--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken.
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -702.76 -716.40
2 -702.66 -716.61
--------------------------------------
TOTAL -702.71 -716.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.137393 0.000841 0.087589 0.194158 0.133804 1307.60 1308.66 1.000
r(A<->C){all} 0.142286 0.002998 0.044625 0.249193 0.137594 430.20 562.85 1.003
r(A<->G){all} 0.210637 0.004747 0.076129 0.340388 0.207005 245.15 412.78 1.000
r(A<->T){all} 0.028591 0.000523 0.000004 0.073265 0.023683 694.86 826.32 1.000
r(C<->G){all} 0.148601 0.004434 0.033493 0.285143 0.140371 434.30 500.51 1.000
r(C<->T){all} 0.387468 0.006249 0.239433 0.543175 0.385884 596.50 648.24 1.002
r(G<->T){all} 0.082417 0.002116 0.004493 0.169092 0.075106 474.85 475.02 1.000
pi(A){all} 0.294301 0.000559 0.249635 0.342100 0.293692 1185.29 1301.92 1.000
pi(C){all} 0.221310 0.000426 0.182477 0.262909 0.220691 1085.78 1217.21 1.000
pi(G){all} 0.189537 0.000415 0.153118 0.231896 0.188226 1291.42 1296.07 1.000
pi(T){all} 0.294852 0.000519 0.251185 0.341108 0.294366 1040.47 1197.48 1.000
alpha{1,2} 0.489825 0.397422 0.000011 1.774339 0.259484 1180.05 1220.48 1.000
alpha{3} 1.666101 1.300541 0.167183 4.075566 1.402344 1232.98 1312.37 1.000
pinvar{all} 0.302286 0.031765 0.000090 0.614808 0.292308 874.34 946.77 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
Model 1: NearlyNeutral -666.392173
Model 2: PositiveSelection -663.682896
Model 7: beta -666.435186
Model 8: beta&w>1 -663.682897
Model 2 vs 1 5.418554
Model 8 vs 7 5.504578
-- Starting log on Wed Oct 26 22:52:39 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=10, Len=119
C1 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C2 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C3 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C5 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C6 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C7 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C8 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C9 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C10 MDYVSLLNQFWQKQIKFYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
**************** ****.****************************
C1 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C2 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C3 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C4 TIKFYEYSAQATECTKALAKQDAARIICQQLQAAGLLNGMELQFRSCFAD
C5 TIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFAD
C6 TIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFAD
C7 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C8 TIKFYEYSAQATECTKASAKQDAARLICQQLQAAGLLNGMELRFRSSAFD
C9 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFD
C10 TIKLYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFD
***:************* *******:** *:**********:***. *
C1 IFGQNRYDASKSYFFSKTA
C2 IFGQNRYDASKSYFFSKTA
C3 IFGQNRYDASKSYFFSKTA
C4 IFGKNRYDASKSYFFSKTT
C5 IFGKNRYDASKSYFFSKTT
C6 IFGKNRYDASKSYFFSKTT
C7 IFGQNRYDASKSYFFSKTA
C8 IFGQNRYDASKSYFFSKTA
C9 IFGQNRYDASKSYFFSKTA
C10 IFGQNRYDASKSYFFSKTA
***:**************:
-- Starting log on Wed Oct 26 22:53:26 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.08 sec, SCORE=997, Nseq=10, Len=119
C1 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C2 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C3 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C5 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C6 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C7 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C8 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C9 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C10 MDYVSLLNQFWQKQIKFYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
**************** ****.****************************
C1 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C2 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C3 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C4 TIKFYEYSAQATECTKALAKQDAARIICQQLQAAGLLNGMELQFRSCFAD
C5 TIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFAD
C6 TIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFAD
C7 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C8 TIKFYEYSAQATECTKASAKQDAARLICQQLQAAGLLNGMELRFRSSAFD
C9 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFD
C10 TIKLYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFD
***:************* *******:** *:**********:***. *
C1 IFGQNRYDASKSYFFSKTA
C2 IFGQNRYDASKSYFFSKTA
C3 IFGQNRYDASKSYFFSKTA
C4 IFGKNRYDASKSYFFSKTT
C5 IFGKNRYDASKSYFFSKTT
C6 IFGKNRYDASKSYFFSKTT
C7 IFGQNRYDASKSYFFSKTA
C8 IFGQNRYDASKSYFFSKTA
C9 IFGQNRYDASKSYFFSKTA
C10 IFGQNRYDASKSYFFSKTA
***:**************:
-- Starting log on Wed Oct 26 23:09:26 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/gapped_alignment/codeml,B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 10 taxa and 357 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C10
Taxon 3 -> C2
Taxon 4 -> C3
Taxon 5 -> C4
Taxon 6 -> C5
Taxon 7 -> C6
Taxon 8 -> C7
Taxon 9 -> C8
Taxon 10 -> C9
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666825771
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1523828466
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1177256039
Seed = 1094462227
Swapseed = 1666825771
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 11 unique site patterns
Division 2 has 12 unique site patterns
Division 3 has 16 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1029.572669 -- 35.653401
Chain 2 -- -1060.000171 -- 35.653401
Chain 3 -- -1084.816655 -- 35.653401
Chain 4 -- -1042.410457 -- 35.653401
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1083.669886 -- 35.653401
Chain 2 -- -1088.503549 -- 35.653401
Chain 3 -- -1077.851838 -- 35.653401
Chain 4 -- -1063.152777 -- 35.653401
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1029.573] (-1060.000) (-1084.817) (-1042.410) * [-1083.670] (-1088.504) (-1077.852) (-1063.153)
1000 -- [-718.348] (-720.619) (-714.389) (-717.695) * (-724.029) (-727.649) [-712.124] (-724.920) -- 0:00:00
2000 -- (-718.643) (-730.530) [-707.721] (-714.736) * (-717.554) (-726.790) (-712.730) [-709.545] -- 0:08:19
3000 -- (-719.690) (-716.843) [-709.492] (-732.018) * (-716.894) [-714.762] (-716.778) (-709.458) -- 0:05:32
4000 -- [-709.919] (-714.528) (-713.883) (-728.716) * (-722.781) (-729.803) (-711.218) [-701.980] -- 0:04:09
5000 -- (-727.053) [-708.946] (-710.509) (-716.633) * (-715.157) [-717.583] (-707.694) (-712.838) -- 0:03:19
Average standard deviation of split frequencies: 0.073946
6000 -- [-703.634] (-712.700) (-710.209) (-715.873) * (-718.761) [-717.371] (-714.409) (-707.397) -- 0:05:31
7000 -- [-705.960] (-707.100) (-713.500) (-708.965) * [-715.313] (-723.850) (-708.845) (-706.311) -- 0:04:43
8000 -- (-712.402) [-705.290] (-716.314) (-711.258) * (-717.064) (-720.389) [-710.075] (-709.519) -- 0:04:08
9000 -- (-710.735) (-711.052) [-706.800] (-707.520) * (-726.367) (-714.929) [-706.081] (-708.644) -- 0:03:40
10000 -- (-705.742) (-724.551) (-711.063) [-707.137] * (-711.176) (-720.217) (-713.007) [-704.261] -- 0:03:18
Average standard deviation of split frequencies: 0.080102
11000 -- (-711.345) (-714.156) (-705.912) [-699.726] * [-714.725] (-714.240) (-707.495) (-708.899) -- 0:04:29
12000 -- (-709.756) (-711.310) [-699.039] (-708.431) * [-716.056] (-709.245) (-717.344) (-705.142) -- 0:04:07
13000 -- (-710.321) (-715.679) [-704.648] (-709.748) * (-714.915) (-711.733) (-703.908) [-705.364] -- 0:03:47
14000 -- [-712.955] (-715.521) (-704.469) (-707.551) * [-713.209] (-708.606) (-710.572) (-705.942) -- 0:03:31
15000 -- (-711.863) (-709.217) [-703.178] (-704.389) * [-706.744] (-708.823) (-707.825) (-709.295) -- 0:04:22
Average standard deviation of split frequencies: 0.041248
16000 -- [-705.343] (-712.733) (-708.717) (-705.047) * (-709.327) [-704.324] (-720.122) (-712.399) -- 0:04:06
17000 -- [-708.304] (-716.919) (-710.647) (-708.100) * (-718.795) (-707.885) [-713.249] (-712.177) -- 0:03:51
18000 -- (-703.847) [-710.235] (-720.029) (-712.983) * (-713.609) [-704.992] (-707.558) (-707.205) -- 0:03:38
19000 -- (-710.103) (-707.659) (-713.133) [-701.190] * (-718.214) [-705.203] (-712.668) (-706.503) -- 0:04:18
20000 -- (-709.168) (-702.739) [-704.976] (-715.966) * [-708.712] (-710.183) (-710.828) (-705.431) -- 0:04:05
Average standard deviation of split frequencies: 0.021289
21000 -- (-709.741) (-704.539) [-704.818] (-705.460) * (-712.650) [-711.772] (-702.988) (-707.040) -- 0:03:53
22000 -- (-711.044) (-706.305) (-706.053) [-708.761] * (-717.742) (-708.015) [-705.824] (-710.313) -- 0:03:42
23000 -- (-712.829) [-706.392] (-719.631) (-719.972) * (-708.863) [-712.106] (-707.243) (-712.722) -- 0:03:32
24000 -- (-705.842) [-703.695] (-718.271) (-701.056) * (-708.331) (-707.408) (-713.486) [-710.448] -- 0:04:04
25000 -- (-711.726) [-708.477] (-709.466) (-718.444) * (-704.735) (-706.269) [-708.659] (-715.572) -- 0:03:54
Average standard deviation of split frequencies: 0.038679
26000 -- [-705.717] (-710.247) (-708.427) (-712.597) * [-715.617] (-705.783) (-709.664) (-709.045) -- 0:03:44
27000 -- (-711.695) (-708.349) [-704.373] (-719.978) * (-706.155) [-712.233] (-712.056) (-709.809) -- 0:03:36
28000 -- (-716.466) (-708.762) (-715.046) [-717.719] * (-705.912) [-706.566] (-717.114) (-713.614) -- 0:04:03
29000 -- [-720.484] (-714.895) (-703.250) (-713.577) * (-717.379) [-700.924] (-715.285) (-706.106) -- 0:03:54
30000 -- (-717.372) (-707.114) (-706.395) [-707.813] * (-708.573) (-707.129) [-706.215] (-704.879) -- 0:03:46
Average standard deviation of split frequencies: 0.036893
31000 -- (-723.807) (-709.193) (-705.781) [-705.116] * (-702.595) [-706.314] (-706.966) (-703.924) -- 0:03:38
32000 -- (-710.582) (-710.398) [-713.351] (-702.491) * (-713.038) (-707.244) [-713.394] (-708.708) -- 0:04:02
33000 -- (-706.589) (-719.129) (-703.617) [-707.368] * (-709.422) [-708.248] (-711.566) (-708.130) -- 0:03:54
34000 -- (-707.904) [-710.939] (-709.468) (-712.011) * (-718.295) (-708.305) (-706.960) [-710.737] -- 0:03:47
35000 -- (-710.715) [-705.973] (-706.762) (-719.599) * (-720.671) (-714.808) (-710.225) [-705.081] -- 0:03:40
Average standard deviation of split frequencies: 0.022697
36000 -- (-713.153) [-708.814] (-707.570) (-711.462) * [-700.623] (-709.808) (-710.223) (-707.036) -- 0:03:34
37000 -- (-715.863) (-718.849) (-704.694) [-704.925] * (-710.078) (-712.425) (-714.041) [-708.533] -- 0:03:54
38000 -- (-709.410) (-713.909) (-705.262) [-709.703] * (-709.096) (-705.145) [-712.776] (-719.905) -- 0:03:47
39000 -- (-705.972) (-717.178) (-704.406) [-705.230] * (-707.490) [-708.964] (-723.769) (-712.789) -- 0:03:41
40000 -- (-702.589) (-722.601) (-702.031) [-710.597] * (-712.010) [-708.744] (-711.294) (-712.370) -- 0:03:36
Average standard deviation of split frequencies: 0.015456
41000 -- [-706.557] (-722.751) (-702.811) (-713.695) * (-713.821) (-710.209) [-705.192] (-707.640) -- 0:03:53
42000 -- (-708.505) (-719.589) [-702.262] (-709.837) * (-707.232) (-716.882) [-704.165] (-709.815) -- 0:03:48
43000 -- (-712.716) (-715.863) (-715.145) [-698.875] * (-710.906) [-699.992] (-713.149) (-714.040) -- 0:03:42
44000 -- [-709.841] (-712.967) (-710.324) (-708.917) * (-705.721) (-708.856) (-699.820) [-708.671] -- 0:03:37
45000 -- [-705.176] (-717.339) (-708.298) (-714.307) * [-712.211] (-707.926) (-707.347) (-716.117) -- 0:03:53
Average standard deviation of split frequencies: 0.020496
46000 -- (-716.692) (-717.122) [-704.255] (-710.627) * (-714.728) (-711.872) [-707.921] (-717.827) -- 0:03:48
47000 -- (-716.770) (-714.779) (-700.470) [-708.234] * (-712.261) (-710.908) [-704.974] (-714.201) -- 0:03:43
48000 -- (-704.717) (-718.513) [-704.623] (-709.412) * [-711.338] (-704.123) (-715.225) (-708.709) -- 0:03:38
49000 -- [-714.477] (-720.437) (-706.847) (-710.086) * (-712.452) (-712.827) [-704.844] (-710.800) -- 0:03:33
50000 -- (-708.331) [-703.502] (-722.515) (-719.876) * (-709.678) (-708.769) [-710.034] (-726.125) -- 0:03:48
Average standard deviation of split frequencies: 0.018608
51000 -- (-712.357) [-707.990] (-714.061) (-707.673) * (-708.059) [-707.704] (-710.590) (-709.999) -- 0:03:43
52000 -- [-715.524] (-708.206) (-706.237) (-716.412) * (-715.104) [-717.183] (-711.178) (-709.973) -- 0:03:38
53000 -- [-710.853] (-714.692) (-708.463) (-717.713) * (-708.414) (-708.917) (-713.640) [-711.405] -- 0:03:34
54000 -- (-720.318) [-708.749] (-710.040) (-708.456) * (-722.441) [-706.897] (-720.744) (-724.160) -- 0:03:47
55000 -- [-701.492] (-707.312) (-712.938) (-709.021) * (-706.287) [-710.935] (-716.312) (-717.877) -- 0:03:43
Average standard deviation of split frequencies: 0.016275
56000 -- (-703.730) (-712.142) (-707.056) [-717.314] * (-708.165) (-709.765) [-713.872] (-717.093) -- 0:03:39
57000 -- (-704.208) [-704.851] (-710.392) (-710.172) * (-707.438) (-708.412) (-704.531) [-711.146] -- 0:03:35
58000 -- (-702.447) [-704.042] (-709.498) (-703.352) * [-710.410] (-710.815) (-711.212) (-716.175) -- 0:03:47
59000 -- (-705.763) (-705.770) [-706.969] (-715.941) * [-715.336] (-711.770) (-717.565) (-719.753) -- 0:03:43
60000 -- (-712.103) [-702.555] (-706.795) (-709.648) * (-706.842) (-708.672) [-706.900] (-705.129) -- 0:03:39
Average standard deviation of split frequencies: 0.010879
61000 -- (-707.784) [-698.726] (-709.730) (-702.912) * (-704.106) (-724.175) (-712.710) [-708.811] -- 0:03:50
62000 -- (-717.061) (-707.987) [-708.894] (-708.381) * (-709.727) (-703.397) (-714.397) [-707.780] -- 0:03:46
63000 -- [-700.835] (-708.731) (-709.781) (-706.160) * (-710.088) (-708.415) (-719.443) [-709.252] -- 0:03:43
64000 -- [-700.581] (-710.425) (-709.129) (-703.855) * (-712.483) (-710.871) (-704.782) [-703.170] -- 0:03:39
65000 -- [-700.775] (-710.028) (-705.209) (-710.281) * (-721.334) (-716.961) (-705.071) [-706.771] -- 0:03:35
Average standard deviation of split frequencies: 0.014761
66000 -- (-710.885) (-723.590) (-726.878) [-703.748] * (-713.145) (-717.671) [-720.710] (-711.856) -- 0:03:46
67000 -- (-708.371) (-707.707) (-713.130) [-706.093] * (-703.390) (-718.600) [-704.406] (-711.942) -- 0:03:42
68000 -- (-703.793) (-708.669) [-709.042] (-713.491) * (-709.195) (-713.359) [-716.395] (-712.007) -- 0:03:39
69000 -- (-715.845) (-704.599) (-717.126) [-710.951] * (-707.722) (-719.006) [-706.573] (-709.723) -- 0:03:35
70000 -- [-706.959] (-705.987) (-712.732) (-715.471) * (-703.517) [-704.486] (-712.170) (-710.477) -- 0:03:45
Average standard deviation of split frequencies: 0.016010
71000 -- (-710.395) (-704.054) [-708.049] (-722.286) * [-706.470] (-710.803) (-708.624) (-711.043) -- 0:03:42
72000 -- (-711.738) [-706.177] (-709.124) (-706.857) * [-700.767] (-711.448) (-713.532) (-715.401) -- 0:03:39
73000 -- (-713.989) [-710.161] (-721.289) (-702.173) * (-708.568) [-713.036] (-721.773) (-713.606) -- 0:03:35
74000 -- (-723.927) [-707.611] (-719.341) (-708.944) * [-715.044] (-712.243) (-704.791) (-708.172) -- 0:03:45
75000 -- [-709.661] (-711.132) (-713.139) (-709.513) * (-710.217) (-710.408) [-712.436] (-726.415) -- 0:03:42
Average standard deviation of split frequencies: 0.016954
76000 -- (-721.761) (-702.118) (-706.792) [-702.046] * (-711.307) (-713.317) [-706.853] (-711.090) -- 0:03:38
77000 -- (-710.020) [-708.467] (-716.780) (-708.118) * (-707.251) [-709.910] (-713.547) (-714.118) -- 0:03:35
78000 -- (-719.372) (-704.586) [-707.008] (-714.484) * (-714.256) [-705.089] (-715.775) (-724.994) -- 0:03:44
79000 -- (-712.200) [-709.657] (-710.635) (-711.077) * (-708.240) (-712.983) [-704.008] (-708.007) -- 0:03:41
80000 -- [-709.703] (-711.163) (-703.401) (-713.737) * [-712.284] (-720.581) (-706.266) (-715.467) -- 0:03:38
Average standard deviation of split frequencies: 0.015194
81000 -- (-712.229) (-708.739) (-707.123) [-709.646] * (-716.092) (-721.257) [-714.863] (-704.591) -- 0:03:35
82000 -- (-716.491) [-706.262] (-709.622) (-706.947) * (-712.635) [-711.386] (-707.650) (-709.410) -- 0:03:32
83000 -- [-708.195] (-707.689) (-709.888) (-702.432) * (-714.960) (-713.164) [-703.681] (-719.497) -- 0:03:40
84000 -- (-704.325) (-711.799) (-712.116) [-708.250] * (-704.906) (-715.413) (-710.512) [-706.190] -- 0:03:38
85000 -- (-705.559) [-704.737] (-720.400) (-714.721) * (-707.773) (-707.523) [-709.404] (-711.522) -- 0:03:35
Average standard deviation of split frequencies: 0.016444
86000 -- (-714.739) [-705.686] (-717.692) (-709.254) * (-715.633) (-709.047) (-706.771) [-717.803] -- 0:03:32
87000 -- (-708.288) [-707.476] (-709.456) (-708.533) * (-704.212) (-721.029) (-715.816) [-702.099] -- 0:03:40
88000 -- (-703.346) [-712.332] (-719.373) (-709.508) * (-717.310) (-710.332) (-710.584) [-710.067] -- 0:03:37
89000 -- (-705.787) (-713.301) [-708.024] (-710.356) * [-713.578] (-710.013) (-720.017) (-705.067) -- 0:03:34
90000 -- [-713.557] (-712.750) (-711.071) (-706.237) * (-708.844) (-703.562) [-711.519] (-715.154) -- 0:03:32
Average standard deviation of split frequencies: 0.012825
91000 -- [-707.500] (-712.004) (-703.886) (-714.796) * [-708.522] (-703.090) (-707.666) (-716.613) -- 0:03:39
92000 -- (-715.111) (-710.627) [-704.716] (-713.468) * (-707.317) (-708.467) (-705.100) [-704.633] -- 0:03:37
93000 -- (-710.770) [-711.439] (-706.562) (-713.793) * (-710.127) (-704.971) (-712.576) [-704.981] -- 0:03:34
94000 -- (-703.985) (-714.845) [-705.987] (-723.672) * (-715.145) [-708.741] (-712.833) (-711.747) -- 0:03:32
95000 -- (-708.924) [-715.074] (-707.166) (-716.572) * (-707.581) [-707.497] (-717.410) (-718.215) -- 0:03:29
Average standard deviation of split frequencies: 0.011785
96000 -- [-711.076] (-707.094) (-714.289) (-711.912) * (-722.954) (-709.986) [-706.090] (-722.038) -- 0:03:36
97000 -- [-708.126] (-713.407) (-709.626) (-720.679) * (-713.636) (-710.505) (-708.710) [-707.369] -- 0:03:34
98000 -- [-710.742] (-710.948) (-718.479) (-714.055) * (-714.505) [-704.316] (-716.935) (-709.613) -- 0:03:31
99000 -- (-712.396) (-712.162) [-703.373] (-704.993) * (-710.799) (-707.619) (-707.702) [-706.525] -- 0:03:29
100000 -- (-700.554) (-715.516) (-704.946) [-713.638] * (-710.607) [-704.773] (-717.595) (-710.134) -- 0:03:36
Average standard deviation of split frequencies: 0.013112
101000 -- (-705.338) (-715.969) [-704.514] (-710.833) * (-709.221) (-709.783) (-711.177) [-710.369] -- 0:03:33
102000 -- (-705.527) (-716.265) (-705.621) [-704.534] * (-718.117) (-704.739) (-713.267) [-704.915] -- 0:03:31
103000 -- (-707.759) (-715.193) (-713.585) [-710.081] * (-709.686) (-711.530) [-707.515] (-705.395) -- 0:03:29
104000 -- (-710.836) (-706.226) (-705.834) [-708.888] * (-716.890) [-709.306] (-705.573) (-703.899) -- 0:03:26
105000 -- (-722.567) (-705.355) [-705.247] (-704.238) * (-714.190) [-705.544] (-710.477) (-710.476) -- 0:03:33
Average standard deviation of split frequencies: 0.013935
106000 -- (-723.501) (-719.642) (-709.056) [-711.213] * (-709.168) (-704.543) [-705.925] (-718.948) -- 0:03:30
107000 -- (-709.110) (-723.751) [-713.729] (-711.957) * (-706.066) [-707.167] (-717.260) (-709.918) -- 0:03:28
108000 -- (-719.940) (-719.015) [-711.601] (-711.074) * (-705.649) (-715.209) [-701.058] (-700.448) -- 0:03:26
109000 -- (-703.401) (-715.185) [-707.780] (-709.506) * (-710.945) (-707.171) [-707.914] (-712.577) -- 0:03:32
110000 -- [-713.428] (-710.353) (-711.721) (-710.588) * [-708.552] (-711.729) (-715.230) (-705.286) -- 0:03:30
Average standard deviation of split frequencies: 0.015051
111000 -- (-707.934) (-715.863) (-713.554) [-712.732] * (-712.076) (-704.468) [-711.856] (-709.971) -- 0:03:28
112000 -- (-706.469) (-705.870) (-718.988) [-707.990] * [-708.052] (-722.995) (-710.242) (-714.190) -- 0:03:26
113000 -- (-701.912) (-705.917) (-707.187) [-705.061] * (-712.723) [-704.279] (-708.772) (-699.140) -- 0:03:31
114000 -- (-713.432) (-705.049) [-709.157] (-706.275) * [-709.750] (-711.266) (-713.355) (-708.327) -- 0:03:29
115000 -- (-706.749) (-707.564) (-719.958) [-704.495] * (-715.581) [-708.274] (-707.176) (-701.563) -- 0:03:27
Average standard deviation of split frequencies: 0.012191
116000 -- (-708.425) (-715.847) (-702.337) [-703.578] * [-708.785] (-705.598) (-707.998) (-704.026) -- 0:03:25
117000 -- (-718.523) (-709.646) (-713.107) [-705.262] * [-710.489] (-723.198) (-711.771) (-707.417) -- 0:03:23
118000 -- [-705.113] (-711.395) (-710.365) (-704.957) * [-707.335] (-712.896) (-713.179) (-709.223) -- 0:03:29
119000 -- (-703.127) (-710.480) [-705.133] (-711.168) * [-708.822] (-715.858) (-708.130) (-719.493) -- 0:03:27
120000 -- (-714.991) (-713.884) [-699.555] (-706.919) * (-716.793) (-713.677) [-704.117] (-708.882) -- 0:03:25
Average standard deviation of split frequencies: 0.011980
121000 -- [-703.693] (-708.476) (-708.913) (-707.217) * (-715.716) (-710.232) (-708.598) [-703.748] -- 0:03:23
122000 -- [-714.301] (-709.506) (-710.310) (-704.889) * (-719.982) (-712.189) (-713.404) [-704.864] -- 0:03:28
123000 -- (-709.625) (-710.155) [-709.529] (-716.531) * (-715.190) [-717.236] (-702.166) (-708.109) -- 0:03:26
124000 -- (-712.012) (-702.753) (-711.027) [-710.008] * (-710.323) (-707.910) [-707.809] (-722.469) -- 0:03:24
125000 -- (-707.218) (-704.827) (-707.000) [-709.251] * (-707.277) (-708.154) (-712.563) [-707.839] -- 0:03:23
Average standard deviation of split frequencies: 0.012970
126000 -- (-703.646) [-709.023] (-712.653) (-713.374) * (-707.488) (-716.655) (-707.965) [-713.348] -- 0:03:28
127000 -- (-710.818) (-709.132) (-731.245) [-709.448] * (-704.604) (-704.595) (-711.946) [-706.399] -- 0:03:26
128000 -- (-708.878) [-706.165] (-711.955) (-705.302) * (-708.377) [-707.369] (-712.173) (-712.013) -- 0:03:24
129000 -- (-713.457) [-701.696] (-713.968) (-713.465) * [-705.096] (-719.014) (-712.047) (-709.857) -- 0:03:22
130000 -- (-711.278) (-708.280) (-719.853) [-703.402] * (-701.137) [-708.604] (-709.942) (-716.819) -- 0:03:20
Average standard deviation of split frequencies: 0.012026
131000 -- (-709.360) [-705.904] (-711.055) (-709.140) * (-704.715) (-713.086) [-708.154] (-714.059) -- 0:03:25
132000 -- (-707.946) (-706.833) [-703.408] (-712.231) * [-704.094] (-713.140) (-705.461) (-708.029) -- 0:03:23
133000 -- (-699.489) (-706.004) (-710.035) [-703.427] * (-702.130) (-714.042) (-710.374) [-718.459] -- 0:03:22
134000 -- (-704.943) (-704.446) (-708.510) [-709.703] * (-710.611) (-704.161) [-705.583] (-713.311) -- 0:03:20
135000 -- (-716.138) (-703.927) [-707.075] (-711.917) * (-714.798) (-701.939) [-705.542] (-711.626) -- 0:03:25
Average standard deviation of split frequencies: 0.012016
136000 -- (-702.886) (-708.088) [-702.063] (-710.997) * [-705.903] (-723.270) (-709.699) (-709.813) -- 0:03:23
137000 -- (-704.457) (-710.459) [-705.258] (-712.066) * (-714.683) (-713.919) (-708.151) [-712.233] -- 0:03:21
138000 -- [-708.990] (-711.692) (-708.128) (-708.612) * [-707.593] (-709.818) (-710.159) (-708.147) -- 0:03:19
139000 -- (-709.020) (-716.825) [-713.267] (-707.796) * [-706.783] (-709.632) (-715.885) (-711.677) -- 0:03:24
140000 -- (-713.831) (-709.754) [-711.540] (-712.113) * [-705.247] (-709.081) (-717.424) (-711.206) -- 0:03:22
Average standard deviation of split frequencies: 0.012288
141000 -- (-715.868) (-708.054) (-722.075) [-708.034] * (-707.497) [-709.686] (-709.677) (-714.284) -- 0:03:21
142000 -- (-710.178) (-709.173) (-713.563) [-701.128] * [-711.234] (-705.317) (-722.182) (-718.341) -- 0:03:19
143000 -- (-706.961) (-715.425) (-726.507) [-705.686] * [-708.526] (-709.922) (-717.282) (-712.586) -- 0:03:17
144000 -- [-703.393] (-706.860) (-710.879) (-708.455) * (-700.742) [-700.085] (-714.689) (-709.165) -- 0:03:22
145000 -- [-706.799] (-704.851) (-717.544) (-703.709) * (-712.989) (-707.417) (-709.485) [-701.009] -- 0:03:20
Average standard deviation of split frequencies: 0.010117
146000 -- (-709.725) (-709.442) (-712.383) [-705.882] * (-724.681) (-704.572) [-707.688] (-709.909) -- 0:03:18
147000 -- (-709.981) (-705.874) [-704.707] (-700.166) * (-717.348) [-703.897] (-706.151) (-703.238) -- 0:03:17
148000 -- (-712.616) (-704.766) (-710.043) [-708.252] * (-714.945) (-703.632) [-708.469] (-703.692) -- 0:03:21
149000 -- (-701.524) [-704.380] (-714.776) (-708.047) * (-722.257) (-701.881) (-708.958) [-710.968] -- 0:03:19
150000 -- (-711.984) (-709.250) (-713.212) [-704.559] * (-707.722) (-716.192) [-710.866] (-714.823) -- 0:03:18
Average standard deviation of split frequencies: 0.010429
151000 -- (-725.492) (-713.570) (-707.983) [-710.918] * (-717.879) (-715.110) (-707.607) [-706.429] -- 0:03:16
152000 -- [-705.000] (-708.487) (-712.139) (-713.426) * (-708.823) [-708.019] (-714.576) (-706.588) -- 0:03:15
153000 -- (-707.806) (-711.247) [-702.120] (-707.710) * (-712.682) [-706.731] (-714.585) (-703.696) -- 0:03:19
154000 -- (-707.303) (-704.726) [-705.087] (-712.081) * [-706.931] (-710.027) (-705.811) (-712.753) -- 0:03:17
155000 -- (-706.692) (-701.243) [-703.258] (-706.482) * [-708.620] (-708.901) (-706.017) (-710.694) -- 0:03:16
Average standard deviation of split frequencies: 0.010476
156000 -- (-724.524) (-705.290) [-706.562] (-714.749) * [-706.541] (-707.594) (-708.716) (-722.926) -- 0:03:14
157000 -- (-706.792) (-701.165) [-703.997] (-705.353) * (-709.118) (-704.655) [-706.421] (-720.869) -- 0:03:18
158000 -- (-713.917) (-711.421) [-709.206] (-704.262) * [-702.683] (-705.591) (-709.005) (-720.657) -- 0:03:17
159000 -- (-722.538) [-705.648] (-711.866) (-706.890) * (-705.478) (-716.508) (-710.321) [-709.808] -- 0:03:15
160000 -- [-702.817] (-709.652) (-711.413) (-705.395) * (-704.475) (-706.165) [-702.616] (-711.037) -- 0:03:14
Average standard deviation of split frequencies: 0.008998
161000 -- (-726.678) (-712.888) (-715.682) [-707.101] * (-706.832) (-699.581) (-703.890) [-705.786] -- 0:03:18
162000 -- (-718.697) [-706.211] (-706.403) (-709.557) * (-701.931) (-708.469) (-711.613) [-708.310] -- 0:03:16
163000 -- (-718.966) [-704.626] (-710.834) (-704.332) * (-700.202) (-703.061) (-705.053) [-704.763] -- 0:03:15
164000 -- (-718.754) [-707.638] (-720.779) (-714.500) * [-707.676] (-711.793) (-706.996) (-710.426) -- 0:03:13
165000 -- (-708.091) [-707.899] (-718.483) (-708.754) * (-709.343) (-712.182) (-706.801) [-702.990] -- 0:03:12
Average standard deviation of split frequencies: 0.007194
166000 -- (-714.503) [-703.437] (-716.782) (-711.857) * [-718.465] (-710.489) (-704.064) (-713.078) -- 0:03:15
167000 -- [-708.800] (-711.279) (-719.054) (-712.876) * [-713.270] (-712.969) (-708.313) (-712.833) -- 0:03:14
168000 -- (-703.777) [-708.755] (-709.282) (-707.163) * (-708.547) [-708.931] (-708.185) (-720.355) -- 0:03:13
169000 -- (-705.585) (-711.990) (-719.950) [-704.986] * [-705.761] (-713.397) (-713.606) (-716.927) -- 0:03:11
170000 -- (-710.545) (-706.870) [-722.544] (-715.581) * [-708.348] (-710.616) (-718.982) (-721.820) -- 0:03:15
Average standard deviation of split frequencies: 0.006813
171000 -- (-707.971) (-702.481) (-714.464) [-715.651] * (-708.678) [-706.577] (-716.781) (-716.508) -- 0:03:13
172000 -- (-714.119) [-714.946] (-720.287) (-713.347) * [-707.773] (-715.637) (-712.842) (-713.452) -- 0:03:12
173000 -- (-713.713) (-703.875) (-714.913) [-713.402] * (-706.649) (-706.737) (-711.246) [-709.311] -- 0:03:11
174000 -- [-712.698] (-711.934) (-703.228) (-717.006) * [-711.571] (-709.726) (-702.658) (-711.372) -- 0:03:14
175000 -- (-711.208) (-705.903) [-704.402] (-702.882) * (-708.922) (-705.420) [-715.127] (-715.073) -- 0:03:13
Average standard deviation of split frequencies: 0.006607
176000 -- (-708.395) (-706.072) (-710.333) [-707.534] * [-719.364] (-715.417) (-714.011) (-716.193) -- 0:03:11
177000 -- (-708.632) [-707.914] (-715.411) (-706.902) * [-705.248] (-714.218) (-711.529) (-710.619) -- 0:03:10
178000 -- [-711.947] (-710.350) (-718.019) (-710.618) * [-713.548] (-722.503) (-712.496) (-708.483) -- 0:03:13
179000 -- (-716.425) (-704.661) [-714.668] (-711.214) * (-717.018) (-715.719) (-707.559) [-706.889] -- 0:03:12
180000 -- (-720.024) (-707.760) [-704.764] (-705.962) * [-709.521] (-720.448) (-714.234) (-699.877) -- 0:03:11
Average standard deviation of split frequencies: 0.007480
181000 -- (-709.424) [-705.378] (-705.915) (-706.053) * (-708.334) (-712.846) (-721.021) [-704.367] -- 0:03:10
182000 -- (-712.764) (-712.280) [-704.154] (-715.031) * (-706.639) [-706.143] (-708.290) (-711.905) -- 0:03:08
183000 -- [-706.830] (-715.372) (-717.390) (-713.125) * [-704.435] (-724.178) (-707.084) (-702.620) -- 0:03:11
184000 -- (-710.450) [-702.675] (-711.307) (-713.299) * [-709.970] (-712.148) (-712.070) (-705.728) -- 0:03:10
185000 -- [-706.806] (-705.607) (-706.466) (-708.738) * [-707.652] (-712.341) (-706.554) (-707.487) -- 0:03:09
Average standard deviation of split frequencies: 0.008279
186000 -- (-696.492) (-709.026) [-708.629] (-717.485) * (-712.636) (-711.290) (-700.974) [-703.895] -- 0:03:08
187000 -- (-710.586) [-712.256] (-709.676) (-727.640) * (-713.272) (-715.398) [-708.664] (-712.743) -- 0:03:11
188000 -- (-706.164) (-713.631) [-707.925] (-706.468) * (-707.369) (-706.293) [-709.288] (-709.834) -- 0:03:10
189000 -- (-710.455) (-711.677) [-705.512] (-710.558) * [-706.938] (-717.214) (-711.197) (-707.248) -- 0:03:08
190000 -- [-702.471] (-712.808) (-710.662) (-713.192) * [-715.792] (-709.546) (-714.910) (-713.247) -- 0:03:07
Average standard deviation of split frequencies: 0.008736
191000 -- (-714.176) (-703.854) [-711.748] (-711.951) * [-701.119] (-719.626) (-715.997) (-718.729) -- 0:03:10
192000 -- (-712.460) [-706.180] (-706.697) (-703.210) * [-705.286] (-722.863) (-709.134) (-715.069) -- 0:03:09
193000 -- [-704.900] (-710.929) (-719.624) (-710.525) * (-713.467) (-721.030) [-704.857] (-708.028) -- 0:03:08
194000 -- (-713.942) [-711.505] (-708.110) (-716.700) * [-706.541] (-711.915) (-708.772) (-708.091) -- 0:03:06
195000 -- (-708.478) (-707.149) [-708.082] (-715.046) * (-708.856) (-721.252) [-709.825] (-706.560) -- 0:03:05
Average standard deviation of split frequencies: 0.008177
196000 -- (-714.958) (-709.992) (-713.167) [-709.907] * (-708.621) (-723.881) (-707.068) [-708.912] -- 0:03:08
197000 -- [-712.787] (-702.647) (-706.541) (-705.272) * (-709.560) (-717.140) [-701.983] (-713.936) -- 0:03:07
198000 -- (-703.618) [-709.726] (-712.800) (-709.091) * (-715.988) [-713.228] (-706.378) (-710.413) -- 0:03:06
199000 -- (-711.302) [-707.144] (-723.622) (-706.604) * (-704.773) [-707.508] (-716.683) (-704.825) -- 0:03:05
200000 -- (-709.501) (-706.087) [-706.049] (-709.717) * (-719.524) [-705.130] (-707.679) (-713.579) -- 0:03:08
Average standard deviation of split frequencies: 0.006265
201000 -- (-714.994) [-703.720] (-712.067) (-707.838) * (-714.368) (-706.690) [-709.539] (-702.951) -- 0:03:06
202000 -- (-714.043) (-715.929) (-707.212) [-711.258] * (-707.461) (-710.878) [-713.024] (-707.812) -- 0:03:05
203000 -- [-705.358] (-719.349) (-706.392) (-706.631) * (-714.599) (-710.206) [-706.611] (-707.324) -- 0:03:04
204000 -- (-715.521) (-717.999) [-707.180] (-718.357) * (-718.050) (-707.015) (-715.914) [-706.145] -- 0:03:03
205000 -- (-704.347) [-707.112] (-711.271) (-715.665) * (-706.561) (-716.454) [-709.206] (-711.941) -- 0:03:06
Average standard deviation of split frequencies: 0.005797
206000 -- (-711.128) (-706.491) (-714.056) [-709.036] * [-708.503] (-713.778) (-705.652) (-711.874) -- 0:03:05
207000 -- [-710.146] (-708.826) (-702.676) (-713.951) * [-703.228] (-707.159) (-713.083) (-707.285) -- 0:03:03
208000 -- (-709.391) (-709.982) (-708.381) [-714.866] * (-711.748) (-712.989) [-703.790] (-706.174) -- 0:03:02
209000 -- [-705.700] (-717.783) (-703.859) (-714.700) * [-713.449] (-713.834) (-712.094) (-710.916) -- 0:03:05
210000 -- (-706.709) (-726.548) [-702.118] (-718.255) * [-708.566] (-718.616) (-709.521) (-712.607) -- 0:03:04
Average standard deviation of split frequencies: 0.004774
211000 -- [-710.689] (-714.416) (-711.670) (-707.278) * (-712.650) (-712.438) (-711.203) [-706.123] -- 0:03:03
212000 -- [-711.359] (-714.850) (-714.800) (-714.071) * (-710.822) (-724.248) (-705.951) [-710.595] -- 0:03:02
213000 -- (-720.449) (-707.554) (-710.419) [-707.279] * (-709.608) (-722.857) [-706.424] (-719.185) -- 0:03:04
214000 -- (-705.277) (-711.326) [-701.953] (-717.275) * [-709.219] (-722.295) (-715.840) (-715.530) -- 0:03:03
215000 -- [-713.909] (-704.355) (-698.267) (-708.682) * [-717.139] (-711.478) (-716.862) (-705.238) -- 0:03:02
Average standard deviation of split frequencies: 0.006111
216000 -- [-703.787] (-721.245) (-711.194) (-712.053) * (-707.986) (-713.786) [-708.819] (-710.756) -- 0:03:01
217000 -- [-706.872] (-708.027) (-710.532) (-701.765) * [-704.111] (-718.366) (-704.170) (-704.305) -- 0:03:00
218000 -- (-708.074) (-704.449) [-709.150] (-704.923) * [-710.376] (-712.673) (-714.361) (-701.940) -- 0:03:02
219000 -- (-710.266) (-711.107) [-704.236] (-703.529) * (-710.002) (-712.382) [-702.488] (-705.832) -- 0:03:01
220000 -- (-714.475) (-709.061) [-706.641] (-707.444) * (-708.726) (-709.669) [-703.196] (-708.379) -- 0:03:00
Average standard deviation of split frequencies: 0.006551
221000 -- (-712.065) [-707.670] (-708.170) (-713.304) * [-704.716] (-705.605) (-703.901) (-722.934) -- 0:02:59
222000 -- (-709.968) (-703.297) [-707.657] (-714.438) * (-710.313) [-710.113] (-703.892) (-708.611) -- 0:03:02
223000 -- (-704.411) (-704.833) [-705.970] (-704.552) * [-709.565] (-711.581) (-707.327) (-714.068) -- 0:03:01
224000 -- (-703.959) [-704.630] (-714.210) (-702.057) * (-712.663) (-714.796) (-710.875) [-712.266] -- 0:03:00
225000 -- (-708.579) [-706.000] (-705.501) (-716.567) * (-711.693) (-707.199) (-711.559) [-709.051] -- 0:02:59
Average standard deviation of split frequencies: 0.005701
226000 -- (-705.725) [-706.732] (-703.352) (-708.098) * (-720.703) (-702.901) [-708.062] (-710.738) -- 0:02:58
227000 -- (-715.366) (-717.832) (-702.528) [-705.233] * (-708.144) (-708.243) [-707.920] (-712.948) -- 0:03:00
228000 -- (-721.989) (-714.048) [-707.199] (-707.778) * [-700.865] (-719.803) (-712.059) (-702.885) -- 0:02:59
229000 -- (-718.251) [-705.023] (-706.257) (-707.395) * (-717.114) [-706.760] (-716.485) (-710.946) -- 0:02:58
230000 -- (-723.974) (-713.961) (-706.216) [-707.138] * (-709.265) (-704.165) (-708.269) [-709.471] -- 0:02:57
Average standard deviation of split frequencies: 0.005586
231000 -- (-714.440) (-713.042) (-706.152) [-709.826] * [-712.077] (-705.239) (-703.939) (-706.993) -- 0:02:59
232000 -- (-716.997) (-715.757) (-705.924) [-709.669] * [-708.403] (-710.432) (-712.310) (-709.727) -- 0:02:58
233000 -- [-705.093] (-706.483) (-715.287) (-714.968) * (-718.700) (-714.701) (-717.674) [-707.571] -- 0:02:57
234000 -- (-723.956) [-704.542] (-704.642) (-703.016) * (-703.758) (-721.125) (-709.467) [-710.151] -- 0:02:56
235000 -- (-716.487) (-707.382) (-709.314) [-709.962] * [-703.448] (-720.821) (-708.378) (-713.576) -- 0:02:59
Average standard deviation of split frequencies: 0.005992
236000 -- [-709.761] (-712.161) (-708.657) (-713.539) * [-709.741] (-707.577) (-712.998) (-716.033) -- 0:02:58
237000 -- (-717.810) (-706.585) (-722.948) [-705.469] * (-708.585) (-716.139) [-711.232] (-713.260) -- 0:02:57
238000 -- (-722.789) (-705.929) (-711.646) [-705.585] * (-709.491) (-706.185) (-714.358) [-708.027] -- 0:02:56
239000 -- [-710.142] (-714.314) (-720.131) (-707.650) * (-712.533) (-714.515) (-716.169) [-713.226] -- 0:02:58
240000 -- [-701.876] (-701.890) (-710.307) (-706.232) * (-707.677) (-708.401) (-708.467) [-707.817] -- 0:02:57
Average standard deviation of split frequencies: 0.007182
241000 -- [-711.859] (-705.822) (-708.434) (-712.026) * (-703.897) (-706.685) [-703.423] (-706.712) -- 0:02:56
242000 -- [-709.078] (-712.001) (-709.310) (-707.534) * [-709.861] (-720.167) (-707.121) (-709.775) -- 0:02:55
243000 -- (-701.972) [-703.703] (-705.595) (-714.328) * (-705.951) (-720.100) [-711.545] (-721.528) -- 0:02:54
244000 -- (-710.696) (-727.529) (-710.866) [-702.361] * [-702.690] (-711.604) (-714.118) (-708.513) -- 0:02:56
245000 -- [-708.900] (-711.592) (-706.618) (-713.961) * (-715.500) (-711.290) (-718.834) [-710.187] -- 0:02:55
Average standard deviation of split frequencies: 0.006515
246000 -- (-710.543) [-703.562] (-715.641) (-710.015) * (-705.828) (-719.360) (-708.554) [-703.444] -- 0:02:54
247000 -- (-703.768) [-704.337] (-716.707) (-708.954) * (-711.911) (-708.169) (-714.753) [-706.268] -- 0:02:53
248000 -- (-711.579) (-704.808) [-703.001] (-713.911) * (-708.243) (-707.600) (-715.079) [-706.111] -- 0:02:55
249000 -- (-706.805) (-702.371) (-717.631) [-711.290] * [-707.184] (-714.155) (-705.947) (-716.451) -- 0:02:54
250000 -- (-706.392) (-709.186) (-707.929) [-707.819] * (-711.442) (-713.178) [-707.449] (-706.463) -- 0:02:54
Average standard deviation of split frequencies: 0.008149
251000 -- (-709.066) (-715.114) [-710.000] (-703.152) * (-718.203) (-708.029) [-707.595] (-705.098) -- 0:02:53
252000 -- (-714.347) (-712.749) (-709.131) [-709.700] * (-718.031) (-710.793) [-706.899] (-713.242) -- 0:02:55
253000 -- (-706.803) [-709.309] (-720.893) (-713.969) * (-713.480) [-711.068] (-708.185) (-707.113) -- 0:02:54
254000 -- (-706.782) [-713.986] (-705.629) (-714.670) * [-716.693] (-719.038) (-702.950) (-710.035) -- 0:02:53
255000 -- (-706.046) (-711.103) [-707.475] (-708.517) * [-704.998] (-706.974) (-704.622) (-703.547) -- 0:02:52
Average standard deviation of split frequencies: 0.008102
256000 -- (-718.716) [-707.480] (-713.935) (-713.648) * (-712.321) [-706.309] (-711.833) (-708.852) -- 0:02:51
257000 -- (-708.523) [-703.171] (-710.134) (-712.017) * (-708.389) (-707.308) [-704.361] (-702.809) -- 0:02:53
258000 -- (-708.301) [-710.314] (-710.592) (-713.667) * [-698.139] (-713.861) (-707.384) (-702.318) -- 0:02:52
259000 -- (-712.809) [-707.721] (-708.517) (-712.561) * (-708.646) (-707.821) [-710.270] (-706.648) -- 0:02:51
260000 -- (-712.351) (-708.906) (-705.230) [-703.219] * (-717.161) [-711.060] (-704.889) (-702.421) -- 0:02:50
Average standard deviation of split frequencies: 0.007234
261000 -- (-710.901) (-705.081) (-707.573) [-713.726] * [-700.437] (-714.374) (-709.408) (-708.827) -- 0:02:52
262000 -- [-706.364] (-703.887) (-720.557) (-721.343) * (-702.385) (-713.468) (-706.524) [-721.050] -- 0:02:51
263000 -- [-702.619] (-709.699) (-724.269) (-723.327) * (-708.210) (-714.212) (-707.415) [-705.362] -- 0:02:50
264000 -- (-715.926) (-714.071) (-721.223) [-704.742] * (-711.179) [-712.138] (-709.574) (-713.278) -- 0:02:50
265000 -- [-700.950] (-710.479) (-709.854) (-711.111) * (-709.616) [-708.305] (-713.438) (-710.887) -- 0:02:51
Average standard deviation of split frequencies: 0.007325
266000 -- (-700.396) (-713.821) (-711.357) [-706.452] * [-708.168] (-719.593) (-708.596) (-710.073) -- 0:02:51
267000 -- (-707.920) (-711.871) [-707.817] (-719.974) * [-704.764] (-717.215) (-713.981) (-704.984) -- 0:02:50
268000 -- (-705.847) [-703.117] (-705.573) (-713.761) * [-709.174] (-713.719) (-711.237) (-720.050) -- 0:02:49
269000 -- (-714.258) (-704.765) (-706.827) [-714.521] * (-712.268) (-712.773) (-709.067) [-705.269] -- 0:02:51
270000 -- [-702.996] (-701.707) (-709.367) (-709.217) * (-707.257) [-703.266] (-705.884) (-705.933) -- 0:02:50
Average standard deviation of split frequencies: 0.007083
271000 -- (-709.124) [-706.381] (-721.727) (-713.891) * (-709.539) (-706.618) (-712.122) [-711.220] -- 0:02:49
272000 -- (-707.484) [-709.640] (-710.618) (-708.861) * (-720.786) [-717.897] (-706.373) (-710.161) -- 0:02:48
273000 -- (-709.779) (-702.699) (-708.154) [-707.625] * (-716.691) (-713.371) [-708.273] (-709.036) -- 0:02:50
274000 -- (-711.685) (-710.431) [-705.623] (-705.751) * (-718.936) (-716.926) (-708.810) [-708.273] -- 0:02:49
275000 -- [-713.770] (-698.768) (-709.362) (-710.926) * (-721.357) (-709.468) (-707.897) [-705.210] -- 0:02:48
Average standard deviation of split frequencies: 0.006490
276000 -- [-698.390] (-722.945) (-704.501) (-707.787) * (-712.823) (-711.123) [-706.820] (-710.350) -- 0:02:47
277000 -- (-715.805) [-704.893] (-714.172) (-705.348) * [-701.292] (-712.919) (-714.848) (-707.250) -- 0:02:47
278000 -- (-714.171) (-711.189) [-701.051] (-705.907) * (-719.630) (-716.375) (-704.066) [-706.375] -- 0:02:48
279000 -- (-715.640) [-706.247] (-707.959) (-712.509) * (-711.302) [-712.250] (-710.520) (-705.503) -- 0:02:47
280000 -- (-704.732) (-715.344) (-719.758) [-712.124] * [-712.044] (-707.854) (-712.846) (-713.151) -- 0:02:47
Average standard deviation of split frequencies: 0.006494
281000 -- (-713.288) [-705.025] (-704.668) (-708.914) * [-700.230] (-704.534) (-719.907) (-711.404) -- 0:02:46
282000 -- (-713.889) (-709.643) [-699.876] (-713.008) * (-708.441) (-716.116) [-710.692] (-711.444) -- 0:02:48
283000 -- [-708.379] (-726.431) (-711.717) (-706.502) * (-713.201) (-725.496) [-702.739] (-710.149) -- 0:02:47
284000 -- (-709.796) [-710.180] (-714.052) (-704.021) * (-712.506) [-709.292] (-708.926) (-711.354) -- 0:02:46
285000 -- (-711.633) (-716.643) (-712.163) [-705.247] * (-705.951) (-709.044) (-715.979) [-715.369] -- 0:02:45
Average standard deviation of split frequencies: 0.006154
286000 -- [-707.111] (-713.427) (-708.509) (-711.751) * (-706.732) (-712.184) [-709.276] (-709.095) -- 0:02:47
287000 -- [-707.011] (-711.385) (-710.322) (-708.173) * (-709.294) (-707.009) [-711.190] (-705.930) -- 0:02:46
288000 -- (-705.283) (-705.329) (-715.179) [-704.472] * [-713.985] (-710.299) (-713.084) (-716.906) -- 0:02:45
289000 -- (-706.147) [-706.100] (-710.359) (-712.274) * (-708.469) (-712.664) (-701.366) [-708.585] -- 0:02:44
290000 -- (-707.697) [-710.376] (-720.849) (-714.536) * (-707.745) (-719.784) [-707.414] (-707.938) -- 0:02:46
Average standard deviation of split frequencies: 0.006163
291000 -- (-707.981) (-712.087) (-705.738) [-718.227] * [-706.157] (-713.127) (-706.808) (-710.371) -- 0:02:45
292000 -- (-707.035) (-708.855) (-711.111) [-707.233] * (-706.148) (-722.204) [-706.802] (-704.935) -- 0:02:44
293000 -- (-714.264) (-715.056) (-717.792) [-707.431] * (-714.362) (-711.854) [-704.193] (-706.394) -- 0:02:44
294000 -- [-712.261] (-714.827) (-710.374) (-703.783) * (-704.632) [-712.172] (-705.803) (-708.928) -- 0:02:43
295000 -- (-712.175) (-707.161) [-707.283] (-708.194) * (-710.294) (-712.144) (-707.329) [-700.890] -- 0:02:44
Average standard deviation of split frequencies: 0.006370
296000 -- (-710.361) [-709.183] (-707.017) (-715.750) * (-705.416) (-709.477) (-708.533) [-704.572] -- 0:02:44
297000 -- (-712.741) (-718.296) (-704.702) [-715.168] * (-718.267) (-713.773) (-710.927) [-703.713] -- 0:02:43
298000 -- (-711.056) (-714.478) [-710.708] (-709.721) * (-710.874) (-705.080) (-714.225) [-706.502] -- 0:02:42
299000 -- (-704.040) (-715.609) [-713.062] (-707.967) * (-707.887) (-707.202) [-702.988] (-707.804) -- 0:02:44
300000 -- (-708.556) [-713.188] (-712.765) (-711.311) * [-719.204] (-716.827) (-706.196) (-710.611) -- 0:02:43
Average standard deviation of split frequencies: 0.007212
301000 -- [-711.209] (-722.117) (-708.302) (-712.133) * (-716.002) (-714.762) (-710.180) [-706.051] -- 0:02:42
302000 -- (-713.874) (-720.805) (-705.264) [-706.655] * (-715.695) (-706.220) (-705.066) [-706.553] -- 0:02:41
303000 -- (-708.144) [-706.621] (-704.924) (-705.042) * (-706.387) (-710.049) (-707.518) [-703.279] -- 0:02:43
304000 -- [-708.173] (-711.996) (-710.395) (-708.056) * [-714.897] (-710.021) (-706.306) (-709.647) -- 0:02:42
305000 -- (-706.482) [-712.548] (-706.382) (-709.239) * (-712.865) [-708.158] (-714.855) (-707.541) -- 0:02:41
Average standard deviation of split frequencies: 0.007497
306000 -- [-711.359] (-707.747) (-704.468) (-705.176) * (-714.590) [-704.669] (-712.917) (-712.829) -- 0:02:41
307000 -- (-708.470) [-704.712] (-716.626) (-710.494) * (-705.172) (-711.757) (-717.184) [-702.887] -- 0:02:40
308000 -- (-706.692) (-703.245) [-706.691] (-723.636) * (-709.811) (-713.310) (-708.648) [-704.502] -- 0:02:41
309000 -- [-704.625] (-706.412) (-720.787) (-715.647) * (-709.641) [-708.208] (-710.919) (-720.652) -- 0:02:41
310000 -- [-704.740] (-710.386) (-708.755) (-713.940) * (-707.099) [-706.814] (-703.891) (-706.383) -- 0:02:40
Average standard deviation of split frequencies: 0.007486
311000 -- [-701.132] (-709.893) (-710.272) (-711.876) * (-708.785) (-714.814) [-710.431] (-711.865) -- 0:02:39
312000 -- (-711.901) (-703.526) [-710.257] (-710.606) * (-710.915) [-705.397] (-701.915) (-718.699) -- 0:02:40
313000 -- (-704.874) (-713.737) [-705.798] (-713.610) * (-711.903) [-705.509] (-707.195) (-708.039) -- 0:02:40
314000 -- (-709.011) [-707.408] (-719.678) (-709.144) * [-709.219] (-712.801) (-708.462) (-717.265) -- 0:02:39
315000 -- (-708.698) (-708.077) [-703.870] (-709.750) * (-711.932) [-705.473] (-720.984) (-705.420) -- 0:02:38
Average standard deviation of split frequencies: 0.007558
316000 -- (-714.371) (-716.189) (-709.890) [-704.949] * (-706.752) [-704.387] (-714.435) (-712.348) -- 0:02:40
317000 -- (-714.631) (-713.127) [-709.354] (-702.107) * [-709.845] (-705.060) (-709.555) (-707.868) -- 0:02:39
318000 -- (-715.816) (-718.807) [-712.491] (-709.767) * (-712.863) (-706.343) [-700.770] (-720.495) -- 0:02:38
319000 -- (-706.946) (-706.554) [-704.873] (-705.244) * [-706.995] (-713.990) (-709.536) (-711.316) -- 0:02:37
320000 -- (-703.194) (-706.784) [-705.890] (-708.177) * [-705.489] (-713.861) (-719.312) (-710.071) -- 0:02:37
Average standard deviation of split frequencies: 0.008232
321000 -- (-711.385) (-708.253) [-707.414] (-715.200) * (-707.852) (-709.207) [-706.422] (-710.209) -- 0:02:38
322000 -- (-707.534) (-707.637) (-711.582) [-711.782] * (-706.469) (-712.716) [-707.182] (-712.791) -- 0:02:37
323000 -- [-714.838] (-708.970) (-710.202) (-712.147) * (-713.143) [-710.323] (-713.833) (-710.301) -- 0:02:37
324000 -- (-714.664) (-720.656) (-717.865) [-708.734] * (-712.126) (-719.362) [-711.070] (-707.775) -- 0:02:36
325000 -- [-716.275] (-701.924) (-709.352) (-718.218) * [-707.203] (-719.308) (-707.129) (-716.946) -- 0:02:37
Average standard deviation of split frequencies: 0.008387
326000 -- (-713.574) (-709.406) [-705.976] (-709.208) * (-700.386) (-708.873) [-702.323] (-710.447) -- 0:02:37
327000 -- (-707.783) [-704.690] (-721.490) (-707.442) * [-706.620] (-706.465) (-709.601) (-708.197) -- 0:02:36
328000 -- [-714.403] (-704.422) (-712.496) (-721.365) * (-707.428) [-706.860] (-711.028) (-712.656) -- 0:02:35
329000 -- (-708.723) [-702.544] (-712.702) (-707.769) * (-710.188) (-706.294) (-713.648) [-705.788] -- 0:02:37
330000 -- (-713.391) (-712.434) [-704.207] (-710.541) * (-717.839) (-706.437) (-712.829) [-710.530] -- 0:02:36
Average standard deviation of split frequencies: 0.007698
331000 -- (-713.499) [-702.727] (-704.577) (-722.758) * [-707.223] (-708.857) (-708.740) (-718.261) -- 0:02:35
332000 -- (-711.380) [-703.154] (-708.960) (-710.445) * (-713.737) [-707.419] (-706.898) (-710.380) -- 0:02:34
333000 -- (-706.073) [-702.566] (-724.255) (-710.709) * (-704.409) (-706.791) [-706.791] (-711.174) -- 0:02:34
334000 -- (-712.103) (-707.970) (-711.171) [-704.457] * (-704.149) [-705.913] (-709.098) (-716.892) -- 0:02:35
335000 -- [-709.077] (-711.267) (-710.590) (-714.095) * (-716.569) (-709.965) (-715.136) [-705.661] -- 0:02:34
Average standard deviation of split frequencies: 0.007108
336000 -- (-710.533) (-702.761) (-705.856) [-705.899] * (-709.929) (-715.509) [-712.153] (-711.652) -- 0:02:34
337000 -- (-701.177) (-711.613) (-715.963) [-708.923] * (-715.412) [-704.417] (-711.795) (-702.722) -- 0:02:33
338000 -- (-716.350) (-725.784) [-710.426] (-714.760) * (-708.603) (-710.823) (-730.819) [-702.593] -- 0:02:34
339000 -- (-709.771) (-712.202) [-710.942] (-709.229) * (-711.935) [-709.329] (-714.325) (-707.586) -- 0:02:34
340000 -- (-714.376) (-716.298) [-706.560] (-707.818) * [-705.944] (-711.554) (-713.259) (-711.329) -- 0:02:33
Average standard deviation of split frequencies: 0.007380
341000 -- [-709.437] (-709.584) (-707.254) (-705.030) * (-706.420) (-712.855) [-708.534] (-709.097) -- 0:02:32
342000 -- (-716.658) [-705.141] (-704.704) (-714.108) * (-707.293) [-704.310] (-714.682) (-707.931) -- 0:02:33
343000 -- (-709.117) [-722.806] (-707.740) (-703.948) * (-709.298) (-709.486) [-708.961] (-707.705) -- 0:02:33
344000 -- (-711.163) (-713.200) [-702.729] (-708.777) * (-709.786) (-710.565) [-701.284] (-714.360) -- 0:02:32
345000 -- (-706.144) (-715.201) [-713.787] (-715.805) * (-709.276) (-708.812) [-705.405] (-704.626) -- 0:02:31
Average standard deviation of split frequencies: 0.007720
346000 -- (-708.080) (-716.110) [-709.310] (-707.021) * (-710.301) (-718.469) (-706.205) [-705.503] -- 0:02:31
347000 -- (-710.427) (-707.414) [-711.570] (-709.570) * (-708.347) (-712.489) [-711.150] (-713.499) -- 0:02:32
348000 -- (-707.011) [-712.259] (-716.092) (-708.327) * (-712.647) (-708.160) [-704.214] (-711.940) -- 0:02:31
349000 -- [-707.745] (-703.433) (-713.350) (-713.829) * (-709.957) [-706.613] (-709.617) (-711.821) -- 0:02:31
350000 -- (-713.414) [-708.617] (-717.400) (-710.843) * (-723.049) (-705.738) [-713.181] (-718.588) -- 0:02:30
Average standard deviation of split frequencies: 0.006901
351000 -- [-710.190] (-708.583) (-706.872) (-706.147) * (-706.505) (-708.730) [-705.598] (-710.882) -- 0:02:31
352000 -- (-707.502) [-713.965] (-710.670) (-710.363) * (-708.812) (-713.092) [-705.244] (-717.537) -- 0:02:30
353000 -- (-706.465) (-705.865) [-721.272] (-715.139) * (-717.665) [-709.564] (-710.887) (-719.422) -- 0:02:30
354000 -- [-705.302] (-706.597) (-711.212) (-711.013) * (-708.030) (-708.631) [-705.485] (-707.473) -- 0:02:29
355000 -- (-707.961) (-705.442) [-707.238] (-706.745) * [-708.493] (-704.487) (-709.771) (-713.258) -- 0:02:28
Average standard deviation of split frequencies: 0.006268
356000 -- (-715.815) [-704.894] (-708.650) (-711.215) * (-719.530) [-712.059] (-705.998) (-714.592) -- 0:02:30
357000 -- (-710.285) (-709.679) (-714.014) [-715.025] * [-704.029] (-710.685) (-714.473) (-708.447) -- 0:02:29
358000 -- [-704.428] (-714.621) (-703.190) (-712.038) * (-711.231) (-711.883) [-714.381] (-705.526) -- 0:02:28
359000 -- (-710.559) (-707.296) [-709.238] (-712.346) * (-713.549) (-705.153) [-711.599] (-708.427) -- 0:02:28
360000 -- (-715.228) (-720.846) (-712.000) [-706.481] * (-704.802) [-711.870] (-703.564) (-717.654) -- 0:02:29
Average standard deviation of split frequencies: 0.006622
361000 -- (-701.695) (-709.070) (-710.127) [-702.571] * [-704.468] (-712.599) (-705.804) (-712.310) -- 0:02:28
362000 -- (-703.026) (-706.596) (-709.316) [-701.527] * [-715.803] (-709.730) (-715.360) (-709.730) -- 0:02:28
363000 -- (-704.376) [-706.309] (-706.113) (-709.591) * (-710.450) (-706.767) [-710.552] (-714.696) -- 0:02:27
364000 -- (-702.785) [-712.886] (-712.115) (-715.195) * (-710.692) (-719.469) [-706.081] (-711.960) -- 0:02:28
365000 -- (-704.528) [-704.330] (-714.859) (-710.999) * (-716.965) (-710.120) [-707.640] (-712.116) -- 0:02:27
Average standard deviation of split frequencies: 0.006526
366000 -- (-732.675) (-702.375) [-713.147] (-712.358) * (-712.236) [-703.832] (-702.911) (-706.846) -- 0:02:27
367000 -- (-707.725) (-708.862) [-708.547] (-712.585) * [-705.949] (-714.426) (-712.395) (-708.628) -- 0:02:26
368000 -- (-708.863) [-704.722] (-714.355) (-708.368) * (-714.261) (-706.870) (-713.236) [-700.773] -- 0:02:25
369000 -- (-704.772) (-704.735) (-714.856) [-709.701] * (-707.734) (-711.847) [-707.416] (-710.034) -- 0:02:27
370000 -- [-704.362] (-702.244) (-723.806) (-710.399) * [-706.038] (-702.970) (-708.315) (-720.233) -- 0:02:26
Average standard deviation of split frequencies: 0.005511
371000 -- (-712.633) [-709.890] (-707.241) (-715.305) * [-705.039] (-704.510) (-709.004) (-712.216) -- 0:02:25
372000 -- [-707.851] (-709.492) (-715.510) (-710.498) * (-711.632) (-704.607) (-717.594) [-706.676] -- 0:02:25
373000 -- (-713.153) (-708.912) [-714.975] (-710.559) * (-710.044) [-706.508] (-703.113) (-708.636) -- 0:02:26
374000 -- [-704.378] (-716.915) (-708.349) (-706.133) * [-708.860] (-713.195) (-706.764) (-714.048) -- 0:02:25
375000 -- (-718.064) [-709.348] (-707.340) (-711.230) * (-714.376) (-718.131) [-706.890] (-708.432) -- 0:02:25
Average standard deviation of split frequencies: 0.006352
376000 -- [-707.740] (-710.520) (-720.373) (-701.882) * (-711.992) (-709.844) (-711.565) [-709.794] -- 0:02:24
377000 -- (-703.722) [-704.377] (-717.587) (-706.336) * [-708.386] (-712.270) (-709.454) (-707.816) -- 0:02:23
378000 -- (-703.693) [-708.286] (-712.913) (-705.895) * [-705.038] (-732.009) (-709.295) (-713.480) -- 0:02:24
379000 -- [-706.620] (-710.219) (-707.216) (-710.091) * (-715.360) [-712.455] (-717.492) (-711.752) -- 0:02:24
380000 -- (-706.023) (-715.765) (-711.262) [-704.596] * (-710.604) (-708.940) (-712.862) [-704.958] -- 0:02:23
Average standard deviation of split frequencies: 0.005862
381000 -- (-706.173) (-705.538) [-705.275] (-708.151) * (-710.917) [-705.835] (-707.250) (-711.826) -- 0:02:22
382000 -- [-705.433] (-715.380) (-707.329) (-708.436) * (-710.165) (-711.371) [-715.480] (-715.039) -- 0:02:23
383000 -- (-709.053) [-710.341] (-714.721) (-712.183) * (-706.329) [-703.111] (-714.844) (-717.064) -- 0:02:23
384000 -- (-713.090) (-713.146) [-707.430] (-718.830) * (-705.394) (-716.292) [-708.536] (-711.905) -- 0:02:22
385000 -- (-713.643) (-703.660) [-710.961] (-715.496) * (-713.670) [-704.918] (-720.137) (-708.103) -- 0:02:22
Average standard deviation of split frequencies: 0.005374
386000 -- (-710.589) (-711.089) (-708.207) [-712.992] * (-715.086) (-709.030) (-716.754) [-703.643] -- 0:02:23
387000 -- (-713.721) (-708.968) (-708.469) [-707.460] * (-704.769) [-706.932] (-704.197) (-710.590) -- 0:02:22
388000 -- (-719.422) (-718.204) [-710.720] (-707.828) * (-705.487) (-712.623) (-704.425) [-708.036] -- 0:02:21
389000 -- [-709.745] (-707.660) (-708.922) (-701.772) * (-707.253) (-714.602) [-709.644] (-707.974) -- 0:02:21
390000 -- (-709.099) (-710.873) [-701.790] (-706.518) * (-701.409) [-704.595] (-707.212) (-709.917) -- 0:02:20
Average standard deviation of split frequencies: 0.005551
391000 -- (-711.418) (-706.858) (-705.221) [-716.446] * [-702.891] (-718.101) (-708.475) (-728.421) -- 0:02:21
392000 -- (-709.637) [-708.561] (-714.030) (-705.721) * (-717.138) (-711.419) [-710.516] (-715.686) -- 0:02:21
393000 -- (-712.616) (-719.705) [-704.684] (-704.813) * (-715.726) [-709.776] (-711.273) (-705.899) -- 0:02:20
394000 -- (-712.859) [-713.429] (-704.479) (-704.773) * (-705.470) (-718.809) (-708.455) [-707.359] -- 0:02:19
395000 -- (-702.991) [-708.253] (-706.453) (-715.782) * (-706.316) (-712.067) (-707.135) [-705.401] -- 0:02:20
Average standard deviation of split frequencies: 0.006031
396000 -- (-708.404) [-707.089] (-710.420) (-710.294) * [-703.023] (-716.253) (-707.307) (-700.866) -- 0:02:20
397000 -- (-708.826) (-714.395) [-704.531] (-716.692) * (-708.931) [-707.631] (-711.974) (-709.268) -- 0:02:19
398000 -- [-708.713] (-706.095) (-709.846) (-709.732) * (-716.437) (-718.042) [-701.734] (-706.413) -- 0:02:19
399000 -- [-703.813] (-718.275) (-710.856) (-711.252) * (-708.602) (-710.763) [-707.967] (-708.105) -- 0:02:20
400000 -- (-706.353) (-705.833) [-706.387] (-703.578) * (-710.112) [-707.371] (-711.024) (-707.984) -- 0:02:19
Average standard deviation of split frequencies: 0.006510
401000 -- (-710.763) [-705.393] (-714.408) (-706.608) * (-710.474) (-705.658) (-706.302) [-707.280] -- 0:02:18
402000 -- (-713.861) (-712.871) [-707.579] (-709.466) * [-706.611] (-717.454) (-711.494) (-708.464) -- 0:02:18
403000 -- (-715.130) [-709.746] (-706.851) (-706.416) * [-710.091] (-711.683) (-715.070) (-701.882) -- 0:02:17
404000 -- (-710.078) (-714.354) (-708.688) [-703.753] * [-710.751] (-702.741) (-713.160) (-704.859) -- 0:02:18
405000 -- (-713.898) (-712.563) [-704.487] (-709.294) * (-715.179) (-707.153) (-707.584) [-706.664] -- 0:02:18
Average standard deviation of split frequencies: 0.006115
406000 -- (-712.204) [-705.826] (-707.837) (-706.573) * [-710.286] (-711.448) (-709.005) (-715.241) -- 0:02:17
407000 -- (-721.008) (-712.321) [-716.446] (-713.213) * (-716.260) (-706.099) [-710.802] (-708.583) -- 0:02:16
408000 -- (-710.166) (-714.796) [-707.284] (-721.733) * (-713.762) (-708.609) [-713.439] (-715.706) -- 0:02:17
409000 -- [-710.574] (-713.513) (-714.945) (-707.889) * (-709.411) (-704.749) [-710.888] (-712.513) -- 0:02:17
410000 -- (-708.502) [-713.694] (-737.036) (-707.556) * [-706.564] (-711.090) (-707.956) (-713.284) -- 0:02:16
Average standard deviation of split frequencies: 0.006352
411000 -- (-709.297) (-709.968) (-716.542) [-708.024] * (-708.534) (-716.786) [-703.311] (-714.488) -- 0:02:16
412000 -- [-709.814] (-704.020) (-724.292) (-707.970) * (-709.380) (-705.261) (-702.929) [-705.079] -- 0:02:17
413000 -- [-705.742] (-713.134) (-716.447) (-716.812) * (-714.587) (-704.270) [-705.910] (-712.870) -- 0:02:16
414000 -- (-712.313) (-702.777) (-711.604) [-708.716] * (-713.422) (-711.520) [-704.927] (-720.785) -- 0:02:15
415000 -- (-702.493) (-712.192) [-706.324] (-707.626) * (-702.846) (-705.540) (-708.054) [-705.781] -- 0:02:15
Average standard deviation of split frequencies: 0.006346
416000 -- (-705.983) [-708.007] (-705.662) (-714.927) * (-708.084) (-713.335) (-705.414) [-706.358] -- 0:02:16
417000 -- (-711.411) (-706.472) [-716.481] (-708.604) * (-707.951) (-714.749) (-702.189) [-711.902] -- 0:02:15
418000 -- [-711.988] (-709.895) (-716.019) (-705.890) * (-711.446) (-708.056) [-700.902] (-712.872) -- 0:02:15
419000 -- (-708.196) [-706.078] (-710.754) (-723.159) * (-706.125) (-712.246) (-707.013) [-703.663] -- 0:02:14
420000 -- (-706.789) [-713.821] (-719.382) (-710.574) * (-706.922) (-706.920) [-712.896] (-706.554) -- 0:02:13
Average standard deviation of split frequencies: 0.006350
421000 -- [-705.453] (-720.013) (-706.511) (-712.570) * (-710.205) (-717.341) [-712.421] (-713.176) -- 0:02:14
422000 -- [-715.803] (-724.781) (-708.343) (-717.928) * (-704.825) [-711.471] (-717.147) (-712.737) -- 0:02:14
423000 -- [-698.585] (-706.656) (-704.239) (-715.927) * [-710.458] (-703.947) (-714.246) (-714.248) -- 0:02:13
424000 -- [-704.238] (-708.190) (-710.428) (-712.029) * (-709.364) (-708.883) [-712.522] (-717.679) -- 0:02:13
425000 -- (-712.299) (-723.275) (-710.125) [-706.030] * (-712.217) [-705.578] (-716.116) (-713.412) -- 0:02:13
Average standard deviation of split frequencies: 0.006492
426000 -- (-708.347) (-712.576) [-702.383] (-709.567) * (-711.025) [-714.906] (-712.627) (-701.477) -- 0:02:13
427000 -- (-711.492) [-713.093] (-711.186) (-706.359) * (-710.878) (-711.135) (-716.744) [-706.273] -- 0:02:12
428000 -- (-718.879) [-705.097] (-712.321) (-707.110) * (-716.845) [-705.912] (-713.819) (-702.854) -- 0:02:12
429000 -- (-704.926) (-704.481) (-718.086) [-701.921] * (-714.898) [-705.576] (-711.148) (-713.229) -- 0:02:11
430000 -- (-702.909) (-712.667) (-708.603) [-702.327] * (-717.756) [-707.840] (-720.625) (-703.450) -- 0:02:12
Average standard deviation of split frequencies: 0.007078
431000 -- (-707.162) (-709.885) (-713.714) [-716.808] * (-718.909) (-707.394) (-712.413) [-708.116] -- 0:02:12
432000 -- (-715.397) (-710.939) (-706.555) [-705.087] * (-709.315) [-709.879] (-725.189) (-711.044) -- 0:02:11
433000 -- (-708.117) (-712.272) [-714.807] (-712.105) * [-711.037] (-700.409) (-715.630) (-706.474) -- 0:02:10
434000 -- (-718.843) (-712.421) (-706.056) [-705.033] * (-718.989) [-705.292] (-725.759) (-706.012) -- 0:02:11
435000 -- (-715.246) (-713.288) (-715.191) [-704.195] * (-713.106) (-706.064) [-712.527] (-714.954) -- 0:02:11
Average standard deviation of split frequencies: 0.007496
436000 -- (-714.293) [-705.424] (-711.619) (-708.457) * (-706.056) [-706.580] (-712.024) (-719.078) -- 0:02:10
437000 -- (-708.697) (-711.824) [-703.315] (-709.793) * (-706.880) (-707.188) [-709.762] (-710.052) -- 0:02:10
438000 -- [-711.039] (-712.926) (-710.740) (-703.633) * [-706.075] (-713.706) (-711.156) (-707.600) -- 0:02:10
439000 -- (-713.032) [-709.536] (-710.700) (-708.483) * [-706.687] (-711.161) (-701.977) (-713.907) -- 0:02:10
440000 -- (-705.542) (-712.854) (-711.345) [-710.296] * (-711.401) (-706.592) [-711.780] (-715.645) -- 0:02:09
Average standard deviation of split frequencies: 0.007702
441000 -- [-712.888] (-710.655) (-708.759) (-714.496) * (-702.124) [-712.813] (-712.444) (-709.522) -- 0:02:09
442000 -- [-711.850] (-703.564) (-707.864) (-705.724) * (-718.096) [-709.202] (-704.061) (-716.102) -- 0:02:08
443000 -- [-708.055] (-708.548) (-707.352) (-713.227) * (-708.292) (-715.671) [-704.505] (-711.750) -- 0:02:09
444000 -- (-711.060) (-715.532) (-701.542) [-707.765] * (-707.736) [-703.842] (-713.827) (-714.026) -- 0:02:08
445000 -- (-719.256) (-707.895) (-713.174) [-705.976] * (-715.614) [-704.074] (-712.973) (-709.954) -- 0:02:08
Average standard deviation of split frequencies: 0.007399
446000 -- (-710.429) (-714.966) [-706.205] (-716.582) * (-719.314) [-708.597] (-708.345) (-704.091) -- 0:02:07
447000 -- (-714.911) (-719.511) [-711.584] (-715.681) * (-708.924) [-708.260] (-707.693) (-703.854) -- 0:02:08
448000 -- (-712.985) [-703.502] (-712.319) (-707.792) * (-714.904) [-706.374] (-711.442) (-705.708) -- 0:02:08
449000 -- (-701.366) [-707.120] (-719.447) (-716.384) * [-705.943] (-707.749) (-707.481) (-705.837) -- 0:02:07
450000 -- (-701.986) (-712.722) [-706.509] (-712.789) * [-707.428] (-708.300) (-704.670) (-711.652) -- 0:02:07
Average standard deviation of split frequencies: 0.006764
451000 -- [-707.238] (-709.144) (-710.943) (-714.645) * [-710.107] (-707.759) (-713.403) (-712.317) -- 0:02:06
452000 -- (-716.335) (-706.500) [-707.255] (-709.451) * (-712.429) [-708.187] (-730.256) (-710.830) -- 0:02:07
453000 -- (-716.626) (-717.028) (-711.360) [-703.256] * (-709.203) [-714.635] (-713.765) (-708.547) -- 0:02:06
454000 -- (-715.662) (-713.423) [-705.854] (-709.605) * (-705.020) [-716.078] (-715.062) (-710.206) -- 0:02:06
455000 -- (-712.622) [-707.174] (-702.545) (-705.198) * (-707.926) (-714.266) (-706.011) [-705.775] -- 0:02:05
Average standard deviation of split frequencies: 0.006341
456000 -- (-714.631) [-716.558] (-708.227) (-708.471) * (-709.279) [-711.281] (-707.064) (-711.262) -- 0:02:06
457000 -- (-712.762) (-710.011) [-713.032] (-712.794) * (-715.345) (-714.810) (-709.504) [-709.636] -- 0:02:05
458000 -- (-705.845) [-704.567] (-715.784) (-702.707) * [-712.863] (-711.657) (-715.363) (-710.753) -- 0:02:05
459000 -- (-711.561) (-706.967) [-704.334] (-716.783) * (-713.266) (-712.304) [-715.045] (-717.921) -- 0:02:04
460000 -- (-704.996) (-705.641) [-711.146] (-716.850) * [-698.160] (-708.110) (-705.697) (-715.257) -- 0:02:05
Average standard deviation of split frequencies: 0.007095
461000 -- (-712.054) (-709.098) (-708.264) [-711.501] * (-714.551) (-708.050) (-714.400) [-705.419] -- 0:02:05
462000 -- (-701.879) (-708.387) [-717.785] (-711.849) * (-708.643) [-712.425] (-715.547) (-706.287) -- 0:02:04
463000 -- (-708.592) (-721.589) (-704.008) [-704.309] * (-714.218) (-712.023) [-711.437] (-710.599) -- 0:02:04
464000 -- [-705.389] (-707.670) (-706.835) (-709.217) * [-703.492] (-707.883) (-710.685) (-713.605) -- 0:02:03
465000 -- (-708.061) (-715.374) [-709.234] (-706.624) * [-709.455] (-713.814) (-708.503) (-717.398) -- 0:02:04
Average standard deviation of split frequencies: 0.007149
466000 -- (-709.790) (-715.625) (-705.606) [-707.327] * (-710.257) [-708.777] (-704.329) (-709.854) -- 0:02:03
467000 -- (-718.406) (-700.224) (-710.829) [-707.943] * (-705.688) (-706.334) [-707.594] (-705.749) -- 0:02:03
468000 -- (-712.528) (-715.111) (-712.307) [-700.564] * (-703.988) (-707.833) (-705.102) [-705.856] -- 0:02:02
469000 -- (-704.674) [-710.615] (-715.451) (-708.117) * (-712.845) [-710.351] (-720.490) (-721.078) -- 0:02:03
470000 -- (-713.109) (-717.476) (-713.804) [-706.994] * [-707.565] (-712.488) (-706.011) (-709.105) -- 0:02:02
Average standard deviation of split frequencies: 0.007211
471000 -- (-711.225) [-705.023] (-711.006) (-712.605) * (-717.195) (-710.694) (-722.575) [-706.873] -- 0:02:02
472000 -- (-706.086) (-700.033) [-708.541] (-712.365) * [-712.290] (-710.431) (-714.869) (-713.303) -- 0:02:01
473000 -- (-711.490) (-703.712) [-711.446] (-711.546) * (-710.324) (-713.509) [-710.981] (-709.215) -- 0:02:01
474000 -- (-711.798) (-706.710) (-706.092) [-708.955] * (-705.991) (-707.886) (-711.911) [-704.448] -- 0:02:02
475000 -- (-707.892) (-712.341) [-708.294] (-714.753) * (-711.040) (-712.987) (-709.201) [-707.976] -- 0:02:01
Average standard deviation of split frequencies: 0.007329
476000 -- (-714.748) (-708.580) [-704.180] (-720.982) * (-715.742) (-708.723) [-704.800] (-708.121) -- 0:02:01
477000 -- (-719.058) (-713.071) (-714.776) [-717.585] * (-718.713) [-712.869] (-703.761) (-705.605) -- 0:02:01
478000 -- [-715.323] (-712.418) (-709.866) (-720.109) * (-709.702) (-712.763) [-711.510] (-713.370) -- 0:02:01
479000 -- [-707.158] (-713.149) (-709.601) (-726.114) * (-706.481) (-706.212) (-709.453) [-701.655] -- 0:02:00
480000 -- (-714.174) [-704.319] (-712.164) (-723.563) * (-703.043) (-716.005) [-707.326] (-709.952) -- 0:02:00
Average standard deviation of split frequencies: 0.006800
481000 -- (-712.105) (-703.565) (-717.132) [-708.892] * [-702.620] (-697.165) (-709.237) (-704.138) -- 0:01:59
482000 -- [-707.872] (-706.753) (-722.163) (-708.027) * [-706.158] (-705.176) (-714.940) (-711.071) -- 0:02:00
483000 -- (-712.314) (-704.821) (-719.742) [-704.791] * (-710.064) [-706.283] (-706.465) (-711.812) -- 0:01:59
484000 -- (-714.463) (-705.481) [-712.149] (-707.514) * (-709.906) [-707.852] (-709.896) (-715.348) -- 0:01:59
485000 -- (-722.079) (-711.011) [-709.490] (-708.515) * [-712.272] (-713.322) (-705.586) (-722.803) -- 0:01:58
Average standard deviation of split frequencies: 0.006854
486000 -- (-708.499) (-715.100) [-707.402] (-704.932) * (-706.396) (-718.752) [-711.078] (-712.547) -- 0:01:59
487000 -- (-717.289) (-714.915) [-704.647] (-709.117) * [-702.879] (-713.940) (-711.676) (-710.900) -- 0:01:59
488000 -- (-706.942) (-707.887) (-716.277) [-715.412] * (-716.184) (-712.232) [-709.469] (-703.063) -- 0:01:58
489000 -- [-705.506] (-713.348) (-723.463) (-707.694) * (-705.585) [-713.478] (-706.701) (-717.104) -- 0:01:58
490000 -- (-709.156) (-718.397) (-717.049) [-706.473] * [-709.773] (-704.961) (-714.568) (-705.346) -- 0:01:57
Average standard deviation of split frequencies: 0.007174
491000 -- [-702.760] (-710.796) (-714.990) (-709.455) * (-717.605) (-712.481) (-705.789) [-712.948] -- 0:01:58
492000 -- (-714.154) [-705.182] (-715.549) (-705.059) * (-706.056) (-711.540) [-707.421] (-707.253) -- 0:01:57
493000 -- (-712.054) [-704.584] (-711.684) (-717.901) * [-710.291] (-701.825) (-708.254) (-710.576) -- 0:01:57
494000 -- (-712.698) (-708.019) (-714.480) [-703.468] * (-705.144) [-707.272] (-717.048) (-709.039) -- 0:01:56
495000 -- (-719.803) [-705.731] (-724.336) (-715.599) * (-705.839) [-708.986] (-708.884) (-705.522) -- 0:01:57
Average standard deviation of split frequencies: 0.007160
496000 -- [-710.034] (-707.092) (-717.143) (-701.723) * (-708.240) (-708.492) (-705.779) [-709.481] -- 0:01:56
497000 -- (-709.778) [-708.274] (-707.806) (-717.124) * (-713.180) [-707.691] (-704.812) (-696.542) -- 0:01:56
498000 -- (-711.968) (-709.512) [-703.261] (-717.342) * [-712.464] (-705.190) (-722.457) (-713.493) -- 0:01:55
499000 -- (-710.300) [-708.241] (-716.876) (-721.640) * (-715.246) (-711.290) (-714.656) [-706.524] -- 0:01:56
500000 -- (-711.857) [-704.395] (-708.763) (-705.474) * (-722.091) [-705.044] (-716.057) (-706.886) -- 0:01:56
Average standard deviation of split frequencies: 0.007030
501000 -- (-710.891) (-706.740) (-723.936) [-711.322] * (-719.239) (-706.046) [-715.497] (-713.771) -- 0:01:55
502000 -- (-708.046) [-706.326] (-710.524) (-713.041) * (-713.606) (-703.941) (-715.313) [-701.181] -- 0:01:55
503000 -- (-710.325) [-704.302] (-718.084) (-706.624) * (-716.109) (-707.695) (-711.237) [-703.793] -- 0:01:54
504000 -- [-709.027] (-714.491) (-708.214) (-718.109) * (-707.688) [-707.090] (-708.206) (-712.611) -- 0:01:55
505000 -- (-714.411) (-708.499) (-707.060) [-701.069] * (-706.646) (-705.461) [-709.467] (-724.380) -- 0:01:54
Average standard deviation of split frequencies: 0.007080
506000 -- (-711.911) (-705.355) [-708.851] (-709.396) * (-707.491) (-710.621) (-710.089) [-712.756] -- 0:01:54
507000 -- (-725.792) (-707.606) (-703.036) [-706.516] * (-717.608) [-714.814] (-728.443) (-710.576) -- 0:01:53
508000 -- (-716.009) (-711.255) [-701.448] (-718.257) * (-720.296) (-720.103) [-708.435] (-718.158) -- 0:01:54
509000 -- [-715.658] (-714.220) (-704.919) (-714.733) * (-709.383) (-704.905) [-703.563] (-712.058) -- 0:01:53
510000 -- (-710.651) (-709.900) (-707.852) [-707.910] * (-713.591) (-717.531) (-709.303) [-706.497] -- 0:01:53
Average standard deviation of split frequencies: 0.007693
511000 -- [-704.708] (-717.610) (-705.154) (-709.398) * (-704.987) [-705.940] (-711.870) (-705.777) -- 0:01:52
512000 -- (-709.487) (-712.633) (-709.963) [-706.953] * (-709.900) (-723.676) (-706.707) [-704.439] -- 0:01:53
513000 -- [-710.315] (-722.592) (-715.817) (-711.383) * (-709.999) [-707.286] (-711.407) (-710.555) -- 0:01:52
514000 -- (-705.160) (-727.011) (-714.379) [-710.496] * [-702.144] (-708.822) (-707.589) (-717.484) -- 0:01:52
515000 -- (-702.859) [-710.183] (-712.013) (-706.986) * (-706.447) [-706.056] (-707.074) (-711.730) -- 0:01:52
Average standard deviation of split frequencies: 0.008039
516000 -- (-703.226) [-701.311] (-704.613) (-713.390) * [-705.361] (-713.088) (-708.701) (-716.892) -- 0:01:51
517000 -- (-705.394) [-706.262] (-707.037) (-708.455) * [-709.265] (-704.208) (-714.575) (-711.093) -- 0:01:52
518000 -- [-710.518] (-709.897) (-712.707) (-709.886) * (-708.768) [-710.113] (-706.735) (-705.622) -- 0:01:51
519000 -- (-706.465) (-711.187) [-704.111] (-712.301) * (-708.590) [-709.606] (-709.882) (-715.135) -- 0:01:51
520000 -- (-703.340) [-707.234] (-703.690) (-714.688) * (-711.906) (-712.794) [-701.068] (-714.117) -- 0:01:50
Average standard deviation of split frequencies: 0.007303
521000 -- (-708.434) (-709.539) (-712.424) [-712.054] * (-707.627) (-712.458) [-707.049] (-718.278) -- 0:01:51
522000 -- (-712.798) (-710.869) (-711.865) [-707.961] * (-710.065) [-706.990] (-716.519) (-717.557) -- 0:01:50
523000 -- [-710.665] (-709.848) (-714.043) (-705.447) * (-713.514) (-714.690) (-704.747) [-705.315] -- 0:01:50
524000 -- (-709.270) (-718.474) (-707.995) [-708.428] * (-713.579) (-713.639) (-713.283) [-712.725] -- 0:01:49
525000 -- (-704.439) [-710.694] (-715.904) (-718.719) * (-714.884) (-713.821) [-710.639] (-710.905) -- 0:01:50
Average standard deviation of split frequencies: 0.007528
526000 -- [-710.396] (-713.829) (-708.413) (-713.721) * (-708.823) [-706.278] (-709.964) (-708.488) -- 0:01:49
527000 -- (-709.242) (-717.567) [-707.144] (-712.729) * (-712.343) [-710.593] (-713.852) (-707.197) -- 0:01:49
528000 -- (-712.667) (-706.246) (-704.427) [-704.089] * (-717.000) [-704.204] (-711.599) (-708.262) -- 0:01:49
529000 -- (-706.938) [-709.838] (-706.001) (-710.459) * [-711.325] (-712.058) (-710.687) (-711.564) -- 0:01:49
530000 -- [-708.730] (-713.987) (-712.118) (-711.008) * (-709.170) [-711.199] (-713.211) (-710.483) -- 0:01:49
Average standard deviation of split frequencies: 0.007284
531000 -- (-709.765) [-704.823] (-719.342) (-710.739) * [-704.985] (-717.927) (-718.618) (-706.247) -- 0:01:48
532000 -- (-717.739) (-704.461) (-704.475) [-706.429] * (-714.740) (-709.226) (-714.229) [-709.330] -- 0:01:48
533000 -- [-711.665] (-710.202) (-726.921) (-715.999) * (-709.453) (-711.463) [-701.030] (-719.704) -- 0:01:47
534000 -- [-709.474] (-707.958) (-711.593) (-709.749) * (-716.824) [-711.356] (-706.209) (-717.171) -- 0:01:48
535000 -- (-713.182) (-709.015) (-722.360) [-709.921] * [-711.988] (-712.326) (-712.990) (-699.656) -- 0:01:47
Average standard deviation of split frequencies: 0.007329
536000 -- (-703.863) (-706.189) (-723.762) [-708.014] * [-706.285] (-719.184) (-709.349) (-711.967) -- 0:01:47
537000 -- [-706.325] (-708.316) (-712.311) (-712.500) * (-709.438) (-709.998) (-704.941) [-708.963] -- 0:01:46
538000 -- (-707.594) [-708.302] (-710.507) (-703.793) * (-713.372) (-707.439) (-707.269) [-698.512] -- 0:01:47
539000 -- (-720.122) (-716.456) [-710.096] (-709.103) * (-706.974) (-717.738) (-711.298) [-708.126] -- 0:01:46
540000 -- (-707.445) (-708.701) (-708.371) [-703.990] * (-709.128) (-707.098) [-710.279] (-708.690) -- 0:01:46
Average standard deviation of split frequencies: 0.006685
541000 -- (-707.201) (-707.582) (-716.911) [-704.097] * (-711.311) (-710.820) [-706.225] (-707.193) -- 0:01:46
542000 -- (-709.523) (-710.974) [-709.485] (-723.296) * (-716.819) (-716.340) (-711.661) [-708.490] -- 0:01:46
543000 -- (-704.928) (-710.019) [-708.797] (-715.938) * (-714.073) [-709.560] (-709.403) (-710.855) -- 0:01:46
544000 -- (-700.779) (-706.016) [-708.867] (-704.807) * (-718.196) [-706.194] (-710.675) (-717.516) -- 0:01:45
545000 -- (-723.513) (-710.911) [-705.204] (-711.172) * (-722.477) (-701.989) [-703.679] (-710.421) -- 0:01:45
Average standard deviation of split frequencies: 0.006274
546000 -- [-706.508] (-713.184) (-710.409) (-720.368) * (-718.308) (-708.215) [-708.417] (-704.562) -- 0:01:44
547000 -- (-711.662) [-705.441] (-726.835) (-715.034) * (-713.027) [-711.165] (-720.848) (-704.099) -- 0:01:45
548000 -- [-711.423] (-710.226) (-702.619) (-716.510) * (-717.217) [-703.351] (-712.379) (-705.067) -- 0:01:44
549000 -- (-703.610) [-711.769] (-710.811) (-714.167) * (-720.858) (-706.079) (-721.105) [-711.554] -- 0:01:44
550000 -- (-713.935) [-712.192] (-706.581) (-707.761) * (-707.922) (-712.087) [-707.785] (-719.713) -- 0:01:43
Average standard deviation of split frequencies: 0.006278
551000 -- (-709.691) (-715.063) (-709.245) [-715.694] * (-716.141) [-703.006] (-713.009) (-710.227) -- 0:01:44
552000 -- [-706.133] (-709.755) (-708.827) (-711.462) * (-704.740) (-718.806) (-710.744) [-712.995] -- 0:01:43
553000 -- (-702.296) (-719.520) (-712.682) [-709.139] * (-712.237) (-714.525) [-714.563] (-716.412) -- 0:01:43
554000 -- (-705.494) (-708.505) [-706.176] (-710.069) * (-720.190) [-709.574] (-717.699) (-714.470) -- 0:01:43
555000 -- (-709.257) (-703.395) [-720.803] (-710.676) * (-707.799) (-715.208) (-710.347) [-713.159] -- 0:01:43
Average standard deviation of split frequencies: 0.006839
556000 -- (-719.889) (-701.738) [-706.775] (-708.030) * (-709.678) (-717.482) (-703.755) [-707.399] -- 0:01:43
557000 -- (-713.189) [-708.824] (-711.918) (-707.094) * (-717.350) [-710.607] (-708.590) (-708.670) -- 0:01:42
558000 -- (-715.237) [-713.162] (-707.465) (-708.581) * (-709.052) (-714.932) (-701.619) [-706.451] -- 0:01:42
559000 -- (-706.414) [-708.672] (-710.391) (-715.236) * [-710.520] (-704.360) (-708.986) (-718.390) -- 0:01:42
560000 -- [-712.588] (-714.344) (-714.535) (-710.460) * (-710.450) (-715.045) [-705.006] (-705.718) -- 0:01:42
Average standard deviation of split frequencies: 0.006502
561000 -- (-706.763) (-709.308) (-708.724) [-711.102] * (-712.649) [-710.124] (-712.207) (-715.795) -- 0:01:41
562000 -- (-713.591) (-708.254) [-703.589] (-725.017) * (-707.734) (-705.872) [-714.284] (-709.250) -- 0:01:41
563000 -- (-705.373) (-704.475) [-704.650] (-715.541) * (-713.120) (-718.451) (-703.953) [-709.414] -- 0:01:40
564000 -- [-711.502] (-714.138) (-709.409) (-716.141) * (-714.615) (-707.923) (-706.343) [-708.256] -- 0:01:41
565000 -- (-705.473) (-711.278) [-703.255] (-710.272) * (-709.596) (-716.236) (-716.839) [-706.537] -- 0:01:40
Average standard deviation of split frequencies: 0.006774
566000 -- (-706.961) [-705.652] (-706.602) (-709.821) * (-706.523) (-708.304) [-715.965] (-714.788) -- 0:01:40
567000 -- (-717.074) [-706.316] (-703.431) (-702.251) * (-711.278) (-707.996) (-709.438) [-706.951] -- 0:01:40
568000 -- (-706.952) [-712.981] (-705.518) (-707.703) * [-701.969] (-712.394) (-709.591) (-720.107) -- 0:01:40
569000 -- [-702.804] (-708.033) (-715.381) (-720.732) * [-705.323] (-704.078) (-715.174) (-712.566) -- 0:01:39
570000 -- [-707.485] (-711.668) (-705.118) (-709.181) * (-704.078) (-708.509) [-710.517] (-711.280) -- 0:01:39
Average standard deviation of split frequencies: 0.006168
571000 -- (-712.880) [-710.124] (-708.234) (-713.334) * (-703.584) (-704.666) (-709.984) [-712.849] -- 0:01:39
572000 -- (-711.919) [-701.822] (-704.567) (-707.446) * (-703.728) [-708.913] (-715.109) (-709.680) -- 0:01:39
573000 -- (-717.199) [-712.729] (-707.245) (-714.293) * (-709.023) (-707.517) (-708.334) [-709.448] -- 0:01:39
574000 -- (-705.458) (-711.624) (-707.130) [-705.029] * (-710.533) [-713.681] (-709.641) (-719.806) -- 0:01:38
575000 -- (-706.744) (-714.289) (-710.831) [-707.033] * [-707.040] (-700.608) (-702.608) (-710.907) -- 0:01:38
Average standard deviation of split frequencies: 0.005947
576000 -- [-705.145] (-704.959) (-704.831) (-702.944) * (-713.913) (-704.186) (-717.415) [-706.538] -- 0:01:38
577000 -- (-704.717) (-717.696) (-705.295) [-705.558] * [-708.432] (-712.567) (-711.910) (-706.499) -- 0:01:38
578000 -- [-705.035] (-708.817) (-707.219) (-705.607) * (-721.049) [-712.873] (-702.064) (-718.004) -- 0:01:37
579000 -- (-721.224) (-703.431) (-704.887) [-713.535] * [-703.793] (-718.553) (-703.540) (-704.006) -- 0:01:37
580000 -- [-712.416] (-715.943) (-713.846) (-707.247) * (-717.081) [-706.935] (-709.807) (-705.970) -- 0:01:37
Average standard deviation of split frequencies: 0.006441
581000 -- (-709.647) [-707.784] (-711.168) (-707.001) * (-707.421) (-705.817) [-706.020] (-712.844) -- 0:01:37
582000 -- [-707.557] (-706.423) (-715.270) (-711.985) * (-718.688) (-709.217) (-704.776) [-717.355] -- 0:01:36
583000 -- [-708.544] (-723.729) (-716.034) (-703.023) * (-712.432) (-714.831) [-703.941] (-710.321) -- 0:01:36
584000 -- (-713.993) [-707.333] (-708.696) (-719.424) * (-707.090) [-707.314] (-707.342) (-710.320) -- 0:01:36
585000 -- (-704.622) (-715.579) (-715.428) [-710.672] * [-709.646] (-709.178) (-707.966) (-707.962) -- 0:01:36
Average standard deviation of split frequencies: 0.006114
586000 -- (-706.259) [-704.245] (-707.247) (-705.085) * (-711.558) [-708.174] (-710.253) (-710.407) -- 0:01:36
587000 -- [-707.801] (-707.327) (-711.694) (-705.198) * [-701.525] (-717.022) (-715.188) (-703.299) -- 0:01:35
588000 -- (-703.512) [-707.121] (-715.301) (-711.203) * [-709.882] (-708.754) (-709.168) (-709.402) -- 0:01:35
589000 -- [-707.003] (-709.432) (-719.799) (-715.889) * (-711.366) (-715.238) (-713.249) [-705.750] -- 0:01:35
590000 -- (-706.072) (-709.797) (-708.906) [-712.729] * [-711.079] (-707.559) (-706.574) (-702.788) -- 0:01:35
Average standard deviation of split frequencies: 0.005906
591000 -- (-704.325) [-709.839] (-713.370) (-707.398) * (-713.594) (-709.674) [-710.774] (-713.357) -- 0:01:34
592000 -- (-703.132) (-713.691) [-715.883] (-716.564) * (-712.697) (-712.543) [-710.380] (-708.289) -- 0:01:34
593000 -- (-712.157) (-711.173) (-711.812) [-702.554] * (-709.408) (-717.657) (-706.463) [-705.620] -- 0:01:34
594000 -- (-719.282) (-712.844) (-715.132) [-706.831] * (-708.292) (-717.058) (-711.636) [-703.928] -- 0:01:34
595000 -- (-714.865) [-708.315] (-715.638) (-720.216) * (-714.137) (-714.979) (-715.769) [-711.468] -- 0:01:33
Average standard deviation of split frequencies: 0.005906
596000 -- (-717.225) (-716.349) [-701.974] (-717.982) * [-702.912] (-710.306) (-708.434) (-712.351) -- 0:01:33
597000 -- [-706.172] (-712.631) (-705.416) (-710.562) * (-705.083) (-710.549) (-707.208) [-707.603] -- 0:01:33
598000 -- [-715.100] (-713.668) (-704.988) (-714.295) * [-706.668] (-703.010) (-709.822) (-712.170) -- 0:01:33
599000 -- (-712.636) [-712.975] (-703.611) (-709.313) * (-714.132) (-708.336) [-702.623] (-712.645) -- 0:01:33
600000 -- [-711.080] (-709.888) (-706.208) (-709.756) * [-705.963] (-710.689) (-704.757) (-718.850) -- 0:01:32
Average standard deviation of split frequencies: 0.005703
601000 -- (-713.510) (-704.095) [-709.591] (-711.177) * (-702.290) (-714.900) (-723.482) [-709.917] -- 0:01:32
602000 -- (-709.249) [-707.785] (-704.278) (-707.982) * [-708.525] (-709.508) (-705.896) (-713.606) -- 0:01:31
603000 -- (-713.342) (-708.546) (-704.784) [-704.941] * (-703.580) (-708.675) (-714.265) [-706.755] -- 0:01:32
604000 -- [-711.037] (-722.568) (-706.358) (-709.080) * (-712.085) [-707.197] (-712.330) (-702.636) -- 0:01:31
605000 -- (-714.289) [-708.186] (-708.827) (-718.095) * [-705.528] (-711.986) (-713.055) (-701.591) -- 0:01:31
Average standard deviation of split frequencies: 0.005342
606000 -- (-717.788) [-713.918] (-701.719) (-715.675) * (-713.234) (-705.751) (-710.565) [-711.991] -- 0:01:31
607000 -- (-708.614) (-720.160) [-711.568] (-705.649) * (-697.463) (-712.856) [-703.419] (-709.006) -- 0:01:31
608000 -- (-706.663) (-730.770) [-705.035] (-710.607) * [-697.972] (-712.700) (-711.453) (-707.383) -- 0:01:30
609000 -- [-703.286] (-708.387) (-707.072) (-714.215) * [-705.926] (-714.543) (-716.168) (-715.365) -- 0:01:30
610000 -- (-710.239) (-709.096) (-710.709) [-718.423] * (-712.942) (-704.193) [-708.446] (-713.597) -- 0:01:30
Average standard deviation of split frequencies: 0.004992
611000 -- (-716.967) (-710.623) [-711.134] (-711.568) * (-714.672) (-710.590) (-712.813) [-712.770] -- 0:01:30
612000 -- (-710.200) (-713.291) (-708.040) [-701.884] * [-710.554] (-709.198) (-712.416) (-705.670) -- 0:01:30
613000 -- [-710.657] (-709.442) (-716.456) (-711.663) * (-710.458) (-711.446) [-701.833] (-715.877) -- 0:01:29
614000 -- (-703.985) [-705.294] (-714.478) (-716.733) * [-716.835] (-706.980) (-703.458) (-703.070) -- 0:01:29
615000 -- (-703.716) (-711.300) [-703.788] (-706.523) * (-715.300) [-713.190] (-708.760) (-707.589) -- 0:01:29
Average standard deviation of split frequencies: 0.005051
616000 -- (-717.264) [-702.524] (-714.832) (-709.277) * (-711.297) (-710.283) (-712.541) [-713.104] -- 0:01:29
617000 -- (-702.639) [-708.709] (-717.805) (-709.111) * (-718.744) (-708.378) (-712.498) [-708.930] -- 0:01:28
618000 -- (-709.639) (-720.006) [-711.775] (-699.631) * (-703.632) (-707.351) (-707.096) [-706.858] -- 0:01:28
619000 -- (-707.006) (-707.222) (-707.299) [-707.848] * (-718.751) (-704.676) (-713.352) [-712.017] -- 0:01:28
620000 -- (-709.755) (-716.140) (-708.073) [-707.094] * [-708.257] (-711.026) (-714.180) (-705.508) -- 0:01:28
Average standard deviation of split frequencies: 0.005266
621000 -- (-712.082) [-720.377] (-707.005) (-710.198) * (-711.916) (-713.164) (-712.564) [-709.697] -- 0:01:27
622000 -- (-718.253) (-706.920) [-705.216] (-704.166) * (-713.592) [-708.677] (-718.602) (-713.958) -- 0:01:27
623000 -- (-724.972) [-717.622] (-713.092) (-705.728) * (-713.398) [-708.718] (-716.977) (-710.390) -- 0:01:27
624000 -- (-713.810) (-710.356) (-711.916) [-707.569] * (-704.583) (-709.476) (-720.262) [-718.068] -- 0:01:27
625000 -- (-715.743) (-713.823) (-703.782) [-704.077] * [-709.141] (-712.369) (-708.060) (-711.232) -- 0:01:27
Average standard deviation of split frequencies: 0.005673
626000 -- (-705.006) (-714.327) (-712.970) [-704.112] * [-708.197] (-720.497) (-709.796) (-706.583) -- 0:01:26
627000 -- (-719.538) (-710.279) [-704.176] (-705.597) * (-708.606) (-704.062) (-716.097) [-708.016] -- 0:01:26
628000 -- (-706.614) [-712.619] (-712.431) (-714.131) * [-704.427] (-711.755) (-707.733) (-719.213) -- 0:01:26
629000 -- (-699.760) (-715.940) [-703.864] (-712.739) * (-705.932) [-706.217] (-706.809) (-710.893) -- 0:01:26
630000 -- (-704.735) [-715.764] (-713.205) (-709.498) * [-712.363] (-719.449) (-708.651) (-703.499) -- 0:01:25
Average standard deviation of split frequencies: 0.005531
631000 -- (-700.059) (-707.527) [-701.863] (-716.128) * (-711.748) (-707.480) [-706.835] (-713.454) -- 0:01:25
632000 -- (-710.939) (-708.732) [-700.505] (-713.937) * (-709.616) (-706.991) (-721.416) [-709.473] -- 0:01:25
633000 -- (-708.917) (-710.999) [-705.555] (-710.026) * (-704.044) (-705.964) (-709.391) [-706.705] -- 0:01:25
634000 -- (-719.469) [-704.780] (-708.859) (-707.830) * (-710.297) (-709.122) [-703.995] (-707.503) -- 0:01:24
635000 -- (-715.784) (-715.012) (-711.850) [-703.379] * [-707.813] (-707.810) (-703.060) (-707.586) -- 0:01:24
Average standard deviation of split frequencies: 0.005435
636000 -- (-711.072) (-710.058) (-713.847) [-705.241] * (-711.887) (-708.426) (-705.478) [-707.496] -- 0:01:24
637000 -- (-706.848) (-710.882) [-712.798] (-711.902) * (-710.091) (-716.884) (-709.689) [-704.364] -- 0:01:24
638000 -- [-705.416] (-700.191) (-704.056) (-715.058) * (-715.106) (-705.402) (-713.923) [-708.762] -- 0:01:23
639000 -- (-723.599) (-707.114) [-705.872] (-716.224) * (-712.196) (-708.102) [-700.594] (-710.552) -- 0:01:23
640000 -- (-706.718) (-716.917) [-706.364] (-712.849) * (-705.040) [-702.113] (-701.822) (-713.861) -- 0:01:23
Average standard deviation of split frequencies: 0.005592
641000 -- (-707.956) (-708.980) [-707.009] (-702.256) * (-701.517) (-714.289) [-715.136] (-718.538) -- 0:01:23
642000 -- (-708.248) [-704.502] (-709.445) (-706.716) * (-709.663) [-706.368] (-708.392) (-730.068) -- 0:01:23
643000 -- [-707.037] (-720.010) (-710.675) (-714.190) * (-720.100) [-713.185] (-717.283) (-711.434) -- 0:01:22
644000 -- (-711.202) (-707.299) (-712.426) [-707.222] * [-703.875] (-710.863) (-715.764) (-711.282) -- 0:01:22
645000 -- (-717.386) [-708.118] (-712.287) (-710.587) * [-709.919] (-708.040) (-714.984) (-708.396) -- 0:01:22
Average standard deviation of split frequencies: 0.005254
646000 -- (-723.449) [-702.910] (-717.252) (-718.786) * [-707.579] (-725.292) (-707.413) (-711.879) -- 0:01:22
647000 -- [-707.749] (-713.461) (-711.081) (-704.828) * (-712.924) (-718.232) [-706.714] (-705.259) -- 0:01:21
648000 -- (-709.978) (-707.916) [-706.734] (-717.889) * (-705.813) [-714.504] (-705.905) (-709.127) -- 0:01:21
649000 -- (-712.712) [-705.917] (-707.774) (-711.643) * (-715.950) (-715.054) [-703.245] (-713.442) -- 0:01:21
650000 -- (-707.552) [-704.969] (-712.656) (-708.504) * (-706.647) [-709.808] (-702.124) (-707.342) -- 0:01:21
Average standard deviation of split frequencies: 0.005554
651000 -- (-710.588) [-708.444] (-712.268) (-706.882) * (-706.885) (-701.679) [-704.388] (-710.664) -- 0:01:20
652000 -- (-711.551) (-708.548) (-707.059) [-704.495] * [-705.363] (-708.382) (-715.167) (-721.436) -- 0:01:20
653000 -- (-703.059) (-712.447) (-717.103) [-701.745] * (-703.485) (-704.317) [-705.038] (-711.500) -- 0:01:20
654000 -- (-713.818) [-705.805] (-711.100) (-707.040) * (-716.970) [-718.814] (-714.585) (-703.876) -- 0:01:20
655000 -- (-709.197) (-718.694) (-722.465) [-701.458] * (-718.293) (-712.193) [-701.126] (-709.028) -- 0:01:20
Average standard deviation of split frequencies: 0.005270
656000 -- (-707.757) (-715.828) [-706.550] (-707.305) * [-715.478] (-710.501) (-706.847) (-703.911) -- 0:01:19
657000 -- (-720.666) (-709.088) [-707.452] (-706.408) * [-709.163] (-713.677) (-712.549) (-705.879) -- 0:01:19
658000 -- [-707.811] (-717.577) (-705.443) (-714.219) * (-708.270) [-706.267] (-710.468) (-708.980) -- 0:01:19
659000 -- (-708.270) [-706.211] (-705.400) (-717.590) * (-711.479) [-707.239] (-708.532) (-719.220) -- 0:01:19
660000 -- (-710.491) [-714.719] (-712.392) (-702.155) * (-719.156) [-707.276] (-715.966) (-705.139) -- 0:01:18
Average standard deviation of split frequencies: 0.005280
661000 -- [-705.791] (-711.956) (-711.575) (-703.148) * (-707.398) [-706.093] (-711.577) (-715.583) -- 0:01:18
662000 -- (-709.527) [-709.338] (-712.053) (-718.991) * (-709.843) (-705.581) (-702.012) [-705.458] -- 0:01:18
663000 -- (-707.940) [-713.814] (-709.661) (-711.318) * (-716.279) (-713.432) (-707.815) [-706.832] -- 0:01:18
664000 -- [-703.871] (-713.019) (-716.196) (-716.000) * (-715.128) [-703.812] (-710.476) (-711.286) -- 0:01:17
665000 -- (-704.621) [-711.048] (-709.085) (-710.340) * [-712.910] (-712.758) (-710.305) (-722.154) -- 0:01:17
Average standard deviation of split frequencies: 0.005285
666000 -- [-708.060] (-714.442) (-707.269) (-712.147) * (-717.642) (-710.601) (-709.194) [-700.494] -- 0:01:17
667000 -- (-710.568) (-710.868) [-704.656] (-711.234) * (-715.657) (-704.112) (-704.855) [-706.590] -- 0:01:17
668000 -- (-713.106) (-707.338) [-712.891] (-716.068) * (-708.565) (-712.731) [-705.036] (-709.544) -- 0:01:17
669000 -- (-715.465) (-711.997) (-705.023) [-707.743] * (-724.693) [-713.413] (-704.702) (-709.490) -- 0:01:16
670000 -- (-709.848) [-705.256] (-710.883) (-708.195) * [-710.274] (-716.124) (-712.616) (-717.708) -- 0:01:16
Average standard deviation of split frequencies: 0.004780
671000 -- [-710.238] (-712.862) (-711.096) (-701.018) * [-702.559] (-703.148) (-712.023) (-710.156) -- 0:01:16
672000 -- (-706.641) (-714.037) [-710.634] (-710.176) * (-711.789) (-701.785) (-705.654) [-710.691] -- 0:01:16
673000 -- (-718.422) (-706.102) (-709.454) [-711.063] * [-704.852] (-710.840) (-714.845) (-708.430) -- 0:01:15
674000 -- (-705.634) [-715.521] (-702.584) (-713.208) * (-716.432) (-715.280) (-721.410) [-705.717] -- 0:01:15
675000 -- (-711.369) [-709.178] (-708.772) (-712.637) * [-705.917] (-712.713) (-705.246) (-714.691) -- 0:01:15
Average standard deviation of split frequencies: 0.004556
676000 -- (-703.447) [-708.875] (-705.807) (-714.666) * (-703.485) (-711.018) (-704.958) [-719.791] -- 0:01:15
677000 -- [-707.564] (-708.572) (-707.575) (-703.293) * (-712.012) (-709.199) [-716.910] (-711.089) -- 0:01:14
678000 -- (-706.841) (-710.712) [-702.193] (-711.048) * (-712.672) (-708.484) [-706.703] (-707.116) -- 0:01:14
679000 -- (-722.249) (-706.757) [-703.359] (-706.968) * (-709.666) (-711.638) [-707.926] (-709.272) -- 0:01:14
680000 -- (-715.388) [-708.409] (-708.151) (-703.221) * (-705.455) [-710.330] (-708.105) (-720.247) -- 0:01:14
Average standard deviation of split frequencies: 0.004663
681000 -- (-711.639) (-713.769) [-704.237] (-702.790) * (-717.932) (-714.809) (-705.192) [-710.626] -- 0:01:14
682000 -- (-709.431) [-709.793] (-710.594) (-707.750) * [-709.246] (-711.166) (-710.408) (-710.803) -- 0:01:13
683000 -- [-706.857] (-724.952) (-710.513) (-705.599) * [-703.569] (-714.626) (-702.207) (-712.693) -- 0:01:13
684000 -- (-705.820) (-719.336) (-702.062) [-707.521] * [-705.164] (-715.799) (-703.742) (-706.326) -- 0:01:13
685000 -- [-706.068] (-714.706) (-713.456) (-704.994) * (-710.721) (-732.323) [-706.502] (-715.805) -- 0:01:13
Average standard deviation of split frequencies: 0.005452
686000 -- (-702.716) (-709.596) [-702.862] (-714.630) * (-706.130) (-711.414) [-706.135] (-707.992) -- 0:01:12
687000 -- (-712.490) [-703.662] (-714.822) (-710.760) * (-701.085) (-719.139) (-711.558) [-700.026] -- 0:01:12
688000 -- (-711.140) (-708.640) (-716.277) [-705.752] * [-715.998] (-700.880) (-709.239) (-706.789) -- 0:01:12
689000 -- (-715.621) [-704.738] (-710.949) (-705.506) * (-712.624) [-707.505] (-703.340) (-709.920) -- 0:01:12
690000 -- [-702.312] (-712.139) (-714.791) (-700.236) * [-705.689] (-717.803) (-712.836) (-710.031) -- 0:01:11
Average standard deviation of split frequencies: 0.004550
691000 -- [-705.093] (-716.379) (-713.092) (-710.382) * [-706.928] (-709.921) (-717.076) (-705.798) -- 0:01:11
692000 -- [-711.991] (-710.537) (-714.281) (-717.084) * [-706.907] (-707.640) (-706.268) (-718.020) -- 0:01:11
693000 -- (-709.974) (-705.414) (-713.332) [-705.863] * [-705.266] (-712.182) (-712.047) (-707.811) -- 0:01:11
694000 -- [-708.074] (-702.868) (-715.066) (-716.044) * (-702.615) [-702.779] (-721.901) (-708.377) -- 0:01:10
695000 -- (-711.304) (-708.456) (-717.593) [-710.468] * (-702.524) (-711.581) (-715.134) [-704.944] -- 0:01:10
Average standard deviation of split frequencies: 0.004290
696000 -- (-711.358) [-705.900] (-714.011) (-714.500) * (-706.443) (-718.028) [-711.203] (-705.843) -- 0:01:10
697000 -- (-713.475) (-711.977) (-717.146) [-705.965] * (-702.779) (-713.924) (-714.893) [-712.416] -- 0:01:10
698000 -- (-712.277) (-720.217) [-708.247] (-710.136) * [-712.253] (-707.231) (-725.703) (-710.494) -- 0:01:10
699000 -- (-720.685) (-708.867) (-705.821) [-707.044] * (-713.930) (-711.802) (-712.329) [-706.441] -- 0:01:09
700000 -- (-705.647) (-718.499) (-713.704) [-710.291] * [-707.170] (-704.340) (-707.116) (-705.398) -- 0:01:09
Average standard deviation of split frequencies: 0.004485
701000 -- [-701.511] (-706.094) (-705.243) (-709.879) * (-704.768) [-700.353] (-708.881) (-709.495) -- 0:01:09
702000 -- (-706.626) (-706.485) (-706.685) [-713.346] * (-710.072) (-706.373) [-709.709] (-715.225) -- 0:01:09
703000 -- (-723.430) [-712.112] (-711.195) (-710.413) * (-706.301) (-711.300) (-717.722) [-711.870] -- 0:01:08
704000 -- (-713.394) (-712.136) [-709.066] (-706.904) * (-715.186) (-708.089) [-707.236] (-712.829) -- 0:01:08
705000 -- (-699.563) [-710.107] (-712.307) (-708.278) * (-708.774) (-708.078) [-706.029] (-714.194) -- 0:01:08
Average standard deviation of split frequencies: 0.004407
706000 -- (-716.765) (-714.464) (-706.863) [-704.009] * (-712.354) (-708.721) (-706.529) [-709.171] -- 0:01:08
707000 -- (-705.612) (-710.041) [-715.800] (-715.484) * (-715.138) [-710.914] (-711.414) (-708.853) -- 0:01:07
708000 -- (-705.777) (-707.339) (-710.227) [-704.330] * [-710.139] (-705.900) (-713.433) (-723.286) -- 0:01:07
709000 -- (-709.918) (-713.261) (-714.413) [-713.827] * [-707.515] (-710.814) (-709.224) (-713.108) -- 0:01:07
710000 -- (-706.146) (-705.529) (-712.783) [-711.739] * (-710.467) (-709.296) (-711.110) [-715.508] -- 0:01:07
Average standard deviation of split frequencies: 0.004201
711000 -- (-717.107) (-710.032) (-708.683) [-710.511] * (-709.147) (-710.388) (-718.246) [-708.866] -- 0:01:07
712000 -- (-704.816) (-713.671) (-716.449) [-709.979] * (-709.811) (-709.553) [-712.965] (-707.546) -- 0:01:06
713000 -- (-711.435) [-703.536] (-709.889) (-711.338) * (-714.175) (-708.133) [-710.690] (-713.112) -- 0:01:06
714000 -- (-714.397) (-703.099) (-718.259) [-702.753] * [-700.526] (-708.486) (-707.272) (-711.554) -- 0:01:06
715000 -- (-713.096) (-712.528) [-711.631] (-700.405) * (-704.227) (-708.815) [-704.511] (-715.415) -- 0:01:06
Average standard deviation of split frequencies: 0.004345
716000 -- (-722.686) (-708.125) [-701.264] (-707.893) * (-715.167) (-710.727) (-709.690) [-711.943] -- 0:01:05
717000 -- [-708.697] (-710.670) (-715.011) (-709.972) * [-704.718] (-713.489) (-711.341) (-709.913) -- 0:01:05
718000 -- (-709.155) (-713.366) (-712.897) [-704.943] * [-709.533] (-711.457) (-717.487) (-722.497) -- 0:01:05
719000 -- (-711.947) [-707.549] (-721.859) (-716.211) * (-706.315) (-710.758) (-706.716) [-705.731] -- 0:01:05
720000 -- [-709.585] (-710.653) (-706.003) (-711.147) * [-707.006] (-717.274) (-712.052) (-711.285) -- 0:01:04
Average standard deviation of split frequencies: 0.004492
721000 -- (-710.097) [-706.453] (-707.765) (-715.031) * (-706.673) (-709.078) [-704.640] (-714.222) -- 0:01:04
722000 -- (-708.130) (-714.816) (-705.980) [-712.122] * (-711.010) (-710.550) (-704.062) [-703.285] -- 0:01:04
723000 -- (-717.200) [-704.678] (-712.016) (-707.838) * (-705.078) (-714.695) (-704.992) [-708.775] -- 0:01:04
724000 -- (-707.225) (-700.956) [-708.998] (-721.175) * (-711.683) [-709.247] (-711.244) (-712.906) -- 0:01:04
725000 -- [-701.106] (-711.470) (-711.095) (-715.994) * (-713.172) [-707.061] (-715.658) (-715.659) -- 0:01:03
Average standard deviation of split frequencies: 0.004285
726000 -- (-717.267) (-715.809) (-727.377) [-707.691] * (-708.475) (-713.438) (-717.762) [-708.171] -- 0:01:03
727000 -- (-718.508) (-712.067) [-703.984] (-706.191) * (-718.889) (-711.009) (-713.934) [-712.061] -- 0:01:03
728000 -- [-708.937] (-725.098) (-703.858) (-716.622) * (-709.450) (-707.411) (-712.708) [-706.348] -- 0:01:03
729000 -- (-711.615) (-708.752) (-717.974) [-706.290] * [-710.522] (-722.174) (-717.966) (-701.993) -- 0:01:02
730000 -- (-711.311) (-703.450) (-710.582) [-707.392] * [-702.173] (-700.157) (-713.808) (-710.340) -- 0:01:02
Average standard deviation of split frequencies: 0.003957
731000 -- (-704.262) (-703.498) (-705.548) [-709.340] * (-709.625) (-718.180) (-710.758) [-706.349] -- 0:01:02
732000 -- (-708.118) (-705.448) (-706.450) [-699.334] * [-705.953] (-705.689) (-710.214) (-713.924) -- 0:01:02
733000 -- [-703.982] (-718.265) (-706.918) (-705.869) * [-710.016] (-709.398) (-703.453) (-713.038) -- 0:01:01
734000 -- (-713.644) (-708.237) [-707.728] (-708.525) * (-708.944) (-715.265) (-709.149) [-707.429] -- 0:01:01
735000 -- (-710.504) [-704.415] (-715.018) (-730.289) * [-704.693] (-717.025) (-704.636) (-727.843) -- 0:01:01
Average standard deviation of split frequencies: 0.003629
736000 -- (-719.329) (-703.463) [-704.879] (-719.863) * (-711.524) (-707.711) [-706.089] (-712.158) -- 0:01:01
737000 -- (-715.276) (-711.158) [-703.732] (-708.392) * (-714.625) (-706.346) (-716.857) [-709.193] -- 0:01:01
738000 -- (-711.942) [-714.269] (-710.887) (-725.271) * [-705.491] (-714.420) (-708.027) (-712.529) -- 0:01:00
739000 -- (-708.585) [-706.388] (-708.864) (-716.034) * [-706.529] (-710.244) (-704.071) (-708.206) -- 0:01:00
740000 -- (-713.094) [-705.713] (-707.781) (-711.383) * (-716.032) (-705.883) [-705.004] (-711.359) -- 0:01:00
Average standard deviation of split frequencies: 0.003946
741000 -- (-707.673) (-705.959) [-707.089] (-705.796) * (-706.785) (-709.676) (-706.946) [-713.862] -- 0:01:00
742000 -- (-713.620) (-706.333) [-698.857] (-706.699) * (-718.639) (-721.352) (-711.234) [-698.364] -- 0:00:59
743000 -- (-704.820) [-698.405] (-708.863) (-705.160) * (-715.466) [-710.933] (-705.469) (-705.119) -- 0:00:59
744000 -- [-702.573] (-703.969) (-707.555) (-709.709) * (-710.245) [-703.150] (-712.264) (-711.240) -- 0:00:59
745000 -- (-703.359) [-708.359] (-710.253) (-712.552) * [-710.820] (-707.372) (-709.402) (-705.961) -- 0:00:59
Average standard deviation of split frequencies: 0.004465
746000 -- [-704.094] (-706.728) (-705.402) (-715.666) * (-705.532) (-717.075) (-707.058) [-707.103] -- 0:00:58
747000 -- (-713.960) [-707.686] (-705.482) (-713.143) * (-708.230) (-712.754) [-709.523] (-704.990) -- 0:00:58
748000 -- (-720.271) (-716.971) (-710.800) [-712.948] * (-708.245) (-711.936) (-712.272) [-713.152] -- 0:00:58
749000 -- (-714.181) (-721.156) [-707.448] (-709.939) * (-705.762) [-707.437] (-719.173) (-714.659) -- 0:00:58
750000 -- (-710.829) (-714.620) [-710.880] (-704.456) * (-708.861) (-706.574) (-703.725) [-707.978] -- 0:00:58
Average standard deviation of split frequencies: 0.004438
751000 -- (-713.382) (-708.551) (-712.315) [-709.593] * [-700.758] (-704.562) (-705.881) (-715.987) -- 0:00:57
752000 -- (-705.230) (-703.837) [-706.412] (-709.328) * (-716.165) (-706.741) (-715.645) [-707.588] -- 0:00:57
753000 -- [-710.598] (-713.013) (-717.922) (-708.323) * (-714.443) (-713.817) [-713.265] (-709.609) -- 0:00:57
754000 -- (-713.204) (-709.774) [-715.366] (-715.429) * (-714.836) (-712.573) (-715.227) [-710.919] -- 0:00:57
755000 -- (-707.874) (-700.907) (-704.195) [-708.358] * (-719.735) (-709.993) (-717.837) [-706.196] -- 0:00:56
Average standard deviation of split frequencies: 0.004074
756000 -- (-705.615) (-714.799) (-714.312) [-714.640] * (-712.514) (-713.821) (-712.847) [-714.696] -- 0:00:56
757000 -- (-716.157) (-708.818) [-706.598] (-714.986) * (-708.336) (-710.975) [-710.163] (-705.764) -- 0:00:56
758000 -- (-714.090) (-719.062) [-706.682] (-713.123) * (-718.720) (-710.462) (-706.992) [-708.356] -- 0:00:56
759000 -- (-706.220) (-714.505) [-709.448] (-706.006) * [-715.031] (-707.923) (-707.698) (-713.099) -- 0:00:55
760000 -- (-716.139) (-709.496) [-706.478] (-710.505) * [-708.158] (-713.131) (-710.545) (-709.631) -- 0:00:55
Average standard deviation of split frequencies: 0.004214
761000 -- (-706.967) [-705.584] (-709.351) (-708.549) * (-724.869) [-703.678] (-714.980) (-711.364) -- 0:00:55
762000 -- (-701.694) (-712.518) [-713.324] (-711.264) * (-703.286) [-706.228] (-700.465) (-709.026) -- 0:00:55
763000 -- (-717.728) (-710.323) [-706.713] (-709.092) * (-710.678) [-710.551] (-707.038) (-737.043) -- 0:00:54
764000 -- (-713.538) (-705.591) [-706.965] (-711.480) * (-708.297) [-704.242] (-705.654) (-707.370) -- 0:00:54
765000 -- [-705.060] (-707.784) (-702.080) (-714.672) * [-708.748] (-715.843) (-705.810) (-702.041) -- 0:00:54
Average standard deviation of split frequencies: 0.004267
766000 -- (-708.571) [-705.364] (-707.339) (-710.625) * (-726.956) (-712.729) [-703.538] (-706.640) -- 0:00:54
767000 -- [-707.433] (-716.021) (-706.245) (-711.231) * (-709.627) (-709.367) [-707.876] (-701.762) -- 0:00:54
768000 -- (-713.760) (-708.139) (-724.145) [-706.344] * (-710.969) (-714.782) (-707.738) [-710.445] -- 0:00:53
769000 -- (-710.264) (-717.475) (-707.784) [-707.632] * (-712.028) (-706.846) (-711.257) [-703.875] -- 0:00:53
770000 -- (-717.208) (-711.434) [-711.703] (-706.828) * (-714.906) (-707.432) (-707.766) [-705.260] -- 0:00:53
Average standard deviation of split frequencies: 0.004404
771000 -- (-706.853) (-709.366) (-717.829) [-708.583] * [-707.031] (-705.108) (-709.600) (-716.659) -- 0:00:53
772000 -- (-716.551) (-715.148) [-708.879] (-714.727) * (-703.971) [-706.332] (-709.307) (-721.192) -- 0:00:52
773000 -- (-723.927) [-705.021] (-708.779) (-707.747) * [-703.556] (-710.598) (-714.680) (-704.073) -- 0:00:52
774000 -- (-715.340) (-716.509) (-708.695) [-714.163] * [-710.027] (-718.262) (-703.208) (-702.781) -- 0:00:52
775000 -- [-702.662] (-702.597) (-717.723) (-704.132) * (-707.889) (-711.680) (-713.918) [-706.670] -- 0:00:52
Average standard deviation of split frequencies: 0.004414
776000 -- (-716.443) (-725.100) (-705.137) [-707.847] * [-703.222] (-716.930) (-706.920) (-715.583) -- 0:00:51
777000 -- (-714.160) (-716.606) [-706.310] (-711.244) * [-703.559] (-706.508) (-709.679) (-711.093) -- 0:00:51
778000 -- (-714.287) (-710.198) (-708.409) [-707.083] * (-707.909) [-705.280] (-714.580) (-716.417) -- 0:00:51
779000 -- [-710.899] (-707.189) (-713.244) (-720.765) * [-702.416] (-702.424) (-722.137) (-708.481) -- 0:00:51
780000 -- (-712.702) (-712.786) (-706.909) [-703.768] * (-711.546) (-705.936) (-712.617) [-708.286] -- 0:00:51
Average standard deviation of split frequencies: 0.004227
781000 -- (-711.253) (-714.872) (-715.208) [-704.424] * (-708.791) [-702.779] (-710.453) (-704.989) -- 0:00:50
782000 -- (-708.493) (-717.413) (-723.324) [-702.811] * (-712.862) [-702.818] (-712.934) (-702.638) -- 0:00:50
783000 -- [-709.532] (-718.131) (-716.239) (-707.075) * (-706.581) (-708.394) [-708.154] (-709.012) -- 0:00:50
784000 -- (-707.054) (-708.941) [-705.197] (-713.874) * (-711.060) [-706.367] (-709.405) (-709.338) -- 0:00:50
785000 -- (-718.529) (-713.529) (-712.699) [-706.453] * (-714.279) (-705.811) (-710.398) [-701.422] -- 0:00:49
Average standard deviation of split frequencies: 0.004478
786000 -- [-707.490] (-715.469) (-709.377) (-706.012) * (-710.081) (-711.493) [-710.869] (-711.406) -- 0:00:49
787000 -- (-711.291) (-712.162) (-705.586) [-706.661] * (-711.311) (-721.501) (-714.279) [-710.814] -- 0:00:49
788000 -- (-709.367) (-715.393) (-703.393) [-716.288] * (-706.519) [-710.004] (-715.959) (-702.768) -- 0:00:49
789000 -- (-713.937) [-710.743] (-709.985) (-726.279) * [-717.118] (-700.759) (-709.891) (-710.103) -- 0:00:48
790000 -- [-707.572] (-708.639) (-707.173) (-706.398) * (-708.730) (-716.337) [-715.461] (-712.417) -- 0:00:48
Average standard deviation of split frequencies: 0.004571
791000 -- [-703.774] (-715.968) (-710.304) (-704.485) * (-716.732) (-708.115) (-713.211) [-708.943] -- 0:00:48
792000 -- (-706.516) (-713.290) (-726.690) [-712.626] * [-710.650] (-707.466) (-709.742) (-709.188) -- 0:00:48
793000 -- (-714.926) (-709.123) [-713.955] (-708.558) * [-713.279] (-705.550) (-708.292) (-709.815) -- 0:00:48
794000 -- [-703.109] (-708.697) (-715.525) (-705.038) * [-710.919] (-703.273) (-708.710) (-708.987) -- 0:00:47
795000 -- (-706.503) (-707.760) [-707.376] (-705.311) * (-716.427) (-707.364) (-715.101) [-700.212] -- 0:00:47
Average standard deviation of split frequencies: 0.004461
796000 -- (-706.591) (-719.296) (-709.007) [-709.637] * (-710.839) (-713.100) [-706.984] (-707.200) -- 0:00:47
797000 -- (-709.900) (-712.891) [-705.966] (-707.748) * (-710.462) (-711.348) [-708.382] (-706.475) -- 0:00:47
798000 -- (-716.338) [-706.364] (-719.994) (-703.375) * (-713.474) (-717.433) (-712.774) [-704.255] -- 0:00:46
799000 -- (-704.805) [-706.403] (-709.766) (-708.092) * (-705.673) [-703.506] (-711.208) (-711.382) -- 0:00:46
800000 -- [-706.722] (-715.690) (-711.979) (-714.241) * (-708.335) (-707.624) (-710.152) [-708.971] -- 0:00:46
Average standard deviation of split frequencies: 0.004161
801000 -- (-700.362) (-714.570) [-712.306] (-709.115) * (-712.925) [-707.753] (-705.506) (-708.197) -- 0:00:46
802000 -- (-720.439) (-704.379) (-712.850) [-707.424] * (-709.295) [-701.269] (-716.628) (-710.795) -- 0:00:45
803000 -- (-704.715) (-709.633) (-704.282) [-712.087] * (-710.955) [-712.254] (-704.665) (-712.027) -- 0:00:45
804000 -- (-709.834) [-705.710] (-720.746) (-718.181) * (-712.139) (-707.202) (-707.270) [-703.019] -- 0:00:45
805000 -- (-714.613) (-702.342) [-708.658] (-707.257) * (-707.977) (-711.379) [-706.173] (-712.569) -- 0:00:45
Average standard deviation of split frequencies: 0.004211
806000 -- (-710.062) (-718.023) [-708.342] (-711.336) * (-713.228) (-709.661) [-708.946] (-712.189) -- 0:00:45
807000 -- (-706.118) (-705.668) (-710.200) [-708.582] * (-721.930) (-708.858) [-710.709] (-707.387) -- 0:00:44
808000 -- (-706.461) (-708.030) (-713.164) [-710.923] * (-702.260) (-710.751) [-702.416] (-705.649) -- 0:00:44
809000 -- (-709.688) [-709.178] (-707.502) (-713.929) * (-710.290) [-712.602] (-716.077) (-717.031) -- 0:00:44
810000 -- [-715.779] (-706.792) (-718.430) (-713.702) * (-711.640) (-715.352) [-705.275] (-712.431) -- 0:00:44
Average standard deviation of split frequencies: 0.003993
811000 -- (-702.134) (-709.933) (-716.664) [-710.617] * (-713.714) (-708.479) (-704.699) [-708.730] -- 0:00:43
812000 -- [-705.372] (-714.479) (-707.416) (-703.225) * [-704.188] (-702.688) (-707.377) (-705.850) -- 0:00:43
813000 -- (-721.585) [-708.603] (-724.686) (-704.248) * (-711.287) (-712.423) [-709.259] (-707.111) -- 0:00:43
814000 -- (-710.193) (-705.548) (-714.836) [-704.968] * (-704.643) [-708.710] (-714.703) (-711.811) -- 0:00:43
815000 -- (-700.114) [-705.937] (-708.296) (-718.933) * (-703.135) (-714.970) [-707.608] (-708.672) -- 0:00:42
Average standard deviation of split frequencies: 0.004044
816000 -- (-711.953) (-705.930) [-710.105] (-706.636) * [-708.575] (-715.205) (-707.737) (-716.023) -- 0:00:42
817000 -- [-706.012] (-708.990) (-716.949) (-706.371) * (-711.946) (-709.207) [-710.310] (-706.980) -- 0:00:42
818000 -- (-714.953) (-708.155) [-703.559] (-706.444) * (-709.389) (-712.006) (-716.926) [-709.987] -- 0:00:42
819000 -- (-707.344) (-707.029) [-708.669] (-715.728) * (-713.871) [-706.621] (-715.716) (-709.640) -- 0:00:41
820000 -- [-710.978] (-715.559) (-713.174) (-712.245) * (-716.242) (-707.067) [-703.755] (-707.226) -- 0:00:41
Average standard deviation of split frequencies: 0.004519
821000 -- (-717.882) (-708.035) (-715.063) [-705.731] * (-708.952) (-710.142) [-708.088] (-716.581) -- 0:00:41
822000 -- (-704.490) (-718.568) (-718.901) [-708.222] * (-708.687) (-714.266) [-706.248] (-719.619) -- 0:00:41
823000 -- [-709.075] (-703.891) (-713.861) (-715.000) * [-704.130] (-714.171) (-706.349) (-708.573) -- 0:00:41
824000 -- [-705.866] (-704.603) (-716.262) (-715.590) * [-706.384] (-711.997) (-709.115) (-708.462) -- 0:00:40
825000 -- [-701.668] (-705.181) (-708.403) (-707.376) * [-707.467] (-706.065) (-708.563) (-714.513) -- 0:00:40
Average standard deviation of split frequencies: 0.004680
826000 -- [-710.122] (-711.528) (-714.766) (-713.267) * (-707.508) [-701.798] (-714.832) (-713.918) -- 0:00:40
827000 -- [-707.132] (-709.358) (-713.658) (-714.944) * (-708.781) (-710.551) [-717.058] (-717.925) -- 0:00:40
828000 -- (-707.092) (-717.753) (-706.728) [-710.419] * [-708.381] (-702.915) (-712.358) (-708.611) -- 0:00:39
829000 -- [-706.863] (-722.140) (-712.672) (-718.199) * (-712.893) (-700.606) (-708.545) [-714.668] -- 0:00:39
830000 -- (-712.082) (-708.083) (-714.183) [-710.224] * (-708.337) (-711.818) (-724.001) [-711.467] -- 0:00:39
Average standard deviation of split frequencies: 0.003973
831000 -- (-710.436) (-710.682) (-712.383) [-702.006] * (-712.089) [-706.591] (-708.537) (-709.035) -- 0:00:39
832000 -- (-706.169) [-707.290] (-708.067) (-702.784) * (-707.190) (-710.130) (-719.623) [-707.731] -- 0:00:38
833000 -- (-703.752) (-715.271) [-713.170] (-715.906) * [-709.566] (-707.069) (-707.176) (-716.936) -- 0:00:38
834000 -- (-706.159) (-703.984) [-707.536] (-717.368) * (-716.287) [-709.097] (-707.857) (-704.343) -- 0:00:38
835000 -- (-710.846) (-714.759) (-707.678) [-704.698] * (-711.696) [-705.499] (-709.178) (-706.140) -- 0:00:38
Average standard deviation of split frequencies: 0.003797
836000 -- (-709.741) (-716.428) (-708.888) [-711.393] * (-713.541) [-707.626] (-708.662) (-709.917) -- 0:00:38
837000 -- (-701.972) (-703.624) (-712.201) [-702.397] * (-717.101) [-706.288] (-710.087) (-710.046) -- 0:00:37
838000 -- [-709.794] (-711.873) (-703.361) (-717.314) * [-715.023] (-705.612) (-713.707) (-716.069) -- 0:00:37
839000 -- (-707.063) (-710.323) (-713.641) [-704.979] * (-714.888) (-702.660) (-704.028) [-702.102] -- 0:00:37
840000 -- [-712.493] (-714.264) (-713.160) (-707.322) * (-726.374) [-707.292] (-707.471) (-710.404) -- 0:00:37
Average standard deviation of split frequencies: 0.004187
841000 -- (-706.591) (-704.766) (-705.683) [-711.602] * (-716.917) (-712.548) [-705.825] (-699.753) -- 0:00:36
842000 -- (-710.430) (-708.933) [-712.884] (-716.483) * (-708.183) [-701.002] (-709.074) (-709.100) -- 0:00:36
843000 -- (-699.434) [-697.924] (-716.934) (-706.255) * (-710.655) (-710.725) (-712.174) [-705.814] -- 0:00:36
844000 -- (-709.243) (-707.258) [-711.566] (-713.161) * (-712.844) [-710.803] (-706.713) (-709.632) -- 0:00:36
845000 -- (-708.666) (-708.757) (-715.539) [-703.270] * (-711.005) (-708.284) [-703.596] (-714.105) -- 0:00:35
Average standard deviation of split frequencies: 0.003975
846000 -- [-706.313] (-711.146) (-712.629) (-709.862) * (-715.092) (-715.051) [-706.423] (-706.314) -- 0:00:35
847000 -- [-700.433] (-716.207) (-713.748) (-705.843) * (-714.500) (-710.970) (-708.007) [-702.665] -- 0:00:35
848000 -- (-709.059) (-712.056) [-702.469] (-706.843) * (-701.366) [-704.346] (-717.629) (-711.966) -- 0:00:35
849000 -- (-708.270) [-705.023] (-716.161) (-712.025) * (-708.518) [-703.881] (-711.892) (-706.904) -- 0:00:35
850000 -- (-708.163) (-714.876) [-713.536] (-704.090) * (-713.706) (-707.501) (-712.432) [-702.765] -- 0:00:34
Average standard deviation of split frequencies: 0.004249
851000 -- (-714.822) (-707.764) [-706.638] (-709.300) * (-715.386) (-720.341) [-717.525] (-703.236) -- 0:00:34
852000 -- (-701.429) [-704.318] (-711.792) (-706.644) * (-700.573) (-711.901) (-710.192) [-706.627] -- 0:00:34
853000 -- (-707.538) [-703.873] (-711.874) (-713.619) * [-703.618] (-716.368) (-703.886) (-707.170) -- 0:00:34
854000 -- (-727.862) (-712.425) (-705.511) [-713.828] * [-704.632] (-711.612) (-715.176) (-703.857) -- 0:00:33
855000 -- [-709.026] (-715.939) (-715.854) (-706.069) * (-708.122) (-712.072) (-710.142) [-707.451] -- 0:00:33
Average standard deviation of split frequencies: 0.004406
856000 -- [-704.587] (-709.711) (-708.990) (-718.278) * (-715.128) [-709.409] (-712.452) (-704.630) -- 0:00:33
857000 -- (-713.082) (-708.002) [-712.652] (-719.506) * (-719.745) [-709.027] (-710.312) (-710.675) -- 0:00:33
858000 -- (-709.285) [-705.703] (-710.366) (-709.571) * (-713.363) [-700.888] (-707.903) (-712.083) -- 0:00:32
859000 -- (-719.061) (-707.624) (-705.778) [-708.932] * (-716.460) (-710.063) (-707.803) [-705.558] -- 0:00:32
860000 -- (-702.477) [-710.502] (-723.127) (-708.782) * (-709.725) (-712.141) (-704.414) [-707.800] -- 0:00:32
Average standard deviation of split frequencies: 0.004856
861000 -- [-701.651] (-717.822) (-722.734) (-705.421) * (-703.191) [-715.444] (-711.643) (-717.972) -- 0:00:32
862000 -- (-702.274) [-709.478] (-711.026) (-713.772) * (-712.212) (-714.116) [-705.674] (-711.156) -- 0:00:32
863000 -- (-703.087) (-718.421) [-705.919] (-705.693) * (-709.234) (-709.414) (-711.409) [-704.198] -- 0:00:31
864000 -- (-704.537) (-709.685) [-706.871] (-707.238) * (-719.328) (-710.229) (-710.518) [-704.939] -- 0:00:31
865000 -- (-710.739) (-707.565) [-712.463] (-711.696) * (-715.559) (-716.391) [-703.820] (-709.313) -- 0:00:31
Average standard deviation of split frequencies: 0.004899
866000 -- [-708.017] (-711.519) (-714.163) (-719.048) * (-712.331) (-707.242) (-712.565) [-707.041] -- 0:00:30
867000 -- (-719.926) [-709.351] (-708.686) (-706.758) * (-712.551) [-710.904] (-710.787) (-707.372) -- 0:00:30
868000 -- [-710.979] (-720.220) (-705.894) (-702.015) * (-713.403) [-719.453] (-709.217) (-711.781) -- 0:00:30
869000 -- (-703.266) (-717.941) [-713.444] (-712.152) * (-705.154) [-705.520] (-710.919) (-708.062) -- 0:00:30
870000 -- [-705.802] (-723.333) (-703.894) (-710.224) * (-710.205) (-709.423) [-709.789] (-713.884) -- 0:00:30
Average standard deviation of split frequencies: 0.005270
871000 -- (-710.506) (-718.802) [-721.961] (-706.952) * (-708.326) (-714.092) (-709.642) [-709.810] -- 0:00:29
872000 -- (-707.094) (-709.186) [-705.138] (-704.871) * (-721.377) (-706.025) [-707.099] (-712.530) -- 0:00:29
873000 -- (-716.959) (-711.444) (-708.389) [-707.437] * [-708.692] (-714.319) (-703.279) (-721.262) -- 0:00:29
874000 -- (-705.017) (-700.548) (-707.378) [-705.833] * [-710.725] (-712.801) (-712.284) (-711.173) -- 0:00:29
875000 -- [-708.244] (-717.458) (-707.241) (-717.621) * [-711.183] (-711.497) (-712.424) (-702.632) -- 0:00:29
Average standard deviation of split frequencies: 0.004771
876000 -- (-710.366) [-702.111] (-715.147) (-714.314) * [-706.585] (-710.490) (-707.699) (-721.560) -- 0:00:28
877000 -- (-709.056) (-712.729) [-712.476] (-717.503) * (-708.613) (-707.163) (-715.338) [-702.183] -- 0:00:28
878000 -- [-706.210] (-709.306) (-701.071) (-711.770) * (-712.429) (-711.899) (-705.930) [-708.001] -- 0:00:28
879000 -- (-705.225) (-711.185) (-701.994) [-714.604] * (-715.323) (-719.839) (-706.758) [-706.069] -- 0:00:27
880000 -- (-714.609) (-712.969) [-707.622] (-708.694) * [-711.207] (-709.948) (-704.901) (-709.559) -- 0:00:27
Average standard deviation of split frequencies: 0.005210
881000 -- (-710.584) [-705.535] (-715.081) (-711.782) * (-710.555) (-707.886) [-704.588] (-713.364) -- 0:00:27
882000 -- (-711.050) (-710.587) (-713.252) [-715.257] * (-708.037) (-709.912) (-705.206) [-703.984] -- 0:00:27
883000 -- (-708.427) (-713.784) [-709.248] (-719.552) * (-708.021) (-702.690) (-708.078) [-708.008] -- 0:00:27
884000 -- (-706.897) [-702.107] (-705.323) (-710.163) * (-704.904) [-714.199] (-712.455) (-706.802) -- 0:00:26
885000 -- [-704.594] (-713.092) (-707.271) (-710.271) * (-717.459) (-706.575) [-707.630] (-710.533) -- 0:00:26
Average standard deviation of split frequencies: 0.004789
886000 -- (-710.720) (-708.989) (-715.516) [-715.052] * [-719.309] (-711.621) (-707.212) (-709.990) -- 0:00:26
887000 -- (-703.979) [-713.471] (-711.079) (-705.527) * [-708.075] (-707.135) (-706.856) (-707.757) -- 0:00:26
888000 -- [-706.679] (-716.781) (-703.321) (-711.669) * (-713.706) (-714.241) [-709.952] (-709.910) -- 0:00:25
889000 -- (-704.052) (-703.097) [-710.140] (-723.320) * (-710.292) (-710.925) [-701.159] (-710.596) -- 0:00:25
890000 -- [-705.038] (-702.504) (-723.228) (-714.675) * (-719.815) (-721.764) [-707.825] (-713.723) -- 0:00:25
Average standard deviation of split frequencies: 0.004869
891000 -- [-701.663] (-719.192) (-718.322) (-724.948) * (-709.577) [-706.994] (-709.864) (-716.201) -- 0:00:25
892000 -- (-718.405) (-701.745) (-714.054) [-707.857] * (-722.152) (-713.990) [-717.934] (-710.611) -- 0:00:24
893000 -- (-704.992) [-705.248] (-704.987) (-719.096) * (-719.244) (-708.403) (-709.696) [-703.027] -- 0:00:24
894000 -- [-711.034] (-708.841) (-705.291) (-712.117) * (-700.876) (-712.087) (-715.659) [-710.601] -- 0:00:24
895000 -- (-706.401) (-707.530) [-702.939] (-708.725) * (-709.791) (-710.838) [-711.967] (-729.639) -- 0:00:24
Average standard deviation of split frequencies: 0.004665
896000 -- [-707.133] (-710.905) (-711.328) (-702.449) * [-713.742] (-707.713) (-717.023) (-711.721) -- 0:00:24
897000 -- [-702.843] (-714.803) (-721.038) (-706.245) * (-716.403) [-713.306] (-713.083) (-705.717) -- 0:00:23
898000 -- (-709.671) [-712.004] (-710.695) (-711.766) * (-711.804) [-702.966] (-713.256) (-703.909) -- 0:00:23
899000 -- (-715.368) [-708.250] (-711.482) (-713.710) * [-708.463] (-714.303) (-717.024) (-706.461) -- 0:00:23
900000 -- [-707.470] (-709.508) (-713.436) (-712.352) * (-710.704) (-713.976) (-706.794) [-705.569] -- 0:00:23
Average standard deviation of split frequencies: 0.004641
901000 -- [-705.622] (-712.495) (-719.385) (-708.921) * (-715.700) [-709.030] (-709.457) (-709.155) -- 0:00:22
902000 -- [-705.702] (-703.704) (-718.557) (-712.616) * (-711.159) [-712.636] (-713.121) (-709.691) -- 0:00:22
903000 -- [-701.171] (-712.918) (-707.053) (-714.645) * (-702.892) [-711.771] (-710.379) (-705.210) -- 0:00:22
904000 -- [-710.809] (-711.948) (-703.143) (-713.757) * (-704.366) (-702.231) [-706.125] (-708.194) -- 0:00:22
905000 -- (-714.162) (-714.383) [-710.601] (-723.150) * [-706.654] (-717.170) (-708.121) (-708.490) -- 0:00:22
Average standard deviation of split frequencies: 0.004648
906000 -- (-710.006) (-706.861) [-704.231] (-715.897) * (-708.343) [-705.949] (-718.078) (-712.048) -- 0:00:21
907000 -- (-706.234) (-713.549) [-710.065] (-708.400) * (-709.771) (-706.912) (-716.341) [-706.732] -- 0:00:21
908000 -- [-716.279] (-716.654) (-711.070) (-712.429) * (-715.498) (-707.515) [-703.977] (-713.569) -- 0:00:21
909000 -- (-706.729) [-713.015] (-700.510) (-711.601) * (-725.155) (-709.594) [-703.562] (-710.660) -- 0:00:21
910000 -- (-709.490) (-709.971) (-710.442) [-709.829] * [-712.973] (-712.900) (-702.294) (-705.483) -- 0:00:20
Average standard deviation of split frequencies: 0.004314
911000 -- (-714.231) (-707.899) [-712.054] (-709.034) * (-711.147) (-705.894) [-705.282] (-707.114) -- 0:00:20
912000 -- (-705.215) (-713.217) [-708.130] (-713.932) * (-708.131) (-712.296) [-705.904] (-716.421) -- 0:00:20
913000 -- (-714.397) [-704.891] (-716.648) (-711.775) * (-703.577) [-704.203] (-702.441) (-708.913) -- 0:00:20
914000 -- (-710.833) [-708.004] (-701.993) (-711.917) * (-711.185) (-709.520) (-708.097) [-706.737] -- 0:00:19
915000 -- (-718.506) (-710.435) (-710.095) [-706.092] * (-706.176) (-705.578) (-706.554) [-709.175] -- 0:00:19
Average standard deviation of split frequencies: 0.004529
916000 -- (-710.476) (-710.998) (-706.825) [-710.300] * (-708.246) (-713.797) (-705.263) [-708.884] -- 0:00:19
917000 -- (-710.378) (-708.248) [-706.710] (-714.198) * [-711.399] (-712.412) (-705.734) (-705.484) -- 0:00:19
918000 -- (-706.387) [-710.119] (-713.696) (-709.848) * [-707.851] (-706.817) (-713.580) (-705.958) -- 0:00:18
919000 -- (-707.860) [-701.887] (-713.703) (-712.529) * [-710.209] (-701.576) (-706.588) (-710.495) -- 0:00:18
920000 -- [-711.542] (-704.094) (-708.166) (-704.500) * (-707.710) (-710.298) [-708.174] (-709.521) -- 0:00:18
Average standard deviation of split frequencies: 0.004438
921000 -- (-707.317) [-703.233] (-709.030) (-709.766) * (-714.202) (-702.912) (-705.180) [-710.420] -- 0:00:18
922000 -- (-708.316) [-709.224] (-719.050) (-711.915) * (-719.160) (-712.148) (-709.017) [-712.562] -- 0:00:18
923000 -- (-711.400) (-704.754) (-710.831) [-708.447] * (-710.178) [-708.600] (-710.771) (-714.459) -- 0:00:17
924000 -- (-713.572) [-709.335] (-708.107) (-709.105) * [-705.944] (-712.694) (-706.932) (-707.059) -- 0:00:17
925000 -- (-713.805) [-706.849] (-716.440) (-714.713) * (-708.052) (-715.288) [-709.314] (-713.743) -- 0:00:17
Average standard deviation of split frequencies: 0.004276
926000 -- (-709.010) [-703.303] (-715.312) (-714.354) * (-710.516) [-706.753] (-711.278) (-706.130) -- 0:00:17
927000 -- [-705.113] (-706.797) (-712.125) (-719.056) * (-708.092) (-715.490) [-703.120] (-704.994) -- 0:00:16
928000 -- (-709.962) (-710.674) [-716.864] (-717.028) * (-714.538) (-704.504) [-711.220] (-708.496) -- 0:00:16
929000 -- (-701.975) [-708.372] (-710.242) (-712.443) * (-705.981) [-708.682] (-709.040) (-710.919) -- 0:00:16
930000 -- (-717.640) (-709.802) (-714.475) [-712.271] * (-709.519) (-712.874) [-713.352] (-710.207) -- 0:00:16
Average standard deviation of split frequencies: 0.004322
931000 -- (-707.383) [-702.854] (-706.964) (-725.974) * (-708.074) (-709.973) [-711.333] (-717.101) -- 0:00:16
932000 -- (-712.905) [-705.427] (-710.881) (-702.323) * (-710.518) (-709.586) [-704.225] (-702.504) -- 0:00:15
933000 -- (-712.754) [-702.253] (-716.913) (-707.184) * (-705.977) (-710.760) (-713.903) [-714.353] -- 0:00:15
934000 -- (-709.757) (-717.206) [-711.764] (-711.052) * (-707.045) (-704.761) (-708.228) [-707.043] -- 0:00:15
935000 -- (-710.021) (-720.384) (-706.193) [-705.569] * (-718.103) (-708.376) (-714.327) [-706.764] -- 0:00:15
Average standard deviation of split frequencies: 0.004197
936000 -- [-707.587] (-713.171) (-708.830) (-710.204) * (-705.360) (-710.891) (-710.014) [-712.600] -- 0:00:14
937000 -- (-703.782) (-707.809) (-711.198) [-710.533] * (-714.771) [-703.363] (-708.321) (-704.835) -- 0:00:14
938000 -- [-703.071] (-703.981) (-717.686) (-714.478) * (-707.197) (-723.058) (-710.827) [-705.257] -- 0:00:14
939000 -- (-708.694) (-721.190) (-706.181) [-708.679] * (-714.585) (-713.971) [-705.973] (-706.529) -- 0:00:14
940000 -- (-716.111) (-706.698) (-715.712) [-707.447] * (-715.734) (-710.780) (-706.049) [-713.099] -- 0:00:13
Average standard deviation of split frequencies: 0.004243
941000 -- (-710.250) [-714.576] (-708.080) (-710.511) * (-709.488) (-711.040) [-708.905] (-704.307) -- 0:00:13
942000 -- (-710.637) (-719.384) [-710.081] (-707.190) * [-709.123] (-720.137) (-706.606) (-716.783) -- 0:00:13
943000 -- (-706.373) (-706.394) (-713.789) [-700.398] * (-723.792) (-723.858) [-707.553] (-705.727) -- 0:00:13
944000 -- [-705.299] (-700.995) (-713.240) (-710.971) * (-705.289) (-703.590) (-710.809) [-700.189] -- 0:00:12
945000 -- (-707.124) [-705.710] (-700.865) (-712.685) * (-727.792) (-708.340) [-703.601] (-714.605) -- 0:00:12
Average standard deviation of split frequencies: 0.004518
946000 -- (-704.955) (-710.458) (-708.683) [-708.159] * [-709.935] (-714.248) (-721.187) (-710.047) -- 0:00:12
947000 -- (-711.582) (-710.285) (-725.119) [-716.584] * (-707.720) (-707.544) (-707.799) [-704.851] -- 0:00:12
948000 -- (-707.530) [-710.336] (-707.062) (-712.501) * (-703.749) [-707.828] (-711.965) (-711.116) -- 0:00:12
949000 -- (-716.279) (-707.994) [-711.704] (-717.209) * (-708.221) (-707.548) (-715.244) [-707.743] -- 0:00:11
950000 -- (-709.868) [-704.012] (-707.972) (-713.446) * [-707.000] (-707.869) (-717.558) (-706.047) -- 0:00:11
Average standard deviation of split frequencies: 0.004793
951000 -- (-707.234) (-704.517) (-712.440) [-706.609] * [-712.883] (-712.734) (-705.970) (-706.153) -- 0:00:11
952000 -- (-712.541) (-719.338) (-714.121) [-708.018] * (-706.766) (-711.195) (-724.958) [-705.467] -- 0:00:11
953000 -- (-709.473) (-706.454) [-705.186] (-707.031) * (-703.403) [-701.950] (-712.355) (-708.237) -- 0:00:10
954000 -- (-718.747) (-706.613) [-708.693] (-709.159) * (-702.503) (-709.955) [-709.752] (-714.998) -- 0:00:10
955000 -- [-707.719] (-710.798) (-711.298) (-710.721) * [-701.732] (-716.224) (-704.348) (-710.367) -- 0:00:10
Average standard deviation of split frequencies: 0.004734
956000 -- (-706.682) (-716.484) (-712.108) [-709.923] * (-713.548) (-714.563) [-703.054] (-715.970) -- 0:00:10
957000 -- (-721.641) (-713.314) [-709.081] (-709.602) * [-703.664] (-715.540) (-712.667) (-715.822) -- 0:00:09
958000 -- (-711.099) (-720.125) [-710.012] (-711.550) * (-719.455) (-713.232) [-715.270] (-705.574) -- 0:00:09
959000 -- (-702.710) (-712.826) [-708.039] (-717.551) * [-716.904] (-717.473) (-706.960) (-711.454) -- 0:00:09
960000 -- (-715.764) (-706.752) (-700.281) [-703.968] * [-711.537] (-705.930) (-709.397) (-710.499) -- 0:00:09
Average standard deviation of split frequencies: 0.004514
961000 -- (-712.266) (-706.638) [-701.752] (-712.569) * (-707.330) (-701.938) (-701.813) [-708.428] -- 0:00:09
962000 -- (-717.310) (-708.904) (-705.684) [-704.735] * [-710.907] (-716.551) (-707.600) (-707.020) -- 0:00:08
963000 -- (-700.823) (-713.036) [-700.763] (-721.421) * (-710.606) (-709.436) [-705.896] (-711.289) -- 0:00:08
964000 -- (-715.785) [-713.203] (-708.296) (-701.252) * (-707.379) [-706.798] (-716.871) (-712.211) -- 0:00:08
965000 -- (-715.416) (-707.248) (-709.530) [-706.086] * (-709.404) [-709.050] (-710.999) (-704.600) -- 0:00:08
Average standard deviation of split frequencies: 0.004652
966000 -- (-711.645) (-708.785) (-709.493) [-708.052] * (-705.425) (-706.606) (-713.888) [-704.479] -- 0:00:07
967000 -- (-712.237) [-702.856] (-710.460) (-706.722) * [-711.699] (-717.672) (-717.777) (-713.639) -- 0:00:07
968000 -- (-715.837) [-708.788] (-710.276) (-714.857) * (-716.225) (-709.076) [-709.378] (-702.570) -- 0:00:07
969000 -- (-709.147) (-704.733) [-706.820] (-701.018) * (-714.223) (-700.623) (-713.085) [-701.275] -- 0:00:07
970000 -- (-706.219) (-703.650) (-706.725) [-712.645] * (-711.658) [-705.106] (-711.160) (-713.437) -- 0:00:06
Average standard deviation of split frequencies: 0.004468
971000 -- (-712.820) (-709.776) [-708.368] (-715.740) * (-717.209) (-707.644) (-713.325) [-711.247] -- 0:00:06
972000 -- (-704.462) (-708.590) [-707.138] (-725.855) * (-714.274) [-708.245] (-715.281) (-707.702) -- 0:00:06
973000 -- (-707.788) (-708.976) [-705.009] (-717.410) * (-711.953) (-706.683) (-710.311) [-709.340] -- 0:00:06
974000 -- (-716.569) (-708.014) (-710.622) [-705.060] * (-711.118) [-712.672] (-714.051) (-722.390) -- 0:00:06
975000 -- (-712.356) (-706.304) (-711.522) [-703.529] * (-718.586) [-703.204] (-715.664) (-716.020) -- 0:00:05
Average standard deviation of split frequencies: 0.004250
976000 -- [-721.116] (-703.036) (-718.746) (-704.723) * (-716.912) (-711.677) (-709.821) [-711.418] -- 0:00:05
977000 -- [-705.354] (-705.024) (-711.091) (-710.894) * (-714.060) (-706.752) (-708.493) [-708.547] -- 0:00:05
978000 -- [-706.228] (-718.160) (-712.627) (-716.428) * (-711.125) (-709.178) (-715.985) [-715.958] -- 0:00:05
979000 -- (-707.497) [-705.434] (-702.114) (-705.245) * (-707.478) (-708.100) (-715.483) [-709.938] -- 0:00:04
980000 -- (-712.254) (-710.606) [-703.687] (-714.913) * (-714.870) (-705.073) (-712.814) [-708.601] -- 0:00:04
Average standard deviation of split frequencies: 0.004134
981000 -- (-711.678) (-721.101) (-715.366) [-709.223] * [-709.658] (-711.895) (-711.149) (-710.401) -- 0:00:04
982000 -- [-710.295] (-713.795) (-708.073) (-724.095) * (-706.879) (-704.066) [-704.270] (-702.823) -- 0:00:04
983000 -- (-712.859) [-709.472] (-711.578) (-707.807) * (-712.024) (-711.609) (-712.798) [-703.285] -- 0:00:03
984000 -- [-710.908] (-703.249) (-707.747) (-708.186) * (-714.289) (-713.257) (-716.450) [-703.084] -- 0:00:03
985000 -- (-708.859) (-711.852) (-703.303) [-705.322] * (-710.305) [-708.030] (-710.396) (-708.255) -- 0:00:03
Average standard deviation of split frequencies: 0.003889
986000 -- (-706.694) (-709.135) (-706.223) [-706.586] * (-713.290) (-717.940) (-706.046) [-712.355] -- 0:00:03
987000 -- (-700.493) [-705.393] (-706.350) (-716.633) * (-714.074) [-706.341] (-708.774) (-698.801) -- 0:00:03
988000 -- (-702.676) [-712.389] (-706.285) (-710.186) * (-709.640) [-704.755] (-705.207) (-703.297) -- 0:00:02
989000 -- (-714.073) [-701.633] (-708.561) (-706.077) * (-717.165) (-706.682) [-713.250] (-704.873) -- 0:00:02
990000 -- (-710.739) [-708.153] (-710.680) (-710.081) * (-705.999) (-711.368) (-711.605) [-705.206] -- 0:00:02
Average standard deviation of split frequencies: 0.003870
991000 -- [-701.399] (-711.440) (-712.898) (-712.970) * (-710.096) (-707.099) (-714.058) [-716.360] -- 0:00:02
992000 -- [-707.826] (-712.774) (-715.519) (-707.121) * [-700.236] (-711.189) (-711.485) (-713.127) -- 0:00:01
993000 -- [-705.075] (-710.588) (-705.378) (-711.578) * (-715.686) (-713.531) (-712.583) [-702.862] -- 0:00:01
994000 -- (-708.736) (-718.413) (-710.590) [-708.505] * (-708.923) (-720.968) (-710.903) [-704.649] -- 0:00:01
995000 -- (-709.595) (-716.148) [-707.958] (-707.374) * (-711.524) (-704.960) (-720.514) [-712.401] -- 0:00:01
Average standard deviation of split frequencies: 0.003755
996000 -- (-710.549) (-713.802) (-716.076) [-707.220] * [-706.015] (-702.749) (-712.644) (-708.762) -- 0:00:00
997000 -- (-715.556) (-704.858) [-704.557] (-705.749) * (-699.464) (-701.907) [-702.973] (-715.245) -- 0:00:00
998000 -- (-709.209) (-708.189) [-710.131] (-709.458) * (-711.046) (-708.834) [-703.126] (-714.124) -- 0:00:00
999000 -- (-711.458) (-707.391) [-707.511] (-708.112) * (-709.780) [-709.067] (-705.808) (-713.360) -- 0:00:00
1000000 -- (-704.868) (-706.594) [-704.911] (-707.604) * [-704.992] (-712.553) (-706.720) (-705.255) -- 0:00:00
Average standard deviation of split frequencies: 0.004020
Analysis completed in 3 mins 51 seconds
Analysis used 230.73 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -695.97
Likelihood of best state for "cold" chain of run 2 was -695.93
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
67.5 % ( 62 %) Dirichlet(Revmat{all})
82.6 % ( 74 %) Slider(Revmat{all})
35.4 % ( 31 %) Dirichlet(Pi{all})
36.5 % ( 27 %) Slider(Pi{all})
79.8 % ( 54 %) Multiplier(Alpha{1,2})
70.3 % ( 39 %) Multiplier(Alpha{3})
89.5 % ( 84 %) Slider(Pinvar{all})
29.6 % ( 31 %) ExtSPR(Tau{all},V{all})
18.5 % ( 16 %) ExtTBR(Tau{all},V{all})
30.5 % ( 33 %) NNI(Tau{all},V{all})
26.8 % ( 23 %) ParsSPR(Tau{all},V{all})
27.4 % ( 26 %) Multiplier(V{all})
60.3 % ( 66 %) Nodeslider(V{all})
26.3 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
66.2 % ( 59 %) Dirichlet(Revmat{all})
83.0 % ( 75 %) Slider(Revmat{all})
35.8 % ( 28 %) Dirichlet(Pi{all})
36.4 % ( 23 %) Slider(Pi{all})
79.9 % ( 64 %) Multiplier(Alpha{1,2})
69.3 % ( 38 %) Multiplier(Alpha{3})
89.7 % ( 73 %) Slider(Pinvar{all})
29.6 % ( 32 %) ExtSPR(Tau{all},V{all})
18.7 % ( 13 %) ExtTBR(Tau{all},V{all})
30.2 % ( 34 %) NNI(Tau{all},V{all})
27.0 % ( 20 %) ParsSPR(Tau{all},V{all})
27.3 % ( 24 %) Multiplier(V{all})
60.1 % ( 56 %) Nodeslider(V{all})
26.6 % ( 20 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.74 0.51 0.34
2 | 166303 0.75 0.54
3 | 167069 166768 0.77
4 | 166785 165994 167081
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.73 0.51 0.34
2 | 166700 0.75 0.54
3 | 167082 165885 0.76
4 | 166260 166558 167515
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -705.82
| 1 1 |
| 1 |
| 12 2 2 1 |
|2 1 1 *1 1 1 2 |
| 2 11 1 2 1 2 2 1 1 2|
| 1 * 1 1 2 2 1 |
| 1 * 2* 2 2 2 2 11 2 21 |
| 2 2 1 22 2 221* 2 1 2 2 2 2 2 2 * |
|1 2 2 1 2 2 2 1 11 * 2 |
| 1 1 1 1 2 2 2 2 1 *1 1|
| 2 2 2 2 1 2 |
| 1 2 1 1 1 1 1 21 |
| 1 1 1 1 |
| 2 |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -709.87
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -702.76 -716.40
2 -702.66 -716.61
--------------------------------------
TOTAL -702.71 -716.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.137393 0.000841 0.087589 0.194158 0.133804 1307.60 1308.66 1.000
r(A<->C){all} 0.142286 0.002998 0.044625 0.249193 0.137594 430.20 562.85 1.003
r(A<->G){all} 0.210637 0.004747 0.076129 0.340388 0.207005 245.15 412.78 1.000
r(A<->T){all} 0.028591 0.000523 0.000004 0.073265 0.023683 694.86 826.32 1.000
r(C<->G){all} 0.148601 0.004434 0.033493 0.285143 0.140371 434.30 500.51 1.000
r(C<->T){all} 0.387468 0.006249 0.239433 0.543175 0.385884 596.50 648.24 1.002
r(G<->T){all} 0.082417 0.002116 0.004493 0.169092 0.075106 474.85 475.02 1.000
pi(A){all} 0.294301 0.000559 0.249635 0.342100 0.293692 1185.29 1301.92 1.000
pi(C){all} 0.221310 0.000426 0.182477 0.262909 0.220691 1085.78 1217.21 1.000
pi(G){all} 0.189537 0.000415 0.153118 0.231896 0.188226 1291.42 1296.07 1.000
pi(T){all} 0.294852 0.000519 0.251185 0.341108 0.294366 1040.47 1197.48 1.000
alpha{1,2} 0.489825 0.397422 0.000011 1.774339 0.259484 1180.05 1220.48 1.000
alpha{3} 1.666101 1.300541 0.167183 4.075566 1.402344 1232.98 1312.37 1.000
pinvar{all} 0.302286 0.031765 0.000090 0.614808 0.292308 874.34 946.77 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C10
3 -- C2
4 -- C3
5 -- C4
6 -- C5
7 -- C6
8 -- C7
9 -- C8
10 -- C9
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
----------------
1 -- .*********
2 -- .*........
3 -- ..*.......
4 -- ...*......
5 -- ....*.....
6 -- .....*....
7 -- ......*...
8 -- .......*..
9 -- ........*.
10 -- .........*
11 -- ....***...
12 -- .*..***.**
13 -- .*..***...
14 -- .....**...
15 -- .*..***.*.
16 -- .*..******
17 -- .*.****.**
18 -- ..**......
19 -- ..*....*..
20 -- .**.***.**
21 -- .*.*******
22 -- .******.**
23 -- .**.******
24 -- ..**...*..
25 -- ...*...*..
----------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 2998 0.998668 0.000000 0.998668 0.998668 2
13 2977 0.991672 0.004240 0.988674 0.994670 2
14 2968 0.988674 0.000000 0.988674 0.988674 2
15 2810 0.936043 0.005653 0.932045 0.940040 2
16 632 0.210526 0.007537 0.205197 0.215856 2
17 626 0.208528 0.004711 0.205197 0.211859 2
18 618 0.205863 0.001884 0.204530 0.207195 2
19 603 0.200866 0.001413 0.199867 0.201865 2
20 603 0.200866 0.003298 0.198534 0.203198 2
21 601 0.200200 0.002355 0.198534 0.201865 2
22 600 0.199867 0.004711 0.196536 0.203198 2
23 575 0.191539 0.014604 0.181213 0.201865 2
24 573 0.190873 0.003298 0.188541 0.193205 2
25 570 0.189873 0.006595 0.185210 0.194537 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.002149 0.000005 0.000000 0.006557 0.001440 1.000 2
length{all}[2] 0.004103 0.000014 0.000000 0.011589 0.003014 1.000 2
length{all}[3] 0.002212 0.000005 0.000000 0.006783 0.001494 1.000 2
length{all}[4] 0.002185 0.000005 0.000000 0.006693 0.001505 1.001 2
length{all}[5] 0.009681 0.000034 0.000605 0.020711 0.008573 1.000 2
length{all}[6] 0.002249 0.000005 0.000000 0.006626 0.001563 1.001 2
length{all}[7] 0.002244 0.000005 0.000002 0.006722 0.001555 1.000 2
length{all}[8] 0.002181 0.000005 0.000002 0.006696 0.001495 1.000 2
length{all}[9] 0.004501 0.000011 0.000008 0.010874 0.003719 1.000 2
length{all}[10] 0.002256 0.000005 0.000001 0.006962 0.001544 1.000 2
length{all}[11] 0.067488 0.000366 0.034654 0.104526 0.064317 1.000 2
length{all}[12] 0.006446 0.000015 0.000579 0.013802 0.005661 1.002 2
length{all}[13] 0.011790 0.000034 0.002622 0.023648 0.010903 1.000 2
length{all}[14] 0.009359 0.000030 0.000652 0.020196 0.008326 1.000 2
length{all}[15] 0.004519 0.000012 0.000008 0.011116 0.003744 1.000 2
length{all}[16] 0.002135 0.000005 0.000001 0.006729 0.001403 0.999 2
length{all}[17] 0.002161 0.000005 0.000003 0.006468 0.001455 1.000 2
length{all}[18] 0.002056 0.000004 0.000003 0.006256 0.001442 1.003 2
length{all}[19] 0.002139 0.000005 0.000007 0.006318 0.001571 1.002 2
length{all}[20] 0.002169 0.000005 0.000004 0.006598 0.001497 0.999 2
length{all}[21] 0.002259 0.000005 0.000002 0.006574 0.001456 1.001 2
length{all}[22] 0.002159 0.000005 0.000009 0.006367 0.001534 0.998 2
length{all}[23] 0.002178 0.000005 0.000005 0.006478 0.001512 0.999 2
length{all}[24] 0.002164 0.000005 0.000005 0.006822 0.001487 1.000 2
length{all}[25] 0.002192 0.000005 0.000004 0.006322 0.001489 1.005 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004020
Maximum standard deviation of split frequencies = 0.014604
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (3)
|
|----------------------------------------------------------------------- C3 (4)
|
|----------------------------------------------------------------------- C7 (8)
|
+ /----------------------------------- C10 (2)
| |
| /-----99----+ /------------------------ C4 (5)
| | | |
| | \----100---+ /------------ C5 (6)
| /-----94----+ \-----99----+
| | | \------------ C6 (7)
| | |
\----100----+ \----------------------------------------------- C8 (9)
|
\----------------------------------------------------------- C9 (10)
Phylogram (based on average branch lengths):
/- C1 (1)
|
|- C2 (3)
|
|- C3 (4)
|
|- C7 (8)
|
+ /--- C10 (2)
| |
| /-------+ /------- C4 (5)
| | | |
| | \------------------------------------------------+ /- C5 (6)
| /--+ \------+
| | | \- C6 (7)
| | |
\---+ \--- C8 (9)
|
\- C9 (10)
|--------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (88 trees sampled):
50 % credible set contains 8 trees
90 % credible set contains 15 trees
95 % credible set contains 25 trees
99 % credible set contains 58 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Wed Oct 26 22:52:39 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=10, Len=119
C1 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C2 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C3 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C5 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C6 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C7 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C8 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C9 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
C10 MDYVSLLNQFWQKQIKFYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCC
**************** ****.****************************
C1 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C2 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C3 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C4 TIKFYEYSAQATECTKALAKQDAARIICQQLQAAGLLNGMELQFRSCFAD
C5 TIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFAD
C6 TIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFAD
C7 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASD
C8 TIKFYEYSAQATECTKASAKQDAARLICQQLQAAGLLNGMELRFRSSAFD
C9 TIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFD
C10 TIKLYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFD
***:************* *******:** *:**********:***. *
C1 IFGQNRYDASKSYFFSKTA
C2 IFGQNRYDASKSYFFSKTA
C3 IFGQNRYDASKSYFFSKTA
C4 IFGKNRYDASKSYFFSKTT
C5 IFGKNRYDASKSYFFSKTT
C6 IFGKNRYDASKSYFFSKTT
C7 IFGQNRYDASKSYFFSKTA
C8 IFGQNRYDASKSYFFSKTA
C9 IFGQNRYDASKSYFFSKTA
C10 IFGQNRYDASKSYFFSKTA
***:**************:
-- Starting log on Wed Oct 26 23:28:39 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/codeml,B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C1 357 sites
reading seq# 2 C2 357 sites
reading seq# 3 C3 357 sites
reading seq# 4 C4 357 sites
reading seq# 5 C5 357 sites
reading seq# 6 C6 357 sites
reading seq# 7 C7 357 sites
reading seq# 8 C8 357 sites
reading seq# 9 C9 357 sites
reading seq#10 C10 357 sitesns = 10 ls = 357
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Sites with gaps or missing data are removed.
3 ambiguity characters in seq. 5
3 ambiguity characters in seq. 6
1 sites are removed. 80
Sequences read..
Counting site patterns.. 0:01
Compressing, 69 patterns at 118 / 118 sites (100.0%), 0:01
Collecting fpatt[] & pose[], 69 patterns at 118 / 118 sites (100.0%), 0:01
Counting codons..
360 bytes for distance
67344 bytes for conP
6072 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 7, (((10, (4, (5, 6))), 8), 9)); MP score: 31
202032 bytes for conP, adjusted
0.035494 0.067574 0.094707 0.056918 0.058535 0.074035 0.072955 0.041763 0.020442 0.094011 0.093628 0.109752 0.085452 0.085212 0.105928 0.300000 0.792783 0.413545
ntime & nrate & np: 15 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.829663
np = 18
lnL0 = -809.346943
Iterating by ming2
Initial: fx= 809.346943
x= 0.03549 0.06757 0.09471 0.05692 0.05854 0.07404 0.07295 0.04176 0.02044 0.09401 0.09363 0.10975 0.08545 0.08521 0.10593 0.30000 0.79278 0.41355
1 h-m-p 0.0000 0.0003 988.9670 +++ 738.696645 m 0.0003 24 | 1/18
2 h-m-p 0.0000 0.0002 345.2751 ++ 719.305106 m 0.0002 45 | 2/18
3 h-m-p 0.0000 0.0000 3116.1947 ++ 711.610059 m 0.0000 66 | 3/18
4 h-m-p 0.0000 0.0000 2107.7497 ++ 701.939649 m 0.0000 87 | 4/18
5 h-m-p 0.0000 0.0000 4408.6083 ++ 698.533764 m 0.0000 108 | 5/18
6 h-m-p 0.0000 0.0000 2581.9659 ++ 695.393769 m 0.0000 129 | 6/18
7 h-m-p 0.0000 0.0000 388.6067 ++ 694.862920 m 0.0000 150 | 7/18
8 h-m-p 0.0000 0.0024 159.2008 ++++ 681.963122 m 0.0024 173 | 7/18
9 h-m-p 0.0000 0.0000 1953.1394 YCCC 681.697083 3 0.0000 199 | 7/18
10 h-m-p 0.0000 0.0000 2223.9677 ++ 679.318208 m 0.0000 220 | 8/18
11 h-m-p 0.0009 0.0286 35.8058 ++YCCCCC 674.365345 5 0.0096 252 | 8/18
12 h-m-p 0.0045 0.0224 13.2168 YCCC 673.599458 3 0.0068 278 | 8/18
13 h-m-p 0.0027 0.0133 17.6070 +YCCC 673.104899 3 0.0070 305 | 8/18
14 h-m-p 0.0107 0.0536 0.7457 ++ 672.739000 m 0.0536 326 | 9/18
15 h-m-p 0.1259 2.3307 0.3171 +YCYCCC 668.921092 5 1.3233 366 | 8/18
16 h-m-p 0.0004 0.0021 160.9595 CCCC 668.833943 3 0.0001 402 | 8/18
17 h-m-p 0.0323 0.7370 0.4719 +YCCC 668.394695 3 0.2246 429 | 8/18
18 h-m-p 0.2147 1.0733 0.4728 +YC 667.528687 1 0.5782 462 | 8/18
19 h-m-p 1.1574 5.7871 0.1565 CYCCC 666.965710 4 1.7588 500 | 8/18
20 h-m-p 0.4741 2.3705 0.1955 YCCC 666.568593 3 1.1137 536 | 8/18
21 h-m-p 1.6000 8.0000 0.0892 YCCC 666.490997 3 1.0770 572 | 8/18
22 h-m-p 1.6000 8.0000 0.0563 YCC 666.457175 2 1.2384 606 | 8/18
23 h-m-p 1.6000 8.0000 0.0057 CCC 666.436775 2 1.8439 641 | 8/18
24 h-m-p 0.2826 8.0000 0.0370 ++CCC 666.403189 2 4.0276 678 | 8/18
25 h-m-p 1.6000 8.0000 0.0189 CC 666.394699 1 1.6376 711 | 8/18
26 h-m-p 1.6000 8.0000 0.0048 YC 666.394479 1 1.1169 743 | 8/18
27 h-m-p 1.6000 8.0000 0.0008 ++ 666.394086 m 8.0000 774 | 8/18
28 h-m-p 1.6000 8.0000 0.0030 CC 666.393327 1 2.0138 807 | 8/18
29 h-m-p 1.6000 8.0000 0.0014 CC 666.392957 1 2.1697 840 | 8/18
30 h-m-p 1.6000 8.0000 0.0008 ++ 666.392356 m 8.0000 871 | 8/18
31 h-m-p 1.6000 8.0000 0.0019 YC 666.392178 1 1.2013 903 | 8/18
32 h-m-p 1.6000 8.0000 0.0006 Y 666.392173 0 1.1896 934 | 8/18
33 h-m-p 1.6000 8.0000 0.0000 Y 666.392173 0 1.1481 965 | 8/18
34 h-m-p 1.6000 8.0000 0.0000 C 666.392173 0 0.4000 996 | 8/18
35 h-m-p 0.6973 8.0000 0.0000 C 666.392173 0 0.1743 1027 | 8/18
36 h-m-p 0.0980 8.0000 0.0000 ----------Y 666.392173 0 0.0000 1068
Out..
lnL = -666.392173
1069 lfun, 3207 eigenQcodon, 32070 P(t)
end of tree file.
Time used: 0:11
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 7, (((10, (4, (5, 6))), 8), 9)); MP score: 31
0.060839 0.090059 0.085584 0.047589 0.047541 0.104751 0.058282 0.098476 0.035454 0.088212 0.102903 0.053674 0.031274 0.054674 0.097812 1.985647 1.381475 0.551439 0.474970 1.305653
ntime & nrate & np: 15 3 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.978769
np = 20
lnL0 = -775.550790
Iterating by ming2
Initial: fx= 775.550790
x= 0.06084 0.09006 0.08558 0.04759 0.04754 0.10475 0.05828 0.09848 0.03545 0.08821 0.10290 0.05367 0.03127 0.05467 0.09781 1.98565 1.38148 0.55144 0.47497 1.30565
1 h-m-p 0.0000 0.0003 591.4089 +++ 721.166114 m 0.0003 26 | 1/20
2 h-m-p 0.0000 0.0001 453.7170 ++ 705.613381 m 0.0001 49 | 2/20
3 h-m-p 0.0000 0.0000 5542.2658 ++ 701.329037 m 0.0000 72 | 3/20
4 h-m-p 0.0000 0.0000 21402.3691 ++ 696.556534 m 0.0000 95 | 4/20
5 h-m-p 0.0000 0.0000 1754.7861 ++ 686.071528 m 0.0000 118 | 5/20
6 h-m-p 0.0000 0.0000 575.8801 ++ 684.735641 m 0.0000 141 | 6/20
7 h-m-p 0.0000 0.0000 621.6852 ++ 683.380769 m 0.0000 164 | 7/20
8 h-m-p 0.0000 0.0007 101.3532 ++YYCYCCC 679.686213 6 0.0006 198 | 7/20
9 h-m-p 0.0002 0.0008 32.0276 CCCC 679.573062 3 0.0003 227 | 7/20
10 h-m-p 0.0001 0.0011 58.0659 YCCC 679.361267 3 0.0003 255 | 7/20
11 h-m-p 0.0014 0.0330 13.4537 +++ 672.291683 m 0.0330 279 | 8/20
12 h-m-p 0.0080 0.0400 12.5608 YCYCCC 670.761228 5 0.0204 310 | 8/20
13 h-m-p 0.0175 0.0876 3.4394 YCYCCC 669.159202 5 0.0480 341 | 8/20
14 h-m-p 0.0221 0.1211 7.4613 YCCCC 668.286672 4 0.0555 371 | 8/20
15 h-m-p 0.0837 0.4185 2.1759 CCCC 667.843443 3 0.1412 400 | 8/20
16 h-m-p 0.1342 8.0000 2.2883 +YCCC 667.039357 3 0.3686 429 | 8/20
17 h-m-p 0.5074 6.0802 1.6625 YCCC 666.294675 3 0.9446 457 | 8/20
18 h-m-p 0.2081 1.0403 0.6792 +YCCC 666.107554 3 0.6879 486 | 8/20
19 h-m-p 0.1231 0.6156 0.7542 +YCC 666.013748 2 0.4098 525 | 8/20
20 h-m-p 0.1219 0.6096 0.2203 CC 666.012900 1 0.1467 562 | 8/20
21 h-m-p 1.2907 8.0000 0.0250 -------------Y 666.012900 0 0.0000 610 | 8/20
22 h-m-p 0.0000 0.0071 53.6034 +++++ 665.899156 m 0.0071 648 | 9/20
23 h-m-p 0.3358 3.8207 1.1295 +YYCCC 665.628539 4 1.0675 678 | 8/20
24 h-m-p 0.0017 0.0086 361.1315 -CCC 665.624153 2 0.0001 706 | 8/20
25 h-m-p 0.2212 5.4382 0.1554 ++YCC 665.246750 2 2.6371 734 | 8/20
26 h-m-p 0.0454 0.2269 0.4260 ++ 665.081906 m 0.2269 769 | 8/20
27 h-m-p -0.0000 -0.0000 1.4039
h-m-p: -2.67338838e-19 -1.33669419e-18 1.40394349e+00 665.081906
.. | 8/20
28 h-m-p 0.0000 0.0007 48.4772 ++CCC 664.891750 2 0.0002 830 | 8/20
29 h-m-p 0.0000 0.0000 39.1890 ++ 664.876524 m 0.0000 853 | 9/20
30 h-m-p 0.0000 0.0008 50.7717 ++CCCC 664.769055 3 0.0002 884 | 9/20
31 h-m-p 0.0002 0.0020 62.7728 CYC 664.661633 2 0.0002 910 | 9/20
32 h-m-p 0.0003 0.0032 49.8297 CCCC 664.528532 3 0.0004 939 | 9/20
33 h-m-p 0.0011 0.0057 14.0208 CCC 664.501029 2 0.0004 966 | 9/20
34 h-m-p 0.0054 0.1520 1.1272 +YCC 664.484908 2 0.0153 993 | 9/20
35 h-m-p 0.0026 0.0309 6.6523 CC 664.480297 1 0.0010 1018 | 9/20
36 h-m-p 0.0017 0.8661 6.8308 +++YCC 664.139510 2 0.0763 1047 | 9/20
37 h-m-p 0.2054 1.2881 2.5377 CCC 663.833147 2 0.2257 1074 | 9/20
38 h-m-p 1.6000 8.0000 0.1718 CYC 663.786350 2 1.8873 1100 | 9/20
39 h-m-p 1.6000 8.0000 0.1808 CCC 663.766594 2 1.6379 1138 | 9/20
40 h-m-p 1.6000 8.0000 0.1129 +YCCC 663.742040 3 5.0962 1178 | 9/20
41 h-m-p 1.0281 8.0000 0.5595 CCCC 663.713960 3 1.2933 1218 | 9/20
42 h-m-p 1.6000 8.0000 0.2863 CY 663.700281 1 1.5715 1254 | 9/20
43 h-m-p 1.6000 8.0000 0.1901 CC 663.694644 1 2.1439 1290 | 9/20
44 h-m-p 1.6000 8.0000 0.1138 YC 663.690984 1 2.8009 1325 | 9/20
45 h-m-p 0.6523 8.0000 0.4888 YC 663.687772 1 1.3785 1360 | 9/20
46 h-m-p 1.6000 8.0000 0.3344 CYC 663.685225 2 1.9110 1397 | 9/20
47 h-m-p 1.6000 8.0000 0.3774 CC 663.683957 1 2.0768 1433 | 9/20
48 h-m-p 1.6000 8.0000 0.3421 CC 663.683388 1 2.2665 1469 | 9/20
49 h-m-p 1.6000 8.0000 0.3906 CC 663.683113 1 2.0359 1505 | 9/20
50 h-m-p 1.6000 8.0000 0.3720 YC 663.682980 1 2.6166 1540 | 9/20
51 h-m-p 1.6000 8.0000 0.3535 C 663.682932 0 2.3809 1574 | 9/20
52 h-m-p 1.6000 8.0000 0.3404 Y 663.682911 0 2.5688 1608 | 9/20
53 h-m-p 1.6000 8.0000 0.3504 C 663.682902 0 2.3889 1642 | 9/20
54 h-m-p 1.6000 8.0000 0.3598 C 663.682899 0 2.3139 1676 | 9/20
55 h-m-p 1.6000 8.0000 0.3523 C 663.682897 0 2.4185 1710 | 9/20
56 h-m-p 1.6000 8.0000 0.3564 C 663.682896 0 2.3482 1744 | 9/20
57 h-m-p 1.6000 8.0000 0.3547 Y 663.682896 0 2.6438 1778 | 9/20
58 h-m-p 1.6000 8.0000 0.3453 C 663.682896 0 2.3427 1812 | 9/20
59 h-m-p 1.6000 8.0000 0.3575 Y 663.682896 0 2.8827 1846 | 9/20
60 h-m-p 1.6000 8.0000 0.2687 C 663.682896 0 1.9246 1880 | 9/20
61 h-m-p 1.6000 8.0000 0.3230 +Y 663.682896 0 4.3363 1915 | 9/20
62 h-m-p 1.6000 8.0000 0.2632 C 663.682896 0 1.5864 1949 | 9/20
63 h-m-p 0.2333 8.0000 1.7898 Y 663.682896 0 0.1615 1983 | 9/20
64 h-m-p 1.0164 8.0000 0.2844 C 663.682896 0 0.2541 2006 | 9/20
65 h-m-p 1.6000 8.0000 0.0004 C 663.682896 0 1.7742 2040 | 9/20
66 h-m-p 1.0683 8.0000 0.0007 --Y 663.682896 0 0.0167 2076 | 9/20
67 h-m-p 0.0160 8.0000 0.1211 -------Y 663.682896 0 0.0000 2117 | 9/20
68 h-m-p 0.0160 8.0000 0.0003 C 663.682896 0 0.0160 2151 | 9/20
69 h-m-p 0.0160 8.0000 0.0009 -------------.. | 9/20
70 h-m-p 0.0160 8.0000 0.0002 ------------- | 9/20
71 h-m-p 0.0160 8.0000 0.0002 -------------
Out..
lnL = -663.682896
2287 lfun, 9148 eigenQcodon, 102915 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -670.538763 S = -625.094479 -66.470836
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 69 patterns 0:46
did 20 / 69 patterns 0:46
did 30 / 69 patterns 0:47
did 40 / 69 patterns 0:47
did 50 / 69 patterns 0:47
did 60 / 69 patterns 0:47
did 69 / 69 patterns 0:47end of tree file.
Time used: 0:47
Model 7: beta
TREE # 1
(1, 2, 3, 7, (((10, (4, (5, 6))), 8), 9)); MP score: 31
0.084767 0.058316 0.034717 0.016016 0.049756 0.049484 0.033088 0.059706 0.037033 0.020781 0.071380 0.071311 0.011109 0.079328 0.041549 2.661870 1.052672 1.232678
ntime & nrate & np: 15 1 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 6.833184
np = 18
lnL0 = -744.281740
Iterating by ming2
Initial: fx= 744.281740
x= 0.08477 0.05832 0.03472 0.01602 0.04976 0.04948 0.03309 0.05971 0.03703 0.02078 0.07138 0.07131 0.01111 0.07933 0.04155 2.66187 1.05267 1.23268
1 h-m-p 0.0000 0.0001 600.6775 ++ 718.540231 m 0.0001 41 | 1/18
2 h-m-p 0.0000 0.0000 431.4701 ++ 714.059307 m 0.0000 80 | 2/18
3 h-m-p 0.0000 0.0000 3523098.3816 ++ 699.230801 m 0.0000 118 | 3/18
4 h-m-p 0.0000 0.0001 237.5475 ++ 695.102363 m 0.0001 155 | 4/18
5 h-m-p 0.0000 0.0000 703.2107 ++ 687.721130 m 0.0000 191 | 5/18
6 h-m-p 0.0000 0.0000 718.5352 ++ 683.957759 m 0.0000 226 | 6/18
7 h-m-p 0.0000 0.0000 402.6509 ++ 682.054278 m 0.0000 260 | 7/18
8 h-m-p 0.0008 0.0048 8.2552 +YYCCC 681.724160 4 0.0025 300 | 7/18
9 h-m-p 0.0004 0.0023 50.3871 +YCYCCC 680.730066 5 0.0011 341 | 7/18
10 h-m-p 0.0001 0.0006 117.3650 +YYCYCC 679.676970 5 0.0004 381 | 7/18
11 h-m-p 0.0013 0.0065 8.9519 CCC 679.657081 2 0.0005 417 | 7/18
12 h-m-p 0.0004 0.0260 11.3955 ++YCYCYC 678.621045 5 0.0177 459 | 7/18
13 h-m-p 0.0125 0.0626 12.9611 CYYCCC 677.257354 5 0.0291 500 | 7/18
14 h-m-p 0.2307 1.1534 1.0135 YCYCCC 674.839289 5 0.6347 541 | 7/18
15 h-m-p 0.0728 0.3639 6.0382 CCCCC 672.237434 4 0.1062 581 | 7/18
16 h-m-p 0.1810 0.9048 1.4467 +YCYCCC 670.173215 5 0.5605 623 | 7/18
17 h-m-p 0.1626 0.8128 0.4455 +YYYYYYC 667.877531 6 0.6433 662 | 7/18
18 h-m-p 0.0079 0.0397 2.7895 YYYCCCC 667.831352 6 0.0083 703 | 7/18
19 h-m-p 0.0285 0.1849 0.8162 ++ 666.999336 m 0.1849 735 | 8/18
20 h-m-p 0.5355 2.6775 0.0916 CCYCC 666.807346 4 0.4571 774 | 8/18
21 h-m-p 0.0112 0.1123 3.7344 CCC 666.717916 2 0.0110 809 | 8/18
22 h-m-p 0.3454 6.2230 0.1189 +CYC 666.492704 2 1.3418 844 | 8/18
23 h-m-p 0.3427 1.7135 0.0096 YCCC 666.448247 3 0.7974 880 | 8/18
24 h-m-p 0.1519 8.0000 0.0507 +CCC 666.435980 2 0.7650 916 | 8/18
25 h-m-p 1.6000 8.0000 0.0031 YC 666.435326 1 0.7321 948 | 8/18
26 h-m-p 1.5421 8.0000 0.0015 YC 666.435228 1 0.8601 980 | 8/18
27 h-m-p 1.5092 8.0000 0.0008 C 666.435214 0 1.3184 1011 | 8/18
28 h-m-p 1.6000 8.0000 0.0001 C 666.435213 0 1.2908 1042 | 8/18
29 h-m-p 1.6000 8.0000 0.0000 +C 666.435212 0 6.3690 1074 | 8/18
30 h-m-p 1.6000 8.0000 0.0000 ++ 666.435205 m 8.0000 1105 | 8/18
31 h-m-p 1.6000 8.0000 0.0002 +Y 666.435191 0 4.0675 1137 | 8/18
32 h-m-p 1.6000 8.0000 0.0001 C 666.435186 0 1.6506 1168 | 8/18
33 h-m-p 1.6000 8.0000 0.0001 C 666.435186 0 1.3860 1199 | 8/18
34 h-m-p 1.6000 8.0000 0.0000 C 666.435186 0 1.6728 1230 | 8/18
35 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 8/18
36 h-m-p 0.0149 7.4704 0.0005 --C 666.435186 0 0.0003 1308 | 8/18
37 h-m-p 0.0160 8.0000 0.0002 -------------.. | 8/18
38 h-m-p 0.0160 8.0000 0.0008 -------------
Out..
lnL = -666.435186
1393 lfun, 15323 eigenQcodon, 208950 P(t)
end of tree file.
Time used: 1:57
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 7, (((10, (4, (5, 6))), 8), 9)); MP score: 31
0.093298 0.011101 0.070787 0.090683 0.072428 0.070131 0.023456 0.103171 0.039061 0.011471 0.018451 0.037278 0.075644 0.061126 0.098814 1.933597 0.900000 0.423675 1.996386 1.300000
ntime & nrate & np: 15 2 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 10.738915
np = 20
lnL0 = -757.254026
Iterating by ming2
Initial: fx= 757.254026
x= 0.09330 0.01110 0.07079 0.09068 0.07243 0.07013 0.02346 0.10317 0.03906 0.01147 0.01845 0.03728 0.07564 0.06113 0.09881 1.93360 0.90000 0.42367 1.99639 1.30000
1 h-m-p 0.0000 0.0001 602.1195 ++ 730.308432 m 0.0001 45 | 1/20
2 h-m-p 0.0000 0.0002 360.0977 ++ 709.086998 m 0.0002 88 | 2/20
3 h-m-p 0.0000 0.0000 14098.3086 ++ 685.842223 m 0.0000 130 | 3/20
4 h-m-p 0.0000 0.0000 776.0612 ++ 684.158800 m 0.0000 171 | 4/20
5 h-m-p 0.0000 0.0000 803.1855 ++ 678.079933 m 0.0000 211 | 5/20
6 h-m-p 0.0000 0.0000 1248.0684 ++ 677.355549 m 0.0000 250 | 6/20
7 h-m-p 0.0000 0.0000 281.8974 ++ 676.495510 m 0.0000 288 | 7/20
8 h-m-p 0.0001 0.0008 56.7522 +YYYCCCCC 675.388502 7 0.0004 337 | 7/20
9 h-m-p 0.0000 0.0002 130.0877 +YYCCCC 674.623392 5 0.0002 382 | 7/20
10 h-m-p 0.0022 0.0177 9.2046 YCCC 674.535709 3 0.0012 423 | 7/20
11 h-m-p 0.0005 0.0095 22.7853 +CCCCC 674.060770 4 0.0025 468 | 7/20
12 h-m-p 0.0027 0.0160 21.3950 +YYCCC 672.897999 4 0.0086 511 | 7/20
13 h-m-p 0.0028 0.0142 14.8168 ++ 671.783543 m 0.0142 547 | 7/20
14 h-m-p 0.0000 0.0000 12.4242
h-m-p: 7.99107333e-20 3.99553666e-19 1.24242059e+01 671.783543
.. | 7/20
15 h-m-p 0.0000 0.0002 176.8122 ++CYC 670.081748 2 0.0001 621 | 7/20
16 h-m-p 0.0001 0.0003 135.9416 ++ 667.274584 m 0.0003 657
QuantileBeta(0.15, 0.00496, 2.06704) = 4.888851e-162 2000 rounds
| 7/20
17 h-m-p 0.0000 0.0002 133.6749 +YCYCCC 666.634985 5 0.0001 702
QuantileBeta(0.15, 0.00496, 2.06704) = 6.618593e-162 2000 rounds
| 7/20
18 h-m-p 0.0002 0.0008 89.1891 CCCC 666.232623 3 0.0002 744
QuantileBeta(0.15, 0.00496, 2.06704) = 4.769379e-162 2000 rounds
| 7/20
19 h-m-p 0.0001 0.0003 42.0801 +YCCC 666.126307 3 0.0002 786
QuantileBeta(0.15, 0.00496, 2.06704) = 3.793404e-162 2000 rounds
| 7/20
20 h-m-p 0.0001 0.0004 20.4837 +YC 666.091235 1 0.0002 824 | 7/20
21 h-m-p 0.0000 0.0001 15.7490 ++ 666.077686 m 0.0001 860 | 8/20
22 h-m-p 0.0001 0.0052 13.1702 +CYC 666.058135 2 0.0004 900 | 8/20
23 h-m-p 0.0009 0.0043 5.6566 YC 666.052046 1 0.0005 936 | 8/20
24 h-m-p 0.0011 0.1517 2.9008 ++++ 665.167113 m 0.1517 973 | 9/20
25 h-m-p 0.4233 2.1166 0.9223 YCCC 664.134634 3 1.0577 1013 | 9/20
26 h-m-p 1.6000 8.0000 0.3044 CYCCC 663.774751 4 1.4027 1054 | 9/20
27 h-m-p 1.6000 8.0000 0.1716 CYC 663.696017 2 1.4414 1091 | 9/20
28 h-m-p 1.6000 8.0000 0.0828 YC 663.685906 1 1.1394 1126 | 9/20
29 h-m-p 1.6000 8.0000 0.0548 YC 663.684084 1 0.7286 1161 | 9/20
30 h-m-p 1.6000 8.0000 0.0234 CC 663.683237 1 1.9832 1197 | 9/20
31 h-m-p 1.6000 8.0000 0.0121 C 663.682934 0 1.7165 1231 | 9/20
32 h-m-p 1.6000 8.0000 0.0011 C 663.682899 0 1.5434 1265 | 9/20
33 h-m-p 1.6000 8.0000 0.0006 C 663.682897 0 1.3232 1299 | 9/20
34 h-m-p 1.6000 8.0000 0.0001 Y 663.682897 0 1.2556 1333 | 9/20
35 h-m-p 1.6000 8.0000 0.0000 Y 663.682897 0 1.0745 1367 | 9/20
36 h-m-p 1.6000 8.0000 0.0000 -C 663.682897 0 0.1000 1402 | 9/20
37 h-m-p 0.0768 8.0000 0.0000 -C 663.682897 0 0.0048 1437 | 9/20
38 h-m-p 0.0160 8.0000 0.0007 -------------.. | 9/20
39 h-m-p 0.0160 8.0000 0.0006 -------------
Out..
lnL = -663.682897
1528 lfun, 18336 eigenQcodon, 252120 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -669.821778 S = -625.094478 -84.893759
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 69 patterns 3:24
did 20 / 69 patterns 3:24
did 30 / 69 patterns 3:25
did 40 / 69 patterns 3:25
did 50 / 69 patterns 3:25
did 60 / 69 patterns 3:25
did 69 / 69 patterns 3:25end of tree file.
Time used: 3:25
The loglikelihoods for models M1, M2, M7 and M8 are -666.392173 -663.682896 -666.435186 -663.682897 respectively
CLUSTAL W (1.8) multiple sequence alignment (ALTER 1.3.3)
B04f_NS3b_ABN10841_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQ
B07f_NS3b_ABN10859_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQ
B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQ
BtTp_GX2012_NA_AIA62354_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQ
CZ01_orf4a_AWH65879_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQ
CZ07_orf4a_AWH65890_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQ
HKU4_1_B04f_NS3b_YP_001039955_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQ
LMH1f_NS3b_ABN10868_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQ
SM3A_NA_QQD78085_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQ
SZ140324_orf4a_AWH65901_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKFYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKLYEYSAQ
**************** ****.*******************************:******
B04f_NS3b_ABN10841_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASDIFGQNRYDASKSYFFSKTA
B07f_NS3b_ABN10859_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASDIFGQNRYDASKSYFFSKTA
B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASDIFGQNRYDASKSYFFSKTA
BtTp_GX2012_NA_AIA62354_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATECTKALAKQDAARIICQQLQAAGLLNGMELQFRSCFADIFGKNRYDASKSYFFSKTT
CZ01_orf4a_AWH65879_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFADIFGKNRYDASKSYFFSKTT
CZ07_orf4a_AWH65890_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFADIFGKNRYDASKSYFFSKTT
HKU4_1_B04f_NS3b_YP_001039955_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASDIFGQNRYDASKSYFFSKTA
LMH1f_NS3b_ABN10868_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATECTKASAKQDAARLICQQLQAAGLLNGMELRFRSSAFDIFGQNRYDASKSYFFSKTA
SM3A_NA_QQD78085_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 ATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFDIFGQNRYDASKSYFFSKTA
SZ140324_orf4a_AWH65901_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFDIFGQNRYDASKSYFFSKTA
******* *******:** *:**********:***. ****:**************:
>B04f_NS3b_ABN10841_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTCTTATAAAGAGACTCCTAGTCAGTATCATTACCTGTATCCACCCAGGTTTTTCTATAAACCTGTTTTGGGTAATTTACAGCACCCTACCAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCATCAGCAAAACAAGATGCAGCTAGACTTATCTGTGAACAGTTACAAGCTGCTGGACTACTCAATGGAATGGAGCTCCGATTCCGTAGTTCTGCCTCCGACATCTTCGGACAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGGCA >B07f_NS3b_ABN10859_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTCTTATAAAGAGACTCCTAGTCAGTATCATTACCTGTATCCACCCAGGTTTTTCTATAAACCTGTTTTGGGTAATTTACAGCACCCTACCAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCATCAGCAAAACAAGATGCAGCTAGACTTATCTGTGAACAGTTACAAGCTGCTGGACTACTCAATGGAATGGAGCTCCGATTCCGTAGTTCTGCCTCCGACATCTTCGGACAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGGCA >B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTCTTATAAAGAGACTCCTAGTCAGTATCATTACCTGTATCCACCCAGGTTTTTCTATAAACCTGTTTTGGGTAATTTACAGCACCCTACCAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCATCAGCAAAACAAGATGCAGCTAGACTTATCTGTGAACAGTTACAAGCTGCTGGACTACTCAATGGAATGGAGCTCCGATTCCGTAGTTCTGCCTCCGACATCTTCGGACAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGGCA >BtTp_GX2012_NA_AIA62354_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTTCTATAAAGAGACTAGTAGTCAGTACCATTACCTGTATCCACCCAGGTTCTTTTACAAACCTGTTTTAGGTAATTTACAGCACCCTACTAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCTTTAGCAAAACAAGATGCAGCCAGAATTATCTGTCAGCAATTGCAGGCTGCTGGACTCCTCAATGGAATGGAGCTCCAGTTCCGTAGCTGCTTTGCTGACATCTTCGGAAAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGACA >CZ01_orf4a_AWH65879_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTTCTATAAAGAGACTAGTAGTCAGTACCATTACCTGTATCCACCCAGGTTCTTTTACAAACCTGTTTTAGGTAATTTACAGCACCCTACTAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCTTCAGCAAAACAAGATGCAGCCAGAATTATATGTGCA---TTGCATGCTGCTGGACTCCTCAATGGAATGGAGCTCCAGTTCCGTAGCTGCTTTGCTGACATCTTCGGAAAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGACA >CZ07_orf4a_AWH65890_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTTCTATAAAGAGACTAGTAGTCAGTACCATTACCTGTATCCACCCAGGTTCTTTTACAAACCTGTTTTAGGTAATTTACAGCACCCTACTAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCTTCAGCAAAACAAGATGCAGCCAGAATTATATGTGCA---TTGCATGCTGCTGGACTCCTCAATGGAATGGAGCTCCAGTTCCGTAGCTGCTTTGCTGACATCTTCGGAAAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGACA >HKU4_1_B04f_NS3b_YP_001039955_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTCTTATAAAGAGACTCCTAGTCAGTATCATTACCTGTATCCACCCAGGTTTTTCTATAAACCTGTTTTGGGTAATTTACAGCACCCTACCAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCATCAGCAAAACAAGATGCAGCTAGACTTATCTGTGAACAGTTACAAGCTGCTGGACTACTCAATGGAATGGAGCTCCGATTCCGTAGTTCTGCCTCCGACATCTTCGGACAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGGCA >LMH1f_NS3b_ABN10868_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTCTTATAAAGAGACTCCTAGTCAGTATCATTACCTGTATCCACCCAGGTTTTTCTATAAACCTGTTTTAGGTAATTTACAGCACCCTACCAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCATCAGCAAAACAAGATGCAGCTAGACTTATCTGTCAACAGTTACAAGCTGCTGGACTCCTCAATGGAATGGAGCTCCGATTCCGTAGTTCTGCCTTCGACATCTTCGGACAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGGCA >SM3A_NA_QQD78085_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTCTTATAAAGAGACTCCTAGTCAGTATCATTACCTGTATCCACCCAGGTTTTTCTATAAACCTGTTTTGGGTAATTTACAGCACCCTACCAAGTGGTGTTGTACTATTAAATTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCATCAGCAAAACAAGATGCAGCTAGACTTATCTGTGAACAGTTACAAGCTGCTGGACTCCTCAATGGAATGGAGCTCCGATTCCGTAGTTCTGCCTTCGACATCTTCGGACAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGGCA >SZ140324_orf4a_AWH65901_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ATGGACTACGTCTCTTTGCTTAACCAATTTTGGCAGAAGCAAATTAAGTTTTATAAAGAGACTCCTAGTCAGTACCATTACCTGTATCCACCCAGGTTTTTCTATAAACCTGTTTTAGGTAATTTACAGCACCCTACTAAGTGGTGTTGTACTATTAAACTTTATGAGTATAGTGCTCAGGCTACTGAGTGTACTAAAGCATCAGCAAAACAAGATGCAGCTAGACTTATCTGTGAACAGTTACAAGCTGCTGGACTCCTCAATGGAATGGAGCTCCGATTCCGTAGTTCTGCTTTCGACATCTTCGGACAAAACCGTTATGATGCCAGCAAAAGCTACTTCTTCTCGAAAACGGCA
>B04f_NS3b_ABN10841_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASDIFGQNRYDASKSYFFSKTA >B07f_NS3b_ABN10859_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASDIFGQNRYDASKSYFFSKTA >B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASDIFGQNRYDASKSYFFSKTA >BtTp_GX2012_NA_AIA62354_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQATECTKALAKQDAARIICQQLQAAGLLNGMELQFRSCFADIFGKNRYDASKSYFFSKTT >CZ01_orf4a_AWH65879_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFADIFGKNRYDASKSYFFSKTT >CZ07_orf4a_AWH65890_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKFYKETSSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQATECTKASAKQDAARIICA-LHAAGLLNGMELQFRSCFADIFGKNRYDASKSYFFSKTT >HKU4_1_B04f_NS3b_YP_001039955_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSASDIFGQNRYDASKSYFFSKTA >LMH1f_NS3b_ABN10868_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQATECTKASAKQDAARLICQQLQAAGLLNGMELRFRSSAFDIFGQNRYDASKSYFFSKTA >SM3A_NA_QQD78085_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKSYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKFYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFDIFGQNRYDASKSYFFSKTA >SZ140324_orf4a_AWH65901_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MDYVSLLNQFWQKQIKFYKETPSQYHYLYPPRFFYKPVLGNLQHPTKWCCTIKLYEYSAQATECTKASAKQDAARLICEQLQAAGLLNGMELRFRSSAFDIFGQNRYDASKSYFFSKTA
Reading sequence file /data//pss_subsets/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/codeml/fasta/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1
Found 10 sequences of length 357
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 4.5%
Found 32 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 7
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 23 polymorphic sites
**p-Value(s)**
----------
NSS: 2.04e-01 (1000 permutations)
Max Chi^2: 5.00e-02 (1000 permutations)
PHI (Permutation): 2.28e-01 (1000 permutations)
PHI (Normal): 1.80e-01
#NEXUS
[ID: 1177256039]
begin taxa;
dimensions ntax=10;
taxlabels
B04f_NS3b_ABN10841_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
SZ140324_orf4a_AWH65901_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4
B07f_NS3b_ABN10859_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
BtTp_GX2012_NA_AIA62354_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4
CZ01_orf4a_AWH65879_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4
CZ07_orf4a_AWH65890_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4
HKU4_1_B04f_NS3b_YP_001039955_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
LMH1f_NS3b_ABN10868_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
SM3A_NA_QQD78085_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4
;
end;
begin trees;
translate
1 B04f_NS3b_ABN10841_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
2 SZ140324_orf4a_AWH65901_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4,
3 B07f_NS3b_ABN10859_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
4 B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
5 BtTp_GX2012_NA_AIA62354_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
6 CZ01_orf4a_AWH65879_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4,
7 CZ07_orf4a_AWH65890_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4,
8 HKU4_1_B04f_NS3b_YP_001039955_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
9 LMH1f_NS3b_ABN10868_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
10 SM3A_NA_QQD78085_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:1.440133e-03,3:1.494202e-03,4:1.504922e-03,8:1.495234e-03,(((2:3.013842e-03,(5:8.572956e-03,(6:1.562559e-03,7:1.555161e-03)0.989:8.325823e-03)1.000:6.431686e-02)0.992:1.090304e-02,9:3.719457e-03)0.936:3.743593e-03,10:1.543958e-03)0.999:5.661049e-03);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:1.440133e-03,3:1.494202e-03,4:1.504922e-03,8:1.495234e-03,(((2:3.013842e-03,(5:8.572956e-03,(6:1.562559e-03,7:1.555161e-03):8.325823e-03):6.431686e-02):1.090304e-02,9:3.719457e-03):3.743593e-03,10:1.543958e-03):5.661049e-03);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -702.76 -716.40
2 -702.66 -716.61
--------------------------------------
TOTAL -702.71 -716.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.137393 0.000841 0.087589 0.194158 0.133804 1307.60 1308.66 1.000
r(A<->C){all} 0.142286 0.002998 0.044625 0.249193 0.137594 430.20 562.85 1.003
r(A<->G){all} 0.210637 0.004747 0.076129 0.340388 0.207005 245.15 412.78 1.000
r(A<->T){all} 0.028591 0.000523 0.000004 0.073265 0.023683 694.86 826.32 1.000
r(C<->G){all} 0.148601 0.004434 0.033493 0.285143 0.140371 434.30 500.51 1.000
r(C<->T){all} 0.387468 0.006249 0.239433 0.543175 0.385884 596.50 648.24 1.002
r(G<->T){all} 0.082417 0.002116 0.004493 0.169092 0.075106 474.85 475.02 1.000
pi(A){all} 0.294301 0.000559 0.249635 0.342100 0.293692 1185.29 1301.92 1.000
pi(C){all} 0.221310 0.000426 0.182477 0.262909 0.220691 1085.78 1217.21 1.000
pi(G){all} 0.189537 0.000415 0.153118 0.231896 0.188226 1291.42 1296.07 1.000
pi(T){all} 0.294852 0.000519 0.251185 0.341108 0.294366 1040.47 1197.48 1.000
alpha{1,2} 0.489825 0.397422 0.000011 1.774339 0.259484 1180.05 1220.48 1.000
alpha{3} 1.666101 1.300541 0.167183 4.075566 1.402344 1232.98 1312.37 1.000
pinvar{all} 0.302286 0.031765 0.000090 0.614808 0.292308 874.34 946.77 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/B05f_NS3b_ABN10850_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 10 ls = 118
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 4 4 4 | Ser TCT 3 3 3 1 1 1 | Tyr TAT 7 7 7 5 5 5 | Cys TGT 4 4 4 4 4 4
TTC 5 5 5 6 6 6 | TCC 1 1 1 0 0 0 | TAC 3 3 3 5 5 5 | TGC 0 0 0 1 1 1
Leu TTA 2 2 2 3 2 2 | TCA 1 1 1 0 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 1 1 1 | Pro CCT 3 3 3 2 2 2 | His CAT 1 1 1 1 2 2 | Arg CGT 2 2 2 2 2 2
CTC 2 2 2 3 3 3 | CCC 1 1 1 1 1 1 | CAC 1 1 1 1 1 1 | CGC 0 0 0 0 0 0
CTA 1 1 1 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 5 5 5 3 3 3 | CGA 1 1 1 0 0 0
CTG 1 1 1 1 1 1 | CCG 0 0 0 0 0 0 | CAG 4 4 4 7 5 5 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 3 3 3 | Thr ACT 4 4 4 5 5 5 | Asn AAT 2 2 2 2 2 2 | Ser AGT 3 3 3 3 3 3
ATC 2 2 2 2 1 1 | ACC 1 1 1 0 0 0 | AAC 2 2 2 2 2 2 | AGC 2 2 2 3 3 3
ATA 0 0 0 0 1 1 | ACA 0 0 0 1 1 1 | Lys AAA 7 7 7 8 8 8 | Arg AGA 1 1 1 1 1 1
Met ATG 2 2 2 2 2 2 | ACG 1 1 1 1 1 1 | AAG 3 3 3 3 3 3 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 5 5 5 6 6 6 | Asp GAT 2 2 2 2 2 2 | Gly GGT 1 1 1 1 1 1
GTC 1 1 1 1 1 1 | GCC 2 2 2 2 2 2 | GAC 2 2 2 2 2 2 | GGC 0 0 0 0 0 0
GTA 0 0 0 0 0 0 | GCA 4 4 4 2 3 3 | Glu GAA 1 1 1 0 0 0 | GGA 3 3 3 3 3 3
GTG 0 0 0 0 0 0 | GCG 0 0 0 0 0 0 | GAG 4 4 4 4 4 4 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 | Ser TCT 3 3 3 2 | Tyr TAT 7 7 7 6 | Cys TGT 4 4 4 4
TTC 5 6 6 6 | TCC 1 0 0 0 | TAC 3 3 3 4 | TGC 0 0 0 0
Leu TTA 2 3 2 3 | TCA 1 1 1 1 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 2 1 2 1 | TCG 1 1 1 1 | TAG 0 0 0 0 | Trp TGG 2 2 2 2
------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 3 | Pro CCT 3 3 3 3 | His CAT 1 1 1 1 | Arg CGT 2 2 2 2
CTC 2 3 3 3 | CCC 1 1 1 1 | CAC 1 1 1 1 | CGC 0 0 0 0
CTA 1 0 0 0 | CCA 1 1 1 1 | Gln CAA 5 6 5 5 | CGA 1 1 1 1
CTG 1 1 1 1 | CCG 0 0 0 0 | CAG 4 4 4 4 | CGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 | Thr ACT 4 4 4 5 | Asn AAT 2 2 2 2 | Ser AGT 3 3 3 3
ATC 2 2 2 2 | ACC 1 1 1 0 | AAC 2 2 2 2 | AGC 2 2 2 2
ATA 0 0 0 0 | ACA 0 0 0 0 | Lys AAA 7 7 7 7 | Arg AGA 1 1 1 1
Met ATG 2 2 2 2 | ACG 1 1 1 1 | AAG 3 3 3 3 | AGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 | Ala GCT 5 5 5 6 | Asp GAT 2 2 2 2 | Gly GGT 1 1 1 1
GTC 1 1 1 1 | GCC 2 2 2 1 | GAC 2 2 2 2 | GGC 0 0 0 0
GTA 0 0 0 0 | GCA 4 4 4 4 | Glu GAA 1 0 1 1 | GGA 3 3 3 3
GTG 0 0 0 0 | GCG 0 0 0 0 | GAG 4 4 4 4 | GGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C1
position 1: T:0.28814 C:0.21186 A:0.27966 G:0.22034
position 2: T:0.22034 C:0.23729 A:0.37288 G:0.16949
position 3: T:0.38136 C:0.21186 A:0.22881 G:0.17797
Average T:0.29661 C:0.22034 A:0.29379 G:0.18927
#2: C2
position 1: T:0.28814 C:0.21186 A:0.27966 G:0.22034
position 2: T:0.22034 C:0.23729 A:0.37288 G:0.16949
position 3: T:0.38136 C:0.21186 A:0.22881 G:0.17797
Average T:0.29661 C:0.22034 A:0.29379 G:0.18927
#3: C3
position 1: T:0.28814 C:0.21186 A:0.27966 G:0.22034
position 2: T:0.22034 C:0.23729 A:0.37288 G:0.16949
position 3: T:0.38136 C:0.21186 A:0.22881 G:0.17797
Average T:0.29661 C:0.22034 A:0.29379 G:0.18927
#4: C4
position 1: T:0.28814 C:0.19492 A:0.31356 G:0.20339
position 2: T:0.24576 C:0.19492 A:0.38136 G:0.17797
position 3: T:0.36441 C:0.24576 A:0.18644 G:0.20339
Average T:0.29944 C:0.21186 A:0.29379 G:0.19492
#5: C5
position 1: T:0.28814 C:0.18644 A:0.31356 G:0.21186
position 2: T:0.23729 C:0.21186 A:0.37288 G:0.17797
position 3: T:0.37288 C:0.23729 A:0.20339 G:0.18644
Average T:0.29944 C:0.21186 A:0.29661 G:0.19209
#6: C6
position 1: T:0.28814 C:0.18644 A:0.31356 G:0.21186
position 2: T:0.23729 C:0.21186 A:0.37288 G:0.17797
position 3: T:0.37288 C:0.23729 A:0.20339 G:0.18644
Average T:0.29944 C:0.21186 A:0.29661 G:0.19209
#7: C7
position 1: T:0.28814 C:0.21186 A:0.27966 G:0.22034
position 2: T:0.22034 C:0.23729 A:0.37288 G:0.16949
position 3: T:0.38136 C:0.21186 A:0.22881 G:0.17797
Average T:0.29661 C:0.22034 A:0.29379 G:0.18927
#8: C8
position 1: T:0.28814 C:0.22034 A:0.27966 G:0.21186
position 2: T:0.22881 C:0.22881 A:0.37288 G:0.16949
position 3: T:0.38136 C:0.22034 A:0.22881 G:0.16949
Average T:0.29944 C:0.22316 A:0.29379 G:0.18362
#9: C9
position 1: T:0.28814 C:0.21186 A:0.27966 G:0.22034
position 2: T:0.22881 C:0.22881 A:0.37288 G:0.16949
position 3: T:0.38136 C:0.22034 A:0.22034 G:0.17797
Average T:0.29944 C:0.22034 A:0.29096 G:0.18927
#10: C10
position 1: T:0.27966 C:0.22034 A:0.27966 G:0.22034
position 2: T:0.23729 C:0.22034 A:0.37288 G:0.16949
position 3: T:0.38983 C:0.21186 A:0.22881 G:0.16949
Average T:0.30226 C:0.21751 A:0.29379 G:0.18644
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 33 | Ser S TCT 23 | Tyr Y TAT 63 | Cys C TGT 40
TTC 56 | TCC 4 | TAC 37 | TGC 3
Leu L TTA 23 | TCA 9 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 10 | TAG 0 | Trp W TGG 20
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 27 | His H CAT 12 | Arg R CGT 20
CTC 26 | CCC 10 | CAC 10 | CGC 0
CTA 4 | CCA 10 | Gln Q CAA 45 | CGA 7
CTG 10 | CCG 0 | CAG 45 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 23 | Thr T ACT 44 | Asn N AAT 20 | Ser S AGT 30
ATC 18 | ACC 6 | AAC 20 | AGC 23
ATA 2 | ACA 3 | Lys K AAA 73 | Arg R AGA 10
Met M ATG 20 | ACG 10 | AAG 30 | AGG 10
------------------------------------------------------------------------------
Val V GTT 10 | Ala A GCT 54 | Asp D GAT 20 | Gly G GGT 10
GTC 10 | GCC 19 | GAC 20 | GGC 0
GTA 0 | GCA 36 | Glu E GAA 6 | GGA 30
GTG 0 | GCG 0 | GAG 40 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.28729 C:0.20678 A:0.28983 G:0.21610
position 2: T:0.22966 C:0.22458 A:0.37373 G:0.17203
position 3: T:0.37881 C:0.22203 A:0.21864 G:0.18051
Average T:0.29859 C:0.21780 A:0.29407 G:0.18955
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 7, (((10, (4, (5, 6))), 8), 9)); MP score: 31
lnL(ntime: 15 np: 18): -666.392173 +0.000000
11..1 11..2 11..3 11..7 11..12 12..13 13..14 14..10 14..15 15..4 15..16 16..5 16..6 13..8 12..9
0.000004 0.000004 0.000004 0.000004 0.018411 0.009142 0.043614 0.003015 0.248315 0.030445 0.025098 0.000004 0.000004 0.009282 0.000004 1.985647 0.781304 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.387350
(1: 0.000004, 2: 0.000004, 3: 0.000004, 7: 0.000004, (((10: 0.003015, (4: 0.030445, (5: 0.000004, 6: 0.000004): 0.025098): 0.248315): 0.043614, 8: 0.009282): 0.009142, 9: 0.000004): 0.018411);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C7: 0.000004, (((C10: 0.003015, (C4: 0.030445, (C5: 0.000004, C6: 0.000004): 0.025098): 0.248315): 0.043614, C8: 0.009282): 0.009142, C9: 0.000004): 0.018411);
Detailed output identifying parameters
kappa (ts/tv) = 1.98565
MLEs of dN/dS (w) for site classes (K=2)
p: 0.78130 0.21870
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.000 272.2 81.8 0.2187 0.0000 0.0000 0.0 0.0
11..2 0.000 272.2 81.8 0.2187 0.0000 0.0000 0.0 0.0
11..3 0.000 272.2 81.8 0.2187 0.0000 0.0000 0.0 0.0
11..7 0.000 272.2 81.8 0.2187 0.0000 0.0000 0.0 0.0
11..12 0.018 272.2 81.8 0.2187 0.0034 0.0154 0.9 1.3
12..13 0.009 272.2 81.8 0.2187 0.0017 0.0076 0.5 0.6
13..14 0.044 272.2 81.8 0.2187 0.0080 0.0364 2.2 3.0
14..10 0.003 272.2 81.8 0.2187 0.0006 0.0025 0.1 0.2
14..15 0.248 272.2 81.8 0.2187 0.0453 0.2073 12.3 17.0
15..4 0.030 272.2 81.8 0.2187 0.0056 0.0254 1.5 2.1
15..16 0.025 272.2 81.8 0.2187 0.0046 0.0210 1.2 1.7
16..5 0.000 272.2 81.8 0.2187 0.0000 0.0000 0.0 0.0
16..6 0.000 272.2 81.8 0.2187 0.0000 0.0000 0.0 0.0
13..8 0.009 272.2 81.8 0.2187 0.0017 0.0077 0.5 0.6
12..9 0.000 272.2 81.8 0.2187 0.0000 0.0000 0.0 0.0
Time used: 0:11
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 7, (((10, (4, (5, 6))), 8), 9)); MP score: 31
check convergence..
lnL(ntime: 15 np: 20): -663.682896 +0.000000
11..1 11..2 11..3 11..7 11..12 12..13 13..14 14..10 14..15 15..4 15..16 16..5 16..6 13..8 12..9
0.000004 0.000004 0.000004 0.000004 0.018811 0.009465 0.047735 0.000004 0.283700 0.030776 0.024906 0.000004 0.000004 0.009418 0.000004 2.661870 0.857189 0.000000 0.000001 3.232922
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.424844
(1: 0.000004, 2: 0.000004, 3: 0.000004, 7: 0.000004, (((10: 0.000004, (4: 0.030776, (5: 0.000004, 6: 0.000004): 0.024906): 0.283700): 0.047735, 8: 0.009418): 0.009465, 9: 0.000004): 0.018811);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C7: 0.000004, (((C10: 0.000004, (C4: 0.030776, (C5: 0.000004, C6: 0.000004): 0.024906): 0.283700): 0.047735, C8: 0.009418): 0.009465, C9: 0.000004): 0.018811);
Detailed output identifying parameters
kappa (ts/tv) = 2.66187
MLEs of dN/dS (w) for site classes (K=3)
p: 0.85719 0.00000 0.14281
w: 0.00000 1.00000 3.23292
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.000 266.6 87.4 0.4617 0.0000 0.0000 0.0 0.0
11..2 0.000 266.6 87.4 0.4617 0.0000 0.0000 0.0 0.0
11..3 0.000 266.6 87.4 0.4617 0.0000 0.0000 0.0 0.0
11..7 0.000 266.6 87.4 0.4617 0.0000 0.0000 0.0 0.0
11..12 0.019 266.6 87.4 0.4617 0.0049 0.0105 1.3 0.9
12..13 0.009 266.6 87.4 0.4617 0.0024 0.0053 0.7 0.5
13..14 0.048 266.6 87.4 0.4617 0.0124 0.0268 3.3 2.3
14..10 0.000 266.6 87.4 0.4617 0.0000 0.0000 0.0 0.0
14..15 0.284 266.6 87.4 0.4617 0.0734 0.1590 19.6 13.9
15..4 0.031 266.6 87.4 0.4617 0.0080 0.0173 2.1 1.5
15..16 0.025 266.6 87.4 0.4617 0.0064 0.0140 1.7 1.2
16..5 0.000 266.6 87.4 0.4617 0.0000 0.0000 0.0 0.0
16..6 0.000 266.6 87.4 0.4617 0.0000 0.0000 0.0 0.0
13..8 0.009 266.6 87.4 0.4617 0.0024 0.0053 0.6 0.5
12..9 0.000 266.6 87.4 0.4617 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
17 S 1.000** 3.233
22 P 1.000** 3.233
54 F 1.000** 3.233
68 S 1.000** 3.233
76 L 1.000** 3.233
79 E 1.000** 3.233
81 Q 1.000** 3.233
92 R 1.000** 3.233
96 S 1.000** 3.233
97 A 1.000** 3.233
98 S 1.000** 3.233
103 Q 1.000** 3.233
118 A 1.000** 3.233
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
22 P 0.693 4.132 +- 2.835
54 F 0.535 3.209 +- 2.655
79 E 0.939 5.586 +- 2.552
97 A 0.644 3.843 +- 2.810
98 S 0.920 5.470 +- 2.597
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.826 0.156 0.017 0.001 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.025 0.087 0.143 0.160 0.149 0.127 0.103 0.083 0.067 0.055
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.016
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.022 0.093
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.026 0.130 0.186
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.006 0.030 0.140 0.261 0.081
sum of density on p0-p1 = 1.000000
Time used: 0:47
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 7, (((10, (4, (5, 6))), 8), 9)); MP score: 31
check convergence..
lnL(ntime: 15 np: 18): -666.435186 +0.000000
11..1 11..2 11..3 11..7 11..12 12..13 13..14 14..10 14..15 15..4 15..16 16..5 16..6 13..8 12..9
0.000004 0.000004 0.000004 0.000004 0.018206 0.009041 0.043344 0.002793 0.246554 0.030157 0.024740 0.000004 0.000004 0.009177 0.000004 1.933597 0.005000 0.020192
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.384039
(1: 0.000004, 2: 0.000004, 3: 0.000004, 7: 0.000004, (((10: 0.002793, (4: 0.030157, (5: 0.000004, 6: 0.000004): 0.024740): 0.246554): 0.043344, 8: 0.009177): 0.009041, 9: 0.000004): 0.018206);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C7: 0.000004, (((C10: 0.002793, (C4: 0.030157, (C5: 0.000004, C6: 0.000004): 0.024740): 0.246554): 0.043344, C8: 0.009177): 0.009041, C9: 0.000004): 0.018206);
Detailed output identifying parameters
kappa (ts/tv) = 1.93360
Parameters in M7 (beta):
p = 0.00500 q = 0.02019
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.000 272.7 81.3 0.2000 0.0000 0.0000 0.0 0.0
11..2 0.000 272.7 81.3 0.2000 0.0000 0.0000 0.0 0.0
11..3 0.000 272.7 81.3 0.2000 0.0000 0.0000 0.0 0.0
11..7 0.000 272.7 81.3 0.2000 0.0000 0.0000 0.0 0.0
11..12 0.018 272.7 81.3 0.2000 0.0032 0.0158 0.9 1.3
12..13 0.009 272.7 81.3 0.2000 0.0016 0.0079 0.4 0.6
13..14 0.043 272.7 81.3 0.2000 0.0075 0.0376 2.1 3.1
14..10 0.003 272.7 81.3 0.2000 0.0005 0.0024 0.1 0.2
14..15 0.247 272.7 81.3 0.2000 0.0428 0.2141 11.7 17.4
15..4 0.030 272.7 81.3 0.2000 0.0052 0.0262 1.4 2.1
15..16 0.025 272.7 81.3 0.2000 0.0043 0.0215 1.2 1.7
16..5 0.000 272.7 81.3 0.2000 0.0000 0.0000 0.0 0.0
16..6 0.000 272.7 81.3 0.2000 0.0000 0.0000 0.0 0.0
13..8 0.009 272.7 81.3 0.2000 0.0016 0.0080 0.4 0.6
12..9 0.000 272.7 81.3 0.2000 0.0000 0.0000 0.0 0.0
Time used: 1:57
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 7, (((10, (4, (5, 6))), 8), 9)); MP score: 31
check convergence..
lnL(ntime: 15 np: 20): -663.682897 +0.000000
11..1 11..2 11..3 11..7 11..12 12..13 13..14 14..10 14..15 15..4 15..16 16..5 16..6 13..8 12..9
0.000004 0.000004 0.000004 0.000004 0.018811 0.009465 0.047735 0.000004 0.283700 0.030776 0.024906 0.000004 0.000004 0.009418 0.000004 2.661870 0.857189 0.005000 2.067143 3.232917
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.424844
(1: 0.000004, 2: 0.000004, 3: 0.000004, 7: 0.000004, (((10: 0.000004, (4: 0.030776, (5: 0.000004, 6: 0.000004): 0.024906): 0.283700): 0.047735, 8: 0.009418): 0.009465, 9: 0.000004): 0.018811);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C7: 0.000004, (((C10: 0.000004, (C4: 0.030776, (C5: 0.000004, C6: 0.000004): 0.024906): 0.283700): 0.047735, C8: 0.009418): 0.009465, C9: 0.000004): 0.018811);
Detailed output identifying parameters
kappa (ts/tv) = 2.66187
Parameters in M8 (beta&w>1):
p0 = 0.85719 p = 0.00500 q = 2.06714
(p1 = 0.14281) w = 3.23292
MLEs of dN/dS (w) for site classes (K=11)
p: 0.08572 0.08572 0.08572 0.08572 0.08572 0.08572 0.08572 0.08572 0.08572 0.08572 0.14281
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 3.23292
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.000 266.6 87.4 0.4617 0.0000 0.0000 0.0 0.0
11..2 0.000 266.6 87.4 0.4617 0.0000 0.0000 0.0 0.0
11..3 0.000 266.6 87.4 0.4617 0.0000 0.0000 0.0 0.0
11..7 0.000 266.6 87.4 0.4617 0.0000 0.0000 0.0 0.0
11..12 0.019 266.6 87.4 0.4617 0.0049 0.0105 1.3 0.9
12..13 0.009 266.6 87.4 0.4617 0.0024 0.0053 0.7 0.5
13..14 0.048 266.6 87.4 0.4617 0.0124 0.0268 3.3 2.3
14..10 0.000 266.6 87.4 0.4617 0.0000 0.0000 0.0 0.0
14..15 0.284 266.6 87.4 0.4617 0.0734 0.1590 19.6 13.9
15..4 0.031 266.6 87.4 0.4617 0.0080 0.0173 2.1 1.5
15..16 0.025 266.6 87.4 0.4617 0.0064 0.0140 1.7 1.2
16..5 0.000 266.6 87.4 0.4617 0.0000 0.0000 0.0 0.0
16..6 0.000 266.6 87.4 0.4617 0.0000 0.0000 0.0 0.0
13..8 0.009 266.6 87.4 0.4617 0.0024 0.0053 0.6 0.5
12..9 0.000 266.6 87.4 0.4617 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
17 S 1.000** 3.233
22 P 1.000** 3.233
54 F 1.000** 3.233
68 S 1.000** 3.233
76 L 1.000** 3.233
79 E 1.000** 3.233
81 Q 1.000** 3.233
92 R 1.000** 3.233
96 S 1.000** 3.233
97 A 1.000** 3.233
98 S 1.000** 3.233
103 Q 1.000** 3.233
118 A 1.000** 3.233
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
22 P 0.792 4.600 +- 2.835
54 F 0.628 3.591 +- 2.863
79 E 0.976* 5.690 +- 2.366
97 A 0.744 4.307 +- 2.880
98 S 0.968* 5.644 +- 2.394
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.007 0.199 0.793
p : 0.645 0.254 0.075 0.019 0.005 0.001 0.000 0.000 0.000 0.000
q : 0.000 0.023 0.062 0.084 0.099 0.114 0.130 0.146 0.163 0.179
ws: 0.021 0.083 0.139 0.164 0.160 0.137 0.108 0.082 0.061 0.045
Time used: 3:25
Model 1: NearlyNeutral -666.392173 Model 2: PositiveSelection -663.682896 Model 7: beta -666.435186 Model 8: beta&w>1 -663.682897 Model 2 vs 1 5.418554 Model 8 vs 7 5.504578
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken. # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
