-1598.924] (-1600.247) * (-1593.922) (-1587.459) (-1591.984) [-1588.730] -- 0:03:01
387000 -- (-1600.546) (-1589.397) (-1605.572) [-1590.210] * [-1594.072] (-1595.801) (-1593.922) (-1591.016) -- 0:03:00
388000 -- (-1595.456) (-1596.460) [-1602.362] (-1595.600) * (-1589.202) [-1592.366] (-1593.949) (-1591.211) -- 0:03:01
389000 -- (-1604.658) (-1590.601) [-1592.696] (-1593.837) * (-1592.458) [-1596.181] (-1601.992) (-1594.233) -- 0:03:00
390000 -- (-1587.512) (-1597.651) [-1588.877] (-1584.134) * (-1599.977) [-1588.748] (-1608.710) (-1589.101) -- 0:02:59
Average standard deviation of split frequencies: 0.006275
391000 -- [-1589.934] (-1588.647) (-1598.914) (-1596.034) * (-1597.309) (-1598.421) (-1589.904) [-1595.185] -- 0:03:00
392000 -- (-1588.054) (-1597.792) (-1606.594) [-1590.700] * [-1594.807] (-1592.513) (-1602.806) (-1598.701) -- 0:02:59
393000 -- (-1593.864) (-1596.188) (-1588.897) [-1588.173] * (-1601.927) (-1587.358) (-1592.968) [-1599.210] -- 0:02:59
394000 -- (-1599.239) (-1592.679) (-1607.389) [-1590.104] * (-1598.710) (-1588.739) (-1597.224) [-1587.441] -- 0:02:59
395000 -- (-1595.519) (-1604.255) (-1599.064) [-1591.449] * (-1607.649) [-1585.847] (-1592.486) (-1595.317) -- 0:02:59
Average standard deviation of split frequencies: 0.006666
396000 -- (-1600.083) (-1595.922) (-1599.608) [-1584.543] * (-1603.711) (-1595.425) [-1590.327] (-1600.059) -- 0:02:58
397000 -- (-1592.970) (-1594.984) [-1592.902] (-1590.632) * (-1597.719) [-1593.433] (-1591.327) (-1603.170) -- 0:02:57
398000 -- [-1596.326] (-1590.598) (-1599.451) (-1600.974) * (-1597.105) (-1596.664) [-1594.502] (-1597.430) -- 0:02:58
399000 -- (-1593.598) (-1593.020) (-1594.093) [-1589.390] * (-1596.914) [-1589.650] (-1595.475) (-1600.852) -- 0:02:57
400000 -- (-1590.218) [-1595.130] (-1596.694) (-1601.750) * (-1594.255) [-1588.644] (-1592.081) (-1594.751) -- 0:02:57
Average standard deviation of split frequencies: 0.007138
401000 -- (-1607.592) [-1595.099] (-1588.019) (-1596.830) * (-1598.829) [-1588.562] (-1600.205) (-1589.402) -- 0:02:57
402000 -- (-1598.803) [-1593.452] (-1588.561) (-1592.830) * (-1587.736) (-1598.027) (-1594.894) [-1590.778] -- 0:02:57
403000 -- (-1595.918) (-1599.338) (-1593.017) [-1589.494] * (-1611.933) (-1603.536) [-1590.000] (-1590.755) -- 0:02:56
404000 -- [-1590.824] (-1591.778) (-1601.918) (-1589.439) * (-1596.071) [-1593.840] (-1589.910) (-1591.045) -- 0:02:55
405000 -- (-1598.053) (-1603.543) (-1601.749) [-1581.763] * (-1596.666) [-1593.889] (-1599.680) (-1590.915) -- 0:02:56
Average standard deviation of split frequencies: 0.005883
406000 -- (-1607.291) (-1600.701) (-1596.116) [-1598.748] * (-1597.797) [-1590.864] (-1604.841) (-1598.561) -- 0:02:55
407000 -- (-1596.354) (-1612.421) (-1595.073) [-1593.156] * (-1589.614) (-1592.069) [-1590.121] (-1595.566) -- 0:02:54
408000 -- [-1598.544] (-1593.331) (-1599.306) (-1600.312) * (-1592.817) (-1597.342) [-1597.083] (-1596.040) -- 0:02:55
409000 -- (-1591.735) [-1592.342] (-1596.609) (-1600.422) * (-1595.604) (-1604.803) [-1591.597] (-1595.366) -- 0:02:54
410000 -- (-1599.336) [-1596.488] (-1592.940) (-1596.911) * (-1593.550) [-1598.398] (-1597.077) (-1599.568) -- 0:02:54
Average standard deviation of split frequencies: 0.005204
411000 -- (-1594.275) [-1590.619] (-1595.015) (-1592.497) * (-1599.968) (-1594.959) (-1596.098) [-1595.803] -- 0:02:54
412000 -- (-1599.724) (-1594.755) (-1596.009) [-1599.282] * [-1596.676] (-1605.430) (-1596.862) (-1597.232) -- 0:02:54
413000 -- (-1593.197) [-1596.093] (-1596.138) (-1597.083) * (-1597.881) (-1602.727) (-1592.454) [-1592.746] -- 0:02:53
414000 -- (-1602.460) (-1591.516) (-1592.167) [-1587.355] * (-1589.553) (-1593.908) [-1597.514] (-1599.104) -- 0:02:52
415000 -- (-1600.724) (-1603.071) [-1590.652] (-1593.715) * (-1591.268) [-1590.126] (-1594.202) (-1591.958) -- 0:02:53
Average standard deviation of split frequencies: 0.005741
416000 -- (-1593.264) [-1592.768] (-1598.427) (-1593.458) * [-1591.299] (-1593.730) (-1594.756) (-1590.586) -- 0:02:52
417000 -- (-1593.415) (-1596.157) (-1587.979) [-1588.920] * (-1594.105) [-1594.693] (-1593.193) (-1601.883) -- 0:02:51
418000 -- [-1591.788] (-1590.115) (-1600.039) (-1600.619) * (-1588.168) [-1591.593] (-1587.057) (-1597.321) -- 0:02:52
419000 -- [-1592.158] (-1590.848) (-1597.204) (-1604.502) * (-1592.957) (-1602.354) (-1591.929) [-1592.181] -- 0:02:51
420000 -- (-1596.070) (-1594.014) [-1599.179] (-1592.542) * (-1600.478) (-1597.852) [-1589.520] (-1606.688) -- 0:02:51
Average standard deviation of split frequencies: 0.005977
421000 -- (-1592.318) (-1593.613) (-1597.935) [-1594.799] * (-1596.692) (-1593.308) [-1590.345] (-1592.965) -- 0:02:51
422000 -- [-1588.867] (-1616.559) (-1604.069) (-1593.942) * (-1588.671) [-1587.835] (-1592.739) (-1598.257) -- 0:02:51
423000 -- [-1585.811] (-1600.046) (-1597.379) (-1595.135) * [-1589.628] (-1591.209) (-1591.890) (-1592.261) -- 0:02:50
424000 -- [-1593.377] (-1603.763) (-1593.497) (-1591.944) * [-1591.333] (-1597.674) (-1588.009) (-1598.551) -- 0:02:49
425000 -- (-1595.014) (-1596.921) [-1599.023] (-1596.133) * (-1600.776) [-1597.059] (-1592.407) (-1601.777) -- 0:02:50
Average standard deviation of split frequencies: 0.005902
426000 -- (-1605.124) (-1596.687) [-1595.688] (-1596.888) * (-1593.384) [-1591.638] (-1589.492) (-1602.442) -- 0:02:49
427000 -- (-1594.175) (-1606.900) [-1594.678] (-1593.995) * (-1593.710) (-1587.276) [-1592.214] (-1596.757) -- 0:02:49
428000 -- (-1594.868) [-1598.305] (-1589.711) (-1597.269) * [-1589.674] (-1597.351) (-1594.311) (-1600.587) -- 0:02:49
429000 -- (-1604.570) [-1592.273] (-1591.044) (-1600.037) * (-1598.665) (-1594.301) (-1600.314) [-1593.368] -- 0:02:49
430000 -- (-1597.193) (-1601.914) [-1596.789] (-1602.434) * (-1597.959) [-1592.493] (-1599.133) (-1590.000) -- 0:02:48
Average standard deviation of split frequencies: 0.007078
431000 -- [-1591.606] (-1607.477) (-1589.628) (-1595.324) * (-1594.314) [-1590.409] (-1602.477) (-1604.982) -- 0:02:47
432000 -- (-1593.440) [-1600.717] (-1598.554) (-1598.149) * (-1593.485) (-1591.107) (-1590.468) [-1586.350] -- 0:02:48
433000 -- [-1591.656] (-1591.019) (-1607.961) (-1596.695) * [-1590.744] (-1587.751) (-1586.205) (-1592.478) -- 0:02:47
434000 -- [-1598.572] (-1591.088) (-1602.974) (-1594.703) * (-1593.048) (-1600.260) [-1598.702] (-1598.550) -- 0:02:46
435000 -- (-1592.989) (-1592.952) [-1597.768] (-1593.370) * (-1596.683) [-1590.597] (-1599.316) (-1591.967) -- 0:02:47
Average standard deviation of split frequencies: 0.007496
436000 -- (-1598.858) (-1591.727) [-1594.078] (-1589.213) * (-1595.856) (-1596.834) [-1593.039] (-1588.307) -- 0:02:46
437000 -- [-1600.288] (-1590.568) (-1593.915) (-1589.826) * [-1590.556] (-1590.527) (-1605.489) (-1590.570) -- 0:02:46
438000 -- (-1604.272) (-1589.727) (-1594.891) [-1594.492] * (-1597.212) (-1589.879) (-1599.972) [-1593.308] -- 0:02:45
439000 -- (-1591.772) (-1611.175) [-1591.596] (-1598.781) * (-1601.738) (-1587.910) [-1598.642] (-1599.543) -- 0:02:46
440000 -- (-1595.337) (-1598.250) (-1602.079) [-1592.998] * [-1599.465] (-1603.928) (-1599.385) (-1603.220) -- 0:02:45
Average standard deviation of split frequencies: 0.006846
441000 -- [-1590.671] (-1597.863) (-1596.404) (-1603.107) * (-1602.559) (-1605.203) [-1593.782] (-1596.301) -- 0:02:44
442000 -- (-1590.122) (-1596.072) [-1592.938] (-1592.342) * (-1596.483) (-1601.783) (-1603.126) [-1596.919] -- 0:02:45
443000 -- (-1600.175) (-1598.999) [-1594.599] (-1603.545) * (-1601.330) [-1592.009] (-1595.652) (-1598.916) -- 0:02:44
444000 -- (-1599.614) [-1592.364] (-1591.300) (-1597.866) * (-1596.029) (-1598.975) [-1595.094] (-1596.428) -- 0:02:44
445000 -- (-1598.490) (-1604.442) (-1600.749) [-1585.471] * (-1591.762) (-1588.800) [-1589.469] (-1590.770) -- 0:02:44
Average standard deviation of split frequencies: 0.006765
446000 -- (-1597.000) (-1593.347) (-1587.908) [-1590.930] * (-1605.789) (-1594.314) (-1591.284) [-1596.513] -- 0:02:43
447000 -- (-1591.725) [-1590.973] (-1592.715) (-1596.041) * (-1595.493) [-1595.291] (-1590.885) (-1588.402) -- 0:02:43
448000 -- (-1598.815) (-1594.040) [-1593.161] (-1595.831) * [-1595.016] (-1595.758) (-1596.193) (-1594.962) -- 0:02:42
449000 -- (-1594.922) (-1594.184) [-1591.194] (-1592.719) * (-1590.170) (-1595.797) (-1595.275) [-1593.872] -- 0:02:43
450000 -- (-1593.726) [-1590.747] (-1587.866) (-1593.022) * (-1597.390) [-1593.290] (-1596.336) (-1596.798) -- 0:02:42
Average standard deviation of split frequencies: 0.006276
451000 -- (-1589.462) [-1589.780] (-1595.313) (-1595.343) * (-1599.976) (-1593.415) (-1602.337) [-1594.466] -- 0:02:41
452000 -- (-1594.371) [-1584.816] (-1591.517) (-1598.499) * (-1601.598) (-1586.514) (-1604.205) [-1591.645] -- 0:02:42
453000 -- (-1586.295) (-1596.607) (-1594.068) [-1592.453] * (-1603.591) (-1595.819) (-1595.707) [-1587.852] -- 0:02:41
454000 -- (-1594.603) (-1590.062) [-1590.244] (-1599.519) * (-1595.599) [-1589.196] (-1595.101) (-1591.847) -- 0:02:41
455000 -- [-1600.971] (-1599.133) (-1594.360) (-1605.675) * (-1592.675) [-1591.616] (-1595.373) (-1594.242) -- 0:02:41
Average standard deviation of split frequencies: 0.007236
456000 -- (-1593.403) (-1594.661) [-1599.174] (-1588.534) * (-1594.305) [-1590.608] (-1598.395) (-1594.398) -- 0:02:41
457000 -- (-1591.613) [-1588.051] (-1599.837) (-1597.253) * (-1597.191) [-1602.558] (-1596.984) (-1593.929) -- 0:02:40
458000 -- (-1598.782) [-1585.566] (-1602.229) (-1597.982) * [-1589.821] (-1590.751) (-1600.232) (-1606.418) -- 0:02:39
459000 -- (-1603.313) (-1589.652) (-1601.636) [-1602.077] * (-1599.614) [-1596.794] (-1600.853) (-1592.528) -- 0:02:40
460000 -- [-1592.991] (-1598.155) (-1596.279) (-1614.864) * (-1587.833) (-1598.932) (-1590.561) [-1595.889] -- 0:02:39
Average standard deviation of split frequencies: 0.007163
461000 -- (-1591.842) [-1592.887] (-1596.729) (-1597.510) * (-1590.768) (-1599.379) [-1589.489] (-1595.071) -- 0:02:39
462000 -- [-1599.644] (-1594.718) (-1602.448) (-1590.965) * (-1596.184) (-1597.237) [-1593.893] (-1605.873) -- 0:02:39
463000 -- [-1603.490] (-1592.922) (-1591.557) (-1601.796) * (-1587.624) (-1596.820) [-1592.283] (-1594.215) -- 0:02:38
464000 -- (-1594.848) [-1589.954] (-1600.139) (-1590.372) * (-1597.021) (-1591.503) (-1594.176) [-1599.218] -- 0:02:38
465000 -- (-1594.209) [-1590.695] (-1598.484) (-1591.994) * (-1592.460) [-1599.480] (-1596.664) (-1591.541) -- 0:02:38
Average standard deviation of split frequencies: 0.007284
466000 -- (-1593.803) (-1596.672) (-1604.386) [-1591.132] * [-1592.169] (-1599.030) (-1602.255) (-1593.104) -- 0:02:38
467000 -- (-1601.519) (-1595.394) (-1591.508) [-1587.796] * [-1594.472] (-1606.818) (-1590.958) (-1592.475) -- 0:02:37
468000 -- (-1592.378) (-1590.665) [-1591.408] (-1598.739) * (-1608.700) (-1599.715) (-1593.594) [-1600.895] -- 0:02:38
469000 -- (-1591.312) [-1596.134] (-1588.090) (-1591.832) * (-1584.659) (-1592.076) (-1588.213) [-1594.489] -- 0:02:37
470000 -- (-1599.837) [-1598.538] (-1598.666) (-1600.379) * (-1598.038) [-1598.336] (-1595.040) (-1593.570) -- 0:02:36
Average standard deviation of split frequencies: 0.007612
471000 -- (-1593.531) [-1586.966] (-1594.267) (-1591.329) * (-1601.618) (-1588.532) [-1587.916] (-1591.368) -- 0:02:36
472000 -- (-1594.274) (-1595.202) (-1594.516) [-1592.980] * (-1607.558) [-1587.061] (-1594.056) (-1597.192) -- 0:02:36
473000 -- [-1596.896] (-1595.093) (-1600.370) (-1601.784) * (-1601.345) (-1606.229) (-1603.223) [-1589.525] -- 0:02:35
474000 -- (-1601.218) [-1588.201] (-1600.916) (-1588.551) * (-1595.326) (-1588.931) (-1597.032) [-1588.064] -- 0:02:35
475000 -- [-1589.653] (-1592.903) (-1595.529) (-1601.549) * (-1613.347) (-1594.548) (-1595.951) [-1600.183] -- 0:02:35
Average standard deviation of split frequencies: 0.006866
476000 -- (-1596.218) (-1604.956) (-1599.440) [-1597.622] * (-1593.778) [-1590.885] (-1595.374) (-1594.075) -- 0:02:35
477000 -- (-1596.330) (-1591.430) (-1597.921) [-1594.137] * (-1591.171) (-1599.227) [-1594.125] (-1590.053) -- 0:02:34
478000 -- (-1595.862) [-1594.645] (-1596.403) (-1596.949) * (-1605.651) [-1591.609] (-1592.837) (-1590.239) -- 0:02:33
479000 -- (-1596.558) [-1598.503] (-1587.844) (-1596.656) * (-1609.636) [-1598.105] (-1595.740) (-1588.699) -- 0:02:34
480000 -- (-1587.944) (-1597.413) [-1597.747] (-1604.009) * (-1602.827) (-1589.067) [-1593.733] (-1590.309) -- 0:02:33
Average standard deviation of split frequencies: 0.006407
481000 -- (-1597.210) [-1592.931] (-1598.601) (-1595.453) * (-1597.454) [-1596.500] (-1597.979) (-1593.025) -- 0:02:33
482000 -- (-1603.711) (-1595.819) (-1597.364) [-1591.577] * (-1596.992) (-1590.722) [-1597.393] (-1598.186) -- 0:02:33
483000 -- (-1592.360) (-1594.917) (-1599.309) [-1590.419] * (-1600.208) [-1593.051] (-1587.713) (-1594.433) -- 0:02:33
484000 -- (-1593.863) [-1595.950] (-1593.073) (-1594.628) * (-1597.839) (-1592.805) [-1594.173] (-1591.371) -- 0:02:32
485000 -- [-1594.062] (-1599.066) (-1600.761) (-1602.196) * (-1600.484) (-1600.311) [-1591.609] (-1590.911) -- 0:02:31
Average standard deviation of split frequencies: 0.006854
486000 -- (-1593.671) [-1596.348] (-1596.245) (-1592.149) * (-1598.033) (-1590.939) [-1593.012] (-1587.257) -- 0:02:32
487000 -- (-1600.309) (-1602.920) (-1590.494) [-1590.410] * (-1603.939) [-1593.858] (-1595.187) (-1599.278) -- 0:02:31
488000 -- (-1592.227) [-1592.530] (-1595.040) (-1591.742) * (-1603.539) [-1596.830] (-1601.928) (-1593.020) -- 0:02:31
489000 -- [-1591.787] (-1591.142) (-1591.142) (-1591.370) * (-1597.259) [-1595.688] (-1591.313) (-1593.683) -- 0:02:31
490000 -- [-1593.344] (-1592.099) (-1594.621) (-1590.147) * (-1609.440) [-1590.298] (-1592.229) (-1602.026) -- 0:02:30
Average standard deviation of split frequencies: 0.007238
491000 -- (-1602.502) [-1597.841] (-1596.114) (-1592.296) * [-1592.146] (-1596.722) (-1589.562) (-1605.010) -- 0:02:30
492000 -- (-1600.298) (-1598.028) [-1587.325] (-1597.933) * (-1595.151) (-1596.611) [-1593.872] (-1604.137) -- 0:02:30
493000 -- [-1597.119] (-1589.668) (-1589.728) (-1605.492) * [-1589.319] (-1596.030) (-1602.637) (-1588.731) -- 0:02:30
494000 -- (-1597.639) (-1594.737) [-1589.767] (-1590.029) * (-1593.484) (-1594.508) (-1598.665) [-1588.242] -- 0:02:29
495000 -- [-1593.411] (-1594.712) (-1595.663) (-1591.840) * [-1595.108] (-1599.344) (-1592.964) (-1601.895) -- 0:02:28
Average standard deviation of split frequencies: 0.007540
496000 -- (-1595.163) (-1599.844) [-1593.552] (-1598.006) * (-1603.816) (-1595.534) [-1587.737] (-1602.438) -- 0:02:29
497000 -- (-1598.853) (-1594.523) (-1591.985) [-1588.968] * (-1596.558) [-1592.976] (-1594.911) (-1600.103) -- 0:02:28
498000 -- [-1590.757] (-1592.662) (-1590.096) (-1592.856) * (-1596.113) (-1587.788) [-1594.401] (-1603.318) -- 0:02:28
499000 -- (-1596.975) (-1592.200) [-1589.437] (-1603.661) * (-1589.574) (-1595.540) (-1591.462) [-1593.976] -- 0:02:28
500000 -- [-1590.697] (-1590.143) (-1592.897) (-1600.989) * (-1593.329) (-1600.540) (-1587.651) [-1593.052] -- 0:02:28
Average standard deviation of split frequencies: 0.007658
501000 -- (-1596.025) [-1595.611] (-1598.512) (-1602.618) * (-1586.554) [-1591.362] (-1587.134) (-1588.689) -- 0:02:27
502000 -- [-1591.079] (-1593.839) (-1596.492) (-1597.729) * (-1600.975) (-1595.299) [-1592.784] (-1591.739) -- 0:02:26
503000 -- (-1607.633) (-1589.082) [-1594.759] (-1598.453) * (-1589.492) [-1586.914] (-1590.985) (-1601.520) -- 0:02:27
504000 -- (-1601.926) (-1596.042) (-1602.183) [-1596.681] * (-1602.930) (-1594.139) [-1592.119] (-1594.662) -- 0:02:26
505000 -- [-1590.670] (-1602.846) (-1597.864) (-1597.012) * (-1599.017) (-1593.860) [-1592.292] (-1597.975) -- 0:02:26
Average standard deviation of split frequencies: 0.007577
506000 -- [-1589.619] (-1591.124) (-1596.525) (-1610.918) * (-1593.997) [-1592.731] (-1608.458) (-1593.281) -- 0:02:26
507000 -- (-1590.853) (-1592.638) [-1586.023] (-1588.539) * (-1592.503) (-1604.684) (-1596.054) [-1589.004] -- 0:02:25
508000 -- (-1589.240) [-1595.538] (-1592.341) (-1594.949) * [-1597.159] (-1592.159) (-1590.869) (-1588.186) -- 0:02:25
509000 -- (-1591.577) (-1600.793) [-1591.719] (-1604.978) * (-1594.794) (-1594.616) (-1585.042) [-1591.117] -- 0:02:25
510000 -- (-1597.685) (-1607.722) [-1595.488] (-1595.634) * (-1595.683) [-1591.822] (-1589.634) (-1594.364) -- 0:02:25
Average standard deviation of split frequencies: 0.007262
511000 -- (-1594.694) [-1597.073] (-1589.697) (-1589.914) * (-1598.941) (-1588.962) [-1587.821] (-1594.045) -- 0:02:24
512000 -- (-1593.432) [-1591.545] (-1602.272) (-1594.076) * [-1600.483] (-1594.478) (-1598.791) (-1602.674) -- 0:02:23
513000 -- (-1593.399) [-1592.603] (-1596.205) (-1590.362) * (-1588.786) (-1602.241) (-1593.046) [-1594.618] -- 0:02:24
514000 -- [-1591.708] (-1594.655) (-1588.261) (-1599.196) * [-1597.514] (-1601.254) (-1594.781) (-1595.012) -- 0:02:23
515000 -- (-1588.937) (-1610.856) (-1595.064) [-1592.946] * [-1590.794] (-1593.495) (-1592.410) (-1596.675) -- 0:02:23
Average standard deviation of split frequencies: 0.007370
516000 -- [-1591.277] (-1601.885) (-1598.595) (-1598.401) * (-1588.201) (-1596.777) (-1587.011) [-1595.979] -- 0:02:23
517000 -- (-1594.148) (-1590.267) [-1599.858] (-1608.134) * (-1601.030) [-1589.790] (-1604.700) (-1592.930) -- 0:02:22
518000 -- [-1589.980] (-1598.387) (-1605.915) (-1593.174) * (-1596.634) [-1597.834] (-1596.369) (-1601.366) -- 0:02:22
519000 -- [-1586.818] (-1602.924) (-1588.843) (-1594.646) * (-1591.019) (-1593.798) [-1587.391] (-1601.714) -- 0:02:22
520000 -- (-1595.629) (-1598.271) [-1590.920] (-1590.114) * (-1594.504) (-1598.775) [-1592.924] (-1599.849) -- 0:02:22
Average standard deviation of split frequencies: 0.007545
521000 -- (-1599.124) (-1607.776) (-1595.541) [-1585.543] * (-1598.476) (-1591.757) (-1592.429) [-1591.939] -- 0:02:21
522000 -- (-1607.467) (-1598.715) [-1594.879] (-1598.476) * (-1596.078) [-1596.201] (-1600.872) (-1592.161) -- 0:02:21
523000 -- (-1596.126) (-1591.976) [-1599.389] (-1593.600) * (-1597.515) (-1593.550) [-1589.334] (-1598.886) -- 0:02:21
524000 -- (-1598.544) (-1591.878) [-1590.880] (-1596.005) * (-1595.446) [-1596.783] (-1595.826) (-1596.668) -- 0:02:20
525000 -- (-1594.211) (-1599.630) (-1585.791) [-1595.413] * (-1595.483) [-1585.074] (-1601.809) (-1595.314) -- 0:02:20
Average standard deviation of split frequencies: 0.007468
526000 -- (-1601.788) (-1597.612) (-1595.535) [-1588.813] * (-1587.816) [-1592.050] (-1597.894) (-1601.994) -- 0:02:20
527000 -- (-1594.998) (-1599.253) (-1591.955) [-1593.547] * [-1591.472] (-1599.937) (-1598.001) (-1594.815) -- 0:02:20
528000 -- (-1596.338) (-1603.040) [-1600.530] (-1593.871) * (-1600.566) [-1594.409] (-1615.877) (-1591.891) -- 0:02:19
529000 -- (-1598.274) [-1593.458] (-1591.725) (-1593.975) * (-1596.469) [-1588.882] (-1603.489) (-1599.165) -- 0:02:18
530000 -- (-1598.148) (-1596.750) [-1586.813] (-1592.623) * (-1588.161) (-1600.070) [-1590.907] (-1595.828) -- 0:02:19
Average standard deviation of split frequencies: 0.007580
531000 -- [-1591.309] (-1596.071) (-1602.582) (-1602.505) * (-1600.163) (-1600.556) (-1592.859) [-1593.412] -- 0:02:18
532000 -- (-1596.147) (-1594.539) [-1597.078] (-1598.775) * (-1596.357) (-1597.969) [-1591.013] (-1597.022) -- 0:02:18
533000 -- [-1596.226] (-1599.583) (-1593.672) (-1602.347) * [-1593.986] (-1603.507) (-1596.631) (-1595.962) -- 0:02:18
534000 -- (-1598.811) [-1595.485] (-1586.590) (-1592.060) * (-1596.053) (-1595.442) [-1586.864] (-1605.528) -- 0:02:17
535000 -- (-1591.019) [-1597.414] (-1599.078) (-1596.359) * (-1597.944) (-1605.046) (-1602.779) [-1587.704] -- 0:02:17
Average standard deviation of split frequencies: 0.007974
536000 -- [-1589.242] (-1591.887) (-1595.408) (-1589.239) * [-1598.984] (-1594.155) (-1593.373) (-1595.492) -- 0:02:16
537000 -- [-1595.444] (-1597.492) (-1598.913) (-1594.286) * (-1587.863) (-1592.585) [-1593.738] (-1597.002) -- 0:02:17
538000 -- (-1590.503) (-1590.864) (-1596.211) [-1588.684] * [-1588.915] (-1590.035) (-1592.187) (-1601.955) -- 0:02:16
539000 -- (-1596.170) (-1597.628) (-1589.604) [-1592.534] * (-1601.734) [-1594.568] (-1597.287) (-1601.944) -- 0:02:15
540000 -- [-1586.868] (-1592.668) (-1599.768) (-1593.137) * (-1590.876) (-1592.426) (-1596.764) [-1593.621] -- 0:02:16
Average standard deviation of split frequencies: 0.007382
541000 -- [-1589.635] (-1591.693) (-1596.374) (-1597.446) * (-1593.102) (-1596.270) (-1605.806) [-1595.504] -- 0:02:15
542000 -- (-1598.557) (-1595.885) [-1591.860] (-1592.057) * (-1603.577) [-1594.474] (-1591.109) (-1589.655) -- 0:02:15
543000 -- (-1587.634) [-1584.968] (-1592.906) (-1602.015) * [-1589.702] (-1591.767) (-1591.483) (-1603.713) -- 0:02:14
544000 -- (-1597.461) [-1589.627] (-1590.060) (-1596.658) * (-1612.975) (-1593.789) [-1589.584] (-1594.506) -- 0:02:14
545000 -- (-1600.930) (-1597.934) [-1594.748] (-1595.744) * [-1590.460] (-1597.526) (-1599.530) (-1599.709) -- 0:02:14
Average standard deviation of split frequencies: 0.007425
546000 -- (-1600.410) (-1600.904) (-1591.412) [-1593.236] * (-1595.425) (-1595.781) (-1594.079) [-1594.981] -- 0:02:13
547000 -- (-1599.784) (-1601.365) [-1593.149] (-1602.725) * (-1590.407) [-1601.171] (-1609.441) (-1601.082) -- 0:02:14
548000 -- (-1598.898) (-1592.966) (-1592.309) [-1594.065] * (-1594.858) [-1585.207] (-1601.781) (-1604.178) -- 0:02:13
549000 -- [-1596.745] (-1600.875) (-1598.862) (-1593.394) * (-1593.726) (-1592.625) [-1590.282] (-1598.220) -- 0:02:13
550000 -- [-1592.806] (-1597.158) (-1599.157) (-1591.174) * (-1603.007) (-1596.206) [-1595.915] (-1589.880) -- 0:02:13
Average standard deviation of split frequencies: 0.006963
551000 -- (-1589.547) [-1589.131] (-1602.279) (-1591.171) * (-1592.475) (-1603.827) (-1592.453) [-1589.332] -- 0:02:12
552000 -- (-1593.296) [-1591.511] (-1608.378) (-1594.777) * (-1605.069) (-1593.156) (-1597.816) [-1600.562] -- 0:02:12
553000 -- (-1594.165) [-1588.270] (-1603.772) (-1596.076) * (-1603.188) (-1595.579) [-1592.895] (-1592.420) -- 0:02:11
554000 -- (-1592.640) (-1593.191) [-1591.496] (-1594.367) * [-1590.496] (-1590.624) (-1598.370) (-1607.677) -- 0:02:12
555000 -- (-1594.281) (-1595.168) [-1595.266] (-1589.305) * (-1606.614) (-1598.591) (-1602.935) [-1594.302] -- 0:02:11
Average standard deviation of split frequencies: 0.006839
556000 -- (-1605.843) (-1588.171) (-1590.437) [-1587.181] * (-1595.202) (-1598.845) (-1593.660) [-1588.893] -- 0:02:10
557000 -- (-1598.682) (-1589.368) [-1593.447] (-1591.404) * (-1610.394) (-1593.087) (-1593.604) [-1588.981] -- 0:02:11
558000 -- (-1595.935) (-1590.081) [-1599.985] (-1591.835) * [-1598.396] (-1593.000) (-1598.800) (-1590.879) -- 0:02:10
559000 -- (-1597.661) (-1597.188) [-1588.512] (-1592.239) * (-1592.579) (-1597.514) (-1606.220) [-1592.159] -- 0:02:10
560000 -- (-1596.013) [-1587.337] (-1596.160) (-1605.392) * (-1596.859) (-1601.233) (-1595.156) [-1591.959] -- 0:02:09
Average standard deviation of split frequencies: 0.007175
561000 -- (-1591.835) (-1600.293) (-1588.516) [-1594.747] * [-1590.032] (-1598.528) (-1599.876) (-1597.096) -- 0:02:09
562000 -- (-1592.778) (-1595.410) (-1587.186) [-1592.517] * (-1592.789) [-1599.868] (-1592.227) (-1597.858) -- 0:02:09
563000 -- (-1597.079) (-1590.031) (-1604.965) [-1597.592] * (-1604.996) (-1600.950) (-1600.641) [-1589.721] -- 0:02:08
564000 -- (-1596.502) [-1594.811] (-1599.101) (-1591.725) * (-1593.720) (-1601.996) (-1594.143) [-1594.475] -- 0:02:09
565000 -- [-1594.240] (-1593.573) (-1593.671) (-1595.237) * (-1591.616) (-1601.085) (-1587.710) [-1588.496] -- 0:02:08
Average standard deviation of split frequencies: 0.006663
566000 -- (-1597.986) (-1609.848) [-1596.519] (-1598.568) * (-1596.316) (-1587.528) (-1598.645) [-1601.658] -- 0:02:08
567000 -- [-1597.775] (-1593.761) (-1617.895) (-1593.484) * [-1594.931] (-1596.116) (-1588.808) (-1596.352) -- 0:02:07
568000 -- (-1591.397) [-1593.797] (-1602.829) (-1593.244) * [-1595.992] (-1596.826) (-1595.083) (-1595.934) -- 0:02:07
569000 -- (-1593.999) (-1601.837) (-1589.345) [-1601.647] * (-1599.589) (-1589.579) [-1603.667] (-1594.638) -- 0:02:07
570000 -- (-1595.608) (-1595.330) [-1591.211] (-1618.528) * (-1587.312) [-1591.265] (-1605.949) (-1592.115) -- 0:02:06
Average standard deviation of split frequencies: 0.006994
571000 -- [-1592.139] (-1596.478) (-1600.659) (-1589.461) * (-1597.135) [-1601.836] (-1599.992) (-1595.317) -- 0:02:06
572000 -- [-1588.420] (-1598.439) (-1592.480) (-1594.439) * (-1587.365) (-1595.983) (-1589.923) [-1600.423] -- 0:02:06
573000 -- (-1595.653) [-1593.751] (-1599.180) (-1597.801) * (-1600.823) (-1592.710) (-1592.939) [-1600.335] -- 0:02:05
574000 -- (-1592.132) (-1598.248) [-1595.236] (-1598.148) * (-1595.406) (-1597.551) [-1590.649] (-1600.462) -- 0:02:06
575000 -- (-1593.936) [-1596.016] (-1591.018) (-1594.737) * (-1592.596) (-1596.983) (-1608.730) [-1593.741] -- 0:02:05
Average standard deviation of split frequencies: 0.007202
576000 -- (-1606.577) [-1592.293] (-1598.256) (-1597.585) * [-1598.232] (-1591.872) (-1599.991) (-1593.571) -- 0:02:05
577000 -- [-1592.640] (-1594.518) (-1594.127) (-1598.364) * (-1596.099) (-1606.774) (-1592.867) [-1592.098] -- 0:02:04
578000 -- (-1591.076) (-1595.311) [-1588.504] (-1592.521) * (-1598.668) (-1595.843) (-1595.793) [-1591.801] -- 0:02:04
579000 -- (-1595.640) [-1594.246] (-1593.539) (-1597.075) * (-1597.879) [-1595.766] (-1587.637) (-1590.567) -- 0:02:04
580000 -- [-1589.124] (-1588.322) (-1600.622) (-1593.761) * [-1596.015] (-1609.372) (-1611.494) (-1599.160) -- 0:02:03
Average standard deviation of split frequencies: 0.006819
581000 -- (-1592.270) [-1591.188] (-1588.621) (-1594.732) * (-1593.917) [-1593.827] (-1594.813) (-1592.965) -- 0:02:04
582000 -- (-1589.964) (-1590.524) (-1596.831) [-1590.145] * (-1600.879) [-1596.480] (-1590.231) (-1596.257) -- 0:02:03
583000 -- (-1598.469) [-1601.451] (-1596.436) (-1600.016) * [-1592.243] (-1592.573) (-1599.530) (-1598.003) -- 0:02:03
584000 -- (-1603.457) (-1591.547) (-1602.916) [-1591.989] * (-1604.734) [-1593.668] (-1603.947) (-1589.287) -- 0:02:02
585000 -- (-1599.204) (-1595.542) [-1592.878] (-1592.932) * (-1596.186) (-1591.652) (-1588.760) [-1586.265] -- 0:02:02
Average standard deviation of split frequencies: 0.007186
586000 -- (-1596.264) [-1593.464] (-1591.412) (-1593.218) * (-1598.465) [-1589.607] (-1593.399) (-1609.048) -- 0:02:02
587000 -- (-1592.939) (-1604.976) (-1592.213) [-1599.291] * (-1596.292) (-1596.973) (-1596.379) [-1591.299] -- 0:02:01
588000 -- (-1591.131) [-1597.895] (-1599.130) (-1595.386) * (-1590.695) [-1593.836] (-1597.767) (-1591.837) -- 0:02:01
589000 -- (-1595.585) [-1587.422] (-1605.952) (-1596.336) * (-1595.073) (-1592.925) (-1594.804) [-1591.613] -- 0:02:01
590000 -- (-1593.962) (-1591.190) [-1586.956] (-1597.845) * (-1590.245) (-1594.028) (-1593.580) [-1591.235] -- 0:02:00
Average standard deviation of split frequencies: 0.006757
591000 -- (-1592.308) [-1591.311] (-1596.940) (-1602.588) * (-1591.648) (-1590.553) [-1591.291] (-1589.911) -- 0:02:01
592000 -- (-1594.994) (-1599.555) (-1596.521) [-1590.743] * (-1584.912) (-1597.925) [-1590.614] (-1590.043) -- 0:02:00
593000 -- [-1597.295] (-1598.948) (-1600.602) (-1592.099) * (-1593.626) (-1602.874) [-1591.333] (-1606.870) -- 0:02:00
594000 -- (-1594.444) [-1594.416] (-1596.475) (-1594.244) * (-1595.595) (-1595.974) (-1602.900) [-1588.038] -- 0:01:59
595000 -- [-1591.574] (-1595.550) (-1596.207) (-1609.191) * (-1598.433) [-1595.171] (-1603.130) (-1590.636) -- 0:01:59
Average standard deviation of split frequencies: 0.006802
596000 -- [-1596.462] (-1604.477) (-1598.088) (-1586.472) * [-1588.081] (-1603.914) (-1601.051) (-1587.188) -- 0:01:59
597000 -- [-1596.803] (-1592.961) (-1596.985) (-1597.308) * (-1596.182) (-1588.970) [-1597.727] (-1601.863) -- 0:01:58
598000 -- (-1596.663) (-1590.587) [-1593.674] (-1594.981) * [-1589.407] (-1594.070) (-1597.125) (-1596.343) -- 0:01:58
599000 -- (-1598.803) (-1591.937) [-1595.249] (-1606.231) * (-1589.005) [-1592.046] (-1603.546) (-1598.280) -- 0:01:58
600000 -- (-1593.653) [-1592.799] (-1594.698) (-1604.302) * (-1596.378) (-1597.195) (-1595.767) [-1591.792] -- 0:01:58
Average standard deviation of split frequencies: 0.006959
601000 -- [-1591.567] (-1607.596) (-1595.798) (-1592.463) * (-1593.750) [-1591.568] (-1593.173) (-1592.170) -- 0:01:58
602000 -- [-1592.006] (-1606.408) (-1594.176) (-1594.291) * (-1602.237) [-1591.882] (-1590.915) (-1592.708) -- 0:01:57
603000 -- (-1596.652) (-1599.110) [-1597.396] (-1599.057) * (-1595.664) [-1586.818] (-1594.390) (-1589.664) -- 0:01:57
604000 -- (-1602.764) [-1590.964] (-1596.113) (-1594.599) * (-1591.682) [-1592.863] (-1595.383) (-1589.549) -- 0:01:56
605000 -- (-1601.874) (-1603.779) (-1589.996) [-1594.016] * (-1596.429) (-1588.426) [-1592.683] (-1601.938) -- 0:01:56
Average standard deviation of split frequencies: 0.006690
606000 -- (-1589.253) [-1603.691] (-1596.145) (-1590.898) * (-1588.871) [-1589.323] (-1602.484) (-1594.958) -- 0:01:56
607000 -- [-1593.781] (-1591.919) (-1596.066) (-1598.334) * (-1598.757) [-1590.087] (-1599.139) (-1594.465) -- 0:01:55
608000 -- (-1598.102) (-1593.309) [-1596.684] (-1592.916) * (-1594.468) (-1598.832) (-1591.362) [-1591.636] -- 0:01:56
609000 -- (-1597.406) (-1600.424) (-1594.940) [-1586.711] * (-1597.924) (-1590.015) [-1590.318] (-1591.897) -- 0:01:55
610000 -- (-1604.882) (-1599.024) (-1600.267) [-1595.789] * (-1590.341) (-1605.223) [-1592.575] (-1594.705) -- 0:01:55
Average standard deviation of split frequencies: 0.007102
611000 -- (-1594.775) (-1598.890) (-1590.883) [-1586.604] * (-1594.629) [-1596.776] (-1594.945) (-1602.513) -- 0:01:54
612000 -- (-1593.970) [-1594.187] (-1589.440) (-1596.764) * [-1591.746] (-1591.524) (-1594.121) (-1602.708) -- 0:01:54
613000 -- [-1595.026] (-1595.626) (-1587.939) (-1595.650) * (-1596.477) (-1607.706) [-1587.727] (-1594.511) -- 0:01:54
614000 -- (-1598.955) (-1594.159) [-1592.841] (-1596.516) * (-1595.197) [-1599.620] (-1606.525) (-1600.516) -- 0:01:53
615000 -- (-1605.067) (-1595.373) [-1594.476] (-1591.919) * (-1593.581) (-1597.447) [-1589.207] (-1593.435) -- 0:01:53
Average standard deviation of split frequencies: 0.006632
616000 -- [-1589.673] (-1600.497) (-1591.744) (-1592.293) * (-1595.422) (-1593.839) (-1597.862) [-1594.381] -- 0:01:53
617000 -- (-1604.150) [-1596.791] (-1594.569) (-1590.736) * [-1597.868] (-1597.387) (-1589.796) (-1599.160) -- 0:01:52
618000 -- [-1594.706] (-1600.964) (-1593.152) (-1594.332) * (-1608.367) (-1595.321) [-1591.620] (-1603.746) -- 0:01:53
619000 -- [-1595.567] (-1603.985) (-1597.544) (-1597.941) * (-1593.925) [-1589.477] (-1601.384) (-1593.782) -- 0:01:52
620000 -- (-1593.562) [-1591.706] (-1590.959) (-1595.302) * (-1599.258) [-1596.439] (-1607.828) (-1598.611) -- 0:01:52
Average standard deviation of split frequencies: 0.005620
621000 -- [-1602.904] (-1606.070) (-1589.162) (-1594.977) * (-1598.727) (-1599.230) [-1589.740] (-1592.592) -- 0:01:51
622000 -- (-1593.831) [-1590.578] (-1603.058) (-1593.630) * [-1586.331] (-1591.787) (-1593.728) (-1593.752) -- 0:01:51
623000 -- [-1595.431] (-1594.933) (-1605.750) (-1596.302) * (-1587.418) [-1594.277] (-1590.191) (-1598.802) -- 0:01:51
624000 -- (-1588.709) (-1594.917) [-1594.447] (-1589.609) * (-1590.619) (-1592.000) (-1590.603) [-1588.179] -- 0:01:50
625000 -- [-1591.815] (-1592.850) (-1593.881) (-1600.057) * (-1595.799) (-1599.941) [-1593.946] (-1596.790) -- 0:01:51
Average standard deviation of split frequencies: 0.005723
626000 -- (-1596.049) (-1594.060) (-1592.088) [-1591.693] * [-1585.199] (-1591.131) (-1611.616) (-1595.476) -- 0:01:50
627000 -- [-1588.789] (-1594.090) (-1590.818) (-1594.417) * (-1587.797) [-1588.339] (-1588.439) (-1596.162) -- 0:01:50
628000 -- (-1586.220) [-1595.970] (-1602.604) (-1598.254) * (-1599.772) [-1588.737] (-1592.282) (-1600.427) -- 0:01:50
629000 -- [-1593.613] (-1595.693) (-1593.141) (-1592.321) * (-1595.501) (-1587.863) (-1592.284) [-1596.264] -- 0:01:49
630000 -- (-1594.600) [-1593.321] (-1593.138) (-1604.221) * (-1594.513) [-1597.643] (-1600.242) (-1601.734) -- 0:01:49
Average standard deviation of split frequencies: 0.005731
631000 -- (-1592.496) [-1587.893] (-1591.895) (-1592.802) * (-1608.821) [-1596.096] (-1586.844) (-1594.989) -- 0:01:48
632000 -- [-1590.899] (-1593.704) (-1605.518) (-1592.272) * (-1589.879) [-1597.028] (-1591.621) (-1591.133) -- 0:01:48
633000 -- (-1591.892) (-1607.137) (-1595.710) [-1591.542] * (-1593.863) [-1594.029] (-1598.075) (-1592.142) -- 0:01:48
634000 -- (-1590.403) (-1598.190) [-1587.262] (-1594.162) * (-1601.479) [-1593.512] (-1591.815) (-1603.114) -- 0:01:47
635000 -- (-1600.050) (-1605.598) (-1589.784) [-1586.455] * (-1596.301) (-1591.381) [-1590.047] (-1594.930) -- 0:01:48
Average standard deviation of split frequencies: 0.005386
636000 -- [-1589.968] (-1613.349) (-1596.377) (-1591.176) * (-1591.822) (-1595.417) (-1592.635) [-1587.711] -- 0:01:47
637000 -- [-1587.047] (-1602.731) (-1596.198) (-1597.465) * [-1586.789] (-1598.525) (-1593.491) (-1602.699) -- 0:01:47
638000 -- (-1596.188) (-1592.689) (-1597.390) [-1594.529] * (-1599.217) [-1602.488] (-1598.195) (-1596.571) -- 0:01:47
639000 -- [-1589.862] (-1589.480) (-1600.490) (-1594.511) * (-1591.644) (-1588.672) [-1584.618] (-1599.839) -- 0:01:46
640000 -- [-1588.501] (-1589.199) (-1592.725) (-1598.195) * (-1592.440) (-1590.470) [-1585.362] (-1593.844) -- 0:01:46
Average standard deviation of split frequencies: 0.005788
641000 -- (-1589.788) (-1601.376) (-1592.906) [-1591.629] * (-1596.225) (-1603.204) (-1593.307) [-1594.931] -- 0:01:45
642000 -- [-1591.941] (-1594.311) (-1605.658) (-1594.858) * [-1590.540] (-1591.956) (-1598.831) (-1607.435) -- 0:01:45
643000 -- (-1592.270) (-1602.620) [-1599.374] (-1596.479) * [-1590.805] (-1590.925) (-1597.544) (-1604.033) -- 0:01:45
644000 -- (-1606.777) (-1601.835) [-1596.785] (-1592.548) * (-1592.182) (-1594.408) (-1599.532) [-1592.557] -- 0:01:45
645000 -- [-1593.997] (-1594.127) (-1611.265) (-1589.550) * (-1586.824) (-1599.904) (-1590.977) [-1593.489] -- 0:01:45
Average standard deviation of split frequencies: 0.005935
646000 -- (-1592.271) (-1591.892) [-1588.378] (-1590.584) * (-1592.175) (-1597.840) [-1588.488] (-1588.397) -- 0:01:44
647000 -- [-1591.926] (-1595.517) (-1605.703) (-1590.773) * (-1595.935) (-1592.815) [-1594.527] (-1596.346) -- 0:01:44
648000 -- [-1593.058] (-1593.416) (-1600.941) (-1592.395) * [-1598.001] (-1594.081) (-1594.096) (-1589.520) -- 0:01:43
649000 -- (-1589.703) (-1596.935) (-1596.385) [-1602.926] * [-1592.374] (-1591.242) (-1597.716) (-1594.354) -- 0:01:43
650000 -- (-1589.101) (-1591.360) (-1590.841) [-1590.764] * (-1600.377) (-1590.586) [-1590.005] (-1600.039) -- 0:01:43
Average standard deviation of split frequencies: 0.005893
651000 -- [-1598.270] (-1610.122) (-1592.261) (-1595.917) * (-1594.766) (-1595.882) (-1593.790) [-1596.957] -- 0:01:42
652000 -- (-1599.757) [-1601.044] (-1610.220) (-1592.348) * (-1594.072) [-1589.368] (-1592.254) (-1595.450) -- 0:01:43
653000 -- (-1597.862) [-1590.747] (-1599.146) (-1597.550) * (-1603.961) (-1606.848) [-1596.759] (-1590.178) -- 0:01:42
654000 -- (-1594.816) [-1597.670] (-1599.158) (-1593.845) * [-1598.104] (-1597.656) (-1601.038) (-1592.413) -- 0:01:42
655000 -- (-1596.390) [-1589.442] (-1595.683) (-1597.914) * (-1589.698) [-1596.235] (-1601.744) (-1596.438) -- 0:01:42
Average standard deviation of split frequencies: 0.005940
656000 -- (-1597.038) (-1597.988) (-1598.358) [-1601.070] * (-1597.563) (-1607.191) (-1596.331) [-1588.605] -- 0:01:41
657000 -- (-1585.485) (-1595.569) [-1595.427] (-1594.720) * (-1591.250) (-1594.684) (-1603.023) [-1588.275] -- 0:01:41
658000 -- (-1602.688) (-1591.133) (-1594.499) [-1590.826] * [-1589.486] (-1600.744) (-1595.844) (-1596.494) -- 0:01:40
659000 -- [-1596.923] (-1598.474) (-1590.481) (-1603.865) * (-1597.452) (-1596.108) (-1599.474) [-1588.632] -- 0:01:40
660000 -- (-1601.064) [-1589.155] (-1596.721) (-1587.759) * (-1601.218) [-1591.715] (-1596.168) (-1598.018) -- 0:01:40
Average standard deviation of split frequencies: 0.005899
661000 -- [-1593.874] (-1585.916) (-1602.818) (-1594.452) * (-1592.732) [-1591.724] (-1603.326) (-1592.660) -- 0:01:40
662000 -- [-1592.459] (-1596.257) (-1594.722) (-1599.108) * [-1600.366] (-1587.016) (-1588.507) (-1592.640) -- 0:01:40
663000 -- [-1596.045] (-1610.983) (-1593.536) (-1607.398) * (-1592.467) (-1601.190) [-1587.407] (-1598.462) -- 0:01:39
664000 -- (-1592.957) (-1596.300) [-1596.154] (-1593.389) * (-1599.116) [-1593.804] (-1601.428) (-1597.474) -- 0:01:39
665000 -- (-1585.807) [-1590.356] (-1598.676) (-1596.067) * (-1605.727) [-1589.861] (-1593.689) (-1599.737) -- 0:01:39
Average standard deviation of split frequencies: 0.005898
666000 -- (-1586.900) [-1592.294] (-1599.330) (-1594.253) * (-1598.875) (-1594.081) [-1598.371] (-1596.202) -- 0:01:38
667000 -- (-1596.973) (-1598.233) (-1588.623) [-1593.810] * (-1597.876) (-1594.914) (-1599.139) [-1593.721] -- 0:01:38
668000 -- (-1605.432) (-1599.480) [-1589.671] (-1594.798) * (-1598.151) (-1607.453) [-1596.948] (-1593.708) -- 0:01:37
669000 -- [-1595.680] (-1602.201) (-1595.146) (-1596.746) * [-1589.607] (-1588.261) (-1593.746) (-1593.152) -- 0:01:37
670000 -- (-1595.936) (-1596.906) [-1592.074] (-1595.848) * (-1588.494) (-1595.308) [-1595.428] (-1592.363) -- 0:01:37
Average standard deviation of split frequencies: 0.006513
671000 -- [-1589.454] (-1597.270) (-1594.019) (-1591.905) * (-1616.876) (-1592.703) [-1588.328] (-1592.564) -- 0:01:37
672000 -- (-1591.276) [-1596.084] (-1600.211) (-1594.239) * (-1596.579) (-1602.097) (-1590.587) [-1595.489] -- 0:01:37
673000 -- (-1593.968) (-1598.219) [-1595.396] (-1590.900) * (-1599.364) [-1595.233] (-1593.627) (-1588.167) -- 0:01:36
674000 -- (-1592.343) (-1588.980) (-1601.227) [-1592.664] * [-1593.758] (-1600.481) (-1594.712) (-1585.993) -- 0:01:36
675000 -- [-1595.646] (-1591.361) (-1593.736) (-1594.446) * [-1585.425] (-1597.442) (-1596.185) (-1601.539) -- 0:01:35
Average standard deviation of split frequencies: 0.006369
676000 -- (-1599.101) [-1591.670] (-1597.020) (-1598.871) * (-1595.157) (-1596.002) [-1590.121] (-1595.743) -- 0:01:35
677000 -- (-1596.086) (-1590.400) (-1602.743) [-1592.076] * [-1594.836] (-1605.661) (-1589.229) (-1595.559) -- 0:01:35
678000 -- (-1605.449) (-1600.174) [-1594.756] (-1591.257) * (-1604.057) (-1597.373) [-1592.173] (-1602.531) -- 0:01:34
679000 -- (-1595.260) (-1597.016) [-1583.809] (-1587.306) * (-1601.203) (-1603.033) (-1602.700) [-1592.427] -- 0:01:35
680000 -- (-1597.449) (-1588.140) [-1593.334] (-1591.097) * (-1592.311) (-1588.062) (-1601.641) [-1598.384] -- 0:01:34
Average standard deviation of split frequencies: 0.007110
681000 -- (-1603.551) [-1599.199] (-1594.032) (-1590.180) * [-1593.173] (-1605.535) (-1595.669) (-1603.982) -- 0:01:34
682000 -- (-1602.270) (-1595.684) (-1595.363) [-1590.558] * (-1600.465) (-1599.565) [-1592.447] (-1606.068) -- 0:01:34
683000 -- (-1596.174) (-1603.763) [-1590.122] (-1596.207) * (-1592.952) (-1593.853) (-1598.894) [-1591.227] -- 0:01:33
684000 -- (-1599.840) [-1589.835] (-1593.600) (-1598.878) * (-1599.737) [-1596.696] (-1595.625) (-1595.108) -- 0:01:33
685000 -- (-1594.173) (-1596.031) [-1593.327] (-1594.924) * (-1605.707) [-1594.998] (-1597.922) (-1589.393) -- 0:01:32
Average standard deviation of split frequencies: 0.007238
686000 -- (-1601.886) (-1598.115) (-1599.521) [-1592.638] * (-1610.760) [-1593.606] (-1593.077) (-1597.446) -- 0:01:32
687000 -- (-1603.696) [-1598.216] (-1596.028) (-1596.455) * (-1606.554) (-1592.312) [-1591.110] (-1596.031) -- 0:01:32
688000 -- [-1590.983] (-1609.939) (-1596.091) (-1597.658) * [-1590.901] (-1597.037) (-1593.456) (-1605.457) -- 0:01:32
689000 -- (-1595.763) (-1594.045) [-1587.298] (-1594.630) * (-1595.960) [-1589.205] (-1597.869) (-1612.590) -- 0:01:32
690000 -- (-1586.539) (-1593.103) (-1594.501) [-1589.042] * (-1599.272) (-1606.166) (-1594.823) [-1603.044] -- 0:01:31
Average standard deviation of split frequencies: 0.007280
691000 -- (-1602.293) (-1593.252) (-1604.445) [-1593.557] * (-1602.196) [-1597.484] (-1594.814) (-1600.279) -- 0:01:31
692000 -- (-1591.117) [-1597.466] (-1593.052) (-1604.640) * (-1614.593) (-1600.111) [-1595.815] (-1596.576) -- 0:01:31
693000 -- (-1596.764) (-1592.731) (-1591.478) [-1596.348] * (-1598.989) (-1593.438) (-1600.692) [-1592.100] -- 0:01:30
694000 -- [-1594.150] (-1591.558) (-1591.290) (-1590.294) * (-1602.976) (-1606.398) (-1595.816) [-1595.743] -- 0:01:30
695000 -- (-1601.942) (-1598.010) (-1594.461) [-1593.107] * (-1595.066) (-1598.728) [-1590.834] (-1588.395) -- 0:01:29
Average standard deviation of split frequencies: 0.007360
696000 -- [-1589.455] (-1594.264) (-1598.198) (-1599.104) * (-1591.180) (-1591.886) (-1603.391) [-1594.577] -- 0:01:29
697000 -- (-1595.927) (-1584.665) (-1602.596) [-1595.995] * (-1594.228) (-1597.982) (-1589.679) [-1595.132] -- 0:01:29
698000 -- (-1592.163) (-1590.697) [-1590.484] (-1589.997) * (-1596.463) (-1590.166) [-1595.498] (-1607.973) -- 0:01:29
699000 -- (-1590.605) (-1594.686) (-1601.390) [-1592.344] * (-1594.306) (-1593.789) (-1593.349) [-1587.309] -- 0:01:29
700000 -- [-1592.541] (-1605.350) (-1606.456) (-1595.829) * (-1586.749) [-1592.612] (-1598.828) (-1591.247) -- 0:01:28
Average standard deviation of split frequencies: 0.007221
701000 -- (-1596.038) [-1596.093] (-1605.439) (-1594.994) * (-1590.909) (-1601.241) [-1590.363] (-1599.229) -- 0:01:28
702000 -- (-1599.472) [-1593.670] (-1599.935) (-1602.427) * (-1599.083) (-1587.549) [-1590.864] (-1600.821) -- 0:01:28
703000 -- (-1601.280) (-1595.191) [-1594.146] (-1604.036) * (-1601.181) (-1602.596) [-1593.266] (-1595.384) -- 0:01:27
704000 -- (-1601.399) [-1588.591] (-1593.719) (-1605.333) * [-1586.687] (-1601.738) (-1592.256) (-1605.508) -- 0:01:27
705000 -- [-1588.867] (-1593.366) (-1590.008) (-1596.425) * [-1595.066] (-1611.819) (-1589.680) (-1593.924) -- 0:01:27
Average standard deviation of split frequencies: 0.007567
706000 -- (-1586.672) (-1592.596) [-1597.150] (-1598.427) * [-1589.182] (-1597.984) (-1595.164) (-1607.248) -- 0:01:27
707000 -- (-1601.461) (-1593.458) [-1593.414] (-1604.946) * (-1602.430) (-1597.881) [-1598.120] (-1597.880) -- 0:01:26
708000 -- [-1588.177] (-1596.858) (-1599.508) (-1596.321) * (-1591.457) [-1590.658] (-1611.631) (-1597.050) -- 0:01:26
709000 -- [-1592.215] (-1598.861) (-1595.615) (-1601.486) * (-1599.036) (-1596.263) [-1601.449] (-1599.774) -- 0:01:26
710000 -- (-1588.837) (-1595.140) (-1596.419) [-1593.565] * (-1593.364) [-1592.566] (-1601.788) (-1592.561) -- 0:01:25
Average standard deviation of split frequencies: 0.007252
711000 -- (-1593.294) [-1593.929] (-1595.217) (-1592.126) * (-1592.241) [-1593.625] (-1598.483) (-1593.175) -- 0:01:25
712000 -- (-1589.067) (-1598.082) [-1598.972] (-1596.992) * [-1592.316] (-1608.601) (-1601.029) (-1593.461) -- 0:01:24
713000 -- [-1593.129] (-1594.452) (-1595.564) (-1612.095) * (-1588.254) (-1598.151) (-1602.489) [-1597.400] -- 0:01:24
714000 -- (-1600.382) (-1594.400) [-1592.662] (-1602.964) * [-1588.920] (-1589.945) (-1598.300) (-1602.159) -- 0:01:24
715000 -- (-1597.984) (-1593.705) (-1596.976) [-1590.898] * (-1596.724) (-1595.988) (-1608.316) [-1592.613] -- 0:01:24
Average standard deviation of split frequencies: 0.006935
716000 -- (-1587.531) [-1594.394] (-1595.253) (-1594.027) * [-1600.490] (-1589.968) (-1590.920) (-1598.897) -- 0:01:24
717000 -- (-1589.742) [-1589.805] (-1597.097) (-1600.522) * (-1595.449) [-1587.484] (-1594.674) (-1597.228) -- 0:01:23
718000 -- (-1595.998) [-1594.650] (-1596.469) (-1597.081) * (-1590.642) (-1590.442) (-1604.491) [-1597.156] -- 0:01:23
719000 -- [-1592.203] (-1589.549) (-1588.138) (-1599.028) * (-1600.384) (-1593.695) (-1596.249) [-1595.173] -- 0:01:23
720000 -- (-1603.368) [-1599.157] (-1589.903) (-1591.970) * (-1589.873) (-1597.227) (-1594.844) [-1593.355] -- 0:01:22
Average standard deviation of split frequencies: 0.006367
721000 -- (-1593.889) (-1599.004) [-1593.318] (-1592.162) * (-1593.049) (-1592.025) (-1588.861) [-1591.163] -- 0:01:22
722000 -- (-1597.439) (-1592.992) [-1598.881] (-1585.602) * (-1594.049) (-1599.617) (-1591.761) [-1589.158] -- 0:01:22
723000 -- (-1593.146) (-1595.701) (-1599.584) [-1590.304] * (-1603.277) (-1592.437) [-1589.573] (-1594.682) -- 0:01:21
724000 -- [-1593.111] (-1600.301) (-1595.419) (-1597.862) * (-1605.787) (-1597.038) (-1587.135) [-1594.398] -- 0:01:21
725000 -- (-1597.871) [-1592.999] (-1598.636) (-1585.304) * (-1601.387) (-1600.377) (-1600.124) [-1590.698] -- 0:01:21
Average standard deviation of split frequencies: 0.006320
726000 -- (-1590.301) (-1600.896) [-1592.759] (-1601.614) * (-1602.511) (-1595.307) (-1597.067) [-1595.093] -- 0:01:21
727000 -- [-1591.438] (-1604.697) (-1594.536) (-1596.927) * (-1604.804) [-1586.552] (-1592.713) (-1599.413) -- 0:01:20
728000 -- (-1593.093) [-1593.157] (-1592.571) (-1591.783) * (-1592.239) [-1593.667] (-1592.571) (-1603.706) -- 0:01:20
729000 -- (-1594.166) [-1588.800] (-1602.302) (-1598.454) * (-1598.633) (-1590.146) [-1587.913] (-1594.596) -- 0:01:20
730000 -- (-1599.820) [-1591.579] (-1599.572) (-1605.190) * [-1591.965] (-1603.285) (-1597.773) (-1598.609) -- 0:01:19
Average standard deviation of split frequencies: 0.006538
731000 -- (-1596.343) (-1606.824) (-1588.980) [-1589.937] * (-1592.594) (-1590.737) [-1589.276] (-1592.373) -- 0:01:19
732000 -- (-1596.572) (-1600.930) [-1595.495] (-1598.130) * (-1592.912) (-1596.030) [-1587.407] (-1594.923) -- 0:01:19
733000 -- (-1600.035) (-1597.276) [-1593.056] (-1598.810) * (-1587.748) [-1593.724] (-1593.491) (-1594.921) -- 0:01:19
734000 -- (-1598.367) (-1594.719) [-1596.441] (-1593.296) * [-1591.374] (-1597.415) (-1589.646) (-1599.779) -- 0:01:18
735000 -- (-1598.486) (-1599.768) (-1597.401) [-1587.104] * (-1595.280) (-1595.528) (-1588.423) [-1592.875] -- 0:01:18
Average standard deviation of split frequencies: 0.007088
736000 -- (-1589.024) (-1591.394) [-1585.743] (-1595.858) * (-1596.123) [-1591.187] (-1593.325) (-1592.284) -- 0:01:18
737000 -- (-1599.102) (-1599.993) [-1590.893] (-1601.507) * (-1596.102) (-1601.507) (-1590.568) [-1593.229] -- 0:01:17
738000 -- [-1587.477] (-1604.589) (-1595.587) (-1605.120) * (-1593.436) (-1594.878) (-1599.509) [-1588.788] -- 0:01:17
739000 -- (-1592.159) (-1600.084) [-1597.734] (-1591.985) * (-1606.949) (-1594.984) (-1595.012) [-1589.893] -- 0:01:17
740000 -- (-1599.377) [-1598.835] (-1592.706) (-1600.377) * [-1589.685] (-1591.677) (-1595.238) (-1603.754) -- 0:01:16
Average standard deviation of split frequencies: 0.006831
741000 -- (-1594.530) (-1602.701) [-1596.286] (-1601.434) * [-1598.355] (-1600.209) (-1590.097) (-1596.621) -- 0:01:16
742000 -- (-1596.395) (-1605.619) [-1592.623] (-1595.219) * (-1597.426) [-1590.406] (-1598.003) (-1600.457) -- 0:01:16
743000 -- [-1597.373] (-1607.333) (-1601.029) (-1587.842) * (-1593.200) (-1602.303) [-1590.296] (-1591.074) -- 0:01:16
744000 -- [-1588.653] (-1590.707) (-1597.333) (-1592.972) * (-1595.645) (-1595.802) (-1597.502) [-1595.147] -- 0:01:15
745000 -- [-1590.235] (-1593.603) (-1597.693) (-1589.268) * (-1600.366) [-1591.518] (-1592.468) (-1597.973) -- 0:01:15
Average standard deviation of split frequencies: 0.007246
746000 -- (-1592.367) (-1601.230) (-1596.046) [-1591.979] * (-1594.766) (-1596.931) (-1594.133) [-1590.907] -- 0:01:15
747000 -- (-1595.648) [-1590.881] (-1592.952) (-1599.173) * (-1592.885) (-1601.318) (-1591.538) [-1592.715] -- 0:01:14
748000 -- (-1592.017) [-1592.398] (-1599.404) (-1607.233) * [-1600.414] (-1597.187) (-1594.735) (-1594.194) -- 0:01:14
749000 -- (-1607.831) (-1594.107) [-1593.388] (-1599.169) * (-1589.364) [-1595.320] (-1604.485) (-1592.351) -- 0:01:14
750000 -- (-1602.946) (-1596.867) (-1600.736) [-1586.466] * (-1594.569) (-1589.078) [-1589.374] (-1590.277) -- 0:01:14
Average standard deviation of split frequencies: 0.006950
751000 -- (-1591.958) (-1594.094) (-1590.287) [-1589.376] * (-1589.876) (-1606.933) (-1596.613) [-1592.692] -- 0:01:13
752000 -- [-1586.562] (-1592.780) (-1594.098) (-1597.715) * (-1599.585) (-1588.317) [-1598.424] (-1596.448) -- 0:01:13
753000 -- (-1590.233) (-1598.649) (-1603.380) [-1588.639] * [-1594.172] (-1591.303) (-1596.272) (-1591.111) -- 0:01:13
754000 -- (-1598.207) [-1589.647] (-1595.331) (-1598.574) * [-1590.110] (-1598.397) (-1592.733) (-1600.989) -- 0:01:12
755000 -- (-1588.632) [-1598.752] (-1593.634) (-1595.316) * (-1603.273) [-1604.239] (-1597.039) (-1604.368) -- 0:01:12
Average standard deviation of split frequencies: 0.006693
756000 -- (-1599.114) (-1594.147) [-1592.557] (-1590.849) * (-1597.635) (-1590.707) [-1590.392] (-1599.575) -- 0:01:12
757000 -- [-1589.866] (-1595.717) (-1599.404) (-1588.943) * [-1594.041] (-1594.799) (-1599.645) (-1594.343) -- 0:01:11
758000 -- (-1595.605) (-1588.925) [-1599.961] (-1592.568) * (-1595.728) (-1597.583) [-1592.772] (-1596.276) -- 0:01:11
759000 -- (-1600.061) [-1595.826] (-1597.211) (-1588.472) * (-1595.630) (-1601.555) (-1591.722) [-1596.129] -- 0:01:11
760000 -- (-1598.319) [-1595.499] (-1591.861) (-1599.151) * [-1592.729] (-1594.956) (-1596.144) (-1600.108) -- 0:01:11
Average standard deviation of split frequencies: 0.007230
761000 -- (-1596.297) (-1589.916) [-1592.462] (-1589.958) * (-1594.968) (-1598.279) [-1596.958] (-1603.160) -- 0:01:10
762000 -- (-1600.186) [-1601.233] (-1589.966) (-1595.265) * (-1603.003) (-1605.715) (-1596.418) [-1591.682] -- 0:01:10
763000 -- [-1591.252] (-1592.367) (-1598.348) (-1598.205) * (-1596.525) [-1597.321] (-1608.730) (-1600.908) -- 0:01:10
764000 -- (-1592.681) [-1591.048] (-1598.480) (-1586.806) * (-1599.280) [-1594.972] (-1594.438) (-1595.213) -- 0:01:09
765000 -- [-1596.642] (-1590.796) (-1595.069) (-1608.497) * (-1594.089) [-1595.276] (-1598.656) (-1591.173) -- 0:01:09
Average standard deviation of split frequencies: 0.007098
766000 -- [-1594.656] (-1595.730) (-1590.293) (-1593.083) * [-1597.935] (-1592.800) (-1603.407) (-1596.095) -- 0:01:09
767000 -- (-1596.706) (-1607.030) [-1595.020] (-1599.159) * (-1598.228) (-1595.303) [-1591.686] (-1604.880) -- 0:01:08
768000 -- (-1596.598) [-1592.946] (-1591.738) (-1595.454) * [-1604.098] (-1587.715) (-1604.936) (-1593.230) -- 0:01:08
769000 -- (-1588.859) (-1601.304) (-1600.672) [-1596.118] * (-1599.198) (-1596.833) [-1587.479] (-1600.625) -- 0:01:08
770000 -- (-1590.442) (-1586.503) (-1595.217) [-1591.372] * (-1592.349) (-1593.167) [-1589.074] (-1597.361) -- 0:01:08
Average standard deviation of split frequencies: 0.006484
771000 -- (-1602.597) [-1592.683] (-1600.549) (-1605.178) * (-1602.072) [-1596.543] (-1597.433) (-1592.699) -- 0:01:07
772000 -- (-1596.362) (-1591.617) [-1598.922] (-1594.996) * (-1598.382) (-1589.585) (-1586.295) [-1591.204] -- 0:01:07
773000 -- (-1595.160) (-1592.842) (-1594.983) [-1595.248] * (-1604.750) [-1596.330] (-1601.655) (-1592.283) -- 0:01:07
774000 -- (-1591.267) (-1598.429) [-1597.531] (-1592.083) * [-1594.332] (-1592.877) (-1593.539) (-1595.797) -- 0:01:06
775000 -- (-1589.282) [-1595.429] (-1587.486) (-1594.764) * (-1591.334) (-1599.556) (-1592.239) [-1589.511] -- 0:01:06
Average standard deviation of split frequencies: 0.006601
776000 -- (-1591.143) (-1587.989) [-1591.293] (-1597.914) * (-1598.006) (-1604.739) (-1592.234) [-1590.905] -- 0:01:06
777000 -- (-1592.353) (-1597.148) (-1596.821) [-1604.986] * (-1590.973) [-1591.006] (-1593.655) (-1598.126) -- 0:01:06
778000 -- (-1601.652) (-1591.558) (-1588.441) [-1596.520] * (-1599.304) (-1601.249) (-1591.691) [-1598.163] -- 0:01:05
779000 -- [-1599.647] (-1593.296) (-1596.006) (-1604.003) * (-1604.997) (-1603.841) [-1592.625] (-1589.202) -- 0:01:05
780000 -- [-1593.866] (-1589.588) (-1596.203) (-1601.588) * (-1602.943) (-1592.593) (-1598.230) [-1601.101] -- 0:01:05
Average standard deviation of split frequencies: 0.006522
781000 -- (-1600.650) (-1594.232) [-1592.047] (-1604.934) * [-1589.993] (-1590.662) (-1594.832) (-1597.609) -- 0:01:04
782000 -- (-1600.058) (-1597.904) [-1594.827] (-1600.454) * (-1594.683) [-1591.641] (-1591.528) (-1600.690) -- 0:01:04
783000 -- (-1588.011) (-1595.827) [-1588.213] (-1588.627) * (-1596.483) [-1589.718] (-1595.273) (-1595.803) -- 0:01:04
784000 -- (-1600.994) (-1600.069) (-1597.239) [-1589.741] * (-1591.594) [-1596.046] (-1593.195) (-1601.772) -- 0:01:03
785000 -- [-1589.420] (-1590.276) (-1597.571) (-1603.694) * (-1599.780) (-1591.779) (-1597.736) [-1589.128] -- 0:01:03
Average standard deviation of split frequencies: 0.007117
786000 -- [-1592.430] (-1592.643) (-1600.579) (-1602.473) * [-1596.529] (-1597.398) (-1600.941) (-1588.723) -- 0:01:03
787000 -- [-1594.676] (-1600.279) (-1599.365) (-1591.748) * [-1596.306] (-1601.056) (-1598.299) (-1589.754) -- 0:01:03
788000 -- (-1592.132) [-1595.064] (-1597.911) (-1588.839) * (-1586.629) [-1594.449] (-1595.937) (-1595.536) -- 0:01:02
789000 -- (-1597.362) (-1597.680) [-1596.862] (-1587.989) * [-1588.502] (-1598.135) (-1603.095) (-1591.253) -- 0:01:02
790000 -- (-1591.890) (-1597.316) (-1598.292) [-1593.027] * (-1595.089) (-1599.663) (-1594.570) [-1597.256] -- 0:01:02
Average standard deviation of split frequencies: 0.007393
791000 -- [-1587.991] (-1590.682) (-1603.012) (-1595.954) * [-1599.330] (-1588.830) (-1588.844) (-1596.576) -- 0:01:01
792000 -- [-1593.943] (-1597.540) (-1598.638) (-1589.843) * (-1591.785) [-1591.085] (-1597.385) (-1591.604) -- 0:01:01
793000 -- (-1602.271) (-1599.376) (-1588.104) [-1590.834] * [-1597.081] (-1597.853) (-1606.505) (-1592.600) -- 0:01:01
794000 -- (-1606.645) (-1590.064) (-1594.715) [-1588.558] * (-1588.115) (-1595.828) (-1590.830) [-1595.218] -- 0:01:00
795000 -- [-1594.163] (-1602.765) (-1594.208) (-1591.433) * (-1594.978) (-1596.134) (-1594.952) [-1593.704] -- 0:01:00
Average standard deviation of split frequencies: 0.007343
796000 -- (-1602.424) (-1596.818) [-1586.931] (-1592.656) * (-1591.524) (-1595.562) (-1599.361) [-1596.904] -- 0:01:00
797000 -- (-1604.659) (-1597.019) (-1593.008) [-1589.127] * [-1593.305] (-1597.414) (-1597.146) (-1599.525) -- 0:01:00
798000 -- [-1590.403] (-1601.376) (-1602.315) (-1593.773) * (-1595.126) [-1602.543] (-1596.011) (-1593.699) -- 0:00:59
799000 -- (-1603.676) (-1595.370) (-1598.655) [-1595.364] * [-1590.716] (-1592.144) (-1596.789) (-1594.943) -- 0:00:59
800000 -- (-1601.631) (-1589.669) (-1602.126) [-1591.208] * [-1601.001] (-1599.364) (-1594.220) (-1602.464) -- 0:00:59
Average standard deviation of split frequencies: 0.007536
801000 -- (-1594.611) [-1591.383] (-1602.106) (-1596.316) * (-1589.989) (-1598.317) (-1593.351) [-1590.167] -- 0:00:58
802000 -- (-1591.414) [-1599.717] (-1603.693) (-1593.790) * (-1596.538) (-1591.050) (-1593.848) [-1589.005] -- 0:00:58
803000 -- [-1587.853] (-1597.616) (-1590.890) (-1591.599) * [-1598.737] (-1601.556) (-1601.481) (-1601.780) -- 0:00:58
804000 -- [-1591.405] (-1598.169) (-1599.438) (-1597.743) * (-1596.212) (-1592.658) (-1588.731) [-1597.075] -- 0:00:58
805000 -- (-1594.964) (-1603.747) [-1594.312] (-1598.355) * [-1594.151] (-1601.956) (-1594.735) (-1597.956) -- 0:00:57
Average standard deviation of split frequencies: 0.007213
806000 -- (-1599.051) [-1598.880] (-1590.733) (-1595.140) * (-1596.606) [-1590.103] (-1595.563) (-1597.963) -- 0:00:57
807000 -- (-1589.807) (-1600.261) [-1591.817] (-1595.243) * [-1590.274] (-1595.514) (-1598.157) (-1590.465) -- 0:00:57
808000 -- (-1600.922) [-1593.841] (-1591.326) (-1593.275) * (-1589.108) (-1602.202) (-1589.615) [-1608.347] -- 0:00:56
809000 -- (-1597.265) (-1590.787) [-1600.778] (-1594.100) * [-1592.020] (-1595.568) (-1591.830) (-1597.096) -- 0:00:56
810000 -- [-1592.511] (-1597.598) (-1591.623) (-1603.939) * (-1598.084) [-1595.726] (-1599.297) (-1603.012) -- 0:00:56
Average standard deviation of split frequencies: 0.007094
811000 -- (-1597.005) (-1605.412) [-1594.475] (-1589.793) * (-1599.772) (-1593.751) [-1593.163] (-1592.949) -- 0:00:55
812000 -- (-1589.249) (-1604.752) (-1601.473) [-1596.484] * (-1601.984) [-1597.153] (-1597.816) (-1597.743) -- 0:00:55
813000 -- (-1591.963) (-1596.336) (-1596.016) [-1591.804] * (-1594.858) (-1589.542) [-1594.404] (-1598.308) -- 0:00:55
814000 -- [-1589.171] (-1597.346) (-1596.972) (-1592.156) * [-1594.869] (-1602.037) (-1595.152) (-1591.561) -- 0:00:55
815000 -- (-1595.977) (-1597.877) (-1597.239) [-1593.200] * [-1599.393] (-1592.777) (-1590.536) (-1590.715) -- 0:00:54
Average standard deviation of split frequencies: 0.007395
816000 -- (-1593.560) (-1598.969) [-1591.131] (-1594.242) * (-1606.826) (-1604.283) (-1595.080) [-1597.087] -- 0:00:54
817000 -- (-1597.531) (-1598.480) [-1593.447] (-1600.747) * [-1589.128] (-1588.093) (-1595.431) (-1592.199) -- 0:00:54
818000 -- (-1588.017) [-1598.552] (-1601.771) (-1599.936) * [-1592.819] (-1594.769) (-1611.243) (-1599.829) -- 0:00:53
819000 -- (-1600.801) (-1592.428) (-1600.212) [-1592.050] * (-1591.875) (-1603.763) (-1593.549) [-1591.513] -- 0:00:53
820000 -- (-1605.021) (-1596.837) [-1596.161] (-1598.745) * (-1592.493) [-1591.826] (-1596.161) (-1596.730) -- 0:00:53
Average standard deviation of split frequencies: 0.007238
821000 -- (-1594.733) (-1595.978) [-1599.132] (-1597.141) * [-1591.005] (-1601.361) (-1593.999) (-1595.444) -- 0:00:52
822000 -- (-1596.405) [-1591.849] (-1594.989) (-1589.844) * [-1594.056] (-1591.607) (-1602.849) (-1588.999) -- 0:00:52
823000 -- (-1603.403) (-1597.590) (-1595.737) [-1589.728] * (-1600.942) [-1586.337] (-1593.244) (-1598.687) -- 0:00:52
824000 -- (-1585.831) (-1589.244) (-1592.542) [-1598.195] * (-1589.170) (-1598.193) (-1597.866) [-1586.281] -- 0:00:52
825000 -- (-1594.087) [-1592.965] (-1598.326) (-1599.009) * (-1591.389) (-1588.522) (-1589.188) [-1588.284] -- 0:00:51
Average standard deviation of split frequencies: 0.007229
826000 -- (-1588.091) (-1601.178) [-1605.963] (-1597.608) * (-1599.074) (-1591.736) (-1590.224) [-1601.528] -- 0:00:51
827000 -- [-1587.504] (-1600.110) (-1600.111) (-1597.037) * (-1593.377) (-1600.756) (-1590.203) [-1587.201] -- 0:00:51
828000 -- (-1597.371) [-1602.176] (-1591.187) (-1603.032) * [-1591.774] (-1598.172) (-1602.692) (-1594.533) -- 0:00:50
829000 -- [-1587.614] (-1604.893) (-1595.158) (-1595.662) * [-1595.423] (-1593.231) (-1596.435) (-1604.262) -- 0:00:50
830000 -- (-1596.198) (-1594.817) [-1600.099] (-1598.519) * (-1592.164) (-1598.276) (-1590.339) [-1596.627] -- 0:00:50
Average standard deviation of split frequencies: 0.007378
831000 -- (-1598.725) [-1596.411] (-1595.226) (-1603.661) * (-1599.131) [-1600.499] (-1597.923) (-1592.187) -- 0:00:50
832000 -- (-1602.475) [-1591.454] (-1598.746) (-1594.871) * (-1610.104) (-1594.497) (-1592.347) [-1591.928] -- 0:00:49
833000 -- (-1589.389) (-1586.864) (-1597.970) [-1592.881] * [-1593.081] (-1592.906) (-1600.300) (-1598.087) -- 0:00:49
834000 -- (-1603.628) [-1586.292] (-1600.309) (-1593.084) * (-1595.370) [-1600.190] (-1607.342) (-1592.781) -- 0:00:49
835000 -- (-1596.111) (-1593.701) (-1600.301) [-1596.007] * (-1593.617) (-1598.042) [-1593.828] (-1591.512) -- 0:00:48
Average standard deviation of split frequencies: 0.007330
836000 -- (-1600.529) (-1592.170) (-1598.794) [-1597.092] * (-1599.150) (-1601.796) (-1601.345) [-1596.394] -- 0:00:48
837000 -- (-1604.955) (-1594.255) (-1599.775) [-1591.795] * (-1591.706) (-1593.981) [-1592.467] (-1591.489) -- 0:00:48
838000 -- (-1588.329) [-1588.505] (-1584.628) (-1598.255) * (-1599.188) (-1599.045) (-1590.539) [-1592.964] -- 0:00:47
839000 -- (-1598.305) [-1596.237] (-1593.272) (-1595.016) * (-1591.171) (-1599.261) (-1596.044) [-1592.451] -- 0:00:47
840000 -- [-1595.944] (-1601.380) (-1600.551) (-1600.142) * (-1595.211) (-1598.335) (-1591.483) [-1586.515] -- 0:00:47
Average standard deviation of split frequencies: 0.007664
841000 -- (-1590.710) (-1599.482) (-1590.894) [-1588.535] * (-1595.712) (-1594.638) (-1597.644) [-1591.816] -- 0:00:47
842000 -- (-1598.885) (-1602.924) [-1591.771] (-1596.452) * (-1588.237) [-1589.800] (-1595.521) (-1597.126) -- 0:00:46
843000 -- (-1605.909) [-1595.794] (-1592.838) (-1600.567) * (-1599.447) [-1589.567] (-1592.503) (-1598.940) -- 0:00:46
844000 -- (-1596.498) (-1597.901) [-1587.342] (-1591.200) * (-1601.010) [-1596.064] (-1591.609) (-1595.518) -- 0:00:46
845000 -- (-1603.252) [-1597.621] (-1593.189) (-1596.663) * (-1602.972) [-1590.749] (-1595.512) (-1592.887) -- 0:00:45
Average standard deviation of split frequencies: 0.007727
846000 -- (-1590.551) (-1590.833) (-1607.201) [-1594.613] * (-1598.809) (-1604.912) [-1592.720] (-1589.137) -- 0:00:45
847000 -- [-1593.703] (-1598.505) (-1603.831) (-1605.523) * (-1598.153) (-1596.308) [-1593.894] (-1591.903) -- 0:00:45
848000 -- (-1602.259) (-1602.782) [-1598.908] (-1595.317) * (-1593.214) (-1591.258) [-1598.512] (-1605.984) -- 0:00:44
849000 -- [-1594.278] (-1599.031) (-1603.940) (-1597.243) * [-1586.704] (-1593.942) (-1592.383) (-1594.776) -- 0:00:44
850000 -- [-1596.686] (-1595.962) (-1609.735) (-1597.814) * (-1593.709) [-1591.276] (-1591.273) (-1592.057) -- 0:00:44
Average standard deviation of split frequencies: 0.007315
851000 -- (-1594.077) [-1592.621] (-1602.035) (-1587.791) * (-1603.369) [-1594.040] (-1601.233) (-1599.954) -- 0:00:44
852000 -- (-1593.305) [-1593.690] (-1593.787) (-1608.711) * [-1589.707] (-1584.310) (-1591.979) (-1595.382) -- 0:00:43
853000 -- [-1590.103] (-1602.817) (-1600.273) (-1589.557) * (-1594.385) (-1604.186) [-1592.900] (-1593.699) -- 0:00:43
854000 -- (-1592.097) (-1598.216) (-1600.237) [-1593.037] * (-1596.986) (-1593.193) [-1590.500] (-1598.919) -- 0:00:43
855000 -- (-1588.431) [-1592.313] (-1590.454) (-1600.195) * [-1593.634] (-1587.451) (-1593.177) (-1595.185) -- 0:00:42
Average standard deviation of split frequencies: 0.007600
856000 -- (-1605.895) (-1594.805) [-1593.087] (-1586.118) * (-1589.438) [-1588.045] (-1595.205) (-1597.311) -- 0:00:42
857000 -- [-1593.794] (-1602.714) (-1589.773) (-1600.015) * [-1589.080] (-1587.782) (-1587.516) (-1599.680) -- 0:00:42
858000 -- (-1591.868) [-1591.474] (-1601.756) (-1614.729) * [-1593.319] (-1597.116) (-1590.323) (-1588.941) -- 0:00:42
859000 -- (-1596.473) (-1593.394) [-1599.399] (-1597.622) * (-1587.053) (-1602.066) (-1591.943) [-1596.229] -- 0:00:41
860000 -- [-1591.362] (-1590.667) (-1599.256) (-1588.706) * (-1593.425) (-1591.561) [-1590.191] (-1593.985) -- 0:00:41
Average standard deviation of split frequencies: 0.007339
861000 -- [-1588.774] (-1589.225) (-1596.061) (-1602.241) * (-1591.318) (-1599.446) (-1594.166) [-1589.095] -- 0:00:41
862000 -- [-1601.471] (-1596.601) (-1608.336) (-1594.560) * (-1606.234) (-1605.564) (-1593.235) [-1588.639] -- 0:00:40
863000 -- (-1590.705) (-1592.365) [-1596.128] (-1594.716) * (-1602.606) (-1594.362) (-1610.105) [-1590.936] -- 0:00:40
864000 -- (-1594.234) [-1592.727] (-1596.810) (-1589.147) * [-1593.773] (-1598.070) (-1593.342) (-1608.194) -- 0:00:40
865000 -- (-1597.271) (-1592.891) [-1592.632] (-1600.110) * (-1602.399) (-1605.301) (-1595.132) [-1588.929] -- 0:00:39
Average standard deviation of split frequencies: 0.007476
866000 -- (-1588.824) (-1596.630) [-1590.167] (-1597.029) * (-1590.486) (-1595.065) [-1587.340] (-1603.739) -- 0:00:39
867000 -- (-1591.186) (-1599.968) (-1595.025) [-1593.148] * [-1590.019] (-1590.200) (-1596.759) (-1601.780) -- 0:00:39
868000 -- [-1593.970] (-1602.393) (-1600.852) (-1594.227) * [-1588.119] (-1598.897) (-1596.456) (-1606.728) -- 0:00:39
869000 -- [-1591.944] (-1602.595) (-1598.824) (-1587.448) * (-1593.015) [-1595.157] (-1595.970) (-1593.401) -- 0:00:38
870000 -- [-1589.177] (-1596.748) (-1593.837) (-1590.586) * (-1593.730) [-1591.810] (-1594.168) (-1599.220) -- 0:00:38
Average standard deviation of split frequencies: 0.007400
871000 -- (-1599.844) (-1590.511) [-1596.739] (-1599.849) * (-1592.533) (-1591.112) [-1591.881] (-1593.053) -- 0:00:38
872000 -- (-1589.610) (-1597.605) [-1591.834] (-1600.581) * (-1602.848) [-1589.903] (-1599.382) (-1590.652) -- 0:00:37
873000 -- [-1588.834] (-1596.821) (-1587.184) (-1604.375) * [-1591.398] (-1591.610) (-1588.412) (-1597.838) -- 0:00:37
874000 -- (-1605.768) (-1591.478) [-1590.062] (-1594.765) * (-1595.815) (-1594.076) [-1593.906] (-1599.564) -- 0:00:37
875000 -- (-1596.903) (-1598.373) [-1582.698] (-1604.700) * [-1597.907] (-1599.790) (-1595.998) (-1594.403) -- 0:00:37
Average standard deviation of split frequencies: 0.007857
876000 -- [-1598.855] (-1592.266) (-1603.213) (-1599.738) * (-1600.376) (-1599.968) [-1589.140] (-1594.139) -- 0:00:36
877000 -- (-1589.235) [-1595.096] (-1609.025) (-1605.547) * (-1590.936) [-1588.416] (-1589.179) (-1596.427) -- 0:00:36
878000 -- [-1596.272] (-1599.071) (-1609.657) (-1595.934) * (-1598.767) (-1592.738) [-1591.203] (-1604.197) -- 0:00:36
879000 -- (-1594.236) [-1590.939] (-1599.573) (-1597.955) * (-1596.568) (-1595.321) [-1594.635] (-1603.374) -- 0:00:35
880000 -- [-1596.764] (-1600.678) (-1594.010) (-1593.931) * (-1591.875) [-1589.079] (-1600.305) (-1596.442) -- 0:00:35
Average standard deviation of split frequencies: 0.007565
881000 -- [-1588.036] (-1588.455) (-1597.854) (-1594.424) * [-1597.723] (-1603.396) (-1597.043) (-1597.153) -- 0:00:35
882000 -- (-1593.398) (-1595.846) [-1590.008] (-1599.872) * (-1590.663) [-1594.666] (-1605.556) (-1609.331) -- 0:00:34
883000 -- (-1606.488) (-1593.379) (-1593.402) [-1593.848] * (-1592.190) [-1590.406] (-1593.611) (-1599.580) -- 0:00:34
884000 -- (-1592.001) [-1593.482] (-1599.726) (-1596.567) * (-1594.888) [-1597.143] (-1597.003) (-1596.453) -- 0:00:34
885000 -- (-1600.299) (-1601.332) (-1597.730) [-1584.272] * (-1594.890) (-1598.246) (-1599.033) [-1594.999] -- 0:00:34
Average standard deviation of split frequencies: 0.007378
886000 -- [-1595.574] (-1605.334) (-1607.717) (-1594.127) * (-1594.647) [-1595.728] (-1602.960) (-1600.290) -- 0:00:33
887000 -- (-1600.234) [-1592.360] (-1599.358) (-1591.860) * (-1592.001) [-1590.860] (-1589.146) (-1602.332) -- 0:00:33
888000 -- (-1602.734) (-1593.522) [-1593.628] (-1594.338) * [-1593.645] (-1593.294) (-1586.215) (-1602.018) -- 0:00:33
889000 -- (-1605.755) (-1593.772) [-1588.709] (-1596.340) * (-1591.701) [-1588.220] (-1595.994) (-1603.707) -- 0:00:32
890000 -- (-1598.534) (-1607.726) (-1594.985) [-1596.751] * (-1592.566) (-1599.593) (-1596.494) [-1586.734] -- 0:00:32
Average standard deviation of split frequencies: 0.007516
891000 -- (-1594.734) [-1592.834] (-1592.693) (-1596.811) * (-1596.534) [-1595.819] (-1596.289) (-1593.263) -- 0:00:32
892000 -- (-1595.353) (-1591.370) [-1598.161] (-1599.975) * (-1610.122) (-1599.227) (-1601.331) [-1597.811] -- 0:00:31
893000 -- (-1596.371) (-1592.682) [-1592.258] (-1599.585) * (-1609.115) (-1603.292) [-1591.922] (-1592.851) -- 0:00:31
894000 -- (-1590.515) (-1592.073) [-1594.665] (-1595.988) * (-1603.772) [-1600.834] (-1592.693) (-1601.056) -- 0:00:31
895000 -- (-1587.534) (-1589.066) [-1597.897] (-1599.694) * (-1602.485) (-1593.641) (-1598.379) [-1592.315] -- 0:00:31
Average standard deviation of split frequencies: 0.007506
896000 -- (-1600.787) (-1594.611) [-1595.896] (-1603.470) * (-1596.417) (-1590.676) [-1594.138] (-1593.846) -- 0:00:30
897000 -- (-1596.743) [-1588.393] (-1593.298) (-1594.301) * (-1593.998) (-1599.283) [-1592.624] (-1593.534) -- 0:00:30
898000 -- (-1595.729) (-1590.653) [-1601.581] (-1602.540) * [-1594.983] (-1596.962) (-1595.952) (-1593.999) -- 0:00:30
899000 -- (-1594.544) [-1594.548] (-1592.564) (-1595.793) * (-1592.903) (-1596.055) [-1593.738] (-1594.890) -- 0:00:29
900000 -- (-1590.794) (-1602.295) (-1601.200) [-1590.811] * (-1594.552) (-1593.817) (-1608.927) [-1593.791] -- 0:00:29
Average standard deviation of split frequencies: 0.007362
901000 -- [-1599.891] (-1595.048) (-1591.467) (-1604.853) * [-1594.629] (-1587.840) (-1598.993) (-1593.897) -- 0:00:29
902000 -- (-1593.471) (-1590.146) [-1596.443] (-1594.731) * (-1597.437) (-1593.779) (-1596.405) [-1594.041] -- 0:00:29
903000 -- [-1593.067] (-1602.465) (-1589.538) (-1594.497) * (-1595.577) [-1592.372] (-1593.268) (-1601.103) -- 0:00:28
904000 -- (-1602.611) (-1591.359) (-1591.505) [-1588.838] * (-1595.957) [-1598.855] (-1589.544) (-1596.697) -- 0:00:28
905000 -- [-1596.333] (-1600.976) (-1602.458) (-1595.939) * (-1595.322) (-1607.427) (-1593.642) [-1591.911] -- 0:00:28
Average standard deviation of split frequencies: 0.007458
906000 -- [-1586.880] (-1591.221) (-1601.361) (-1607.281) * (-1596.646) (-1594.333) (-1599.641) [-1588.887] -- 0:00:27
907000 -- (-1607.096) (-1596.477) (-1599.977) [-1595.383] * (-1596.764) (-1596.813) (-1586.492) [-1588.916] -- 0:00:27
908000 -- (-1594.538) (-1592.953) (-1598.591) [-1592.039] * (-1590.973) (-1598.343) (-1591.460) [-1592.683] -- 0:00:27
909000 -- (-1586.895) (-1590.920) [-1596.164] (-1604.261) * [-1598.283] (-1599.068) (-1598.148) (-1601.690) -- 0:00:26
910000 -- (-1597.170) [-1589.405] (-1593.862) (-1594.093) * (-1600.293) (-1595.264) (-1591.959) [-1588.793] -- 0:00:26
Average standard deviation of split frequencies: 0.007730
911000 -- [-1590.828] (-1600.923) (-1601.249) (-1593.133) * [-1587.940] (-1596.057) (-1612.039) (-1597.787) -- 0:00:26
912000 -- (-1591.745) (-1596.622) [-1595.418] (-1594.249) * (-1593.142) (-1597.390) (-1597.551) [-1589.663] -- 0:00:26
913000 -- (-1593.902) (-1597.611) [-1592.198] (-1591.554) * (-1599.260) (-1592.801) [-1591.361] (-1596.110) -- 0:00:25
914000 -- [-1591.586] (-1597.745) (-1602.697) (-1591.155) * (-1602.082) [-1587.099] (-1589.204) (-1596.092) -- 0:00:25
915000 -- (-1596.892) [-1600.254] (-1597.166) (-1599.092) * (-1599.919) (-1597.533) [-1588.527] (-1589.828) -- 0:00:25
Average standard deviation of split frequencies: 0.007720
916000 -- (-1595.343) (-1591.563) (-1590.322) [-1592.148] * (-1597.763) (-1599.323) (-1591.712) [-1592.121] -- 0:00:24
917000 -- (-1601.953) (-1596.857) (-1588.604) [-1587.361] * [-1592.284] (-1592.862) (-1599.622) (-1596.661) -- 0:00:24
918000 -- (-1600.721) (-1593.371) [-1594.207] (-1601.630) * [-1590.832] (-1591.473) (-1594.164) (-1591.134) -- 0:00:24
919000 -- (-1596.856) (-1598.927) [-1598.758] (-1591.326) * (-1593.313) (-1598.274) (-1600.724) [-1593.993] -- 0:00:23
920000 -- (-1601.393) (-1591.796) [-1594.815] (-1606.704) * (-1595.665) [-1587.831] (-1595.750) (-1598.566) -- 0:00:23
Average standard deviation of split frequencies: 0.007134
921000 -- (-1594.293) [-1607.206] (-1591.732) (-1592.988) * (-1601.217) (-1596.442) (-1600.643) [-1593.730] -- 0:00:23
922000 -- (-1586.955) (-1595.465) (-1598.617) [-1594.903] * (-1598.059) [-1593.291] (-1602.422) (-1597.134) -- 0:00:23
923000 -- (-1589.977) (-1591.452) (-1591.668) [-1586.261] * [-1597.843] (-1593.525) (-1592.893) (-1601.583) -- 0:00:22
924000 -- (-1590.210) [-1589.675] (-1598.934) (-1596.761) * [-1598.762] (-1592.724) (-1592.551) (-1616.269) -- 0:00:22
925000 -- (-1593.819) [-1597.207] (-1595.161) (-1597.301) * (-1587.473) (-1597.079) (-1595.933) [-1598.821] -- 0:00:22
Average standard deviation of split frequencies: 0.007263
926000 -- [-1591.622] (-1597.328) (-1595.011) (-1595.359) * (-1597.489) [-1594.302] (-1600.220) (-1606.447) -- 0:00:21
927000 -- (-1597.477) (-1597.578) [-1590.510] (-1593.659) * (-1592.453) (-1595.628) [-1590.794] (-1590.142) -- 0:00:21
928000 -- (-1589.551) [-1592.413] (-1591.887) (-1597.332) * (-1599.783) (-1587.964) (-1599.450) [-1593.874] -- 0:00:21
929000 -- (-1591.473) (-1596.060) (-1593.793) [-1593.565] * (-1606.093) (-1591.844) (-1593.994) [-1592.117] -- 0:00:21
930000 -- (-1595.299) (-1592.442) (-1590.364) [-1589.352] * (-1596.524) [-1597.705] (-1588.573) (-1589.184) -- 0:00:20
Average standard deviation of split frequencies: 0.007632
931000 -- (-1592.630) (-1595.611) [-1594.856] (-1605.421) * (-1595.242) (-1591.989) [-1596.581] (-1604.755) -- 0:00:20
932000 -- (-1597.256) (-1594.445) (-1599.610) [-1593.358] * (-1599.015) (-1598.736) [-1593.205] (-1590.137) -- 0:00:20
933000 -- (-1595.172) (-1599.947) (-1593.064) [-1584.777] * (-1590.410) (-1592.819) [-1591.156] (-1596.526) -- 0:00:19
934000 -- (-1604.436) (-1592.490) [-1586.971] (-1594.726) * (-1590.836) (-1593.733) (-1594.790) [-1591.994] -- 0:00:19
935000 -- (-1589.455) (-1592.959) [-1591.726] (-1598.819) * (-1599.576) (-1594.449) (-1596.265) [-1595.793] -- 0:00:19
Average standard deviation of split frequencies: 0.007823
936000 -- (-1594.046) (-1594.780) [-1594.579] (-1599.729) * (-1597.280) (-1604.623) [-1597.186] (-1589.090) -- 0:00:18
937000 -- (-1593.785) (-1595.276) [-1593.128] (-1592.315) * [-1601.773] (-1593.677) (-1594.469) (-1590.951) -- 0:00:18
938000 -- (-1594.289) [-1595.875] (-1596.880) (-1594.199) * (-1597.165) (-1600.566) [-1593.101] (-1589.936) -- 0:00:18
939000 -- (-1593.581) (-1591.677) (-1586.954) [-1589.948] * (-1602.112) (-1591.140) (-1609.278) [-1591.892] -- 0:00:18
940000 -- (-1597.296) [-1597.108] (-1603.804) (-1592.137) * [-1590.288] (-1591.682) (-1594.459) (-1590.712) -- 0:00:17
Average standard deviation of split frequencies: 0.007684
941000 -- [-1585.646] (-1593.590) (-1593.611) (-1613.238) * [-1598.058] (-1594.769) (-1595.791) (-1602.221) -- 0:00:17
942000 -- (-1600.431) (-1590.154) [-1591.802] (-1588.396) * (-1597.928) [-1601.060] (-1590.145) (-1595.717) -- 0:00:17
943000 -- [-1597.238] (-1597.798) (-1605.736) (-1600.369) * (-1606.425) [-1592.044] (-1586.415) (-1594.861) -- 0:00:16
944000 -- (-1595.930) (-1599.244) [-1589.663] (-1599.111) * (-1602.575) [-1589.973] (-1600.992) (-1594.512) -- 0:00:16
945000 -- (-1597.380) (-1602.976) [-1589.852] (-1607.895) * (-1602.958) [-1587.951] (-1590.992) (-1593.970) -- 0:00:16
Average standard deviation of split frequencies: 0.007574
946000 -- (-1593.252) (-1595.993) (-1590.992) [-1591.586] * (-1597.071) (-1599.483) (-1586.435) [-1597.358] -- 0:00:15
947000 -- (-1598.505) (-1588.882) [-1594.294] (-1589.745) * [-1594.664] (-1598.590) (-1604.643) (-1592.596) -- 0:00:15
948000 -- (-1588.404) [-1592.673] (-1598.355) (-1588.182) * (-1599.953) (-1591.099) [-1596.765] (-1596.498) -- 0:00:15
949000 -- [-1591.550] (-1590.025) (-1595.827) (-1596.630) * (-1593.246) (-1591.262) [-1588.402] (-1588.578) -- 0:00:15
950000 -- (-1599.463) (-1598.392) [-1600.672] (-1597.837) * [-1596.989] (-1594.371) (-1603.532) (-1593.591) -- 0:00:14
Average standard deviation of split frequencies: 0.007471
951000 -- (-1599.021) (-1593.027) (-1602.952) [-1586.233] * (-1591.660) [-1591.211] (-1591.662) (-1596.805) -- 0:00:14
952000 -- (-1602.361) (-1595.625) [-1591.477] (-1588.738) * (-1599.048) (-1594.370) [-1590.351] (-1589.955) -- 0:00:14
953000 -- (-1593.319) [-1593.970] (-1609.082) (-1606.725) * (-1603.593) [-1594.755] (-1605.792) (-1601.982) -- 0:00:13
954000 -- [-1594.733] (-1602.942) (-1600.389) (-1591.097) * (-1592.826) (-1591.586) [-1590.916] (-1593.749) -- 0:00:13
955000 -- (-1588.924) [-1594.444] (-1592.811) (-1596.867) * (-1594.180) (-1604.812) [-1596.005] (-1593.751) -- 0:00:13
Average standard deviation of split frequencies: 0.007035
956000 -- (-1596.350) (-1593.732) (-1593.296) [-1587.589] * (-1594.557) (-1595.228) [-1592.508] (-1605.297) -- 0:00:13
957000 -- (-1595.285) (-1600.672) [-1591.042] (-1596.685) * (-1603.938) (-1602.119) [-1595.599] (-1607.831) -- 0:00:12
958000 -- (-1592.414) (-1585.266) [-1589.132] (-1606.897) * (-1590.909) [-1599.003] (-1594.248) (-1597.257) -- 0:00:12
959000 -- (-1603.088) (-1593.244) (-1605.345) [-1590.943] * (-1590.872) [-1597.336] (-1593.186) (-1587.355) -- 0:00:12
960000 -- (-1594.071) [-1589.004] (-1596.438) (-1601.569) * (-1593.747) (-1601.460) (-1595.618) [-1591.163] -- 0:00:11
Average standard deviation of split frequencies: 0.007132
961000 -- (-1590.797) (-1594.542) [-1594.374] (-1595.900) * (-1595.980) [-1593.160] (-1598.521) (-1601.347) -- 0:00:11
962000 -- (-1589.409) (-1601.998) (-1601.786) [-1595.249] * [-1591.583] (-1593.354) (-1597.206) (-1599.988) -- 0:00:11
963000 -- (-1603.426) (-1598.452) [-1594.544] (-1590.694) * (-1595.462) [-1596.364] (-1593.904) (-1597.696) -- 0:00:10
964000 -- (-1593.978) (-1589.919) (-1599.109) [-1590.527] * [-1593.476] (-1597.376) (-1597.803) (-1596.313) -- 0:00:10
965000 -- (-1596.092) (-1598.901) [-1588.285] (-1593.110) * (-1593.027) [-1598.455] (-1596.657) (-1584.013) -- 0:00:10
Average standard deviation of split frequencies: 0.007352
966000 -- (-1595.886) [-1594.763] (-1596.259) (-1597.941) * (-1594.840) (-1594.372) (-1597.175) [-1591.993] -- 0:00:10
967000 -- [-1592.921] (-1595.333) (-1591.930) (-1597.147) * (-1589.461) (-1593.035) [-1592.426] (-1600.974) -- 0:00:09
968000 -- (-1599.089) (-1590.375) [-1589.585] (-1590.151) * (-1593.325) (-1597.867) (-1590.996) [-1598.285] -- 0:00:09
969000 -- [-1601.120] (-1590.604) (-1590.637) (-1594.792) * (-1590.389) [-1591.399] (-1588.617) (-1598.854) -- 0:00:09
970000 -- (-1595.540) (-1593.908) [-1587.608] (-1607.367) * [-1596.613] (-1607.654) (-1594.261) (-1601.040) -- 0:00:08
Average standard deviation of split frequencies: 0.007155
971000 -- (-1600.603) (-1595.855) [-1593.331] (-1597.794) * (-1590.968) [-1590.612] (-1598.140) (-1596.277) -- 0:00:08
972000 -- [-1594.218] (-1599.664) (-1603.686) (-1598.239) * (-1600.708) [-1589.825] (-1586.813) (-1600.027) -- 0:00:08
973000 -- [-1588.508] (-1601.029) (-1594.305) (-1594.409) * (-1595.721) (-1592.648) [-1594.856] (-1604.228) -- 0:00:07
974000 -- (-1598.444) (-1606.955) [-1597.609] (-1596.289) * [-1590.187] (-1593.362) (-1598.622) (-1594.242) -- 0:00:07
975000 -- (-1599.476) [-1594.447] (-1585.218) (-1589.908) * [-1590.490] (-1600.640) (-1588.640) (-1591.384) -- 0:00:07
Average standard deviation of split frequencies: 0.007148
976000 -- (-1593.087) (-1596.993) [-1588.681] (-1591.256) * (-1600.971) (-1593.802) [-1596.490] (-1594.680) -- 0:00:07
977000 -- (-1601.277) (-1597.273) [-1596.697] (-1594.337) * (-1611.021) (-1587.975) (-1593.294) [-1592.448] -- 0:00:06
978000 -- (-1591.015) (-1595.081) (-1590.137) [-1595.289] * (-1597.190) [-1596.202] (-1595.442) (-1591.172) -- 0:00:06
979000 -- [-1598.583] (-1594.981) (-1590.141) (-1600.937) * [-1588.638] (-1602.684) (-1591.699) (-1603.305) -- 0:00:06
980000 -- [-1591.033] (-1597.726) (-1594.984) (-1595.924) * (-1595.434) (-1597.670) [-1589.867] (-1606.032) -- 0:00:05
Average standard deviation of split frequencies: 0.007275
981000 -- (-1589.292) (-1601.364) [-1591.071] (-1600.739) * (-1591.588) [-1596.637] (-1595.014) (-1596.016) -- 0:00:05
982000 -- [-1593.996] (-1591.950) (-1588.874) (-1590.768) * [-1598.433] (-1587.620) (-1592.403) (-1587.182) -- 0:00:05
983000 -- (-1592.835) (-1597.374) (-1597.119) [-1585.698] * (-1596.701) (-1599.849) [-1587.997] (-1597.159) -- 0:00:05
984000 -- (-1592.126) (-1610.982) (-1590.907) [-1590.931] * (-1595.370) (-1591.182) [-1595.117] (-1588.880) -- 0:00:04
985000 -- [-1599.413] (-1590.902) (-1593.564) (-1597.406) * [-1595.241] (-1589.901) (-1603.876) (-1599.023) -- 0:00:04
Average standard deviation of split frequencies: 0.007458
986000 -- [-1600.614] (-1598.063) (-1590.683) (-1606.324) * (-1598.499) (-1603.775) [-1592.086] (-1590.375) -- 0:00:04
987000 -- [-1595.766] (-1592.023) (-1588.212) (-1609.310) * [-1592.005] (-1599.472) (-1596.148) (-1593.254) -- 0:00:03
988000 -- (-1591.505) (-1598.657) [-1596.307] (-1595.010) * (-1602.311) [-1598.784] (-1612.572) (-1593.068) -- 0:00:03
989000 -- (-1592.224) (-1594.955) [-1597.660] (-1603.565) * [-1590.188] (-1593.238) (-1595.244) (-1602.048) -- 0:00:03
990000 -- (-1605.704) [-1587.461] (-1586.294) (-1598.061) * (-1599.012) (-1598.383) (-1592.344) [-1592.466] -- 0:00:02
Average standard deviation of split frequencies: 0.007614
991000 -- (-1605.876) (-1593.267) (-1590.846) [-1587.084] * (-1602.489) (-1601.908) (-1589.963) [-1594.674] -- 0:00:02
992000 -- (-1599.755) (-1592.520) [-1591.002] (-1595.339) * (-1593.995) (-1604.358) [-1590.127] (-1589.448) -- 0:00:02
993000 -- [-1591.133] (-1595.405) (-1591.685) (-1592.117) * (-1595.612) [-1586.675] (-1597.816) (-1596.729) -- 0:00:02
994000 -- [-1588.990] (-1597.955) (-1594.179) (-1597.149) * (-1595.407) [-1590.944] (-1588.159) (-1595.994) -- 0:00:01
995000 -- (-1588.888) (-1593.113) (-1592.429) [-1591.622] * (-1591.423) [-1592.553] (-1593.474) (-1594.772) -- 0:00:01
Average standard deviation of split frequencies: 0.007510
996000 -- (-1592.403) [-1594.096] (-1591.053) (-1590.848) * [-1593.026] (-1603.542) (-1597.595) (-1598.612) -- 0:00:01
997000 -- (-1596.433) (-1596.082) (-1590.503) [-1590.051] * (-1594.900) [-1593.507] (-1597.921) (-1599.450) -- 0:00:00
998000 -- [-1593.532] (-1595.243) (-1591.041) (-1592.288) * (-1595.757) (-1602.751) [-1587.866] (-1598.266) -- 0:00:00
999000 -- [-1589.708] (-1587.748) (-1600.342) (-1593.281) * (-1592.558) (-1601.699) (-1597.535) [-1601.611] -- 0:00:00
1000000 -- (-1596.667) (-1595.781) (-1592.057) [-1585.853] * [-1595.696] (-1602.461) (-1596.684) (-1604.483) -- 0:00:00
Average standard deviation of split frequencies: 0.007569
Analysis completed in 4 mins 56 seconds
Analysis used 296.08 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1581.17
Likelihood of best state for "cold" chain of run 2 was -1581.62
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
62.8 % ( 49 %) Dirichlet(Revmat{all})
74.6 % ( 66 %) Slider(Revmat{all})
26.5 % ( 22 %) Dirichlet(Pi{all})
27.8 % ( 23 %) Slider(Pi{all})
78.6 % ( 69 %) Multiplier(Alpha{1,2})
67.5 % ( 39 %) Multiplier(Alpha{3})
88.9 % ( 72 %) Slider(Pinvar{all})
28.9 % ( 25 %) ExtSPR(Tau{all},V{all})
17.9 % ( 18 %) ExtTBR(Tau{all},V{all})
29.2 % ( 37 %) NNI(Tau{all},V{all})
27.8 % ( 21 %) ParsSPR(Tau{all},V{all})
27.2 % ( 30 %) Multiplier(V{all})
55.3 % ( 47 %) Nodeslider(V{all})
25.9 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
61.8 % ( 58 %) Dirichlet(Revmat{all})
74.4 % ( 60 %) Slider(Revmat{all})
26.4 % ( 24 %) Dirichlet(Pi{all})
27.8 % ( 23 %) Slider(Pi{all})
78.2 % ( 60 %) Multiplier(Alpha{1,2})
67.1 % ( 50 %) Multiplier(Alpha{3})
88.7 % ( 84 %) Slider(Pinvar{all})
28.6 % ( 29 %) ExtSPR(Tau{all},V{all})
18.6 % ( 17 %) ExtTBR(Tau{all},V{all})
29.5 % ( 35 %) NNI(Tau{all},V{all})
27.4 % ( 34 %) ParsSPR(Tau{all},V{all})
27.2 % ( 25 %) Multiplier(V{all})
55.0 % ( 52 %) Nodeslider(V{all})
25.6 % ( 30 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.75 0.55 0.38
2 | 167000 0.77 0.58
3 | 166884 166865 0.79
4 | 166162 166732 166357
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.75 0.55 0.38
2 | 166845 0.77 0.57
3 | 166819 166769 0.79
4 | 166264 166448 166855
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1591.05
| 1 2 |
| |
| 2 1 1 2 2 1 1|
| 2 1 2 1 2 2 1 |
| 2 2 1 22 2* 1 |
|2 2 1 2 2 12 2 2 12 211 21 1 2|
| 1 1 * 2 2 21 2 2 1 2 * 1 1 2 12 |
| 2 11 2 2 2 1 2 11 2 2 |
|1 1 * 11* 11 1 1 12 1 * 2 1 |
| 12 1 1 21 22 |
| 1 1 1 11 2 2 |
| 1 2 1 1 |
| 2 1 2 2 2 |
| 2 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1595.37
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1587.88 -1601.39
2 -1588.68 -1604.86
--------------------------------------
TOTAL -1588.20 -1604.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.106228 0.000267 0.074909 0.136826 0.104716 1321.67 1325.78 1.000
r(A<->C){all} 0.112013 0.001508 0.037691 0.184533 0.108365 455.52 618.30 1.000
r(A<->G){all} 0.301839 0.003519 0.192655 0.424232 0.300701 788.99 858.83 1.000
r(A<->T){all} 0.057351 0.000618 0.014755 0.105583 0.054181 709.81 780.47 1.000
r(C<->G){all} 0.111832 0.001941 0.031013 0.196265 0.106696 563.94 611.56 1.001
r(C<->T){all} 0.342289 0.003569 0.224600 0.454351 0.341273 626.20 712.18 1.001
r(G<->T){all} 0.074677 0.000971 0.021484 0.135541 0.069950 721.80 758.93 1.000
pi(A){all} 0.276949 0.000229 0.247853 0.307489 0.277126 1260.56 1296.39 1.001
pi(C){all} 0.196515 0.000175 0.171869 0.223382 0.196466 1036.45 1101.06 1.003
pi(G){all} 0.193919 0.000169 0.168519 0.220003 0.193276 1262.49 1381.74 1.000
pi(T){all} 0.332617 0.000241 0.302052 0.362469 0.332218 1361.24 1392.69 1.000
alpha{1,2} 0.309350 0.216923 0.000065 1.142030 0.158933 941.15 1011.81 1.000
alpha{3} 1.926309 1.505518 0.233561 4.379501 1.643428 1359.32 1406.75 1.000
pinvar{all} 0.267427 0.026979 0.000030 0.556706 0.253814 1137.17 1177.33 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C10
3 -- C2
4 -- C3
5 -- C4
6 -- C5
7 -- C6
8 -- C7
9 -- C8
10 -- C9
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
----------------
1 -- .*********
2 -- .*........
3 -- ..*.......
4 -- ...*......
5 -- ....*.....
6 -- .....*....
7 -- ......*...
8 -- .......*..
9 -- ........*.
10 -- .........*
11 -- ....***...
12 -- .*.......*
13 -- .....**...
14 -- .*..***.**
15 -- .*..***..*
16 -- .*.****.**
17 -- .**.******
18 -- ..*....*..
19 -- ...*...*..
20 -- .******.**
21 -- .**.***.**
22 -- .*.*******
23 -- .*..******
24 -- ..**...*..
25 -- ..**......
----------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 3002 1.000000 0.000000 1.000000 1.000000 2
13 2997 0.998334 0.000471 0.998001 0.998668 2
14 2985 0.994337 0.000471 0.994004 0.994670 2
15 2881 0.959694 0.003298 0.957362 0.962025 2
16 629 0.209527 0.006124 0.205197 0.213857 2
17 624 0.207861 0.015075 0.197202 0.218521 2
18 620 0.206529 0.025439 0.188541 0.224517 2
19 610 0.203198 0.010364 0.195869 0.210526 2
20 607 0.202199 0.001413 0.201199 0.203198 2
21 604 0.201199 0.011306 0.193205 0.209194 2
22 598 0.199201 0.008480 0.193205 0.205197 2
23 586 0.195203 0.011306 0.187209 0.203198 2
24 562 0.187209 0.011306 0.179214 0.195203 2
25 550 0.183211 0.008480 0.177215 0.189207 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.001065 0.000001 0.000000 0.003161 0.000739 1.000 2
length{all}[2] 0.002969 0.000004 0.000181 0.006715 0.002622 1.000 2
length{all}[3] 0.001071 0.000001 0.000001 0.003274 0.000724 1.000 2
length{all}[4] 0.001040 0.000001 0.000000 0.003192 0.000718 1.000 2
length{all}[5] 0.003279 0.000005 0.000032 0.007461 0.002841 1.000 2
length{all}[6] 0.001061 0.000001 0.000000 0.003250 0.000743 1.000 2
length{all}[7] 0.001032 0.000001 0.000000 0.003046 0.000719 1.000 2
length{all}[8] 0.001030 0.000001 0.000000 0.003109 0.000732 1.000 2
length{all}[9] 0.003358 0.000004 0.000396 0.006985 0.003031 1.001 2
length{all}[10] 0.006577 0.000008 0.001773 0.011847 0.006181 1.000 2
length{all}[11] 0.060798 0.000150 0.037455 0.083776 0.059387 1.000 2
length{all}[12] 0.007054 0.000010 0.001690 0.013377 0.006560 1.001 2
length{all}[13] 0.005607 0.000007 0.000900 0.010617 0.005254 1.001 2
length{all}[14] 0.003947 0.000004 0.000545 0.007961 0.003645 1.000 2
length{all}[15] 0.004311 0.000006 0.000339 0.009297 0.003831 1.000 2
length{all}[16] 0.001097 0.000001 0.000007 0.003581 0.000752 0.998 2
length{all}[17] 0.001022 0.000001 0.000001 0.003146 0.000671 1.000 2
length{all}[18] 0.001045 0.000001 0.000000 0.003278 0.000702 0.998 2
length{all}[19] 0.001025 0.000001 0.000003 0.003152 0.000697 0.999 2
length{all}[20] 0.001090 0.000001 0.000004 0.003363 0.000742 0.999 2
length{all}[21] 0.001149 0.000001 0.000000 0.003579 0.000738 0.999 2
length{all}[22] 0.001059 0.000001 0.000002 0.003257 0.000754 0.999 2
length{all}[23] 0.001032 0.000001 0.000000 0.003004 0.000738 1.004 2
length{all}[24] 0.001068 0.000001 0.000001 0.003030 0.000777 0.998 2
length{all}[25] 0.001065 0.000001 0.000000 0.003327 0.000729 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007569
Maximum standard deviation of split frequencies = 0.025439
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (3)
|
|----------------------------------------------------------------------- C3 (4)
|
|----------------------------------------------------------------------- C7 (8)
|
+ /-------------- C10 (2)
| /-------------100------------+
| | \-------------- C9 (10)
| |
| /------96-----+ /---------------------------- C4 (5)
| | | |
| | \------100-----+ /-------------- C5 (6)
\------99-----+ \-----100-----+
| \-------------- C6 (7)
|
\--------------------------------------------------------- C8 (9)
Phylogram (based on average branch lengths):
/- C1 (1)
|
|- C2 (3)
|
|- C3 (4)
|
|- C7 (8)
|
+ /-- C10 (2)
| /------+
| | \------ C9 (10)
| |
| /--+ /--- C4 (5)
| | | |
| | \----------------------------------------------------------+ /- C5 (6)
\---+ \----+
| \- C6 (7)
|
\--- C8 (9)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (66 trees sampled):
50 % credible set contains 8 trees
90 % credible set contains 14 trees
95 % credible set contains 15 trees
99 % credible set contains 40 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Wed Oct 26 22:52:38 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_NS3c_ABN10851_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=10, Len=285
C1 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDYSMEWSSDSVVLPPTSSDK
C2 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDYSMEWSSDSVVLPPTSSDK
C3 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDYSMEWSSDSVVLPPTSSDK
C4 -----------------MQPELSVSNCRLLDSSMEWSSSSVAALLTSSEK
C5 MSIVLRLLSVLKLQQNKMQPELYVH-CMLLDSSMEWSSSSVAALLTSSEK
C6 MSIVLRLLSVLKLQQNKMQPELYVH-CMLLDSSMEWSSSSVAALLTSSEK
C7 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDYSMEWSSDSVVLPPTSSDK
C8 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDSSMEWSSDSVVLPSTSSDK
C9 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDSSMEWSSDSVVLPSTSSDK
C10 MSIVLRLLSVLKHQQNKMQLDLSVNSYKLLDSSMEWSSDSVVLLSTSSDK
** :* * *** ******.**. ***:*
C1 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C2 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C3 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C4 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVRQEPTHCVRLVF
C5 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVRQEPTHCVRLVF
C6 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVRQEPTHCVRLVF
C7 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C8 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C9 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
C10 TVMMPAKATSSRKRHRKPKLQYAKRRFSPVNPNDLVLVQQEPTHCVRLVF
**************************************:***********
C1 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIYAPEAGECFGNFLHLC
C2 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIYAPEAGECFGNFLHLC
C3 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIYAPEAGECFGNFLHLC
C4 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIHAPEAGECFGNLLHLT
C5 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIHAPEAGECFGNLLHLT
C6 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIHAPEAGECFGNLLHLT
C7 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIYAPEAGECFGNFLHLC
C8 PLTKRWIHFDGLVYSLARLNVSMTVDYHVTLALIYAPEAGECFGNFLHLC
C9 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIHAPDAGECFGNLLHLS
C10 PLSKRWIHFDGLVYSLARLNVSMTVDYHVTLALIHAPDAGECFGNLLHLS
**:*******************************:**:*******:***
C1 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C2 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C3 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C4 PLLKDCLLEFKKLCILGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C5 PLLKDCLLEFKKLCILGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C6 PLLKDCLLEFKKLCILGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C7 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C8 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C9 PLLKDCLLEFKKLFVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
C10 PLLKDCLLEFKKLCVLGKTLTILASEWPFFTDVKKNKDNLTVPKAVEWLK
************* :***********************************
C1 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
C2 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
C3 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
C4 EHGYEIYSSQLPLHMSLAKLHDLPQAQFTEAAGLCHYFDPREFALPSALE
C5 EHGYEIYSSQLPLHMSLAKLHDLPQAQFTEAAGLCHYFDPREFALPSALE
C6 EHGYEIYSSQLPLHMSLAKLHDLPQAQFTEAAGLCHYFDPREFALPSALE
C7 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
C8 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
C9 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPQEFALPCALE
C10 EHGYEIYNSQLPLHMSLAKLHDLPQAQFAEAAGLCHYFDPREFALPCALE
*******.********************:***********:*****.***
C1 VVKIGGGKVNGRSIPLARFPINNEFKFIPYLYQCV
C2 VVKIGGGKVNGRSIPLARFPINNEFKFIPYLYQCV
C3 VVKIGGGKVNGRSIPLARFPINNEFKFIPYLYQCV
C4 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCA
C5 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCA
C6 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCA
C7 VVKIGGGKVNGRSIPLARFPINNEFKFIPYLYQCV
C8 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCV
C9 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCV
C10 VVKIGGGKVNGRSIPLVRFPINNEFKFIPYLYQCV
****************.*****************.
-- Starting log on Wed Oct 26 23:28:49 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/B05f_NS3c_ABN10851_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/codeml,B05f_NS3c_ABN10851_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C1 855 sites
reading seq# 2 C2 855 sites
reading seq# 3 C3 855 sites
reading seq# 4 C4 855 sites
reading seq# 5 C5 855 sites
reading seq# 6 C6 855 sites
reading seq# 7 C7 855 sites
reading seq# 8 C8 855 sites
reading seq# 9 C9 855 sites
reading seq#10 C10 855 sitesns = 10 ls = 855
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Sites with gaps or missing data are removed.
51 ambiguity characters in seq. 4
3 ambiguity characters in seq. 5
3 ambiguity characters in seq. 6
18 sites are removed. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 26
Sequences read..
Counting site patterns.. 0:00
Compressing, 107 patterns at 267 / 267 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 107 patterns at 267 / 267 sites (100.0%), 0:00
Counting codons..
360 bytes for distance
104432 bytes for conP
9416 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 7, (((10, 9), (4, (5, 6))), 8)); MP score: 64
313296 bytes for conP, adjusted
0.045940 0.078951 0.081275 0.084426 0.065393 0.063992 0.072176 0.032205 0.104170 0.053839 0.046051 0.101946 0.045206 0.061270 0.105381 0.300000 0.664273 0.287783
ntime & nrate & np: 15 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.719098
np = 18
lnL0 = -1694.650639
Iterating by ming2
Initial: fx= 1694.650639
x= 0.04594 0.07895 0.08127 0.08443 0.06539 0.06399 0.07218 0.03221 0.10417 0.05384 0.04605 0.10195 0.04521 0.06127 0.10538 0.30000 0.66427 0.28778
1 h-m-p 0.0000 0.0002 953.7660 +++ 1577.549836 m 0.0002 24 | 0/18
2 h-m-p 0.0000 0.0000 8547.6416 ++ 1559.458039 m 0.0000 45 | 1/18
3 h-m-p 0.0000 0.0000 1404.1835 ++ 1559.185245 m 0.0000 66 | 2/18
4 h-m-p 0.0000 0.0000 31815.7295 ++ 1535.684412 m 0.0000 87 | 3/18
5 h-m-p 0.0000 0.0000 12480.2738 ++ 1516.524183 m 0.0000 108 | 4/18
6 h-m-p 0.0000 0.0000 1092.8814 ++ 1514.859370 m 0.0000 129 | 5/18
7 h-m-p 0.0000 0.0000 1107.3395 ++ 1513.449984 m 0.0000 150 | 6/18
8 h-m-p 0.0000 0.0002 376.4735 ++CCYCC 1506.111549 4 0.0002 180 | 6/18
9 h-m-p 0.0001 0.0003 183.5040 +YYYCCC 1503.410510 5 0.0002 209 | 6/18
10 h-m-p 0.0001 0.0006 341.1139 +YYYCCC 1495.785739 5 0.0004 238 | 6/18
11 h-m-p 0.0000 0.0002 985.8594 +CCCC 1486.880099 3 0.0002 266 | 6/18
12 h-m-p 0.0000 0.0002 209.5763 +CC 1486.075363 1 0.0001 290 | 6/18
13 h-m-p 0.0004 0.0027 54.6551 CCC 1485.300973 2 0.0005 315 | 6/18
14 h-m-p 0.0007 0.0163 39.1054 +CYC 1484.030533 2 0.0020 341 | 6/18
15 h-m-p 0.0030 0.0150 4.6235 YCCCC 1482.963690 4 0.0079 369 | 6/18
16 h-m-p 0.0052 0.0259 5.2717 ++ 1481.497905 m 0.0259 390 | 7/18
17 h-m-p 0.0067 0.0335 2.7064 +YYYCYCCC 1470.379708 7 0.0285 422 | 7/18
18 h-m-p 0.0159 0.0797 1.0610 +YYYCCC 1463.285829 5 0.0576 451 | 7/18
19 h-m-p 0.2155 4.9283 0.2839 +CCCC 1459.509533 3 0.8246 479 | 7/18
20 h-m-p 0.3568 1.7840 0.3308 +YCYCCC 1453.981462 5 1.0490 520 | 7/18
21 h-m-p 1.0346 5.5114 0.3354 CCCC 1451.097228 3 1.0986 558 | 7/18
22 h-m-p 1.4784 7.3920 0.2393 CCCC 1449.228198 3 1.3710 596 | 7/18
23 h-m-p 0.7363 3.6813 0.2519 YCCCC 1447.632788 4 1.5525 635 | 7/18
24 h-m-p 0.6099 3.0496 0.2229 CCCCC 1447.223420 4 0.8258 675 | 7/18
25 h-m-p 1.1206 8.0000 0.1643 C 1447.035143 0 1.1206 707 | 7/18
26 h-m-p 1.6000 8.0000 0.1121 CYC 1446.952233 2 1.8360 742 | 7/18
27 h-m-p 1.6000 8.0000 0.0387 CC 1446.927873 1 2.0879 776 | 7/18
28 h-m-p 1.6000 8.0000 0.0141 YCC 1446.896760 2 2.8442 811 | 7/18
29 h-m-p 1.6000 8.0000 0.0106 CCC 1446.876088 2 1.7840 847 | 7/18
30 h-m-p 1.6000 8.0000 0.0023 CC 1446.869056 1 2.2307 881 | 7/18
31 h-m-p 0.4341 8.0000 0.0119 +YC 1446.858592 1 3.9687 915 | 7/18
32 h-m-p 1.6000 8.0000 0.0155 CC 1446.849705 1 2.0683 949 | 7/18
33 h-m-p 1.6000 8.0000 0.0127 YC 1446.848837 1 1.0474 982 | 7/18
34 h-m-p 1.6000 8.0000 0.0015 C 1446.848820 0 1.3371 1014 | 7/18
35 h-m-p 1.6000 8.0000 0.0000 ++ 1446.848786 m 8.0000 1046 | 7/18
36 h-m-p 0.1750 8.0000 0.0014 +Y 1446.848778 0 1.2578 1079 | 7/18
37 h-m-p 1.6000 8.0000 0.0001 Y 1446.848778 0 1.0416 1111 | 7/18
38 h-m-p 1.6000 8.0000 0.0000 Y 1446.848778 0 1.6000 1143 | 7/18
39 h-m-p 1.6000 8.0000 0.0000 Y 1446.848778 0 0.4000 1175 | 7/18
40 h-m-p 0.3611 8.0000 0.0000 -Y 1446.848778 0 0.0226 1208 | 7/18
41 h-m-p 0.1394 8.0000 0.0000 Y 1446.848778 0 0.1394 1240 | 7/18
42 h-m-p 0.1342 8.0000 0.0000 --------C 1446.848778 0 0.0000 1280
Out..
lnL = -1446.848778
1281 lfun, 3843 eigenQcodon, 38430 P(t)
end of tree file.
Time used: 0:15
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 7, (((10, 9), (4, (5, 6))), 8)); MP score: 64
0.010048 0.040996 0.050890 0.055304 0.096390 0.100307 0.047466 0.023160 0.048777 0.090207 0.104349 0.013459 0.097037 0.056819 0.075735 3.196789 1.642205 0.233240 0.297213 1.360856
ntime & nrate & np: 15 3 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.247805
np = 20
lnL0 = -1603.200835
Iterating by ming2
Initial: fx= 1603.200835
x= 0.01005 0.04100 0.05089 0.05530 0.09639 0.10031 0.04747 0.02316 0.04878 0.09021 0.10435 0.01346 0.09704 0.05682 0.07574 3.19679 1.64221 0.23324 0.29721 1.36086
1 h-m-p 0.0000 0.0000 759.6616 ++ 1578.033690 m 0.0000 25 | 1/20
2 h-m-p 0.0000 0.0000 4589.3606 ++ 1519.928571 m 0.0000 48 | 2/20
3 h-m-p 0.0000 0.0000 95579.5665 ++ 1503.901895 m 0.0000 71 | 3/20
4 h-m-p 0.0000 0.0000 10153.7202 ++ 1497.731320 m 0.0000 94 | 4/20
5 h-m-p 0.0000 0.0000 886.9515 ++ 1494.942360 m 0.0000 117 | 5/20
6 h-m-p 0.0000 0.0000 1878.7886 ++ 1471.822095 m 0.0000 140 | 6/20
7 h-m-p 0.0001 0.0005 117.0421 YCYCCC 1469.977612 5 0.0002 171 | 6/20
8 h-m-p 0.0003 0.0013 41.5735 +YCYCCC 1468.360992 5 0.0007 203 | 6/20
9 h-m-p 0.0001 0.0003 106.9992 +YYCCC 1467.355230 4 0.0002 233 | 6/20
10 h-m-p 0.0003 0.0014 34.9915 YCCCC 1466.607408 4 0.0006 263 | 6/20
11 h-m-p 0.0001 0.0006 202.4149 +YYCCC 1464.048098 4 0.0003 293 | 6/20
12 h-m-p 0.0001 0.0007 128.7059 YCYCCC 1462.375732 5 0.0004 324 | 6/20
13 h-m-p 0.0017 0.0084 24.4210 ++ 1457.427154 m 0.0084 347 | 7/20
14 h-m-p 0.0063 0.0314 3.4197 +YYYCCC 1451.718488 5 0.0230 378 | 7/20
15 h-m-p 0.0219 4.5116 3.5834 +CCYC 1449.388610 3 0.0905 407 | 7/20
16 h-m-p 0.1245 0.6748 2.6053 +YCCCC 1446.622564 4 0.3915 438 | 7/20
17 h-m-p 0.5905 8.0000 1.7274 YCCC 1446.030251 3 0.2479 466 | 6/20
18 h-m-p 0.0025 0.0473 171.7685 CYC 1445.565692 2 0.0022 492 | 6/20
19 h-m-p 0.1791 3.1877 2.1083 +CCCC 1444.464587 3 0.6044 522 | 6/20
20 h-m-p 0.3111 1.5555 0.9538 YCCCC 1444.053285 4 0.6143 552 | 6/20
21 h-m-p 0.5126 2.5632 0.4214 CCCC 1443.797087 3 0.8695 595 | 6/20
22 h-m-p 0.6154 3.0772 0.4350 CCCC 1443.701370 3 0.6816 638 | 6/20
23 h-m-p 0.4856 8.0000 0.6106 YC 1443.593596 1 0.9695 676 | 6/20
24 h-m-p 1.6000 8.0000 0.2876 CYC 1443.525495 2 2.0511 716 | 6/20
25 h-m-p 1.6000 8.0000 0.1951 YCC 1443.507907 2 0.9499 756 | 6/20
26 h-m-p 1.6000 8.0000 0.0409 CC 1443.492960 1 1.7614 795 | 6/20
27 h-m-p 1.3603 8.0000 0.0529 CC 1443.481299 1 2.1747 834 | 6/20
28 h-m-p 0.8096 8.0000 0.1422 YC 1443.471905 1 1.8983 872 | 6/20
29 h-m-p 1.6000 8.0000 0.0525 +YC 1443.459393 1 4.2266 911 | 6/20
30 h-m-p 1.6000 8.0000 0.0391 CC 1443.452664 1 2.1690 950 | 6/20
31 h-m-p 1.4568 8.0000 0.0582 C 1443.451493 0 1.5793 987 | 6/20
32 h-m-p 1.6000 8.0000 0.0109 YC 1443.450712 1 3.3888 1025 | 6/20
33 h-m-p 1.2457 8.0000 0.0296 ++ 1443.445618 m 8.0000 1062 | 6/20
34 h-m-p 0.7027 8.0000 0.3375 CCCC 1443.441161 3 0.8880 1105 | 6/20
35 h-m-p 1.0325 8.0000 0.2903 YC 1443.429307 1 2.2838 1143 | 6/20
36 h-m-p 1.6000 8.0000 0.0713 CC 1443.419543 1 1.7847 1182 | 6/20
37 h-m-p 0.1758 4.1371 0.7242 CYC 1443.414456 2 0.3183 1222 | 6/20
38 h-m-p 1.6000 8.0000 0.1205 CCC 1443.410883 2 1.7855 1263 | 6/20
39 h-m-p 1.6000 8.0000 0.0514 YC 1443.409528 1 0.7531 1301 | 6/20
40 h-m-p 0.4688 8.0000 0.0826 +YY 1443.408161 1 1.5705 1340 | 6/20
41 h-m-p 1.6000 8.0000 0.0167 C 1443.408062 0 1.3832 1377 | 6/20
42 h-m-p 1.6000 8.0000 0.0124 C 1443.408051 0 1.4497 1414 | 6/20
43 h-m-p 1.6000 8.0000 0.0024 Y 1443.408050 0 0.9922 1451 | 6/20
44 h-m-p 1.6000 8.0000 0.0005 Y 1443.408050 0 1.0279 1488 | 6/20
45 h-m-p 1.6000 8.0000 0.0000 C 1443.408050 0 1.5955 1525 | 6/20
46 h-m-p 1.6000 8.0000 0.0000 Y 1443.408050 0 0.4000 1562 | 6/20
47 h-m-p 0.6849 8.0000 0.0000 ----------------.. | 6/20
48 h-m-p 0.0160 8.0000 0.0005 ------------- | 6/20
49 h-m-p 0.0160 8.0000 0.0005 -------------
Out..
lnL = -1443.408050
1710 lfun, 6840 eigenQcodon, 76950 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1449.788168 S = -1363.514161 -83.773711
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 107 patterns 0:44
did 20 / 107 patterns 0:44
did 30 / 107 patterns 0:44
did 40 / 107 patterns 0:44
did 50 / 107 patterns 0:45
did 60 / 107 patterns 0:45
did 70 / 107 patterns 0:45
did 80 / 107 patterns 0:45
did 90 / 107 patterns 0:45
did 100 / 107 patterns 0:45
did 107 / 107 patterns 0:45end of tree file.
Time used: 0:45
Model 7: beta
TREE # 1
(1, 2, 3, 7, (((10, 9), (4, (5, 6))), 8)); MP score: 64
0.042979 0.049190 0.029876 0.045922 0.036058 0.014888 0.087263 0.083503 0.077983 0.028179 0.045745 0.097020 0.100719 0.102255 0.037008 3.627874 1.045579 1.274206
ntime & nrate & np: 15 1 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 5.536828
np = 18
lnL0 = -1649.080179
Iterating by ming2
Initial: fx= 1649.080179
x= 0.04298 0.04919 0.02988 0.04592 0.03606 0.01489 0.08726 0.08350 0.07798 0.02818 0.04575 0.09702 0.10072 0.10225 0.03701 3.62787 1.04558 1.27421
1 h-m-p 0.0000 0.0001 1493.3023 ++ 1533.149448 m 0.0001 41 | 1/18
2 h-m-p 0.0000 0.0000 852.1700 ++ 1508.728824 m 0.0000 80 | 2/18
3 h-m-p 0.0000 0.0000 8933.7941 ++ 1504.374180 m 0.0000 118 | 3/18
4 h-m-p 0.0000 0.0000 8751.8859 ++ 1500.802634 m 0.0000 155 | 4/18
5 h-m-p 0.0000 0.0000 8600.7107 ++ 1462.725325 m 0.0000 191 | 5/18
6 h-m-p 0.0000 0.0000 1556.0561 ++ 1462.081255 m 0.0000 226 | 6/18
7 h-m-p 0.0000 0.0003 147.7511 ++YYCCC 1460.097318 4 0.0001 268 | 6/18
8 h-m-p 0.0001 0.0006 31.5306 YCYCCC 1459.277498 5 0.0003 309 | 6/18
9 h-m-p 0.0001 0.0004 90.8346 CYCCC 1458.433621 4 0.0001 349 | 6/18
10 h-m-p 0.0001 0.0006 49.2444 +YCYCCC 1456.875805 5 0.0003 391 | 6/18
11 h-m-p 0.0002 0.0010 27.1685 YCC 1456.842069 2 0.0001 427 | 6/18
12 h-m-p 0.0002 0.1110 10.7622 ++++YYYYYYC 1452.291569 6 0.0598 470 | 6/18
13 h-m-p 0.0280 0.1400 3.4170 YYCC 1452.066517 3 0.0206 507 | 6/18
14 h-m-p 0.1299 0.8312 0.5408 CCCC 1451.804100 3 0.2271 546 | 6/18
15 h-m-p 0.0415 0.5138 2.9580 +CYCCC 1450.770543 4 0.2641 587 | 6/18
16 h-m-p 0.0367 0.1836 5.0460 CYYCCC 1450.257942 5 0.0836 629 | 6/18
17 h-m-p 0.0366 0.1831 3.6747 +YYCYC 1449.546072 4 0.1226 668 | 6/18
18 h-m-p 0.0056 0.0282 9.2071 +YYYYYYYCCY 1448.395793 10 0.0234 714 | 6/18
19 h-m-p 0.0215 0.1077 0.7866 CYC 1448.353935 2 0.0228 750 | 6/18
20 h-m-p 0.0074 0.5842 2.4142 ++CCCCC 1447.410448 4 0.1948 793 | 6/18
21 h-m-p 0.8475 4.2375 0.0846 CYC 1447.236266 2 0.9647 829 | 6/18
22 h-m-p 0.7448 3.7239 0.0588 CC 1447.190522 1 1.1026 864 | 6/18
23 h-m-p 1.6000 8.0000 0.0182 CCC 1447.180170 2 2.7063 901 | 6/18
24 h-m-p 1.6000 8.0000 0.0218 YYY 1447.174050 2 1.6000 936 | 6/18
25 h-m-p 1.6000 8.0000 0.0110 CC 1447.172968 1 0.5890 971 | 6/18
26 h-m-p 0.7839 3.9195 0.0054 YY 1447.172870 1 0.4952 1005 | 6/18
27 h-m-p 0.0000 0.0001 134.5890 -Y 1447.172870 0 0.0000 1039 | 6/18
28 h-m-p 0.0160 8.0000 0.0263 Y 1447.172868 0 0.0113 1072 | 6/18
29 h-m-p 0.0005 0.0317 0.6071 Y 1447.172868 0 0.0001 1105 | 6/18
30 h-m-p 0.0004 0.1695 0.1202 ----Y 1447.172868 0 0.0000 1142 | 6/18
31 h-m-p 0.0160 8.0000 0.0135 C 1447.172866 0 0.0211 1175 | 6/18
32 h-m-p 0.0359 4.8522 0.0079 C 1447.172864 0 0.0430 1208 | 6/18
33 h-m-p 0.0978 8.0000 0.0035 --------------.. | 6/18
34 h-m-p 0.0001 0.0617 1.3758 C 1447.172828 0 0.0000 1286 | 6/18
35 h-m-p 0.0000 0.0028 3.0841 -Y 1447.172826 0 0.0000 1320 | 6/18
36 h-m-p 0.0001 0.0534 0.3622 Y 1447.172824 0 0.0001 1353 | 6/18
37 h-m-p 0.0001 0.0336 0.5417 Y 1447.172824 0 0.0000 1386 | 6/18
38 h-m-p 0.0000 0.0117 1.4353 +Y 1447.172824 0 0.0001 1420 | 6/18
39 h-m-p 0.0000 0.0003 61.1944 C 1447.172823 0 0.0000 1453 | 6/18
40 h-m-p 0.0000 0.0000 6787.7307 -----C 1447.172823 0 0.0000 1491 | 6/18
41 h-m-p 0.0000 0.0005 36.7081 -Y 1447.172823 0 0.0000 1525 | 6/18
42 h-m-p 0.0000 0.0010 17.5563 -Y 1447.172823 0 0.0000 1559 | 6/18
43 h-m-p 0.0000 0.0113 1.5879 ---Y 1447.172823 0 0.0000 1595 | 6/18
44 h-m-p 0.0001 0.0662 0.3557 --Y 1447.172823 0 0.0000 1630 | 6/18
45 h-m-p 0.0003 0.1518 0.1950 ----------.. | 6/18
46 h-m-p 0.0000 0.0040 1.0797 -Y 1447.172823 0 0.0000 1705 | 6/18
47 h-m-p 0.0001 0.0683 0.2569 Y 1447.172823 0 0.0001 1738 | 6/18
48 h-m-p 0.0000 0.0065 2.5106 C 1447.172823 0 0.0000 1771 | 6/18
49 h-m-p 0.0000 0.0001 116.1358 --Y 1447.172823 0 0.0000 1806 | 6/18
50 h-m-p 0.0000 0.0002 72.9607 -----Y 1447.172823 0 0.0000 1844 | 6/18
51 h-m-p 0.0000 0.0050 3.3734 -----C 1447.172823 0 0.0000 1882 | 6/18
52 h-m-p 0.0001 0.0375 0.5542 ---------.. | 6/18
53 h-m-p 0.0000 0.0042 1.0157 --Y 1447.172823 0 0.0000 1957 | 6/18
54 h-m-p 0.0001 0.0636 0.2543 C 1447.172823 0 0.0000 1990 | 6/18
55 h-m-p 0.0000 0.0024 6.8036 C 1447.172823 0 0.0000 2023 | 6/18
56 h-m-p 0.0000 0.0002 75.6718 -C 1447.172823 0 0.0000 2057 | 6/18
57 h-m-p 0.0000 0.0003 55.0391 -----C 1447.172823 0 0.0000 2095 | 6/18
58 h-m-p 0.0000 0.0045 3.7114 -C 1447.172823 0 0.0000 2129 | 6/18
59 h-m-p 0.0001 0.0375 0.5601 --C 1447.172823 0 0.0000 2164 | 6/18
60 h-m-p 0.0003 0.1346 0.2425 --C 1447.172823 0 0.0000 2199 | 6/18
61 h-m-p 0.0003 0.1547 0.2904 -C 1447.172823 0 0.0000 2233 | 6/18
62 h-m-p 0.0002 0.1060 0.3707 --C 1447.172823 0 0.0000 2268 | 6/18
63 h-m-p 0.0026 1.2933 0.0326 ------------.. | 6/18
64 h-m-p 0.0000 0.0042 1.0239 --Y 1447.172823 0 0.0000 2346 | 6/18
65 h-m-p 0.0001 0.0635 0.2531 C 1447.172823 0 0.0000 2379 | 6/18
66 h-m-p 0.0000 0.0006 25.4394 C 1447.172823 0 0.0000 2412 | 6/18
67 h-m-p 0.0000 0.0001 200.9740 --------.. | 6/18
68 h-m-p 0.0000 0.0041 1.0378 --Y 1447.172823 0 0.0000 2486 | 6/18
69 h-m-p 0.0001 0.0628 0.2563 Y 1447.172823 0 0.0001 2519 | 6/18
70 h-m-p 0.0000 0.0004 38.7686 -C 1447.172823 0 0.0000 2553 | 6/18
71 h-m-p 0.0000 0.0001 170.4861 --------.. | 6/18
72 h-m-p 0.0000 0.0041 1.0269 ---C 1447.172823 0 0.0000 2628 | 6/18
73 h-m-p 0.0001 0.0617 0.2580 Y 1447.172823 0 0.0001 2661 | 6/18
74 h-m-p 0.0000 0.0002 71.7614 -C 1447.172822 0 0.0000 2695 | 6/18
75 h-m-p 0.0000 0.0006 25.0180 ----Y 1447.172822 0 0.0000 2732 | 6/18
76 h-m-p 0.0000 0.0065 2.6178 -Y 1447.172822 0 0.0000 2766 | 6/18
77 h-m-p 0.0002 0.0990 0.2785 --C 1447.172822 0 0.0000 2801 | 6/18
78 h-m-p 0.0008 0.4243 0.0562 ----Y 1447.172822 0 0.0000 2838 | 6/18
79 h-m-p 0.0064 3.1816 0.0178 ------------.. | 6/18
80 h-m-p 0.0000 0.0040 1.0552 --Y 1447.172822 0 0.0000 2916 | 6/18
81 h-m-p 0.0001 0.0611 0.2616 Y 1447.172822 0 0.0001 2949 | 6/18
82 h-m-p 0.0000 0.0006 27.3187 -C 1447.172822 0 0.0000 2983 | 6/18
83 h-m-p 0.0000 0.0001 195.9966 --------.. | 6/18
84 h-m-p 0.0000 0.0040 1.0507 ---C 1447.172822 0 0.0000 3058 | 6/18
85 h-m-p 0.0001 0.0600 0.2630 Y 1447.172822 0 0.0001 3091 | 6/18
86 h-m-p 0.0000 0.0000 359.9578 ---Y 1447.172822 0 0.0000 3127 | 6/18
87 h-m-p 0.0000 0.0037 4.3910 -C 1447.172822 0 0.0000 3161 | 6/18
88 h-m-p 0.0001 0.0354 0.4691 --C 1447.172822 0 0.0000 3196 | 6/18
89 h-m-p 0.0011 0.5357 0.0737 --Y 1447.172822 0 0.0000 3231 | 6/18
90 h-m-p 0.0029 1.4580 0.0182 ---------Y 1447.172822 0 0.0000 3273 | 6/18
91 h-m-p 0.0024 1.1895 0.0248 ------C 1447.172822 0 0.0000 3312 | 6/18
92 h-m-p 0.0009 0.4289 0.0946 -----------.. | 6/18
93 h-m-p 0.0000 0.0040 1.0521 ---C 1447.172822 0 0.0000 3390 | 6/18
94 h-m-p 0.0001 0.0596 0.2659 Y 1447.172822 0 0.0001 3423 | 6/18
95 h-m-p 0.0000 0.0005 31.4899 -C 1447.172822 0 0.0000 3457 | 6/18
96 h-m-p 0.0000 0.0002 70.8603 -----Y 1447.172822 0 0.0000 3495 | 6/18
97 h-m-p 0.0000 0.0060 2.7333 --------.. | 6/18
98 h-m-p 0.0000 0.0039 1.0631 --------
Out..
lnL = -1447.172822
3574 lfun, 39314 eigenQcodon, 536100 P(t)
end of tree file.
Time used: 4:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 7, (((10, 9), (4, (5, 6))), 8)); MP score: 64
0.023488 0.036962 0.013963 0.050377 0.091721 0.064739 0.064833 0.067849 0.057309 0.096040 0.088370 0.059477 0.040900 0.108024 0.058551 3.110306 0.900000 0.649534 1.868470 1.300000
ntime & nrate & np: 15 2 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.952808
np = 20
lnL0 = -1585.973339
Iterating by ming2
Initial: fx= 1585.973339
x= 0.02349 0.03696 0.01396 0.05038 0.09172 0.06474 0.06483 0.06785 0.05731 0.09604 0.08837 0.05948 0.04090 0.10802 0.05855 3.11031 0.90000 0.64953 1.86847 1.30000
1 h-m-p 0.0000 0.0001 735.6055 ++ 1551.385018 m 0.0001 45 | 1/20
2 h-m-p 0.0000 0.0000 15688.9563 ++ 1531.708996 m 0.0000 88 | 2/20
3 h-m-p 0.0000 0.0000 15391.9550 ++ 1503.261633 m 0.0000 130 | 3/20
4 h-m-p 0.0000 0.0000 636.7956 ++ 1497.040904 m 0.0000 171 | 4/20
5 h-m-p 0.0000 0.0000 1719.2224 ++ 1489.928829 m 0.0000 211 | 5/20
6 h-m-p 0.0000 0.0001 1015.7283 ++ 1466.190241 m 0.0001 250 | 6/20
7 h-m-p 0.0001 0.0003 202.6518 +YYYCCC 1459.424171 5 0.0002 296 | 6/20
8 h-m-p 0.0000 0.0002 168.0691 +YYYCCC 1457.000011 5 0.0001 341 | 6/20
9 h-m-p 0.0001 0.0005 126.6697 +YCYCCC 1454.559483 5 0.0003 387 | 6/20
10 h-m-p 0.0000 0.0002 195.2401 YCCCC 1453.871967 4 0.0001 431 | 6/20
11 h-m-p 0.0000 0.0002 73.4418 CCCC 1453.794552 3 0.0000 474 | 6/20
12 h-m-p 0.0002 0.0054 16.6626 ++YCCC 1453.208450 3 0.0022 518 | 6/20
13 h-m-p 0.0001 0.0005 105.8792 YCCC 1452.886424 3 0.0002 560 | 6/20
14 h-m-p 0.0030 0.0702 7.0414 +YCCCC 1451.677588 4 0.0255 605 | 6/20
15 h-m-p 0.0078 0.0388 10.8909 YCYCCC 1450.792694 5 0.0187 650 | 6/20
16 h-m-p 0.1087 0.5434 1.7201 +
QuantileBeta(0.15, 0.00500, 2.38939) = 1.077254e-160 2000 rounds
YCCC 1446.957953 3 0.4708 693 | 6/20
17 h-m-p 0.0024 0.0118 7.2280 +
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
+ 1446.098131 m 0.0118 730
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37373) = 1.086051e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37347) = 1.086194e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37360) = 1.086122e-160 2000 rounds
| 7/20
18 h-m-p 0.0456 0.2678 1.7604
QuantileBeta(0.15, 0.00500, 2.36890) = 1.088789e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35481) = 1.096867e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36314) = 1.092079e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.36286) = 1.092239e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.35884) = 1.094548e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36213) = 1.092657e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.36048) = 1.093602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36207) = 1.092693e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.36128) = 1.093147e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
C 1445.490859 4 0.1121 774
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.130849e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36218) = 1.092631e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36192) = 1.092776e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36205) = 1.092704e-160 2000 rounds
| 7/20
19 h-m-p 0.2999 1.4995 0.3253
QuantileBeta(0.15, 0.00500, 2.32353) = 1.115233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20797) = 1.188693e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.31640) = 1.119506e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.26218) = 1.153074e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30450) = 1.126705e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.30351) = 1.127307e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.28285) = 1.140047e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30244) = 1.127959e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.29265) = 1.133971e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
C 1444.975409 4 0.4648 817
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.167396e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30247) = 1.127941e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30222) = 1.128093e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30235) = 1.128017e-160 2000 rounds
| 7/20
20 h-m-p 0.5889 5.6104 0.2567
QuantileBeta(0.15, 0.00500, 2.19613) = 1.196761e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20731) = 1.189136e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.25483) = 1.157779e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20249) = 1.192414e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
C 1444.898495 2 0.5537 856
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.234046e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20260) = 1.192336e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20236) = 1.192502e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20248) = 1.192419e-160 2000 rounds
| 7/20
21 h-m-p 1.0410 8.0000 0.1366 YCC 1444.838185 2 1.6531 895 | 7/20
22 h-m-p 1.6000 8.0000 0.0902 YC 1444.822024 1 0.9946 932 | 7/20
23 h-m-p 1.6000 8.0000 0.0201 CC 1444.820260 1 1.3143 970 | 6/20
24 h-m-p 0.8789 8.0000 0.0301 CCYC 1444.759028 3 1.1570 1011 | 6/20
25 h-m-p 0.0053 1.2379 6.6336 ---Y 1444.759024 0 0.0000 1051 | 6/20
26 h-m-p 0.0348 8.0000 0.0066 +++YC 1444.755456 1 4.1462 1092 | 6/20
27 h-m-p 1.6000 8.0000 0.0144 ++ 1444.716315 m 8.0000 1129 | 6/20
28 h-m-p 0.5138 8.0000 0.2235 +CYCYCC 1444.372123 5 3.7497 1175 | 6/20
29 h-m-p 0.3327 1.6634 0.9285 YCCCCC 1444.249714 5 0.4173 1221 | 6/20
30 h-m-p 0.6477 3.5397 0.5983 CYC 1443.994740 2 0.6150 1261 | 6/20
31 h-m-p 0.6978 3.4888 0.3483 C 1443.800525 0 0.6982 1298 | 6/20
32 h-m-p 0.4746 4.8872 0.5124 CCCC 1443.725896 3 0.8095 1341 | 6/20
33 h-m-p 1.2578 8.0000 0.3298 CCC 1443.609020 2 1.7459 1382 | 6/20
34 h-m-p 1.1810 8.0000 0.4876 CYCCC 1443.487693 4 1.7499 1426 | 6/20
35 h-m-p 1.6000 8.0000 0.3710 YC 1443.434311 1 0.8125 1464 | 6/20
36 h-m-p 0.5184 7.8874 0.5815 YCCC 1443.400713 3 1.0142 1506 | 6/20
37 h-m-p 1.6000 8.0000 0.3541 YCC 1443.389795 2 0.9042 1546 | 6/20
38 h-m-p 1.6000 8.0000 0.0968 YC 1443.387275 1 0.9035 1584 | 6/20
39 h-m-p 0.8871 8.0000 0.0986 C 1443.386833 0 0.8931 1621 | 6/20
40 h-m-p 1.6000 8.0000 0.0102 C 1443.386790 0 1.6948 1658 | 6/20
41 h-m-p 1.6000 8.0000 0.0057 ++ 1443.386661 m 8.0000 1695 | 6/20
42 h-m-p 1.6000 8.0000 0.0100 +YC 1443.386391 1 4.1048 1734 | 6/20
43 h-m-p 1.4334 8.0000 0.0288 YC 1443.386026 1 2.6374 1772 | 6/20
44 h-m-p 1.6000 8.0000 0.0129 Y 1443.385997 0 1.0443 1809 | 6/20
45 h-m-p 1.6000 8.0000 0.0048 Y 1443.385996 0 0.7570 1846 | 6/20
46 h-m-p 1.6000 8.0000 0.0002 Y 1443.385996 0 0.8781 1883 | 6/20
47 h-m-p 1.6000 8.0000 0.0000 C 1443.385996 0 0.4000 1920 | 6/20
48 h-m-p 0.7733 8.0000 0.0000 --Y 1443.385996 0 0.0121 1959 | 6/20
49 h-m-p 0.0160 8.0000 0.0004 ----C 1443.385996 0 0.0000 2000
Out..
lnL = -1443.385996
2001 lfun, 24012 eigenQcodon, 330165 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1448.786653 S = -1363.519797 -124.810853
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 107 patterns 6:17
did 20 / 107 patterns 6:17
did 30 / 107 patterns 6:17
did 40 / 107 patterns 6:17
did 50 / 107 patterns 6:17
did 60 / 107 patterns 6:18
did 70 / 107 patterns 6:18
did 80 / 107 patterns 6:18
did 90 / 107 patterns 6:18
did 100 / 107 patterns 6:18
did 107 / 107 patterns 6:18end of tree file.
Time used: 6:19
The loglikelihoods for models M1, M2, M7 and M8 are -1446.848778 -1443.408050 -1447.172822 -1443.385996 respectively
The loglikelihood for model M2a is significantly different from that for M1a. Twice the difference is 6.881456
The loglikelihood for model M8 is significantly different from that for M7. Twice the difference is 7.573652
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/B05f_NS3c_ABN10851_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 10 ls = 267
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 12 12 12 11 11 11 | Ser TCT 8 8 8 8 7 7 | Tyr TAT 9 9 9 7 8 8 | Cys TGT 5 5 5 4 4 4
TTC 2 2 2 2 2 2 | TCC 4 4 4 5 5 5 | TAC 2 2 2 1 1 1 | TGC 3 3 3 3 3 3
Leu TTA 12 12 12 13 13 13 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 7 7 7 9 9 9 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 8 8 8 8 8 8 | Pro CCT 11 11 11 9 9 9 | His CAT 7 7 7 9 10 10 | Arg CGT 2 2 2 2 2 2
CTC 3 3 3 4 4 4 | CCC 0 0 0 0 0 0 | CAC 2 2 2 1 1 1 | CGC 2 2 2 2 2 2
CTA 4 4 4 1 1 1 | CCA 7 7 7 9 9 9 | Gln CAA 5 5 5 5 5 5 | CGA 2 2 2 4 4 4
CTG 3 3 3 3 3 3 | CCG 1 1 1 0 0 0 | CAG 3 3 3 2 2 2 | CGG 1 1 1 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 4 4 4 6 6 6 | Asn AAT 9 9 9 8 8 8 | Ser AGT 2 2 2 4 4 4
ATC 1 1 1 2 2 2 | ACC 3 3 3 3 3 3 | AAC 2 2 2 1 1 1 | AGC 1 1 1 3 2 2
ATA 3 3 3 3 3 3 | ACA 3 3 3 3 3 3 | Lys AAA 14 14 14 14 14 14 | Arg AGA 3 3 3 2 2 2
Met ATG 6 6 6 6 7 7 | ACG 0 0 0 0 0 0 | AAG 7 7 7 6 6 6 | AGG 1 1 1 3 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 14 14 14 11 11 11 | Ala GCT 9 9 9 12 12 12 | Asp GAT 6 6 6 4 4 4 | Gly GGT 7 7 7 7 7 7
GTC 1 1 1 4 3 3 | GCC 2 2 2 0 0 0 | GAC 6 6 6 5 5 5 | GGC 2 2 2 2 2 2
GTA 3 3 3 2 2 2 | GCA 4 4 4 4 4 4 | Glu GAA 7 7 7 8 8 8 | GGA 1 1 1 1 1 1
GTG 3 3 3 2 3 3 | GCG 2 2 2 2 2 2 | GAG 6 6 6 7 7 7 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------------
Phe TTT 12 12 10 10 | Ser TCT 8 8 10 9 | Tyr TAT 9 9 8 8 | Cys TGT 5 5 3 4
TTC 2 2 4 3 | TCC 4 5 4 5 | TAC 2 1 1 1 | TGC 3 3 3 3
Leu TTA 12 12 13 13 | TCA 1 1 1 1 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 7 7 7 7 | TCG 1 2 2 2 | TAG 0 0 0 0 | Trp TGG 4 4 4 4
------------------------------------------------------------------------------------------------------
Leu CTT 8 8 9 10 | Pro CCT 11 11 11 10 | His CAT 7 7 8 8 | Arg CGT 2 2 2 2
CTC 3 3 2 2 | CCC 0 0 0 0 | CAC 2 2 2 2 | CGC 2 2 2 2
CTA 4 4 4 4 | CCA 7 7 7 7 | Gln CAA 5 5 6 5 | CGA 2 2 1 2
CTG 3 3 3 3 | CCG 1 0 0 0 | CAG 3 3 3 3 | CGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 | Thr ACT 4 5 4 4 | Asn AAT 9 9 9 9 | Ser AGT 2 1 2 2
ATC 1 1 0 0 | ACC 3 3 3 3 | AAC 2 2 2 2 | AGC 1 1 1 1
ATA 3 3 4 4 | ACA 3 3 3 3 | Lys AAA 14 14 14 14 | Arg AGA 3 3 3 3
Met ATG 6 6 6 6 | ACG 0 0 0 0 | AAG 7 7 7 7 | AGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Val GTT 14 14 14 14 | Ala GCT 9 9 9 9 | Asp GAT 6 6 7 7 | Gly GGT 7 7 5 6
GTC 1 3 2 2 | GCC 2 1 1 1 | GAC 6 6 6 6 | GGC 2 2 4 3
GTA 3 3 3 3 | GCA 4 4 4 4 | Glu GAA 7 7 7 6 | GGA 1 1 1 1
GTG 3 2 3 3 | GCG 2 2 2 2 | GAG 6 6 5 6 | GGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C1
position 1: T:0.26217 C:0.22846 A:0.23596 G:0.27341
position 2: T:0.32210 C:0.22472 A:0.31835 G:0.13483
position 3: T:0.43820 C:0.13483 A:0.25843 G:0.16854
Average T:0.34082 C:0.19600 A:0.27091 G:0.19226
#2: C2
position 1: T:0.26217 C:0.22846 A:0.23596 G:0.27341
position 2: T:0.32210 C:0.22472 A:0.31835 G:0.13483
position 3: T:0.43820 C:0.13483 A:0.25843 G:0.16854
Average T:0.34082 C:0.19600 A:0.27091 G:0.19226
#3: C3
position 1: T:0.26217 C:0.22846 A:0.23596 G:0.27341
position 2: T:0.32210 C:0.22472 A:0.31835 G:0.13483
position 3: T:0.43820 C:0.13483 A:0.25843 G:0.16854
Average T:0.34082 C:0.19600 A:0.27091 G:0.19226
#4: C4
position 1: T:0.25843 C:0.22097 A:0.25468 G:0.26592
position 2: T:0.31835 C:0.23596 A:0.29213 G:0.15356
position 3: T:0.42697 C:0.14232 A:0.26217 G:0.16854
Average T:0.33458 C:0.19975 A:0.26966 G:0.19600
#5: C5
position 1: T:0.25843 C:0.22472 A:0.25094 G:0.26592
position 2: T:0.32210 C:0.23221 A:0.29963 G:0.14607
position 3: T:0.43071 C:0.13483 A:0.26217 G:0.17228
Average T:0.33708 C:0.19725 A:0.27091 G:0.19476
#6: C6
position 1: T:0.25843 C:0.22472 A:0.25094 G:0.26592
position 2: T:0.32210 C:0.23221 A:0.29963 G:0.14607
position 3: T:0.43071 C:0.13483 A:0.26217 G:0.17228
Average T:0.33708 C:0.19725 A:0.27091 G:0.19476
#7: C7
position 1: T:0.26217 C:0.22846 A:0.23596 G:0.27341
position 2: T:0.32210 C:0.22472 A:0.31835 G:0.13483
position 3: T:0.43820 C:0.13483 A:0.25843 G:0.16854
Average T:0.34082 C:0.19600 A:0.27091 G:0.19226
#8: C8
position 1: T:0.26592 C:0.22472 A:0.23596 G:0.27341
position 2: T:0.32584 C:0.22846 A:0.31461 G:0.13109
position 3: T:0.43820 C:0.13858 A:0.25843 G:0.16479
Average T:0.34332 C:0.19725 A:0.26966 G:0.18976
#9: C9
position 1: T:0.26217 C:0.22846 A:0.23596 G:0.27341
position 2: T:0.32959 C:0.22846 A:0.31835 G:0.12360
position 3: T:0.43071 C:0.13858 A:0.26592 G:0.16479
Average T:0.34082 C:0.19850 A:0.27341 G:0.18727
#10: C10
position 1: T:0.26217 C:0.22846 A:0.23596 G:0.27341
position 2: T:0.32959 C:0.22472 A:0.31461 G:0.13109
position 3: T:0.43446 C:0.13483 A:0.26217 G:0.16854
Average T:0.34207 C:0.19600 A:0.27091 G:0.19101
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 113 | Ser S TCT 81 | Tyr Y TAT 84 | Cys C TGT 44
TTC 23 | TCC 45 | TAC 14 | TGC 30
Leu L TTA 125 | TCA 10 | *** * TAA 0 | *** * TGA 0
TTG 76 | TCG 13 | TAG 0 | Trp W TGG 40
------------------------------------------------------------------------------
Leu L CTT 83 | Pro P CCT 103 | His H CAT 80 | Arg R CGT 20
CTC 31 | CCC 0 | CAC 17 | CGC 20
CTA 31 | CCA 76 | Gln Q CAA 51 | CGA 25
CTG 30 | CCG 4 | CAG 27 | CGG 7
------------------------------------------------------------------------------
Ile I ATT 40 | Thr T ACT 47 | Asn N AAT 87 | Ser S AGT 25
ATC 11 | ACC 30 | AAC 17 | AGC 14
ATA 32 | ACA 30 | Lys K AAA 140 | Arg R AGA 27
Met M ATG 62 | ACG 0 | AAG 67 | AGG 14
------------------------------------------------------------------------------
Val V GTT 131 | Ala A GCT 99 | Asp D GAT 56 | Gly G GGT 67
GTC 21 | GCC 11 | GAC 57 | GGC 23
GTA 27 | GCA 40 | Glu E GAA 72 | GGA 10
GTG 28 | GCG 20 | GAG 62 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.26142 C:0.22659 A:0.24082 G:0.27116
position 2: T:0.32360 C:0.22809 A:0.31124 G:0.13708
position 3: T:0.43446 C:0.13633 A:0.26067 G:0.16854
Average T:0.33983 C:0.19700 A:0.27091 G:0.19226
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 7, (((10, 9), (4, (5, 6))), 8)); MP score: 64
lnL(ntime: 15 np: 18): -1446.848778 +0.000000
11..1 11..2 11..3 11..7 11..12 12..13 13..14 14..10 14..9 13..15 15..4 15..16 16..5 16..6 12..8
0.000004 0.000004 0.000004 0.000004 0.011722 0.011929 0.021332 0.007118 0.020649 0.212394 0.008441 0.016053 0.000004 0.000004 0.008178 3.196789 0.760416 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.317841
(1: 0.000004, 2: 0.000004, 3: 0.000004, 7: 0.000004, (((10: 0.007118, 9: 0.020649): 0.021332, (4: 0.008441, (5: 0.000004, 6: 0.000004): 0.016053): 0.212394): 0.011929, 8: 0.008178): 0.011722);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C7: 0.000004, (((C10: 0.007118, C9: 0.020649): 0.021332, (C4: 0.008441, (C5: 0.000004, C6: 0.000004): 0.016053): 0.212394): 0.011929, C8: 0.008178): 0.011722);
Detailed output identifying parameters
kappa (ts/tv) = 3.19679
MLEs of dN/dS (w) for site classes (K=2)
p: 0.76042 0.23958
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.000 615.2 185.8 0.2396 0.0000 0.0000 0.0 0.0
11..2 0.000 615.2 185.8 0.2396 0.0000 0.0000 0.0 0.0
11..3 0.000 615.2 185.8 0.2396 0.0000 0.0000 0.0 0.0
11..7 0.000 615.2 185.8 0.2396 0.0000 0.0000 0.0 0.0
11..12 0.012 615.2 185.8 0.2396 0.0023 0.0094 1.4 1.7
12..13 0.012 615.2 185.8 0.2396 0.0023 0.0096 1.4 1.8
13..14 0.021 615.2 185.8 0.2396 0.0041 0.0171 2.5 3.2
14..10 0.007 615.2 185.8 0.2396 0.0014 0.0057 0.8 1.1
14..9 0.021 615.2 185.8 0.2396 0.0040 0.0165 2.4 3.1
13..15 0.212 615.2 185.8 0.2396 0.0408 0.1702 25.1 31.6
15..4 0.008 615.2 185.8 0.2396 0.0016 0.0068 1.0 1.3
15..16 0.016 615.2 185.8 0.2396 0.0031 0.0129 1.9 2.4
16..5 0.000 615.2 185.8 0.2396 0.0000 0.0000 0.0 0.0
16..6 0.000 615.2 185.8 0.2396 0.0000 0.0000 0.0 0.0
12..8 0.008 615.2 185.8 0.2396 0.0016 0.0066 1.0 1.2
Time used: 0:15
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 7, (((10, 9), (4, (5, 6))), 8)); MP score: 64
check convergence..
lnL(ntime: 15 np: 20): -1443.408050 +0.000000
11..1 11..2 11..3 11..7 11..12 12..13 13..14 14..10 14..9 13..15 15..4 15..16 16..5 16..6 12..8
0.000004 0.000004 0.000004 0.000004 0.012159 0.011253 0.025930 0.006933 0.022683 0.246778 0.007057 0.019105 0.000004 0.000004 0.009047 3.627874 0.848510 0.115637 0.062687 7.161284
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.360968
(1: 0.000004, 2: 0.000004, 3: 0.000004, 7: 0.000004, (((10: 0.006933, 9: 0.022683): 0.025930, (4: 0.007057, (5: 0.000004, 6: 0.000004): 0.019105): 0.246778): 0.011253, 8: 0.009047): 0.012159);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C7: 0.000004, (((C10: 0.006933, C9: 0.022683): 0.025930, (C4: 0.007057, (C5: 0.000004, C6: 0.000004): 0.019105): 0.246778): 0.011253, C8: 0.009047): 0.012159);
Detailed output identifying parameters
kappa (ts/tv) = 3.62787
MLEs of dN/dS (w) for site classes (K=3)
p: 0.84851 0.11564 0.03585
w: 0.06269 1.00000 7.16128
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.000 612.2 188.8 0.4256 0.0000 0.0000 0.0 0.0
11..2 0.000 612.2 188.8 0.4256 0.0000 0.0000 0.0 0.0
11..3 0.000 612.2 188.8 0.4256 0.0000 0.0000 0.0 0.0
11..7 0.000 612.2 188.8 0.4256 0.0000 0.0000 0.0 0.0
11..12 0.012 612.2 188.8 0.4256 0.0031 0.0072 1.9 1.4
12..13 0.011 612.2 188.8 0.4256 0.0028 0.0067 1.7 1.3
13..14 0.026 612.2 188.8 0.4256 0.0066 0.0154 4.0 2.9
14..10 0.007 612.2 188.8 0.4256 0.0018 0.0041 1.1 0.8
14..9 0.023 612.2 188.8 0.4256 0.0057 0.0135 3.5 2.5
13..15 0.247 612.2 188.8 0.4256 0.0624 0.1466 38.2 27.7
15..4 0.007 612.2 188.8 0.4256 0.0018 0.0042 1.1 0.8
15..16 0.019 612.2 188.8 0.4256 0.0048 0.0114 3.0 2.1
16..5 0.000 612.2 188.8 0.4256 0.0000 0.0000 0.0 0.0
16..6 0.000 612.2 188.8 0.4256 0.0000 0.0000 0.0 0.0
12..8 0.009 612.2 188.8 0.4256 0.0023 0.0054 1.4 1.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
8 N 0.863 6.314
10 K 0.741 5.556
25 L 0.784 5.823
26 P 0.972* 6.989
27 P 0.945 6.820
132 C 0.733 5.506
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
8 N 0.864 6.103 +- 2.910
10 K 0.758 5.389 +- 3.189
25 L 0.796 5.667 +- 3.122
26 P 0.968* 6.697 +- 2.420
27 P 0.938 6.547 +- 2.584
132 C 0.749 5.353 +- 3.219
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.694 0.296 0.010 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.007 0.034 0.072 0.113 0.141 0.151 0.146 0.132 0.112 0.092
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.080
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.054 0.388
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.025 0.199 0.247
sum of density on p0-p1 = 1.000000
Time used: 0:45
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 7, (((10, 9), (4, (5, 6))), 8)); MP score: 64
check convergence..
lnL(ntime: 15 np: 18): -1447.172822 +0.000000
11..1 11..2 11..3 11..7 11..12 12..13 13..14 14..10 14..9 13..15 15..4 15..16 16..5 16..6 12..8
0.000004 0.000004 0.000004 0.000004 0.011548 0.011790 0.020986 0.007001 0.020341 0.209810 0.008298 0.015830 0.000004 0.000004 0.008049 3.110306 0.009178 0.030236
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.313676
(1: 0.000004, 2: 0.000004, 3: 0.000004, 7: 0.000004, (((10: 0.007001, 9: 0.020341): 0.020986, (4: 0.008298, (5: 0.000004, 6: 0.000004): 0.015830): 0.209810): 0.011790, 8: 0.008049): 0.011548);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C7: 0.000004, (((C10: 0.007001, C9: 0.020341): 0.020986, (C4: 0.008298, (C5: 0.000004, C6: 0.000004): 0.015830): 0.209810): 0.011790, C8: 0.008049): 0.011548);
Detailed output identifying parameters
kappa (ts/tv) = 3.11031
Parameters in M7 (beta):
p = 0.00918 q = 0.03024
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.07531 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.000 615.9 185.1 0.2075 0.0000 0.0000 0.0 0.0
11..2 0.000 615.9 185.1 0.2075 0.0000 0.0000 0.0 0.0
11..3 0.000 615.9 185.1 0.2075 0.0000 0.0000 0.0 0.0
11..7 0.000 615.9 185.1 0.2075 0.0000 0.0000 0.0 0.0
11..12 0.012 615.9 185.1 0.2075 0.0020 0.0099 1.3 1.8
12..13 0.012 615.9 185.1 0.2075 0.0021 0.0101 1.3 1.9
13..14 0.021 615.9 185.1 0.2075 0.0037 0.0179 2.3 3.3
14..10 0.007 615.9 185.1 0.2075 0.0012 0.0060 0.8 1.1
14..9 0.020 615.9 185.1 0.2075 0.0036 0.0174 2.2 3.2
13..15 0.210 615.9 185.1 0.2075 0.0371 0.1790 22.9 33.1
15..4 0.008 615.9 185.1 0.2075 0.0015 0.0071 0.9 1.3
15..16 0.016 615.9 185.1 0.2075 0.0028 0.0135 1.7 2.5
16..5 0.000 615.9 185.1 0.2075 0.0000 0.0000 0.0 0.0
16..6 0.000 615.9 185.1 0.2075 0.0000 0.0000 0.0 0.0
12..8 0.008 615.9 185.1 0.2075 0.0014 0.0069 0.9 1.3
Time used: 4:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 7, (((10, 9), (4, (5, 6))), 8)); MP score: 64
lnL(ntime: 15 np: 20): -1443.385996 +0.000000
11..1 11..2 11..3 11..7 11..12 12..13 13..14 14..10 14..9 13..15 15..4 15..16 16..5 16..6 12..8
0.000004 0.000004 0.000004 0.000004 0.012164 0.011256 0.025954 0.006935 0.022695 0.246902 0.007031 0.019128 0.000004 0.000004 0.009052 3.625084 0.962884 0.154108 0.755815 7.076028
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.361141
(1: 0.000004, 2: 0.000004, 3: 0.000004, 7: 0.000004, (((10: 0.006935, 9: 0.022695): 0.025954, (4: 0.007031, (5: 0.000004, 6: 0.000004): 0.019128): 0.246902): 0.011256, 8: 0.009052): 0.012164);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C7: 0.000004, (((C10: 0.006935, C9: 0.022695): 0.025954, (C4: 0.007031, (C5: 0.000004, C6: 0.000004): 0.019128): 0.246902): 0.011256, C8: 0.009052): 0.012164);
Detailed output identifying parameters
kappa (ts/tv) = 3.62508
Parameters in M8 (beta&w>1):
p0 = 0.96288 p = 0.15411 q = 0.75581
(p1 = 0.03712) w = 7.07603
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09629 0.09629 0.09629 0.09629 0.09629 0.09629 0.09629 0.09629 0.09629 0.09629 0.03712
w: 0.00000 0.00001 0.00019 0.00170 0.00868 0.03176 0.09265 0.22715 0.47732 0.84302 7.07603
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.000 612.2 188.8 0.4246 0.0000 0.0000 0.0 0.0
11..2 0.000 612.2 188.8 0.4246 0.0000 0.0000 0.0 0.0
11..3 0.000 612.2 188.8 0.4246 0.0000 0.0000 0.0 0.0
11..7 0.000 612.2 188.8 0.4246 0.0000 0.0000 0.0 0.0
11..12 0.012 612.2 188.8 0.4246 0.0031 0.0072 1.9 1.4
12..13 0.011 612.2 188.8 0.4246 0.0028 0.0067 1.7 1.3
13..14 0.026 612.2 188.8 0.4246 0.0066 0.0154 4.0 2.9
14..10 0.007 612.2 188.8 0.4246 0.0018 0.0041 1.1 0.8
14..9 0.023 612.2 188.8 0.4246 0.0057 0.0135 3.5 2.5
13..15 0.247 612.2 188.8 0.4246 0.0624 0.1469 38.2 27.7
15..4 0.007 612.2 188.8 0.4246 0.0018 0.0042 1.1 0.8
15..16 0.019 612.2 188.8 0.4246 0.0048 0.0114 3.0 2.1
16..5 0.000 612.2 188.8 0.4246 0.0000 0.0000 0.0 0.0
16..6 0.000 612.2 188.8 0.4246 0.0000 0.0000 0.0 0.0
12..8 0.009 612.2 188.8 0.4246 0.0023 0.0054 1.4 1.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
8 N 0.885 6.345
10 K 0.771 5.621
25 L 0.810 5.863
26 P 0.983* 6.970
27 P 0.958* 6.810
132 C 0.759 5.538
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
8 N 0.928 6.134 +- 2.459
10 K 0.864 5.725 +- 2.747
21 D 0.536 3.555 +- 3.094
25 L 0.885 5.872 +- 2.670
26 P 0.989* 6.463 +- 2.083
27 P 0.971* 6.376 +- 2.204
132 C 0.853 5.670 +- 2.797
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.017 0.983
p : 0.599 0.343 0.054 0.005 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.008 0.070 0.107 0.111 0.112 0.122 0.138 0.157 0.176
ws: 0.005 0.023 0.071 0.144 0.185 0.181 0.149 0.111 0.078 0.053
Time used: 6:19