--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken.
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -661.20 -675.31
2 -661.42 -674.82
--------------------------------------
TOTAL -661.31 -675.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.244417 0.001925 0.166413 0.333500 0.241348 1347.97 1379.67 1.000
r(A<->C){all} 0.130756 0.002910 0.034473 0.232751 0.124507 547.35 611.46 1.001
r(A<->G){all} 0.151664 0.003032 0.051761 0.257343 0.147630 536.08 614.59 1.001
r(A<->T){all} 0.107938 0.001444 0.037894 0.183019 0.103776 501.22 658.85 1.000
r(C<->G){all} 0.194736 0.004460 0.070312 0.322834 0.190441 595.91 620.68 1.000
r(C<->T){all} 0.305273 0.004349 0.185833 0.437422 0.303200 678.59 692.81 1.000
r(G<->T){all} 0.109632 0.001903 0.035757 0.201501 0.104854 426.53 570.62 1.000
pi(A){all} 0.256399 0.000603 0.211168 0.305750 0.255863 1142.95 1208.62 1.000
pi(C){all} 0.196613 0.000483 0.153181 0.240209 0.196081 862.43 1000.99 1.000
pi(G){all} 0.176108 0.000482 0.133979 0.217289 0.175082 1074.12 1168.91 1.000
pi(T){all} 0.370880 0.000760 0.321745 0.426653 0.369967 1141.06 1180.20 1.000
alpha{1,2} 0.660894 0.486095 0.001693 2.010291 0.442134 1107.58 1143.40 1.001
alpha{3} 1.954139 1.360016 0.304380 4.298999 1.691177 1110.77 1305.88 1.000
pinvar{all} 0.187144 0.017825 0.000136 0.440395 0.162519 955.53 1021.50 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
Model 1: NearlyNeutral -613.089803
Model 2: PositiveSelection -613.089803
Model 7: beta -613.007774
Model 8: beta&w>1 -612.551320
Model 2 vs 1 0
Model 8 vs 7 .912908
-- Starting log on Wed Oct 26 22:52:41 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=10, Len=91
C1 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C2 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C3 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C4 MVSFNVTAILLVLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C5 ---MNVTAILLQNVANAFSNPLYVPEHCVGMPGTLFQACIRQTMVDTTGM
C6 ---MNVTAILLQNVANAFSNPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C7 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C8 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C9 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C10 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSATLFQACIRQTMVDTTGM
:*.***:* :*****:******** **..*****************
C1 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C2 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C3 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C4 YTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV
C5 YTNSAMSYDGTTIPFDIHGIVHEDHYTDTKPTPLSDVGFSV
C6 YTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV
C7 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C8 YTNSAMSHDGITIPFDRDGIVHEEHYTETNPTPLSDVGFSV
C9 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C10 YTNSDMSHDGITIPFDRDGIVHEEHYTETNPTPLFDAGFSV
**** **:** ***** .*****:***:*:**** *.****
-- Starting log on Wed Oct 26 22:53:24 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.08 sec, SCORE=996, Nseq=10, Len=91
C1 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C2 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C3 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C4 MVSFNVTAILLVLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C5 ---MNVTAILLQNVANAFSNPLYVPEHCVGMPGTLFQACIRQTMVDTTGM
C6 ---MNVTAILLQNVANAFSNPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C7 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C8 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C9 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C10 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSATLFQACIRQTMVDTTGM
:*.***:* :*****:******** **..*****************
C1 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C2 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C3 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C4 YTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV
C5 YTNSAMSYDGTTIPFDIHGIVHEDHYTDTKPTPLSDVGFSV
C6 YTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV
C7 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C8 YTNSAMSHDGITIPFDRDGIVHEEHYTETNPTPLSDVGFSV
C9 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C10 YTNSDMSHDGITIPFDRDGIVHEEHYTETNPTPLFDAGFSV
**** **:** ***** .*****:***:*:**** *.****
-- Starting log on Wed Oct 26 23:05:14 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/gapped_alignment/codeml,B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 10 taxa and 273 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C10
Taxon 3 -> C2
Taxon 4 -> C3
Taxon 5 -> C4
Taxon 6 -> C5
Taxon 7 -> C6
Taxon 8 -> C7
Taxon 9 -> C8
Taxon 10 -> C9
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666825516
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 537411690
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1508476915
Seed = 1900976346
Swapseed = 1666825516
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 16 unique site patterns
Division 2 has 15 unique site patterns
Division 3 has 29 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1098.146100 -- 35.653401
Chain 2 -- -994.981723 -- 35.653401
Chain 3 -- -924.779863 -- 35.653401
Chain 4 -- -1053.916833 -- 35.653401
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1006.831343 -- 35.653401
Chain 2 -- -971.828131 -- 35.653401
Chain 3 -- -1048.987618 -- 35.653401
Chain 4 -- -1066.825695 -- 35.653401
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1098.146] (-994.982) (-924.780) (-1053.917) * [-1006.831] (-971.828) (-1048.988) (-1066.826)
1000 -- (-686.139) (-667.741) (-672.742) [-665.194] * [-665.263] (-682.132) (-676.243) (-666.302) -- 0:00:00
2000 -- (-677.634) [-678.141] (-671.671) (-671.075) * (-673.740) [-670.636] (-669.163) (-673.390) -- 0:08:19
3000 -- (-674.513) (-669.853) [-668.890] (-669.101) * (-673.582) (-671.947) [-670.445] (-670.630) -- 0:05:32
4000 -- (-667.100) (-665.714) (-670.275) [-666.362] * (-675.254) (-668.928) [-666.081] (-673.049) -- 0:04:09
5000 -- (-665.881) (-670.233) [-661.032] (-674.862) * (-675.338) [-670.296] (-664.620) (-661.904) -- 0:03:19
Average standard deviation of split frequencies: 0.060436
6000 -- (-660.639) [-671.106] (-669.391) (-672.908) * (-665.326) (-665.644) (-668.730) [-662.255] -- 0:05:31
7000 -- (-673.761) (-664.341) [-663.445] (-666.944) * (-669.429) [-667.306] (-664.823) (-661.794) -- 0:04:43
8000 -- (-673.246) (-666.913) [-667.679] (-662.883) * (-668.706) (-671.118) [-665.259] (-672.018) -- 0:04:08
9000 -- (-667.315) [-658.192] (-663.929) (-665.000) * (-668.559) (-673.909) [-661.392] (-668.935) -- 0:03:40
10000 -- (-678.054) [-665.722] (-672.741) (-665.057) * (-666.345) (-682.377) [-666.673] (-672.584) -- 0:04:57
Average standard deviation of split frequencies: 0.044194
11000 -- (-667.675) (-668.071) [-661.145] (-666.071) * [-666.367] (-672.209) (-668.071) (-667.637) -- 0:04:29
12000 -- [-667.515] (-675.954) (-665.822) (-667.130) * (-673.725) [-667.912] (-676.348) (-669.000) -- 0:04:07
13000 -- (-667.479) [-664.728] (-661.733) (-660.809) * (-668.077) (-679.024) (-679.319) [-663.834] -- 0:03:47
14000 -- (-670.637) (-668.443) [-666.039] (-668.166) * [-669.440] (-663.527) (-668.470) (-665.564) -- 0:04:41
15000 -- (-668.251) [-665.947] (-670.742) (-672.472) * [-663.262] (-662.607) (-668.414) (-666.032) -- 0:04:22
Average standard deviation of split frequencies: 0.038891
16000 -- (-664.010) [-660.320] (-681.136) (-668.240) * (-667.875) [-666.150] (-661.913) (-670.778) -- 0:04:06
17000 -- (-665.999) (-671.864) [-664.784] (-665.391) * (-669.095) (-672.045) (-663.386) [-663.357] -- 0:04:49
18000 -- (-663.413) (-667.408) [-669.679] (-685.079) * (-664.783) (-670.081) (-667.443) [-659.043] -- 0:04:32
19000 -- (-666.201) [-663.559] (-666.359) (-672.667) * (-663.306) (-679.110) [-664.210] (-665.681) -- 0:04:18
20000 -- (-666.386) (-666.258) (-667.197) [-667.973] * (-667.408) (-666.044) [-660.819] (-667.473) -- 0:04:05
Average standard deviation of split frequencies: 0.050578
21000 -- (-669.372) (-663.798) [-670.598] (-681.234) * (-676.888) (-666.667) (-672.169) [-663.992] -- 0:04:39
22000 -- [-661.214] (-670.381) (-670.476) (-667.971) * (-668.049) (-671.342) (-668.338) [-669.125] -- 0:04:26
23000 -- (-668.084) [-661.462] (-665.541) (-668.999) * (-674.549) (-665.170) [-666.604] (-670.327) -- 0:04:14
24000 -- (-660.459) (-659.363) [-665.458] (-670.270) * (-662.831) (-664.443) [-673.601] (-672.482) -- 0:04:04
25000 -- (-671.401) [-665.834] (-669.797) (-664.359) * (-671.384) (-670.499) (-665.563) [-669.477] -- 0:04:33
Average standard deviation of split frequencies: 0.036987
26000 -- (-662.113) [-661.611] (-677.519) (-669.135) * [-665.307] (-674.846) (-660.735) (-664.517) -- 0:04:22
27000 -- (-662.444) (-664.547) (-671.408) [-662.776] * [-665.130] (-665.640) (-664.131) (-665.010) -- 0:04:12
28000 -- (-664.239) (-672.154) (-672.522) [-666.510] * (-666.690) [-670.706] (-670.493) (-690.142) -- 0:04:03
29000 -- (-660.032) [-672.309] (-667.483) (-663.935) * (-667.961) (-673.491) [-669.059] (-669.776) -- 0:04:27
30000 -- [-667.608] (-666.587) (-661.595) (-673.491) * [-670.039] (-672.714) (-661.387) (-663.570) -- 0:04:18
Average standard deviation of split frequencies: 0.026901
31000 -- (-662.600) [-666.868] (-658.853) (-672.762) * (-667.434) [-662.224] (-666.311) (-673.254) -- 0:04:10
32000 -- [-663.582] (-671.219) (-675.001) (-661.856) * (-662.475) (-665.115) [-666.686] (-666.534) -- 0:04:32
33000 -- (-663.112) (-662.762) (-676.623) [-671.391] * (-675.045) [-660.045] (-665.325) (-661.684) -- 0:04:23
34000 -- (-668.885) [-663.476] (-667.227) (-672.942) * (-667.698) (-672.018) [-674.807] (-673.108) -- 0:04:15
35000 -- (-666.446) [-663.549] (-668.101) (-678.734) * [-666.600] (-666.516) (-669.251) (-665.026) -- 0:04:08
Average standard deviation of split frequencies: 0.024007
36000 -- (-668.244) (-667.016) (-663.887) [-668.014] * (-678.911) [-669.971] (-669.261) (-659.197) -- 0:04:27
37000 -- (-666.497) (-669.757) [-661.704] (-686.717) * (-671.873) [-668.237] (-667.891) (-668.497) -- 0:04:20
38000 -- (-673.802) (-679.418) [-660.567] (-668.984) * (-674.034) [-670.424] (-675.132) (-670.699) -- 0:04:13
39000 -- (-664.112) (-671.431) [-661.951] (-674.249) * (-668.352) [-669.131] (-669.727) (-666.219) -- 0:04:06
40000 -- (-672.679) (-667.882) [-672.045] (-663.419) * (-674.272) [-666.010] (-677.218) (-666.745) -- 0:04:24
Average standard deviation of split frequencies: 0.028980
41000 -- (-677.283) [-671.365] (-669.240) (-667.218) * (-667.822) [-667.351] (-668.431) (-674.357) -- 0:04:17
42000 -- (-668.842) [-670.118] (-671.339) (-672.760) * (-666.491) (-667.854) [-661.839] (-660.775) -- 0:04:10
43000 -- (-666.346) [-661.313] (-666.129) (-667.946) * [-663.762] (-669.384) (-663.074) (-666.505) -- 0:04:04
44000 -- (-675.892) [-671.236] (-663.725) (-673.632) * (-666.544) [-668.947] (-667.599) (-666.850) -- 0:04:20
45000 -- (-670.532) (-666.778) (-666.141) [-663.041] * [-662.027] (-667.909) (-667.625) (-672.609) -- 0:04:14
Average standard deviation of split frequencies: 0.027874
46000 -- (-674.252) [-664.853] (-662.343) (-673.592) * (-664.247) (-668.621) (-669.529) [-669.304] -- 0:04:08
47000 -- (-670.096) (-670.178) (-666.497) [-664.330] * [-664.964] (-670.882) (-668.120) (-664.047) -- 0:04:23
48000 -- (-662.783) (-663.799) [-661.366] (-670.237) * (-663.653) [-666.047] (-674.190) (-678.264) -- 0:04:17
49000 -- (-662.593) (-665.249) (-665.739) [-668.143] * (-669.259) [-667.220] (-668.940) (-668.214) -- 0:04:12
50000 -- (-665.369) (-670.251) (-664.443) [-666.445] * (-664.033) [-671.691] (-667.257) (-666.173) -- 0:04:06
Average standard deviation of split frequencies: 0.025485
51000 -- (-666.699) (-667.858) [-661.898] (-671.055) * (-672.516) [-660.789] (-665.047) (-669.940) -- 0:04:20
52000 -- (-672.960) (-683.529) (-667.600) [-658.163] * [-672.569] (-670.620) (-673.591) (-666.477) -- 0:04:15
53000 -- [-665.773] (-666.089) (-663.155) (-674.340) * [-666.734] (-674.360) (-660.027) (-665.080) -- 0:04:10
54000 -- [-663.909] (-665.037) (-668.568) (-667.199) * (-667.795) [-662.002] (-666.079) (-668.323) -- 0:04:05
55000 -- (-666.841) (-670.259) (-667.856) [-672.045] * (-672.986) (-666.175) (-678.792) [-662.875] -- 0:04:17
Average standard deviation of split frequencies: 0.024833
56000 -- (-666.811) [-664.966] (-668.784) (-673.577) * (-674.854) (-672.916) [-662.541] (-666.262) -- 0:04:12
57000 -- (-671.498) (-667.817) (-671.039) [-665.849] * (-667.942) (-668.217) (-668.444) [-663.154] -- 0:04:08
58000 -- (-665.730) [-666.317] (-669.069) (-671.681) * [-659.706] (-672.919) (-666.636) (-665.571) -- 0:04:03
59000 -- (-669.822) [-665.271] (-667.711) (-671.357) * (-672.506) [-671.222] (-668.758) (-668.385) -- 0:04:15
60000 -- (-665.334) [-666.778] (-668.736) (-679.013) * (-669.413) (-674.030) (-667.575) [-663.911] -- 0:04:10
Average standard deviation of split frequencies: 0.027903
61000 -- [-665.384] (-666.583) (-679.190) (-666.354) * (-662.069) (-676.683) (-668.567) [-666.324] -- 0:04:06
62000 -- (-660.164) [-666.141] (-675.120) (-670.078) * [-673.483] (-665.586) (-662.160) (-665.845) -- 0:04:02
63000 -- (-665.089) (-690.581) (-671.813) [-667.197] * (-663.918) (-668.800) [-667.878] (-666.753) -- 0:04:12
64000 -- (-665.054) [-674.221] (-672.158) (-664.392) * (-670.451) (-667.788) (-668.827) [-667.093] -- 0:04:08
65000 -- (-665.667) [-664.087] (-671.598) (-666.428) * (-671.700) (-667.508) (-664.571) [-658.613] -- 0:04:04
Average standard deviation of split frequencies: 0.029427
66000 -- (-667.411) [-666.740] (-665.062) (-672.214) * [-665.069] (-671.680) (-674.090) (-668.035) -- 0:04:14
67000 -- (-665.041) [-670.328] (-673.260) (-665.517) * [-668.789] (-662.865) (-665.112) (-671.657) -- 0:04:10
68000 -- (-682.919) [-665.420] (-665.710) (-658.961) * (-667.411) [-664.524] (-667.799) (-670.927) -- 0:04:06
69000 -- (-671.494) (-663.091) (-663.139) [-663.242] * (-672.718) (-665.149) [-668.409] (-663.275) -- 0:04:02
70000 -- (-663.557) (-659.125) (-668.851) [-665.652] * (-668.929) [-663.045] (-669.481) (-664.991) -- 0:04:12
Average standard deviation of split frequencies: 0.024653
71000 -- [-661.321] (-664.231) (-676.593) (-665.695) * (-667.089) [-668.373] (-663.122) (-668.537) -- 0:04:08
72000 -- (-668.727) (-663.737) [-660.561] (-660.255) * (-661.265) (-674.389) [-665.743] (-675.450) -- 0:04:04
73000 -- (-666.368) [-663.202] (-668.395) (-664.788) * (-669.399) (-669.276) [-667.900] (-678.677) -- 0:04:01
74000 -- [-662.527] (-661.193) (-669.331) (-668.141) * [-662.308] (-677.460) (-676.583) (-672.056) -- 0:04:10
75000 -- (-677.466) [-665.492] (-663.755) (-672.329) * [-661.532] (-668.480) (-663.384) (-665.953) -- 0:04:06
Average standard deviation of split frequencies: 0.020496
76000 -- (-664.804) (-678.317) [-664.135] (-665.831) * [-666.326] (-669.357) (-670.954) (-667.907) -- 0:04:03
77000 -- [-662.873] (-664.830) (-662.022) (-669.687) * (-666.769) (-671.468) (-672.160) [-668.737] -- 0:03:59
78000 -- (-666.797) (-669.825) (-667.544) [-674.295] * (-668.636) [-671.285] (-661.826) (-673.077) -- 0:04:08
79000 -- (-667.552) (-668.517) (-676.437) [-662.423] * (-658.749) (-676.458) (-666.013) [-662.870] -- 0:04:04
80000 -- (-671.242) (-667.907) [-666.795] (-669.655) * [-662.211] (-670.470) (-669.523) (-669.306) -- 0:04:01
Average standard deviation of split frequencies: 0.019201
81000 -- (-673.083) (-669.620) (-660.747) [-668.516] * (-667.682) [-667.101] (-673.174) (-674.579) -- 0:04:09
82000 -- (-686.040) [-674.397] (-670.777) (-665.922) * (-665.805) [-664.066] (-667.092) (-668.977) -- 0:04:06
83000 -- (-663.656) (-671.503) (-666.962) [-666.375] * (-666.315) (-670.612) (-664.195) [-664.479] -- 0:04:03
84000 -- (-670.216) (-669.322) [-668.560] (-669.719) * (-666.260) (-674.664) (-665.033) [-670.938] -- 0:03:59
85000 -- (-664.183) (-682.843) (-672.832) [-669.141] * [-666.051] (-673.404) (-670.738) (-680.465) -- 0:04:07
Average standard deviation of split frequencies: 0.017636
86000 -- (-665.965) (-689.738) (-669.637) [-662.581] * (-672.585) (-674.412) (-669.031) [-662.403] -- 0:04:04
87000 -- (-674.551) (-666.383) [-662.330] (-671.533) * [-667.941] (-672.816) (-666.065) (-667.271) -- 0:04:01
88000 -- (-670.314) (-672.117) (-665.802) [-662.542] * [-665.845] (-676.701) (-674.879) (-661.374) -- 0:03:58
89000 -- (-670.439) (-678.977) (-675.815) [-667.333] * (-671.975) (-661.725) (-669.388) [-671.104] -- 0:04:05
90000 -- [-668.470] (-665.621) (-663.752) (-663.931) * (-666.058) (-668.753) (-674.284) [-666.261] -- 0:04:02
Average standard deviation of split frequencies: 0.016588
91000 -- (-676.026) (-668.890) (-665.664) [-661.193] * [-665.848] (-662.954) (-670.114) (-666.264) -- 0:03:59
92000 -- (-664.577) (-662.390) [-664.961] (-667.731) * (-676.180) [-667.160] (-664.980) (-663.262) -- 0:03:56
93000 -- (-675.702) (-671.302) (-667.023) [-672.170] * (-668.974) (-664.622) (-666.634) [-668.614] -- 0:04:03
94000 -- (-662.937) (-664.751) [-665.115] (-676.485) * [-667.184] (-672.747) (-670.163) (-662.014) -- 0:04:00
95000 -- (-673.190) (-666.413) (-667.336) [-669.056] * [-663.650] (-666.264) (-659.776) (-667.381) -- 0:03:58
Average standard deviation of split frequencies: 0.015667
96000 -- (-669.527) (-665.906) [-666.622] (-671.976) * [-668.454] (-673.050) (-670.607) (-667.468) -- 0:03:55
97000 -- (-678.250) [-667.971] (-659.044) (-664.555) * [-657.869] (-672.738) (-668.797) (-666.374) -- 0:04:02
98000 -- [-664.955] (-661.774) (-673.570) (-663.033) * (-670.315) (-669.783) [-665.987] (-667.510) -- 0:03:59
99000 -- (-662.981) (-666.755) [-670.923] (-678.116) * (-661.801) [-660.601] (-668.505) (-675.460) -- 0:03:56
100000 -- [-659.916] (-664.256) (-667.622) (-664.069) * (-665.427) [-667.409] (-665.331) (-666.938) -- 0:03:53
Average standard deviation of split frequencies: 0.017667
101000 -- (-666.914) [-662.328] (-663.313) (-662.559) * [-663.708] (-671.742) (-662.638) (-670.560) -- 0:04:00
102000 -- (-668.905) (-663.840) (-667.221) [-659.615] * [-661.746] (-666.837) (-667.423) (-672.705) -- 0:03:57
103000 -- (-670.493) [-672.662] (-664.678) (-667.497) * [-667.316] (-665.283) (-660.537) (-664.050) -- 0:03:55
104000 -- (-661.991) (-668.942) [-668.977] (-665.966) * (-669.556) (-673.364) (-669.005) [-681.019] -- 0:04:01
105000 -- (-662.958) [-663.057] (-667.098) (-666.363) * [-665.039] (-670.436) (-662.529) (-674.177) -- 0:03:58
Average standard deviation of split frequencies: 0.017604
106000 -- [-665.362] (-663.222) (-665.160) (-666.645) * [-658.328] (-673.467) (-666.032) (-670.709) -- 0:03:56
107000 -- (-671.602) (-690.008) (-663.593) [-671.166] * (-667.181) [-677.533] (-670.618) (-663.059) -- 0:03:53
108000 -- [-661.491] (-672.845) (-670.616) (-682.989) * (-665.512) (-674.977) (-669.128) [-663.841] -- 0:03:59
109000 -- [-668.056] (-665.290) (-671.077) (-675.989) * [-668.179] (-672.471) (-669.460) (-662.073) -- 0:03:57
110000 -- (-666.322) (-666.212) (-664.232) [-668.012] * (-675.190) [-666.018] (-664.877) (-661.699) -- 0:03:54
Average standard deviation of split frequencies: 0.016845
111000 -- (-659.303) (-663.578) (-673.453) [-663.556] * (-674.550) (-671.665) [-665.049] (-671.056) -- 0:03:52
112000 -- (-673.034) (-667.241) (-671.704) [-671.956] * (-670.503) [-664.094] (-666.685) (-669.441) -- 0:03:57
113000 -- (-678.945) (-672.623) (-669.210) [-664.359] * (-673.731) (-670.635) [-663.043] (-681.475) -- 0:03:55
114000 -- (-676.518) (-668.364) [-666.714] (-661.001) * [-672.121] (-662.942) (-675.991) (-660.764) -- 0:03:53
115000 -- [-662.644] (-667.796) (-680.437) (-669.962) * (-668.396) [-668.843] (-665.002) (-670.731) -- 0:03:50
Average standard deviation of split frequencies: 0.013546
116000 -- (-667.784) (-680.901) (-661.880) [-668.310] * (-665.412) (-669.314) (-662.101) [-670.035] -- 0:03:56
117000 -- (-673.289) (-674.561) (-676.296) [-661.412] * (-666.851) (-663.069) (-668.484) [-671.474] -- 0:03:53
118000 -- (-667.868) (-673.258) [-658.313] (-659.972) * (-668.042) (-671.999) (-670.592) [-673.459] -- 0:03:51
119000 -- (-663.102) (-671.060) [-664.599] (-671.456) * (-664.311) (-671.772) [-669.864] (-669.597) -- 0:03:49
120000 -- (-670.077) (-666.556) [-663.143] (-668.148) * (-673.091) [-663.587] (-666.580) (-667.546) -- 0:03:54
Average standard deviation of split frequencies: 0.013208
121000 -- (-670.244) (-670.237) [-666.476] (-666.027) * (-670.383) (-664.329) (-676.278) [-668.347] -- 0:03:52
122000 -- (-666.519) [-658.845] (-674.705) (-664.633) * (-679.511) [-669.253] (-664.427) (-669.279) -- 0:03:50
123000 -- (-669.694) (-664.110) [-661.724] (-666.401) * (-665.488) (-662.457) [-675.441] (-668.458) -- 0:03:55
124000 -- [-664.819] (-670.936) (-673.249) (-668.618) * (-661.359) (-661.000) (-664.802) [-668.815] -- 0:03:53
125000 -- [-672.502] (-677.793) (-671.254) (-670.538) * (-669.604) (-678.027) [-664.297] (-668.246) -- 0:03:51
Average standard deviation of split frequencies: 0.014431
126000 -- (-672.439) [-663.022] (-680.933) (-665.418) * (-665.205) (-666.931) (-663.543) [-665.597] -- 0:03:48
127000 -- (-673.793) [-668.528] (-666.572) (-672.263) * (-660.927) (-663.629) [-664.033] (-665.203) -- 0:03:53
128000 -- (-669.296) [-671.986] (-664.146) (-675.243) * [-662.700] (-665.210) (-665.346) (-661.761) -- 0:03:51
129000 -- (-669.242) [-660.338] (-664.290) (-667.043) * [-660.415] (-668.673) (-661.140) (-668.300) -- 0:03:49
130000 -- (-676.555) [-664.213] (-662.025) (-673.303) * (-667.416) (-672.236) [-663.938] (-666.807) -- 0:03:47
Average standard deviation of split frequencies: 0.014603
131000 -- (-671.311) (-669.265) (-668.351) [-669.571] * [-662.452] (-664.171) (-664.681) (-678.361) -- 0:03:52
132000 -- (-672.146) [-663.212] (-668.065) (-669.411) * [-665.820] (-668.687) (-663.800) (-667.075) -- 0:03:50
133000 -- (-666.990) (-669.164) [-663.082] (-666.800) * [-673.563] (-665.697) (-667.807) (-672.666) -- 0:03:48
134000 -- (-670.783) [-665.919] (-662.237) (-667.510) * [-664.198] (-659.090) (-668.191) (-665.253) -- 0:03:46
135000 -- (-669.593) [-668.030] (-672.880) (-662.494) * [-662.750] (-669.381) (-668.468) (-665.321) -- 0:03:50
Average standard deviation of split frequencies: 0.013535
136000 -- [-664.746] (-664.443) (-668.246) (-671.200) * (-667.347) (-660.242) [-676.462] (-665.617) -- 0:03:48
137000 -- (-664.431) (-663.430) [-657.373] (-668.994) * (-664.633) [-662.070] (-667.874) (-663.270) -- 0:03:46
138000 -- (-668.220) (-661.299) [-666.183] (-668.095) * (-666.896) [-665.935] (-664.321) (-667.525) -- 0:03:44
139000 -- [-668.159] (-665.451) (-672.097) (-663.529) * (-667.527) (-665.642) (-666.677) [-665.285] -- 0:03:49
140000 -- (-664.377) [-676.184] (-675.125) (-666.178) * (-672.621) (-667.453) (-676.883) [-664.215] -- 0:03:47
Average standard deviation of split frequencies: 0.011649
141000 -- (-668.394) (-672.083) (-684.413) [-664.259] * (-671.758) (-662.907) [-667.315] (-678.004) -- 0:03:45
142000 -- [-662.492] (-675.465) (-671.261) (-664.130) * [-667.102] (-663.332) (-674.087) (-667.380) -- 0:03:49
143000 -- (-668.774) (-670.282) (-671.826) [-672.755] * [-666.545] (-666.739) (-670.957) (-666.271) -- 0:03:47
144000 -- [-666.343] (-667.493) (-664.626) (-674.893) * (-673.608) (-668.302) [-669.612] (-666.262) -- 0:03:45
145000 -- (-673.122) (-668.460) (-667.889) [-675.017] * [-663.784] (-673.753) (-664.990) (-668.005) -- 0:03:44
Average standard deviation of split frequencies: 0.012213
146000 -- (-670.332) (-670.599) [-668.453] (-665.683) * (-662.915) (-673.455) (-665.786) [-663.590] -- 0:03:48
147000 -- (-675.778) (-665.846) (-667.573) [-656.580] * [-664.864] (-674.231) (-665.408) (-669.925) -- 0:03:46
148000 -- [-665.390] (-672.638) (-669.499) (-664.274) * (-674.755) (-670.050) [-676.984] (-675.385) -- 0:03:44
149000 -- (-664.442) (-666.081) [-666.084] (-670.338) * (-664.528) (-667.712) [-665.785] (-662.665) -- 0:03:48
150000 -- (-678.795) (-666.719) [-664.544] (-672.503) * (-667.405) (-670.905) [-666.573] (-665.684) -- 0:03:46
Average standard deviation of split frequencies: 0.012089
151000 -- (-673.329) (-672.668) [-671.516] (-664.441) * [-671.593] (-673.544) (-671.519) (-660.057) -- 0:03:44
152000 -- (-671.125) [-668.930] (-669.162) (-666.497) * [-666.690] (-676.533) (-659.055) (-673.780) -- 0:03:43
153000 -- (-677.942) (-667.058) [-663.458] (-669.096) * [-666.958] (-670.675) (-670.978) (-671.969) -- 0:03:46
154000 -- [-666.308] (-666.396) (-662.290) (-674.254) * [-678.429] (-670.116) (-677.076) (-670.598) -- 0:03:45
155000 -- [-674.591] (-669.862) (-666.164) (-672.038) * (-659.454) (-670.629) [-661.501] (-670.666) -- 0:03:43
Average standard deviation of split frequencies: 0.010648
156000 -- (-661.260) (-669.532) [-663.383] (-661.319) * [-674.363] (-664.364) (-664.826) (-669.645) -- 0:03:41
157000 -- [-664.017] (-684.676) (-672.300) (-666.626) * (-667.732) (-667.303) (-670.528) [-662.842] -- 0:03:45
158000 -- (-672.270) (-667.309) (-673.291) [-668.257] * (-665.199) (-664.265) (-665.869) [-665.501] -- 0:03:43
159000 -- [-660.221] (-670.102) (-674.859) (-669.133) * [-660.405] (-670.395) (-680.289) (-670.492) -- 0:03:42
160000 -- (-673.629) (-670.976) (-665.374) [-664.714] * (-666.757) (-670.836) [-665.612] (-664.219) -- 0:03:40
Average standard deviation of split frequencies: 0.010060
161000 -- (-661.725) (-664.171) (-672.325) [-661.573] * [-666.715] (-664.453) (-672.975) (-665.178) -- 0:03:44
162000 -- (-670.185) (-660.871) [-675.582] (-661.387) * [-665.777] (-667.490) (-675.226) (-663.610) -- 0:03:42
163000 -- (-670.309) (-670.185) [-667.964] (-669.534) * (-677.590) [-669.638] (-676.071) (-674.793) -- 0:03:40
164000 -- (-670.651) (-667.565) (-667.533) [-661.214] * [-665.179] (-667.749) (-673.552) (-668.655) -- 0:03:44
165000 -- (-669.784) (-676.555) (-677.401) [-669.377] * (-675.835) (-665.923) [-670.857] (-663.152) -- 0:03:42
Average standard deviation of split frequencies: 0.010277
166000 -- [-661.267] (-673.166) (-665.610) (-662.101) * [-668.368] (-675.504) (-668.033) (-662.992) -- 0:03:41
167000 -- [-667.532] (-681.501) (-668.693) (-664.910) * (-675.820) (-664.952) [-669.885] (-665.272) -- 0:03:39
168000 -- [-665.102] (-662.517) (-670.767) (-667.763) * (-675.575) (-676.884) [-673.571] (-675.110) -- 0:03:42
169000 -- (-669.279) (-676.482) (-661.198) [-671.278] * (-673.045) [-667.991] (-666.580) (-665.606) -- 0:03:41
170000 -- (-667.474) (-675.607) (-672.832) [-667.893] * (-665.801) [-662.220] (-666.583) (-668.268) -- 0:03:39
Average standard deviation of split frequencies: 0.012053
171000 -- (-662.134) (-676.037) [-665.267] (-668.460) * (-667.475) (-667.280) (-664.661) [-664.929] -- 0:03:38
172000 -- (-667.722) (-675.089) [-668.653] (-664.986) * (-666.182) (-664.262) [-665.679] (-668.517) -- 0:03:41
173000 -- (-673.911) (-662.377) (-665.695) [-661.877] * (-671.472) [-666.480] (-667.077) (-666.187) -- 0:03:39
174000 -- (-663.575) (-667.008) (-663.345) [-659.948] * (-665.514) [-669.181] (-667.602) (-671.498) -- 0:03:38
175000 -- (-666.355) (-681.235) [-664.670] (-674.666) * (-671.451) (-662.841) [-665.629] (-675.998) -- 0:03:41
Average standard deviation of split frequencies: 0.011688
176000 -- [-659.174] (-663.449) (-665.932) (-661.049) * (-670.399) [-665.697] (-664.516) (-663.379) -- 0:03:40
177000 -- (-664.226) (-662.940) (-664.809) [-669.970] * (-667.148) [-662.177] (-668.915) (-667.443) -- 0:03:38
178000 -- (-671.558) (-674.654) [-664.745] (-669.920) * (-675.714) (-667.547) (-665.986) [-665.188] -- 0:03:37
179000 -- (-658.244) (-666.161) [-664.402] (-662.864) * (-669.012) (-666.215) (-674.794) [-662.706] -- 0:03:40
180000 -- (-673.376) (-667.036) (-677.645) [-660.672] * (-667.772) (-666.961) [-664.246] (-669.400) -- 0:03:38
Average standard deviation of split frequencies: 0.013876
181000 -- (-673.784) (-665.250) (-672.043) [-662.146] * (-667.810) (-663.020) [-666.875] (-667.602) -- 0:03:37
182000 -- [-664.481] (-671.727) (-670.191) (-667.947) * (-668.535) (-667.639) [-661.837] (-674.343) -- 0:03:40
183000 -- (-664.646) (-675.964) (-668.816) [-660.376] * (-659.769) (-671.364) (-670.713) [-664.815] -- 0:03:38
184000 -- (-670.341) (-674.415) (-674.919) [-664.805] * (-671.217) (-666.709) [-667.931] (-664.802) -- 0:03:37
185000 -- (-672.079) [-667.996] (-667.754) (-666.978) * (-662.836) (-670.156) (-660.122) [-661.863] -- 0:03:35
Average standard deviation of split frequencies: 0.014746
186000 -- (-677.411) (-668.311) [-662.173] (-664.590) * (-661.968) [-666.739] (-663.861) (-666.323) -- 0:03:38
187000 -- (-670.918) [-667.576] (-666.265) (-668.631) * [-664.721] (-667.181) (-665.108) (-674.510) -- 0:03:37
188000 -- (-670.398) (-668.632) [-665.089] (-671.698) * [-663.313] (-671.779) (-666.342) (-666.600) -- 0:03:35
189000 -- (-668.596) (-664.670) [-667.544] (-666.938) * [-668.256] (-683.129) (-671.330) (-668.059) -- 0:03:38
190000 -- (-679.426) (-671.534) (-666.289) [-659.338] * (-663.774) (-665.189) (-665.902) [-662.464] -- 0:03:37
Average standard deviation of split frequencies: 0.013711
191000 -- (-657.743) (-668.645) [-663.589] (-674.645) * (-662.138) (-663.634) [-667.632] (-663.002) -- 0:03:36
192000 -- (-668.425) [-664.389] (-666.092) (-662.231) * [-666.982] (-670.898) (-667.309) (-668.123) -- 0:03:34
193000 -- [-658.430] (-662.450) (-672.582) (-664.153) * (-664.744) [-664.315] (-669.481) (-663.980) -- 0:03:37
194000 -- (-669.253) [-665.694] (-664.729) (-666.442) * (-662.289) [-662.158] (-667.614) (-668.842) -- 0:03:36
195000 -- (-668.099) [-665.814] (-668.928) (-662.399) * [-666.366] (-667.701) (-665.330) (-666.201) -- 0:03:34
Average standard deviation of split frequencies: 0.013056
196000 -- (-662.310) (-674.690) (-684.431) [-665.242] * (-673.002) [-662.028] (-665.496) (-670.377) -- 0:03:33
197000 -- (-661.432) (-665.530) [-671.533] (-664.183) * (-660.596) (-670.152) [-662.098] (-667.775) -- 0:03:36
198000 -- (-669.276) (-666.669) [-670.876] (-664.265) * [-661.627] (-663.926) (-664.537) (-658.983) -- 0:03:34
199000 -- [-669.296] (-676.928) (-676.027) (-674.054) * (-675.873) [-669.052] (-672.957) (-661.020) -- 0:03:33
200000 -- [-671.698] (-671.487) (-668.800) (-684.704) * (-673.408) (-661.264) (-662.815) [-661.044] -- 0:03:32
Average standard deviation of split frequencies: 0.013312
201000 -- (-667.793) [-664.855] (-672.720) (-668.565) * (-670.300) (-674.122) (-663.791) [-664.647] -- 0:03:34
202000 -- (-665.724) (-666.861) [-666.594] (-662.773) * (-668.825) [-670.172] (-675.386) (-666.157) -- 0:03:33
203000 -- (-670.527) (-669.138) (-668.104) [-662.424] * [-669.021] (-675.565) (-670.978) (-666.204) -- 0:03:32
204000 -- (-670.049) (-674.918) (-669.159) [-662.288] * [-663.731] (-673.852) (-668.171) (-665.839) -- 0:03:34
205000 -- (-661.489) (-681.535) (-664.226) [-665.159] * [-665.359] (-666.488) (-671.724) (-672.790) -- 0:03:33
Average standard deviation of split frequencies: 0.014166
206000 -- [-665.652] (-671.538) (-666.148) (-672.137) * (-666.255) (-661.640) [-674.780] (-678.543) -- 0:03:31
207000 -- (-668.795) (-679.004) (-669.696) [-672.470] * (-670.036) (-666.549) (-666.242) [-664.632] -- 0:03:30
208000 -- [-665.640] (-664.431) (-666.285) (-674.468) * (-664.242) [-663.531] (-678.053) (-669.299) -- 0:03:33
209000 -- (-668.442) (-669.546) (-663.835) [-666.107] * (-664.837) (-662.958) (-669.458) [-667.332] -- 0:03:31
210000 -- (-676.175) (-669.417) [-664.835] (-660.376) * (-669.322) (-670.524) (-668.934) [-669.258] -- 0:03:30
Average standard deviation of split frequencies: 0.015257
211000 -- (-674.238) (-676.705) (-664.233) [-664.128] * (-668.277) (-667.981) (-661.395) [-662.880] -- 0:03:29
212000 -- (-680.932) (-671.947) [-661.135] (-669.965) * (-668.509) (-665.646) [-662.075] (-663.295) -- 0:03:31
213000 -- (-679.938) (-668.465) [-664.827] (-670.939) * [-664.182] (-668.515) (-672.250) (-672.757) -- 0:03:30
214000 -- [-671.292] (-660.538) (-666.386) (-670.057) * (-666.395) (-667.309) (-672.233) [-667.663] -- 0:03:29
215000 -- (-673.698) [-668.812] (-667.317) (-662.306) * (-680.746) (-670.921) [-664.465] (-674.290) -- 0:03:31
Average standard deviation of split frequencies: 0.014342
216000 -- [-661.739] (-667.295) (-673.167) (-666.697) * [-660.377] (-666.987) (-679.513) (-674.193) -- 0:03:30
217000 -- [-666.666] (-668.102) (-668.196) (-665.560) * (-662.522) (-665.425) [-663.168] (-674.311) -- 0:03:29
218000 -- (-667.263) (-656.748) (-671.493) [-665.877] * (-668.650) (-672.529) [-662.304] (-666.557) -- 0:03:28
219000 -- [-662.731] (-676.073) (-666.209) (-673.084) * (-674.772) (-673.433) [-664.395] (-670.865) -- 0:03:30
220000 -- [-661.590] (-663.774) (-666.832) (-666.658) * (-671.613) (-676.231) (-663.621) [-663.862] -- 0:03:29
Average standard deviation of split frequencies: 0.013993
221000 -- (-672.913) [-670.441] (-670.769) (-665.121) * (-667.229) (-671.452) [-670.226] (-666.954) -- 0:03:27
222000 -- (-668.821) (-667.998) [-668.954] (-669.855) * (-667.481) (-675.713) [-665.702] (-662.349) -- 0:03:26
223000 -- (-671.688) [-664.908] (-670.454) (-666.374) * (-673.998) (-662.348) (-664.702) [-663.196] -- 0:03:29
224000 -- (-663.912) (-669.962) (-663.385) [-664.165] * [-671.128] (-673.189) (-665.734) (-663.491) -- 0:03:27
225000 -- (-663.009) (-658.115) [-665.551] (-674.097) * (-668.037) (-669.698) (-669.362) [-668.210] -- 0:03:26
Average standard deviation of split frequencies: 0.013409
226000 -- [-664.371] (-672.703) (-666.383) (-662.873) * (-664.651) (-668.927) (-670.136) [-661.310] -- 0:03:25
227000 -- (-661.948) (-674.848) (-670.760) [-664.236] * (-669.222) [-665.295] (-673.858) (-665.842) -- 0:03:27
228000 -- [-670.697] (-680.539) (-667.498) (-678.318) * (-665.777) (-672.480) [-665.937] (-673.177) -- 0:03:26
229000 -- [-671.147] (-671.021) (-668.592) (-665.309) * (-663.545) [-665.778] (-672.478) (-673.488) -- 0:03:25
230000 -- [-662.818] (-674.842) (-666.007) (-667.637) * [-665.300] (-667.400) (-666.976) (-667.453) -- 0:03:27
Average standard deviation of split frequencies: 0.013332
231000 -- (-670.509) (-670.878) [-666.718] (-666.783) * [-669.473] (-665.136) (-670.824) (-665.794) -- 0:03:26
232000 -- (-679.276) [-663.480] (-670.455) (-671.446) * (-664.615) [-664.259] (-670.613) (-665.566) -- 0:03:25
233000 -- (-662.337) (-678.450) (-675.485) [-669.814] * (-664.857) (-664.335) [-666.269] (-673.432) -- 0:03:24
234000 -- (-668.987) [-661.661] (-666.948) (-665.710) * (-668.358) [-670.747] (-674.862) (-671.333) -- 0:03:26
235000 -- (-674.518) [-661.478] (-663.064) (-671.570) * (-664.815) (-668.977) [-672.577] (-669.659) -- 0:03:25
Average standard deviation of split frequencies: 0.013317
236000 -- (-665.279) (-664.600) (-665.207) [-661.248] * (-674.577) (-666.554) (-682.070) [-661.185] -- 0:03:23
237000 -- (-662.788) (-659.737) (-664.320) [-667.364] * [-670.792] (-673.337) (-666.569) (-671.889) -- 0:03:22
238000 -- (-665.354) (-667.470) [-667.611] (-672.690) * (-675.100) [-662.990] (-668.854) (-672.573) -- 0:03:24
239000 -- (-675.186) (-664.497) [-666.581] (-663.212) * (-676.364) (-672.510) (-664.944) [-667.255] -- 0:03:23
240000 -- [-668.223] (-668.320) (-676.975) (-679.610) * [-666.343] (-671.983) (-660.987) (-675.274) -- 0:03:22
Average standard deviation of split frequencies: 0.013525
241000 -- [-668.089] (-672.171) (-662.935) (-670.045) * (-662.588) (-671.789) [-664.143] (-668.035) -- 0:03:24
242000 -- (-674.447) (-673.002) (-669.311) [-667.438] * (-667.526) [-666.553] (-665.059) (-675.483) -- 0:03:23
243000 -- (-666.406) [-668.783] (-667.511) (-674.744) * [-669.608] (-674.052) (-666.450) (-664.931) -- 0:03:22
244000 -- (-673.047) (-671.042) [-665.931] (-676.186) * (-665.791) [-666.016] (-675.884) (-675.613) -- 0:03:21
245000 -- (-663.695) (-666.197) (-660.415) [-673.406] * (-663.866) (-662.946) [-672.354] (-670.393) -- 0:03:23
Average standard deviation of split frequencies: 0.014691
246000 -- (-665.300) (-670.129) [-667.532] (-670.941) * (-671.861) (-680.910) [-669.667] (-669.803) -- 0:03:22
247000 -- (-671.782) (-666.847) [-661.815] (-668.401) * [-665.046] (-672.585) (-672.347) (-663.378) -- 0:03:21
248000 -- (-662.706) (-667.159) [-658.545] (-670.527) * (-668.177) [-674.082] (-676.208) (-671.624) -- 0:03:20
249000 -- (-670.300) (-663.758) (-667.369) [-667.674] * (-666.791) (-666.850) (-667.750) [-661.495] -- 0:03:22
250000 -- (-674.829) (-666.998) [-670.001] (-683.671) * (-665.977) (-673.417) [-663.502] (-662.013) -- 0:03:21
Average standard deviation of split frequencies: 0.013677
251000 -- [-670.433] (-670.861) (-664.208) (-663.462) * (-676.709) [-668.710] (-676.635) (-666.649) -- 0:03:19
252000 -- (-666.152) (-658.989) (-667.252) [-668.466] * (-662.159) (-671.588) [-669.575] (-666.886) -- 0:03:18
253000 -- (-665.983) [-671.282] (-671.390) (-664.405) * [-664.926] (-679.351) (-668.235) (-667.491) -- 0:03:20
254000 -- (-671.192) (-666.939) [-666.545] (-674.189) * [-667.272] (-675.246) (-663.280) (-671.801) -- 0:03:19
255000 -- (-671.970) (-664.459) [-669.246] (-678.810) * (-676.240) (-668.366) (-667.476) [-667.831] -- 0:03:18
Average standard deviation of split frequencies: 0.014229
256000 -- (-664.897) (-661.007) (-664.526) [-666.451] * [-668.474] (-668.455) (-666.913) (-668.492) -- 0:03:20
257000 -- (-663.884) (-670.911) (-671.574) [-667.781] * (-667.402) [-662.349] (-661.441) (-671.446) -- 0:03:19
258000 -- (-662.519) (-671.634) (-675.710) [-663.491] * [-663.273] (-661.246) (-665.437) (-671.171) -- 0:03:18
259000 -- (-670.725) [-667.090] (-671.483) (-667.830) * [-665.525] (-666.207) (-672.525) (-668.714) -- 0:03:17
260000 -- (-668.852) (-668.255) (-663.821) [-661.534] * (-672.002) [-681.034] (-668.861) (-667.112) -- 0:03:19
Average standard deviation of split frequencies: 0.013235
261000 -- (-663.695) (-664.155) [-668.087] (-658.875) * (-670.241) (-671.063) (-670.268) [-666.249] -- 0:03:18
262000 -- [-661.583] (-666.267) (-670.435) (-674.926) * (-665.967) [-665.954] (-672.359) (-667.875) -- 0:03:17
263000 -- (-674.656) [-664.332] (-668.914) (-665.886) * (-674.095) (-672.542) (-667.377) [-667.613] -- 0:03:16
264000 -- (-668.309) (-674.297) [-664.377] (-666.888) * (-664.672) (-671.547) (-666.856) [-660.742] -- 0:03:17
265000 -- (-666.828) (-677.012) (-669.784) [-674.706] * (-667.512) [-661.483] (-668.786) (-668.799) -- 0:03:16
Average standard deviation of split frequencies: 0.012728
266000 -- (-672.089) (-671.774) (-675.123) [-665.290] * (-670.848) (-664.842) (-668.143) [-672.072] -- 0:03:15
267000 -- [-664.325] (-670.820) (-667.446) (-665.550) * (-667.981) (-675.105) [-663.309] (-667.398) -- 0:03:14
268000 -- (-663.304) (-672.595) [-662.979] (-667.051) * (-672.632) [-668.303] (-676.615) (-671.962) -- 0:03:16
269000 -- (-668.103) (-665.636) (-675.844) [-662.566] * [-666.027] (-672.367) (-663.563) (-664.005) -- 0:03:15
270000 -- [-667.859] (-675.810) (-667.414) (-662.587) * (-660.291) [-658.335] (-663.049) (-666.382) -- 0:03:14
Average standard deviation of split frequencies: 0.012026
271000 -- (-665.622) (-681.782) (-663.486) [-661.657] * (-666.489) (-661.532) (-662.823) [-662.649] -- 0:03:16
272000 -- (-664.186) (-661.482) [-662.471] (-658.361) * [-660.623] (-673.412) (-663.668) (-664.321) -- 0:03:15
273000 -- (-668.727) (-667.289) [-669.868] (-668.303) * (-670.280) [-659.410] (-667.344) (-669.366) -- 0:03:14
274000 -- [-668.231] (-669.269) (-669.400) (-666.995) * (-671.527) [-660.113] (-672.176) (-664.379) -- 0:03:13
275000 -- (-663.076) (-671.638) [-661.877] (-677.444) * (-669.875) (-666.690) (-664.240) [-667.209] -- 0:03:15
Average standard deviation of split frequencies: 0.012444
276000 -- (-671.549) [-670.637] (-667.691) (-670.635) * [-668.762] (-666.544) (-672.343) (-671.582) -- 0:03:14
277000 -- (-668.285) (-663.987) [-659.573] (-660.678) * (-667.660) [-665.508] (-671.706) (-665.890) -- 0:03:13
278000 -- [-659.833] (-679.650) (-669.111) (-662.236) * (-671.911) (-670.664) [-658.014] (-667.494) -- 0:03:12
279000 -- (-675.572) (-663.702) [-664.407] (-677.706) * (-670.143) (-671.768) (-664.903) [-664.645] -- 0:03:13
280000 -- (-668.000) (-670.407) (-661.674) [-664.457] * (-668.909) [-662.778] (-670.753) (-670.429) -- 0:03:12
Average standard deviation of split frequencies: 0.012317
281000 -- (-662.715) (-670.135) [-663.391] (-665.178) * (-659.391) (-666.495) [-673.204] (-671.335) -- 0:03:11
282000 -- [-668.607] (-668.813) (-658.888) (-667.485) * [-668.251] (-678.767) (-667.518) (-662.910) -- 0:03:13
283000 -- (-665.779) [-665.378] (-663.095) (-669.391) * [-666.669] (-666.137) (-670.519) (-666.499) -- 0:03:12
284000 -- (-666.189) (-666.653) [-661.423] (-663.698) * (-667.852) [-668.788] (-667.899) (-669.259) -- 0:03:11
285000 -- (-670.491) [-661.254] (-675.769) (-667.389) * (-667.112) (-666.903) (-667.522) [-665.598] -- 0:03:10
Average standard deviation of split frequencies: 0.012326
286000 -- (-678.296) [-663.939] (-664.047) (-661.678) * (-669.221) (-672.800) [-671.335] (-672.765) -- 0:03:12
287000 -- (-670.595) (-663.131) [-664.393] (-677.412) * [-664.271] (-667.656) (-675.015) (-667.342) -- 0:03:11
288000 -- (-672.434) [-669.697] (-665.439) (-675.096) * [-666.773] (-672.611) (-671.447) (-669.725) -- 0:03:10
289000 -- (-668.256) (-662.734) [-671.185] (-674.257) * (-670.711) (-667.238) (-672.373) [-667.730] -- 0:03:09
290000 -- (-668.696) (-676.373) (-664.014) [-664.246] * (-676.681) (-672.267) [-663.679] (-671.946) -- 0:03:10
Average standard deviation of split frequencies: 0.011574
291000 -- (-671.184) (-666.378) [-662.357] (-666.485) * (-669.042) (-675.324) [-659.947] (-669.455) -- 0:03:10
292000 -- [-671.691] (-670.580) (-664.914) (-665.854) * [-669.715] (-676.345) (-661.489) (-675.774) -- 0:03:09
293000 -- (-676.608) (-672.168) (-669.568) [-671.373] * (-669.695) (-671.827) [-664.881] (-668.501) -- 0:03:08
294000 -- [-667.256] (-666.109) (-666.531) (-660.940) * (-670.118) (-672.571) [-670.660] (-663.956) -- 0:03:09
295000 -- (-670.307) [-664.487] (-666.912) (-674.872) * (-671.009) [-680.543] (-664.449) (-669.823) -- 0:03:08
Average standard deviation of split frequencies: 0.012596
296000 -- (-669.553) (-672.884) [-666.773] (-666.580) * [-660.999] (-675.677) (-673.860) (-678.729) -- 0:03:07
297000 -- [-669.168] (-675.593) (-668.283) (-667.611) * (-671.624) (-668.167) [-664.438] (-669.266) -- 0:03:06
298000 -- (-673.526) [-664.779] (-665.749) (-681.344) * (-666.245) (-666.359) (-674.396) [-674.344] -- 0:03:08
299000 -- (-675.972) [-661.215] (-667.231) (-672.660) * (-670.064) (-661.145) (-669.222) [-664.082] -- 0:03:07
300000 -- (-663.535) (-660.594) [-665.277] (-675.859) * (-668.738) [-663.392] (-666.235) (-663.165) -- 0:03:06
Average standard deviation of split frequencies: 0.012614
301000 -- (-667.501) (-662.677) (-669.002) [-663.499] * (-662.013) (-665.086) [-664.822] (-669.082) -- 0:03:08
302000 -- (-665.537) [-663.918] (-662.881) (-670.510) * (-666.023) [-668.168] (-665.957) (-669.565) -- 0:03:07
303000 -- (-670.407) (-667.318) [-663.821] (-666.362) * (-667.542) (-661.851) [-662.766] (-660.882) -- 0:03:06
304000 -- [-661.355] (-669.983) (-671.095) (-669.441) * (-661.592) [-666.597] (-663.685) (-668.014) -- 0:03:05
305000 -- [-674.637] (-674.238) (-677.092) (-663.341) * (-668.233) [-662.858] (-665.505) (-677.222) -- 0:03:06
Average standard deviation of split frequencies: 0.012464
306000 -- (-662.570) (-667.495) [-663.242] (-663.110) * (-668.719) (-660.111) (-665.420) [-665.665] -- 0:03:05
307000 -- [-667.645] (-672.079) (-669.795) (-668.974) * (-663.036) [-667.956] (-670.067) (-668.429) -- 0:03:05
308000 -- (-666.390) (-668.924) (-664.735) [-666.586] * (-667.109) (-680.174) [-670.527] (-662.576) -- 0:03:04
309000 -- (-671.083) [-660.328] (-669.088) (-667.548) * (-680.110) (-669.313) [-668.290] (-665.991) -- 0:03:05
310000 -- (-666.527) [-660.655] (-675.547) (-664.527) * (-665.851) (-675.745) (-670.765) [-668.102] -- 0:03:04
Average standard deviation of split frequencies: 0.012622
311000 -- (-669.064) [-665.087] (-673.384) (-663.966) * (-667.857) (-674.663) [-663.157] (-668.180) -- 0:03:03
312000 -- [-668.695] (-667.839) (-666.629) (-672.859) * (-669.674) (-669.268) [-671.658] (-668.501) -- 0:03:03
313000 -- (-667.552) (-660.631) (-668.763) [-666.644] * (-669.678) (-668.102) (-664.202) [-668.863] -- 0:03:04
314000 -- (-674.980) (-664.284) (-664.105) [-662.618] * (-663.518) (-670.328) [-663.216] (-672.728) -- 0:03:03
315000 -- (-666.968) (-672.163) (-667.461) [-660.474] * [-664.415] (-675.732) (-670.313) (-676.093) -- 0:03:02
Average standard deviation of split frequencies: 0.012409
316000 -- (-669.133) [-670.953] (-661.316) (-669.871) * (-666.260) (-669.480) [-667.127] (-667.716) -- 0:03:03
317000 -- (-672.152) (-672.097) [-663.993] (-668.226) * (-661.077) (-668.487) [-665.520] (-667.480) -- 0:03:03
318000 -- (-670.485) (-668.239) [-663.883] (-668.646) * (-666.893) (-660.905) [-664.025] (-664.959) -- 0:03:02
319000 -- (-659.310) (-663.774) (-666.986) [-664.151] * (-666.164) [-666.444] (-662.838) (-662.990) -- 0:03:01
320000 -- [-663.707] (-680.518) (-664.226) (-667.135) * (-669.305) [-665.536] (-669.647) (-665.055) -- 0:03:02
Average standard deviation of split frequencies: 0.012041
321000 -- (-675.493) (-665.394) [-658.443] (-662.489) * (-666.346) (-667.942) (-664.189) [-662.762] -- 0:03:01
322000 -- (-664.216) (-680.607) [-666.460] (-668.508) * [-664.120] (-667.330) (-663.420) (-673.282) -- 0:03:01
323000 -- (-668.776) (-679.169) (-664.220) [-664.819] * (-668.852) (-673.315) [-663.508] (-667.454) -- 0:03:00
324000 -- (-664.158) (-662.408) (-666.098) [-663.422] * (-662.357) [-668.781] (-665.903) (-664.735) -- 0:03:01
325000 -- (-663.222) (-664.530) (-667.456) [-670.148] * (-665.502) (-669.839) [-660.018] (-663.795) -- 0:03:00
Average standard deviation of split frequencies: 0.012188
326000 -- (-663.136) [-660.964] (-674.299) (-669.545) * (-663.928) (-665.376) (-665.217) [-665.527] -- 0:02:59
327000 -- [-663.738] (-669.051) (-667.826) (-669.833) * [-657.459] (-659.343) (-663.576) (-667.476) -- 0:02:59
328000 -- (-664.129) [-666.453] (-671.131) (-669.919) * (-671.649) (-668.655) (-666.664) [-659.755] -- 0:03:00
329000 -- (-665.416) (-669.815) (-671.956) [-667.546] * (-663.827) (-670.508) [-660.700] (-667.391) -- 0:02:59
330000 -- (-664.123) (-676.446) [-664.260] (-664.790) * [-669.620] (-666.616) (-668.508) (-670.559) -- 0:02:58
Average standard deviation of split frequencies: 0.011744
331000 -- (-666.897) (-670.173) [-655.661] (-669.724) * (-671.106) [-664.261] (-671.351) (-666.754) -- 0:02:59
332000 -- [-670.921] (-667.533) (-680.815) (-663.317) * [-666.675] (-668.446) (-664.921) (-669.899) -- 0:02:59
333000 -- (-676.232) (-666.735) [-674.265] (-667.479) * (-663.769) [-660.806] (-664.906) (-671.693) -- 0:02:58
334000 -- (-670.320) (-662.840) [-669.440] (-663.010) * [-668.969] (-662.065) (-668.584) (-667.184) -- 0:02:57
335000 -- [-666.301] (-668.085) (-673.784) (-663.784) * [-664.667] (-667.586) (-672.369) (-667.857) -- 0:02:58
Average standard deviation of split frequencies: 0.010689
336000 -- (-665.382) [-663.176] (-664.348) (-674.537) * [-663.219] (-676.090) (-670.814) (-676.539) -- 0:02:57
337000 -- (-671.301) [-664.890] (-666.512) (-674.571) * (-667.329) (-669.437) (-675.560) [-667.214] -- 0:02:57
338000 -- (-667.906) (-665.559) [-663.523] (-667.465) * (-667.512) [-672.055] (-673.207) (-667.830) -- 0:02:56
339000 -- (-664.280) (-666.818) [-676.402] (-672.055) * [-668.328] (-678.154) (-665.342) (-672.191) -- 0:02:57
340000 -- [-666.913] (-669.515) (-668.137) (-661.778) * (-672.858) (-663.140) [-657.915] (-662.181) -- 0:02:56
Average standard deviation of split frequencies: 0.011597
341000 -- (-665.456) [-662.346] (-677.975) (-672.549) * (-668.819) (-669.928) (-663.514) [-667.995] -- 0:02:55
342000 -- (-669.143) (-675.240) [-668.417] (-665.768) * (-670.738) (-666.459) [-670.655] (-667.148) -- 0:02:55
343000 -- (-674.391) [-662.333] (-664.580) (-666.618) * (-665.659) (-671.455) [-669.420] (-669.545) -- 0:02:56
344000 -- (-660.353) [-669.907] (-674.157) (-672.178) * (-675.685) [-667.044] (-664.903) (-664.087) -- 0:02:55
345000 -- (-670.177) [-661.312] (-669.198) (-667.140) * (-664.050) [-671.421] (-672.012) (-673.498) -- 0:02:54
Average standard deviation of split frequencies: 0.011289
346000 -- (-670.064) (-671.326) (-680.645) [-666.973] * [-675.265] (-667.710) (-668.496) (-665.604) -- 0:02:53
347000 -- (-671.330) (-667.328) (-670.492) [-661.856] * (-671.484) [-664.997] (-662.930) (-669.768) -- 0:02:55
348000 -- (-663.985) (-677.880) [-667.351] (-661.802) * (-660.957) (-667.952) (-674.244) [-664.712] -- 0:02:54
349000 -- [-668.289] (-668.766) (-664.676) (-669.572) * (-672.228) [-663.726] (-671.759) (-668.842) -- 0:02:53
350000 -- (-670.868) (-675.321) [-669.354] (-659.702) * (-663.350) [-663.743] (-673.672) (-665.552) -- 0:02:54
Average standard deviation of split frequencies: 0.011060
351000 -- (-670.876) (-665.811) [-664.500] (-666.015) * [-668.147] (-666.443) (-670.286) (-677.847) -- 0:02:53
352000 -- (-668.334) (-671.923) (-668.621) [-662.375] * (-660.165) (-662.717) [-661.279] (-666.402) -- 0:02:53
353000 -- (-674.672) [-669.743] (-672.077) (-668.452) * [-665.370] (-674.878) (-666.572) (-660.897) -- 0:02:52
354000 -- (-669.202) [-665.772] (-667.973) (-661.979) * [-665.960] (-667.036) (-675.063) (-670.654) -- 0:02:53
355000 -- (-669.297) (-662.446) [-667.622] (-662.704) * (-667.657) (-666.559) (-681.159) [-665.819] -- 0:02:52
Average standard deviation of split frequencies: 0.010654
356000 -- (-676.113) (-674.442) (-670.324) [-661.116] * (-668.293) (-668.514) (-673.334) [-660.676] -- 0:02:51
357000 -- (-666.342) (-665.678) (-670.486) [-670.737] * (-662.092) (-666.324) [-661.898] (-664.454) -- 0:02:51
358000 -- [-664.936] (-672.063) (-674.796) (-669.025) * (-672.173) [-656.670] (-666.205) (-665.314) -- 0:02:52
359000 -- [-662.123] (-668.040) (-667.995) (-664.426) * [-663.860] (-663.314) (-666.927) (-667.217) -- 0:02:51
360000 -- [-664.280] (-669.164) (-669.016) (-667.196) * (-666.031) (-674.771) (-665.323) [-662.352] -- 0:02:50
Average standard deviation of split frequencies: 0.011763
361000 -- [-666.903] (-665.570) (-668.066) (-666.145) * (-672.133) (-670.986) [-662.685] (-666.289) -- 0:02:49
362000 -- [-664.932] (-661.690) (-665.343) (-670.893) * (-666.516) (-668.306) [-666.689] (-677.491) -- 0:02:50
363000 -- (-668.707) (-664.385) [-666.979] (-661.051) * [-661.098] (-666.050) (-667.388) (-672.631) -- 0:02:50
364000 -- (-664.412) (-668.349) (-673.314) [-666.665] * (-669.939) [-668.359] (-668.134) (-670.699) -- 0:02:49
365000 -- (-670.406) (-665.476) (-671.032) [-667.206] * (-666.140) (-667.025) (-666.681) [-660.268] -- 0:02:50
Average standard deviation of split frequencies: 0.011299
366000 -- [-664.383] (-663.306) (-664.657) (-669.623) * (-668.525) [-669.689] (-672.404) (-667.744) -- 0:02:49
367000 -- (-668.020) (-676.191) [-660.870] (-670.451) * (-671.357) [-669.850] (-672.935) (-673.070) -- 0:02:49
368000 -- (-665.116) (-671.858) [-670.142] (-664.882) * [-668.127] (-673.400) (-669.526) (-674.623) -- 0:02:48
369000 -- (-687.012) (-667.271) (-667.853) [-668.629] * [-669.291] (-668.028) (-674.675) (-670.311) -- 0:02:49
370000 -- (-664.547) (-674.568) [-661.720] (-661.923) * (-662.265) (-666.370) [-666.059] (-675.702) -- 0:02:48
Average standard deviation of split frequencies: 0.011507
371000 -- [-663.114] (-666.635) (-669.922) (-666.304) * (-668.138) [-660.252] (-669.186) (-664.103) -- 0:02:47
372000 -- (-674.321) [-668.028] (-665.898) (-669.474) * [-662.512] (-667.472) (-667.989) (-669.867) -- 0:02:47
373000 -- [-661.435] (-666.772) (-662.608) (-674.220) * (-670.699) (-668.123) (-664.939) [-661.371] -- 0:02:48
374000 -- (-668.702) (-674.444) [-665.158] (-667.311) * [-663.279] (-663.410) (-669.150) (-667.989) -- 0:02:47
375000 -- (-664.092) [-667.944] (-667.073) (-666.262) * [-662.267] (-670.965) (-667.536) (-666.114) -- 0:02:46
Average standard deviation of split frequencies: 0.011164
376000 -- (-664.823) (-666.873) (-665.576) [-665.966] * (-670.326) (-672.887) [-662.303] (-666.865) -- 0:02:45
377000 -- (-672.513) (-672.399) [-661.924] (-665.178) * (-664.073) [-662.074] (-668.552) (-667.051) -- 0:02:46
378000 -- (-665.546) (-669.047) [-665.978] (-667.930) * (-671.593) [-668.386] (-664.716) (-669.992) -- 0:02:46
379000 -- [-669.189] (-664.300) (-666.192) (-667.061) * [-666.502] (-661.889) (-664.254) (-670.759) -- 0:02:45
380000 -- (-664.008) (-664.886) (-671.999) [-664.888] * (-670.506) (-666.497) [-659.709] (-668.887) -- 0:02:46
Average standard deviation of split frequencies: 0.010320
381000 -- [-662.227] (-668.871) (-672.083) (-665.523) * (-671.231) [-663.007] (-667.885) (-667.595) -- 0:02:45
382000 -- (-664.622) [-672.967] (-662.877) (-666.122) * (-674.391) [-663.749] (-667.483) (-670.299) -- 0:02:45
383000 -- [-660.388] (-678.666) (-662.790) (-663.550) * (-666.601) [-663.419] (-669.034) (-674.374) -- 0:02:44
384000 -- (-669.129) (-669.601) (-670.346) [-662.314] * (-671.114) [-668.980] (-670.812) (-661.302) -- 0:02:45
385000 -- [-667.370] (-677.406) (-666.565) (-660.457) * [-666.627] (-665.747) (-665.490) (-662.501) -- 0:02:44
Average standard deviation of split frequencies: 0.010603
386000 -- (-671.809) (-665.868) (-663.809) [-662.461] * (-668.047) [-667.274] (-661.364) (-659.965) -- 0:02:43
387000 -- (-672.457) (-669.717) (-669.478) [-660.918] * [-661.894] (-661.798) (-666.444) (-672.031) -- 0:02:43
388000 -- (-663.602) (-675.555) (-667.708) [-663.985] * (-663.434) (-664.208) [-672.130] (-664.830) -- 0:02:44
389000 -- (-669.021) (-676.476) (-669.537) [-666.050] * (-663.668) (-664.603) [-662.955] (-674.011) -- 0:02:43
390000 -- (-664.926) [-666.960] (-661.931) (-669.517) * [-667.795] (-667.418) (-659.314) (-665.971) -- 0:02:42
Average standard deviation of split frequencies: 0.010515
391000 -- [-669.524] (-666.362) (-668.844) (-672.698) * [-663.737] (-667.274) (-663.635) (-678.809) -- 0:02:41
392000 -- (-671.584) (-669.109) (-662.728) [-663.637] * (-666.406) (-670.044) [-668.798] (-664.408) -- 0:02:42
393000 -- (-672.654) (-667.388) [-670.382] (-670.927) * [-673.758] (-668.311) (-676.415) (-672.143) -- 0:02:42
394000 -- (-670.380) [-670.292] (-669.764) (-666.166) * [-663.326] (-664.088) (-667.567) (-675.587) -- 0:02:41
395000 -- [-669.062] (-666.492) (-665.011) (-676.433) * (-660.841) [-664.351] (-671.613) (-670.606) -- 0:02:42
Average standard deviation of split frequencies: 0.011111
396000 -- [-668.776] (-669.086) (-669.737) (-666.913) * [-663.723] (-665.597) (-662.786) (-678.089) -- 0:02:41
397000 -- (-667.574) [-661.426] (-666.456) (-674.415) * (-660.599) (-662.156) (-667.676) [-665.545] -- 0:02:41
398000 -- [-671.584] (-675.590) (-667.332) (-671.784) * (-672.183) [-673.688] (-666.767) (-668.952) -- 0:02:40
399000 -- (-662.950) (-675.158) [-661.346] (-672.002) * (-666.712) (-671.102) (-664.319) [-668.775] -- 0:02:41
400000 -- (-668.393) [-661.595] (-668.226) (-673.249) * [-661.673] (-667.483) (-667.188) (-664.456) -- 0:02:40
Average standard deviation of split frequencies: 0.011429
401000 -- (-672.865) (-671.739) (-672.473) [-663.471] * (-672.322) (-677.352) (-671.645) [-661.628] -- 0:02:39
402000 -- [-672.400] (-669.040) (-666.108) (-665.867) * (-664.048) (-665.049) [-662.433] (-664.195) -- 0:02:40
403000 -- (-666.750) [-665.931] (-662.472) (-673.262) * (-664.492) (-667.715) (-667.683) [-664.572] -- 0:02:39
404000 -- (-672.896) (-673.235) [-660.578] (-670.607) * (-671.124) (-662.804) (-666.576) [-664.411] -- 0:02:39
405000 -- (-664.670) [-668.394] (-663.349) (-670.130) * (-674.713) (-665.600) (-670.314) [-661.759] -- 0:02:38
Average standard deviation of split frequencies: 0.011928
406000 -- (-660.251) (-671.195) (-659.214) [-668.282] * (-668.535) (-659.598) (-671.905) [-663.509] -- 0:02:39
407000 -- (-666.912) (-674.790) (-670.859) [-663.946] * (-677.126) [-666.180] (-664.297) (-675.642) -- 0:02:38
408000 -- [-666.644] (-667.173) (-665.745) (-664.832) * (-666.134) (-676.995) [-664.413] (-664.084) -- 0:02:38
409000 -- [-660.721] (-671.637) (-666.902) (-661.596) * (-665.356) (-668.112) [-669.666] (-668.599) -- 0:02:38
410000 -- (-673.440) [-663.503] (-675.943) (-667.370) * (-665.279) (-661.850) (-669.698) [-663.389] -- 0:02:38
Average standard deviation of split frequencies: 0.011424
411000 -- [-672.584] (-673.084) (-666.711) (-674.173) * (-666.614) (-663.227) [-674.353] (-672.091) -- 0:02:37
412000 -- (-680.800) (-660.435) [-662.613] (-665.652) * (-663.510) (-668.486) (-673.673) [-665.980] -- 0:02:36
413000 -- (-666.695) (-665.879) (-669.764) [-667.442] * (-665.314) (-662.750) (-664.698) [-662.404] -- 0:02:37
414000 -- (-668.484) (-670.287) [-668.879] (-665.775) * (-661.389) [-668.754] (-661.244) (-664.216) -- 0:02:37
415000 -- (-672.255) (-673.599) [-663.994] (-666.349) * (-660.279) [-671.499] (-665.681) (-668.300) -- 0:02:36
Average standard deviation of split frequencies: 0.012182
416000 -- (-672.122) [-671.836] (-669.072) (-664.555) * (-673.568) (-670.118) [-666.776] (-673.271) -- 0:02:35
417000 -- [-676.928] (-667.637) (-663.977) (-675.992) * (-670.111) (-676.063) (-673.183) [-666.316] -- 0:02:36
418000 -- (-675.599) [-662.543] (-682.516) (-676.918) * (-667.690) (-668.786) (-670.516) [-665.634] -- 0:02:35
419000 -- (-675.367) [-672.098] (-663.292) (-663.804) * (-669.565) (-665.676) [-666.689] (-670.390) -- 0:02:35
420000 -- (-675.364) [-671.935] (-671.139) (-671.995) * (-669.987) [-668.605] (-663.396) (-672.654) -- 0:02:34
Average standard deviation of split frequencies: 0.012607
421000 -- [-667.200] (-667.582) (-670.049) (-669.021) * (-672.227) (-668.817) [-659.272] (-663.144) -- 0:02:35
422000 -- (-669.484) (-669.955) (-666.510) [-662.827] * (-663.090) (-662.196) (-671.284) [-663.612] -- 0:02:34
423000 -- (-671.186) (-663.858) (-683.380) [-667.428] * [-665.958] (-671.931) (-663.731) (-664.105) -- 0:02:34
424000 -- [-663.841] (-665.707) (-667.695) (-671.838) * (-662.010) (-661.993) [-665.285] (-666.673) -- 0:02:34
425000 -- [-663.678] (-669.095) (-664.976) (-667.381) * (-667.468) (-670.261) [-660.938] (-667.791) -- 0:02:34
Average standard deviation of split frequencies: 0.011820
426000 -- (-668.024) (-679.498) (-665.178) [-664.557] * (-673.191) (-670.512) [-665.923] (-666.274) -- 0:02:33
427000 -- (-675.515) (-666.393) [-665.055] (-675.530) * (-673.456) (-669.334) [-670.853] (-663.439) -- 0:02:32
428000 -- [-659.400] (-668.215) (-663.414) (-664.374) * [-663.627] (-666.060) (-661.506) (-665.988) -- 0:02:33
429000 -- (-663.757) (-671.875) (-673.384) [-663.596] * (-668.705) [-665.137] (-663.798) (-674.261) -- 0:02:33
430000 -- [-665.473] (-670.498) (-664.166) (-669.306) * (-675.802) (-669.588) [-664.851] (-666.511) -- 0:02:32
Average standard deviation of split frequencies: 0.010790
431000 -- (-671.654) (-663.364) [-668.149] (-670.551) * (-671.110) (-667.879) [-667.174] (-663.408) -- 0:02:31
432000 -- (-664.455) (-667.262) [-661.765] (-667.796) * [-665.941] (-667.920) (-677.013) (-669.585) -- 0:02:32
433000 -- (-667.994) (-670.260) [-665.138] (-675.847) * [-668.036] (-665.986) (-677.190) (-665.270) -- 0:02:31
434000 -- (-668.454) [-663.492] (-665.369) (-668.132) * (-673.385) (-675.465) [-672.461] (-672.150) -- 0:02:31
435000 -- [-667.420] (-671.134) (-661.883) (-665.101) * (-667.205) (-677.890) [-662.325] (-670.001) -- 0:02:30
Average standard deviation of split frequencies: 0.011945
436000 -- [-666.372] (-671.995) (-671.366) (-669.490) * (-668.373) [-665.985] (-664.066) (-668.394) -- 0:02:31
437000 -- (-668.162) (-671.747) [-665.982] (-670.689) * [-659.243] (-668.892) (-666.492) (-675.937) -- 0:02:30
438000 -- (-669.832) [-671.506] (-673.479) (-663.603) * (-665.087) (-670.225) [-661.169] (-670.424) -- 0:02:30
439000 -- (-661.830) (-668.733) [-665.378] (-664.749) * [-662.082] (-666.977) (-659.286) (-668.337) -- 0:02:29
440000 -- (-664.589) (-666.360) (-661.887) [-664.692] * (-666.032) (-666.634) [-671.084] (-671.731) -- 0:02:30
Average standard deviation of split frequencies: 0.011179
441000 -- (-664.493) (-676.442) (-663.677) [-665.531] * (-660.251) (-672.210) (-669.321) [-661.680] -- 0:02:29
442000 -- (-662.620) (-667.442) (-664.224) [-668.632] * (-664.085) [-660.347] (-666.700) (-673.204) -- 0:02:28
443000 -- (-669.386) (-660.309) [-672.304] (-670.382) * [-669.707] (-663.594) (-666.826) (-664.148) -- 0:02:29
444000 -- [-670.040] (-661.939) (-669.799) (-679.962) * (-665.465) [-668.296] (-661.861) (-670.295) -- 0:02:29
445000 -- (-671.854) (-677.978) [-661.980] (-681.774) * [-667.499] (-665.287) (-671.684) (-666.617) -- 0:02:28
Average standard deviation of split frequencies: 0.011098
446000 -- (-666.355) (-664.586) [-661.891] (-672.129) * (-663.168) (-669.649) [-664.737] (-661.485) -- 0:02:27
447000 -- (-669.310) [-664.475] (-668.271) (-666.099) * (-666.884) (-671.310) (-666.763) [-665.513] -- 0:02:28
448000 -- (-663.738) (-668.811) [-661.584] (-670.681) * (-672.692) [-664.430] (-673.783) (-666.809) -- 0:02:27
449000 -- (-668.190) (-663.950) [-664.530] (-668.801) * (-669.424) (-666.996) [-669.423] (-660.889) -- 0:02:27
450000 -- [-667.303] (-668.103) (-667.246) (-669.465) * (-668.528) (-665.529) (-664.716) [-662.912] -- 0:02:26
Average standard deviation of split frequencies: 0.010199
451000 -- (-666.812) [-670.204] (-671.928) (-665.635) * (-669.392) [-663.020] (-669.057) (-673.911) -- 0:02:27
452000 -- (-676.304) (-675.533) (-665.203) [-674.167] * (-667.392) (-663.471) (-669.383) [-663.306] -- 0:02:26
453000 -- (-683.547) (-682.634) (-673.282) [-671.650] * [-665.427] (-674.071) (-666.077) (-669.681) -- 0:02:26
454000 -- (-668.400) (-670.301) (-666.384) [-667.534] * (-666.263) (-667.091) [-668.022] (-675.061) -- 0:02:25
455000 -- (-670.670) (-669.346) (-671.320) [-665.175] * [-663.625] (-665.109) (-672.157) (-666.029) -- 0:02:26
Average standard deviation of split frequencies: 0.010286
456000 -- (-669.494) (-662.900) (-676.108) [-671.500] * (-668.860) (-666.925) [-664.596] (-662.747) -- 0:02:25
457000 -- (-666.686) [-671.552] (-666.634) (-673.718) * (-668.262) (-665.600) (-672.069) [-661.036] -- 0:02:24
458000 -- [-664.124] (-682.128) (-668.752) (-665.293) * (-665.383) [-666.140] (-664.101) (-666.276) -- 0:02:25
459000 -- (-664.894) (-670.634) (-661.545) [-667.544] * (-673.779) [-669.939] (-670.395) (-670.478) -- 0:02:24
460000 -- (-667.538) (-666.818) (-666.966) [-669.338] * [-667.755] (-676.479) (-675.270) (-670.065) -- 0:02:24
Average standard deviation of split frequencies: 0.009056
461000 -- [-663.781] (-671.532) (-673.783) (-666.552) * [-664.831] (-661.992) (-669.280) (-668.741) -- 0:02:23
462000 -- [-661.943] (-658.858) (-678.155) (-665.848) * [-663.176] (-673.135) (-667.096) (-673.035) -- 0:02:24
463000 -- (-667.645) (-673.011) (-680.254) [-661.920] * (-675.069) (-669.935) [-662.478] (-671.354) -- 0:02:23
464000 -- (-675.047) (-668.533) [-667.958] (-665.428) * (-672.093) (-661.827) [-664.398] (-669.550) -- 0:02:23
465000 -- (-671.732) (-675.296) (-671.549) [-672.837] * [-666.044] (-673.063) (-668.750) (-672.924) -- 0:02:22
Average standard deviation of split frequencies: 0.009477
466000 -- (-661.542) (-663.163) (-668.734) [-668.298] * (-666.652) [-667.305] (-666.588) (-667.307) -- 0:02:23
467000 -- (-665.991) (-672.214) (-673.335) [-665.620] * (-673.909) (-667.534) (-664.755) [-664.336] -- 0:02:22
468000 -- (-676.360) [-664.898] (-673.810) (-664.905) * [-663.286] (-668.119) (-666.335) (-666.199) -- 0:02:22
469000 -- [-667.136] (-663.771) (-666.910) (-675.170) * [-662.504] (-670.963) (-672.718) (-663.331) -- 0:02:21
470000 -- (-669.143) (-667.807) (-668.246) [-662.936] * [-668.596] (-667.730) (-668.367) (-669.626) -- 0:02:22
Average standard deviation of split frequencies: 0.009067
471000 -- (-670.881) (-669.010) (-667.782) [-664.047] * (-671.163) (-672.157) [-668.918] (-660.986) -- 0:02:21
472000 -- [-665.466] (-663.920) (-663.294) (-661.505) * (-663.147) (-675.379) [-661.132] (-673.212) -- 0:02:20
473000 -- (-670.814) [-663.227] (-665.835) (-673.414) * [-672.366] (-680.532) (-660.372) (-665.096) -- 0:02:21
474000 -- (-678.942) (-665.418) (-663.878) [-665.731] * [-668.406] (-665.512) (-668.967) (-666.827) -- 0:02:20
475000 -- (-668.367) [-661.141] (-665.572) (-664.169) * (-664.726) (-665.556) (-671.095) [-660.768] -- 0:02:20
Average standard deviation of split frequencies: 0.009278
476000 -- (-664.953) [-666.618] (-667.866) (-666.317) * (-674.485) (-677.872) (-675.708) [-662.011] -- 0:02:19
477000 -- (-671.231) (-665.427) [-662.264] (-666.230) * (-663.251) [-665.436] (-664.707) (-666.715) -- 0:02:20
478000 -- (-667.680) (-670.322) [-665.630] (-668.165) * (-674.587) (-667.881) [-669.970] (-674.628) -- 0:02:19
479000 -- (-666.454) (-670.162) (-668.786) [-667.717] * (-670.909) (-667.864) (-673.972) [-668.031] -- 0:02:19
480000 -- (-680.033) (-666.339) (-665.942) [-672.137] * (-675.522) (-668.534) [-664.171] (-662.103) -- 0:02:18
Average standard deviation of split frequencies: 0.009394
481000 -- (-669.460) (-664.344) (-662.380) [-663.765] * (-670.818) [-661.345] (-665.344) (-661.797) -- 0:02:19
482000 -- (-664.860) [-667.668] (-666.267) (-664.935) * (-671.550) (-672.048) (-668.185) [-665.126] -- 0:02:18
483000 -- (-671.994) [-661.833] (-672.993) (-658.862) * (-675.951) (-670.054) [-669.038] (-661.109) -- 0:02:18
484000 -- (-666.198) (-677.556) (-669.036) [-666.269] * (-678.720) [-663.040] (-666.023) (-658.528) -- 0:02:17
485000 -- [-670.300] (-666.403) (-662.649) (-664.957) * (-667.941) [-662.431] (-672.755) (-661.755) -- 0:02:18
Average standard deviation of split frequencies: 0.008628
486000 -- (-668.532) [-669.276] (-679.329) (-664.586) * (-671.665) (-662.262) [-671.607] (-670.273) -- 0:02:17
487000 -- (-670.153) [-664.209] (-667.550) (-671.501) * [-662.471] (-675.974) (-665.804) (-671.005) -- 0:02:16
488000 -- (-665.937) (-672.173) [-672.656] (-671.438) * (-671.505) (-675.531) [-666.537] (-671.630) -- 0:02:16
489000 -- (-672.912) (-662.698) [-666.467] (-664.077) * (-670.572) (-669.937) (-676.291) [-663.624] -- 0:02:16
490000 -- (-669.103) [-661.985] (-673.044) (-665.501) * [-663.296] (-668.718) (-666.071) (-669.000) -- 0:02:16
Average standard deviation of split frequencies: 0.009001
491000 -- [-660.806] (-667.880) (-671.087) (-666.014) * (-674.416) (-664.168) (-683.230) [-668.856] -- 0:02:15
492000 -- (-663.883) (-672.064) (-673.043) [-663.265] * (-673.468) (-669.954) [-669.937] (-670.895) -- 0:02:16
493000 -- [-662.021] (-671.513) (-667.617) (-668.585) * (-672.807) (-667.752) (-670.043) [-663.148] -- 0:02:15
494000 -- [-661.196] (-671.420) (-668.967) (-674.326) * (-665.214) (-668.033) (-670.919) [-662.986] -- 0:02:15
495000 -- (-667.676) (-673.669) [-664.134] (-680.421) * (-670.757) (-668.009) [-666.426] (-666.272) -- 0:02:14
Average standard deviation of split frequencies: 0.009004
496000 -- (-672.420) (-672.461) (-663.105) [-671.034] * (-667.104) (-666.064) (-665.812) [-670.173] -- 0:02:15
497000 -- (-667.936) (-660.420) [-670.341] (-665.342) * (-673.667) [-665.953] (-667.498) (-678.141) -- 0:02:14
498000 -- [-666.046] (-664.238) (-673.698) (-666.056) * (-669.557) (-680.993) (-666.513) [-663.327] -- 0:02:14
499000 -- (-684.686) [-665.197] (-660.827) (-672.148) * (-674.067) (-674.617) [-673.414] (-664.744) -- 0:02:13
500000 -- (-671.687) (-662.983) (-674.796) [-666.391] * (-665.784) (-668.797) (-665.147) [-660.803] -- 0:02:14
Average standard deviation of split frequencies: 0.008821
501000 -- (-662.504) (-665.446) (-664.869) [-665.050] * [-668.803] (-669.779) (-661.562) (-664.623) -- 0:02:13
502000 -- (-664.117) [-659.752] (-670.107) (-668.139) * (-665.662) (-670.975) (-668.673) [-664.491] -- 0:02:12
503000 -- (-666.368) (-677.967) (-667.206) [-662.682] * (-666.043) [-663.434] (-663.495) (-667.959) -- 0:02:12
504000 -- (-657.828) (-672.380) (-665.324) [-669.748] * [-662.163] (-667.693) (-670.192) (-662.615) -- 0:02:12
505000 -- (-667.687) (-670.795) [-662.948] (-665.240) * (-663.039) (-672.806) [-671.564] (-668.061) -- 0:02:12
Average standard deviation of split frequencies: 0.007992
506000 -- (-662.971) [-662.578] (-670.075) (-674.672) * (-662.358) (-672.686) (-667.862) [-663.479] -- 0:02:11
507000 -- (-662.968) [-661.499] (-668.822) (-668.586) * [-665.099] (-668.619) (-668.431) (-667.649) -- 0:02:11
508000 -- (-665.834) [-663.528] (-661.525) (-667.870) * (-677.604) (-666.032) (-666.309) [-661.573] -- 0:02:11
509000 -- (-677.894) (-659.032) (-665.136) [-666.515] * (-669.891) (-664.286) (-660.444) [-664.081] -- 0:02:11
510000 -- [-665.362] (-669.335) (-663.973) (-667.475) * (-666.865) (-671.474) [-664.624] (-667.520) -- 0:02:10
Average standard deviation of split frequencies: 0.007725
511000 -- [-673.339] (-664.083) (-668.098) (-670.849) * (-666.299) [-671.975] (-673.113) (-671.502) -- 0:02:11
512000 -- (-665.228) (-671.391) (-665.547) [-661.487] * [-657.408] (-665.006) (-669.879) (-669.990) -- 0:02:10
513000 -- [-665.258] (-674.385) (-668.681) (-664.916) * (-668.302) (-678.266) [-671.701] (-665.195) -- 0:02:10
514000 -- (-677.575) (-667.605) (-668.622) [-666.592] * [-663.364] (-667.869) (-665.758) (-667.048) -- 0:02:09
515000 -- (-669.116) (-666.470) (-664.364) [-674.138] * (-661.684) (-671.929) (-666.248) [-673.661] -- 0:02:09
Average standard deviation of split frequencies: 0.006780
516000 -- [-660.880] (-670.554) (-669.980) (-674.289) * [-665.332] (-665.374) (-668.381) (-666.792) -- 0:02:09
517000 -- (-678.987) [-667.668] (-667.143) (-661.373) * (-668.535) (-663.583) [-664.851] (-664.623) -- 0:02:08
518000 -- (-664.058) (-661.769) [-664.545] (-673.858) * [-663.936] (-668.786) (-664.568) (-671.137) -- 0:02:08
519000 -- [-667.924] (-661.608) (-665.933) (-668.703) * [-664.802] (-661.085) (-669.033) (-669.128) -- 0:02:08
520000 -- (-667.799) (-663.104) (-669.696) [-668.192] * (-664.447) [-661.441] (-667.403) (-669.877) -- 0:02:08
Average standard deviation of split frequencies: 0.006383
521000 -- (-669.063) [-661.433] (-673.374) (-667.119) * (-669.340) (-668.588) [-664.971] (-676.055) -- 0:02:07
522000 -- (-668.890) [-665.683] (-678.460) (-667.303) * (-668.728) (-667.654) [-667.703] (-675.738) -- 0:02:07
523000 -- (-675.331) (-660.955) (-665.193) [-667.759] * (-670.916) [-660.773] (-675.615) (-668.070) -- 0:02:07
524000 -- (-662.298) (-663.253) (-666.653) [-671.048] * (-668.612) (-671.139) (-663.366) [-663.059] -- 0:02:07
525000 -- [-669.395] (-673.676) (-668.314) (-667.225) * (-675.678) (-661.341) (-676.897) [-661.305] -- 0:02:06
Average standard deviation of split frequencies: 0.006229
526000 -- (-673.616) [-664.901] (-666.839) (-669.118) * (-668.915) (-666.279) [-668.874] (-664.960) -- 0:02:06
527000 -- [-670.631] (-683.599) (-666.274) (-680.966) * (-674.684) (-677.698) (-664.557) [-668.072] -- 0:02:06
528000 -- (-669.289) [-667.968] (-670.652) (-676.789) * (-679.054) [-667.169] (-665.841) (-663.861) -- 0:02:06
529000 -- (-672.959) (-672.392) (-669.842) [-670.621] * (-668.687) [-661.360] (-673.295) (-665.433) -- 0:02:05
530000 -- (-665.770) (-673.900) [-670.793] (-665.690) * (-674.644) (-664.135) [-663.711] (-673.993) -- 0:02:05
Average standard deviation of split frequencies: 0.005891
531000 -- [-664.188] (-669.570) (-677.840) (-676.528) * [-663.385] (-662.949) (-665.729) (-676.665) -- 0:02:05
532000 -- (-667.084) [-660.780] (-668.647) (-660.867) * [-660.381] (-669.106) (-665.172) (-667.373) -- 0:02:04
533000 -- (-681.328) [-660.221] (-673.877) (-676.854) * (-672.398) (-665.647) [-670.704] (-671.825) -- 0:02:04
534000 -- (-664.240) (-665.676) [-665.276] (-671.164) * [-665.736] (-667.813) (-667.475) (-666.675) -- 0:02:04
535000 -- (-668.692) (-666.828) [-665.326] (-680.191) * (-662.542) (-671.202) (-680.148) [-667.850] -- 0:02:04
Average standard deviation of split frequencies: 0.005462
536000 -- [-666.913] (-670.459) (-666.976) (-670.898) * (-666.477) (-672.199) (-674.541) [-667.592] -- 0:02:03
537000 -- (-666.164) (-666.044) [-672.754] (-673.986) * (-669.786) (-668.082) [-675.161] (-665.046) -- 0:02:03
538000 -- (-673.377) [-667.967] (-665.750) (-665.432) * (-665.327) [-664.425] (-664.589) (-666.835) -- 0:02:03
539000 -- (-674.879) (-665.497) [-666.836] (-670.268) * (-672.113) (-664.382) (-664.941) [-664.085] -- 0:02:03
540000 -- (-672.608) [-671.231] (-669.279) (-668.187) * (-670.911) (-667.422) (-670.980) [-664.367] -- 0:02:02
Average standard deviation of split frequencies: 0.005966
541000 -- [-662.189] (-672.726) (-664.460) (-664.500) * (-663.954) (-668.879) [-666.789] (-663.519) -- 0:02:02
542000 -- (-665.483) (-670.409) [-667.852] (-666.891) * [-665.658] (-663.358) (-671.458) (-674.560) -- 0:02:02
543000 -- (-671.062) (-670.249) (-664.713) [-656.119] * [-664.516] (-663.317) (-666.146) (-682.178) -- 0:02:02
544000 -- (-668.405) [-667.416] (-666.456) (-672.257) * (-665.320) [-668.359] (-667.708) (-666.595) -- 0:02:01
545000 -- (-665.408) (-666.890) (-668.623) [-666.889] * [-667.473] (-661.965) (-670.543) (-669.491) -- 0:02:01
Average standard deviation of split frequencies: 0.005726
546000 -- [-673.041] (-672.596) (-663.158) (-667.493) * (-666.855) [-661.687] (-663.914) (-666.139) -- 0:02:01
547000 -- (-680.252) (-665.476) (-665.938) [-674.779] * (-667.251) [-664.506] (-661.498) (-673.248) -- 0:02:00
548000 -- (-675.076) (-674.913) [-662.847] (-680.396) * (-665.201) (-669.053) (-672.710) [-664.753] -- 0:02:00
549000 -- (-677.890) (-670.606) (-673.049) [-666.120] * [-663.265] (-671.353) (-673.275) (-665.803) -- 0:02:00
550000 -- (-665.536) (-662.516) [-673.414] (-668.650) * (-668.087) (-667.695) (-669.585) [-668.304] -- 0:02:00
Average standard deviation of split frequencies: 0.005542
551000 -- (-675.852) [-663.179] (-668.996) (-666.291) * (-672.923) (-661.279) [-660.659] (-668.662) -- 0:01:59
552000 -- [-663.201] (-665.139) (-664.163) (-675.293) * [-663.014] (-667.852) (-662.403) (-663.001) -- 0:01:59
553000 -- (-674.579) (-662.440) (-669.073) [-662.069] * [-665.499] (-661.363) (-672.307) (-666.002) -- 0:01:59
554000 -- [-665.600] (-670.050) (-663.708) (-666.219) * (-667.151) [-663.071] (-679.670) (-672.867) -- 0:01:59
555000 -- [-675.364] (-663.777) (-667.075) (-671.466) * (-667.950) [-663.611] (-673.795) (-661.950) -- 0:01:58
Average standard deviation of split frequencies: 0.005667
556000 -- (-664.047) (-670.521) [-665.483] (-667.203) * [-671.885] (-670.168) (-663.385) (-671.699) -- 0:01:58
557000 -- (-664.603) [-663.720] (-664.496) (-673.404) * [-670.446] (-665.925) (-666.634) (-665.072) -- 0:01:58
558000 -- [-672.130] (-672.365) (-670.238) (-666.106) * (-671.605) [-671.826] (-662.304) (-666.496) -- 0:01:58
559000 -- (-668.370) (-671.830) [-666.506] (-674.495) * (-667.720) (-669.980) (-667.648) [-661.904] -- 0:01:57
560000 -- (-664.498) [-664.948] (-666.007) (-669.293) * (-670.434) (-676.001) [-662.586] (-667.652) -- 0:01:57
Average standard deviation of split frequencies: 0.005664
561000 -- [-664.915] (-673.974) (-673.733) (-670.120) * (-671.193) [-666.615] (-664.186) (-669.489) -- 0:01:57
562000 -- [-674.405] (-672.997) (-663.326) (-674.742) * (-667.295) (-661.604) [-670.034] (-670.808) -- 0:01:56
563000 -- (-675.094) (-666.976) (-663.107) [-663.405] * [-663.121] (-674.122) (-673.770) (-665.364) -- 0:01:56
564000 -- (-674.827) (-666.473) (-681.500) [-670.819] * (-668.040) [-669.829] (-667.949) (-663.358) -- 0:01:56
565000 -- (-670.439) (-662.637) (-667.591) [-664.822] * (-669.225) [-662.831] (-671.130) (-663.625) -- 0:01:56
Average standard deviation of split frequencies: 0.005913
566000 -- [-666.425] (-666.252) (-670.072) (-675.426) * (-675.849) [-664.356] (-668.404) (-667.347) -- 0:01:55
567000 -- (-669.616) [-667.303] (-660.299) (-673.782) * [-660.687] (-665.041) (-666.828) (-668.164) -- 0:01:55
568000 -- (-666.740) (-665.757) (-665.919) [-672.304] * (-662.072) (-674.618) [-663.914] (-663.381) -- 0:01:55
569000 -- (-669.538) (-678.686) [-668.603] (-663.709) * [-671.834] (-673.098) (-668.222) (-669.055) -- 0:01:55
570000 -- [-674.146] (-671.479) (-668.159) (-665.758) * [-668.468] (-672.150) (-665.008) (-668.514) -- 0:01:54
Average standard deviation of split frequencies: 0.004998
571000 -- (-673.564) [-663.761] (-668.090) (-672.794) * (-667.853) (-664.515) [-663.015] (-669.870) -- 0:01:54
572000 -- (-664.468) [-668.669] (-667.344) (-671.667) * (-666.078) (-668.124) [-661.208] (-670.159) -- 0:01:54
573000 -- [-667.121] (-663.018) (-665.460) (-668.663) * (-670.652) [-668.544] (-666.817) (-665.512) -- 0:01:54
574000 -- (-682.405) (-674.658) (-668.059) [-665.906] * (-672.526) (-673.443) [-662.623] (-668.803) -- 0:01:53
575000 -- (-665.766) [-672.729] (-670.906) (-667.615) * (-665.394) [-666.167] (-667.092) (-670.288) -- 0:01:53
Average standard deviation of split frequencies: 0.005126
576000 -- [-660.352] (-677.929) (-658.437) (-668.713) * (-668.614) (-674.823) [-670.144] (-666.834) -- 0:01:53
577000 -- (-664.890) (-672.066) (-674.480) [-665.876] * (-662.397) [-661.572] (-671.213) (-666.470) -- 0:01:52
578000 -- [-663.122] (-676.894) (-667.858) (-667.626) * (-674.935) (-667.144) (-662.631) [-668.270] -- 0:01:52
579000 -- [-663.514] (-664.851) (-678.428) (-663.196) * (-677.689) (-664.388) [-678.271] (-672.220) -- 0:01:52
580000 -- (-670.168) [-664.409] (-669.396) (-674.191) * (-669.590) (-661.008) (-661.860) [-666.169] -- 0:01:52
Average standard deviation of split frequencies: 0.005085
581000 -- [-672.777] (-664.750) (-672.486) (-669.901) * [-668.709] (-664.892) (-664.255) (-671.254) -- 0:01:51
582000 -- (-670.847) [-666.249] (-663.079) (-661.661) * (-669.283) (-670.193) [-664.022] (-668.081) -- 0:01:51
583000 -- (-672.156) (-667.418) [-664.839] (-668.626) * [-660.991] (-674.681) (-673.335) (-678.136) -- 0:01:51
584000 -- (-678.139) [-659.311] (-666.669) (-677.890) * (-667.652) (-671.944) [-665.881] (-673.278) -- 0:01:51
585000 -- (-675.155) (-668.449) [-661.662] (-659.040) * (-669.043) [-664.252] (-664.629) (-670.561) -- 0:01:50
Average standard deviation of split frequencies: 0.005028
586000 -- [-664.432] (-664.113) (-667.113) (-667.282) * (-667.578) (-665.887) [-665.963] (-681.672) -- 0:01:50
587000 -- [-659.798] (-671.658) (-672.820) (-667.937) * (-680.730) (-664.028) (-672.181) [-663.718] -- 0:01:50
588000 -- [-668.999] (-668.373) (-671.460) (-662.853) * (-660.950) [-665.983] (-665.349) (-664.995) -- 0:01:50
589000 -- (-670.525) (-671.674) (-664.258) [-670.084] * (-665.699) [-664.885] (-666.963) (-671.928) -- 0:01:49
590000 -- (-674.445) (-666.173) (-665.468) [-668.817] * (-669.162) [-669.329] (-664.068) (-663.947) -- 0:01:49
Average standard deviation of split frequencies: 0.004669
591000 -- (-665.913) (-665.204) [-659.139] (-671.329) * [-668.485] (-662.916) (-672.007) (-663.191) -- 0:01:49
592000 -- (-672.229) (-665.566) [-666.922] (-678.914) * [-661.963] (-662.056) (-674.714) (-668.072) -- 0:01:48
593000 -- [-665.350] (-669.087) (-664.638) (-675.691) * (-671.800) [-667.155] (-667.372) (-681.269) -- 0:01:48
594000 -- (-666.783) [-664.349] (-669.087) (-674.090) * (-668.302) [-664.302] (-669.628) (-668.566) -- 0:01:48
595000 -- (-668.566) [-671.252] (-666.670) (-669.349) * [-662.303] (-673.667) (-667.902) (-667.216) -- 0:01:48
Average standard deviation of split frequencies: 0.004904
596000 -- [-660.172] (-670.396) (-671.063) (-668.395) * (-662.271) (-668.056) [-668.761] (-661.978) -- 0:01:47
597000 -- (-667.826) [-670.994] (-667.275) (-677.046) * (-661.885) (-667.583) [-670.138] (-666.168) -- 0:01:47
598000 -- (-664.637) [-661.888] (-677.546) (-666.681) * (-667.785) (-660.447) (-665.557) [-664.661] -- 0:01:47
599000 -- (-666.541) (-671.159) [-670.843] (-668.229) * (-666.268) (-665.175) [-665.611] (-662.642) -- 0:01:47
600000 -- (-664.692) (-667.077) (-673.010) [-670.010] * (-663.263) (-665.964) (-662.800) [-659.225] -- 0:01:46
Average standard deviation of split frequencies: 0.004709
601000 -- (-671.934) (-665.422) [-672.071] (-666.833) * [-665.406] (-663.700) (-673.572) (-663.233) -- 0:01:46
602000 -- (-668.615) (-668.074) (-672.269) [-664.455] * (-660.134) [-662.371] (-669.790) (-674.575) -- 0:01:46
603000 -- (-668.127) [-663.042] (-667.958) (-667.241) * [-667.042] (-669.765) (-662.441) (-665.275) -- 0:01:45
604000 -- [-661.449] (-671.857) (-672.104) (-669.828) * (-674.761) (-672.866) (-673.242) [-665.890] -- 0:01:45
605000 -- (-666.424) (-665.824) (-677.312) [-671.303] * (-668.503) (-679.193) (-673.776) [-662.894] -- 0:01:45
Average standard deviation of split frequencies: 0.004784
606000 -- [-668.778] (-665.060) (-672.232) (-660.667) * (-665.804) (-668.316) (-665.349) [-665.974] -- 0:01:45
607000 -- (-664.239) (-668.992) (-666.693) [-664.553] * (-660.265) (-671.160) [-662.566] (-666.440) -- 0:01:44
608000 -- [-671.165] (-674.404) (-668.778) (-675.003) * [-666.334] (-669.843) (-665.032) (-662.533) -- 0:01:44
609000 -- (-669.296) (-666.167) [-671.404] (-667.787) * (-663.771) [-660.318] (-669.543) (-669.267) -- 0:01:44
610000 -- (-661.725) (-667.286) [-669.298] (-666.875) * (-670.047) [-662.819] (-671.746) (-668.774) -- 0:01:44
Average standard deviation of split frequencies: 0.004713
611000 -- [-666.418] (-668.581) (-673.751) (-665.086) * (-668.655) (-672.466) [-664.658] (-669.667) -- 0:01:43
612000 -- (-667.435) (-673.027) [-672.342] (-670.299) * (-674.900) [-666.748] (-672.749) (-661.676) -- 0:01:43
613000 -- (-672.020) (-664.522) (-671.370) [-664.226] * (-659.376) (-664.231) (-673.370) [-663.978] -- 0:01:43
614000 -- (-672.793) (-664.123) (-666.246) [-665.939] * [-667.848] (-673.927) (-670.041) (-668.862) -- 0:01:43
615000 -- (-673.261) (-666.479) [-664.505] (-667.174) * (-666.061) [-663.975] (-674.766) (-668.656) -- 0:01:42
Average standard deviation of split frequencies: 0.004914
616000 -- [-666.343] (-670.103) (-665.162) (-661.695) * (-666.862) [-662.162] (-666.797) (-661.528) -- 0:01:42
617000 -- (-679.262) [-663.885] (-674.522) (-673.533) * (-665.524) [-662.169] (-669.508) (-663.083) -- 0:01:42
618000 -- (-668.126) [-661.811] (-669.938) (-667.368) * [-670.631] (-674.887) (-663.782) (-670.306) -- 0:01:41
619000 -- (-664.004) [-668.695] (-660.997) (-666.562) * (-667.586) (-672.859) [-667.661] (-673.858) -- 0:01:41
620000 -- (-670.056) (-665.595) (-665.587) [-669.593] * [-661.520] (-667.148) (-673.829) (-668.415) -- 0:01:41
Average standard deviation of split frequencies: 0.005117
621000 -- (-675.814) [-666.826] (-668.484) (-667.345) * (-666.014) (-665.567) [-665.973] (-668.388) -- 0:01:41
622000 -- (-668.901) [-663.923] (-665.924) (-673.814) * (-669.776) [-666.179] (-674.426) (-663.042) -- 0:01:40
623000 -- (-669.545) (-662.968) (-669.094) [-665.798] * (-667.731) (-673.467) [-668.310] (-667.899) -- 0:01:40
624000 -- (-669.700) [-665.810] (-669.198) (-662.363) * [-669.366] (-664.269) (-667.509) (-672.747) -- 0:01:40
625000 -- (-669.118) (-664.493) [-663.985] (-667.724) * (-674.317) [-665.667] (-669.790) (-668.366) -- 0:01:40
Average standard deviation of split frequencies: 0.004875
626000 -- (-670.266) [-663.598] (-665.477) (-665.043) * (-670.302) (-666.956) [-670.444] (-673.281) -- 0:01:39
627000 -- (-671.016) (-665.089) [-661.499] (-676.259) * [-669.226] (-664.976) (-672.303) (-674.272) -- 0:01:39
628000 -- (-668.525) (-664.117) (-667.688) [-667.476] * [-670.121] (-662.668) (-667.468) (-670.158) -- 0:01:39
629000 -- (-664.671) [-658.720] (-670.144) (-666.940) * (-673.205) (-671.819) (-667.399) [-660.703] -- 0:01:39
630000 -- [-662.881] (-670.197) (-666.061) (-674.946) * [-666.289] (-669.895) (-668.846) (-666.843) -- 0:01:38
Average standard deviation of split frequencies: 0.005272
631000 -- [-673.950] (-680.740) (-661.774) (-666.252) * (-668.331) (-663.012) (-669.378) [-662.742] -- 0:01:38
632000 -- (-668.722) (-665.774) (-669.051) [-661.951] * [-666.313] (-672.002) (-670.343) (-673.415) -- 0:01:38
633000 -- (-669.685) [-663.009] (-667.244) (-667.913) * [-667.104] (-668.932) (-661.855) (-667.107) -- 0:01:37
634000 -- (-663.733) (-669.582) (-664.538) [-662.286] * (-675.995) (-662.349) (-669.643) [-674.971] -- 0:01:37
635000 -- (-671.161) (-675.952) [-676.099] (-665.353) * [-661.798] (-673.064) (-671.417) (-668.021) -- 0:01:37
Average standard deviation of split frequencies: 0.005500
636000 -- [-666.939] (-670.522) (-671.174) (-666.140) * (-671.677) (-681.447) [-668.807] (-671.627) -- 0:01:37
637000 -- (-663.695) (-670.803) [-667.364] (-682.709) * (-670.097) [-664.387] (-669.696) (-665.942) -- 0:01:36
638000 -- (-665.927) [-661.611] (-677.008) (-667.808) * (-666.147) [-664.823] (-675.335) (-673.700) -- 0:01:36
639000 -- (-670.967) [-672.854] (-672.576) (-667.438) * (-663.150) (-670.837) [-664.784] (-661.307) -- 0:01:36
640000 -- (-670.543) [-668.975] (-668.780) (-678.049) * (-659.730) [-672.364] (-670.076) (-670.197) -- 0:01:36
Average standard deviation of split frequencies: 0.005344
641000 -- (-668.020) (-672.914) (-670.583) [-666.948] * (-668.333) (-665.955) (-667.876) [-664.428] -- 0:01:35
642000 -- (-667.332) [-661.193] (-663.799) (-665.881) * (-662.601) [-665.642] (-670.094) (-663.307) -- 0:01:35
643000 -- [-663.779] (-667.842) (-664.811) (-662.478) * (-673.770) (-671.420) [-664.142] (-672.672) -- 0:01:35
644000 -- (-671.728) (-671.234) (-671.601) [-671.097] * [-669.563] (-675.153) (-664.460) (-673.459) -- 0:01:35
645000 -- (-672.780) (-663.286) [-661.374] (-664.501) * (-673.070) (-677.402) (-668.047) [-670.861] -- 0:01:34
Average standard deviation of split frequencies: 0.005300
646000 -- (-663.442) (-666.954) [-664.591] (-666.409) * [-662.106] (-666.342) (-662.370) (-671.627) -- 0:01:34
647000 -- [-665.433] (-670.548) (-667.533) (-663.595) * [-666.228] (-665.259) (-672.433) (-667.395) -- 0:01:34
648000 -- (-659.078) (-667.573) (-665.993) [-661.055] * (-664.925) (-661.177) (-673.312) [-660.918] -- 0:01:33
649000 -- (-669.896) [-663.417] (-669.296) (-661.825) * (-667.911) (-665.112) (-672.588) [-666.177] -- 0:01:33
650000 -- (-663.980) [-662.753] (-664.070) (-675.095) * (-665.992) (-662.522) [-669.700] (-668.646) -- 0:01:33
Average standard deviation of split frequencies: 0.005148
651000 -- [-664.827] (-673.971) (-659.085) (-668.569) * (-679.948) [-664.185] (-670.383) (-668.610) -- 0:01:33
652000 -- (-666.127) (-661.337) (-670.312) [-659.614] * [-666.993] (-667.880) (-663.571) (-666.510) -- 0:01:32
653000 -- (-667.341) [-662.698] (-666.708) (-667.018) * (-679.855) (-668.461) [-658.710] (-661.903) -- 0:01:32
654000 -- (-666.321) (-664.432) [-657.870] (-667.028) * [-676.207] (-670.219) (-664.953) (-673.931) -- 0:01:32
655000 -- (-665.899) (-666.328) [-664.333] (-673.208) * [-664.143] (-672.317) (-661.677) (-664.363) -- 0:01:32
Average standard deviation of split frequencies: 0.005257
656000 -- (-674.612) (-663.912) (-665.651) [-666.532] * (-666.746) (-663.904) [-662.980] (-666.148) -- 0:01:31
657000 -- (-671.079) (-666.083) (-668.061) [-661.902] * (-660.823) (-666.083) [-667.117] (-662.385) -- 0:01:31
658000 -- (-673.885) (-667.135) [-668.254] (-661.233) * (-671.177) [-669.284] (-664.396) (-664.190) -- 0:01:31
659000 -- (-664.945) (-676.691) (-663.702) [-663.069] * (-674.613) (-672.639) (-669.950) [-668.510] -- 0:01:31
660000 -- (-664.052) (-661.519) (-662.052) [-668.686] * (-663.842) (-671.155) (-670.623) [-661.465] -- 0:01:30
Average standard deviation of split frequencies: 0.005145
661000 -- (-666.819) (-662.404) [-659.575] (-668.372) * (-662.288) (-677.288) (-661.986) [-671.208] -- 0:01:30
662000 -- (-664.948) [-665.629] (-677.727) (-665.149) * [-665.636] (-664.137) (-663.744) (-676.666) -- 0:01:30
663000 -- (-672.921) (-665.250) (-667.133) [-663.915] * (-669.243) (-667.016) (-659.849) [-656.605] -- 0:01:29
664000 -- (-674.836) [-663.336] (-668.646) (-666.181) * (-660.764) (-669.790) [-665.357] (-675.078) -- 0:01:29
665000 -- (-674.280) (-666.282) (-670.549) [-663.328] * (-663.922) (-668.635) (-672.859) [-667.073] -- 0:01:29
Average standard deviation of split frequencies: 0.005364
666000 -- (-665.960) [-664.782] (-669.254) (-667.742) * (-669.340) (-668.304) (-667.513) [-659.062] -- 0:01:29
667000 -- (-666.728) (-671.931) (-667.983) [-664.136] * (-670.935) (-672.513) [-670.059] (-671.536) -- 0:01:28
668000 -- (-669.920) [-663.665] (-665.780) (-667.936) * [-663.866] (-674.582) (-670.312) (-678.311) -- 0:01:28
669000 -- (-667.126) [-664.422] (-663.064) (-664.943) * (-677.634) (-662.711) [-660.217] (-662.031) -- 0:01:28
670000 -- (-666.777) [-664.294] (-681.247) (-676.649) * (-665.779) [-670.423] (-665.771) (-674.539) -- 0:01:28
Average standard deviation of split frequencies: 0.004994
671000 -- (-670.400) [-666.539] (-668.574) (-662.840) * (-674.567) (-670.889) [-665.780] (-667.637) -- 0:01:27
672000 -- (-674.887) (-667.409) (-671.121) [-658.551] * (-665.350) [-666.635] (-664.592) (-668.050) -- 0:01:27
673000 -- (-675.964) (-673.848) [-665.584] (-667.394) * (-659.392) [-672.490] (-670.585) (-675.108) -- 0:01:26
674000 -- (-664.049) (-661.838) [-663.603] (-665.518) * (-663.667) (-673.020) [-663.071] (-666.204) -- 0:01:27
675000 -- (-668.970) [-669.019] (-673.488) (-671.769) * (-676.737) [-671.975] (-662.100) (-666.684) -- 0:01:26
Average standard deviation of split frequencies: 0.005028
676000 -- (-675.623) [-662.658] (-668.625) (-673.582) * (-679.970) (-666.008) (-671.542) [-669.844] -- 0:01:26
677000 -- (-668.167) (-673.408) (-665.537) [-667.839] * (-667.239) (-663.593) (-669.939) [-666.509] -- 0:01:26
678000 -- (-676.698) (-668.159) [-669.428] (-667.005) * (-673.781) (-671.489) (-666.769) [-667.228] -- 0:01:25
679000 -- (-674.684) [-666.539] (-668.190) (-661.751) * (-667.036) (-662.378) [-666.722] (-671.177) -- 0:01:25
680000 -- (-671.689) (-663.369) [-660.933] (-660.484) * [-663.707] (-676.074) (-659.578) (-673.316) -- 0:01:25
Average standard deviation of split frequencies: 0.004884
681000 -- (-660.918) [-672.354] (-671.284) (-662.437) * (-671.003) (-663.840) [-661.500] (-668.636) -- 0:01:25
682000 -- [-669.614] (-672.473) (-663.124) (-668.317) * (-665.436) [-669.230] (-663.882) (-671.845) -- 0:01:24
683000 -- [-671.916] (-670.371) (-676.093) (-662.114) * (-675.583) (-671.279) (-671.951) [-666.387] -- 0:01:24
684000 -- [-671.141] (-663.906) (-672.400) (-664.089) * (-669.876) [-663.416] (-667.707) (-671.656) -- 0:01:24
685000 -- (-666.626) (-665.904) (-667.044) [-666.066] * (-673.110) [-664.198] (-675.978) (-676.115) -- 0:01:24
Average standard deviation of split frequencies: 0.004991
686000 -- [-664.863] (-678.154) (-670.248) (-671.507) * [-672.363] (-673.235) (-663.331) (-670.638) -- 0:01:23
687000 -- [-662.493] (-664.224) (-665.496) (-667.065) * (-664.395) (-669.999) [-670.723] (-659.576) -- 0:01:23
688000 -- (-665.646) [-673.521] (-670.331) (-669.763) * (-667.946) (-673.220) (-675.651) [-668.808] -- 0:01:22
689000 -- (-669.036) [-659.963] (-665.804) (-664.214) * [-671.494] (-659.506) (-675.793) (-669.900) -- 0:01:23
690000 -- (-667.064) (-675.921) [-663.847] (-667.990) * (-675.855) (-662.696) (-663.971) [-668.866] -- 0:01:22
Average standard deviation of split frequencies: 0.004850
691000 -- [-661.786] (-674.891) (-672.450) (-664.333) * [-668.912] (-667.902) (-664.615) (-664.068) -- 0:01:22
692000 -- (-664.996) (-664.223) (-665.246) [-666.970] * (-670.133) (-663.462) [-663.195] (-663.785) -- 0:01:21
693000 -- (-660.493) (-664.229) [-671.077] (-684.708) * (-673.807) [-666.501] (-662.629) (-666.036) -- 0:01:21
694000 -- (-673.409) (-662.244) [-664.440] (-674.677) * (-662.628) [-667.898] (-664.553) (-665.589) -- 0:01:21
695000 -- (-670.807) [-663.255] (-671.543) (-677.961) * (-665.559) [-670.043] (-665.606) (-674.525) -- 0:01:21
Average standard deviation of split frequencies: 0.004527
696000 -- [-666.243] (-664.066) (-670.111) (-669.977) * (-666.290) (-673.724) [-662.259] (-669.366) -- 0:01:21
697000 -- [-671.418] (-661.636) (-682.630) (-673.181) * (-663.293) (-668.407) [-661.535] (-677.325) -- 0:01:20
698000 -- (-667.168) (-666.935) (-664.646) [-669.810] * (-669.037) [-662.048] (-666.809) (-679.175) -- 0:01:20
699000 -- (-667.373) [-661.129] (-668.268) (-667.151) * (-666.655) (-657.591) (-672.122) [-663.156] -- 0:01:20
700000 -- [-665.700] (-668.426) (-670.887) (-668.296) * (-665.982) (-670.961) [-669.062] (-667.978) -- 0:01:20
Average standard deviation of split frequencies: 0.004780
701000 -- [-658.793] (-669.792) (-670.697) (-665.869) * (-660.742) [-664.665] (-669.169) (-668.505) -- 0:01:19
702000 -- (-669.751) [-662.634] (-674.332) (-673.310) * (-664.956) (-667.524) [-661.940] (-666.530) -- 0:01:19
703000 -- (-670.321) (-667.623) (-662.775) [-662.427] * (-667.725) [-668.586] (-661.710) (-669.458) -- 0:01:19
704000 -- (-681.152) (-668.475) (-664.149) [-662.174] * (-661.310) (-669.828) (-668.302) [-662.679] -- 0:01:19
705000 -- (-663.847) (-671.699) [-664.828] (-675.947) * (-676.162) (-669.328) [-666.115] (-672.653) -- 0:01:18
Average standard deviation of split frequencies: 0.005141
706000 -- (-674.539) (-661.517) (-665.554) [-669.675] * (-679.412) (-667.887) (-664.081) [-668.792] -- 0:01:18
707000 -- [-663.402] (-668.817) (-675.282) (-662.911) * (-672.572) [-670.869] (-666.476) (-668.511) -- 0:01:17
708000 -- (-667.256) (-672.292) (-677.652) [-667.378] * (-671.322) (-668.473) (-665.782) [-669.569] -- 0:01:17
709000 -- (-674.234) [-667.404] (-675.951) (-667.619) * (-660.582) (-666.430) [-663.316] (-665.679) -- 0:01:17
710000 -- [-662.948] (-663.086) (-674.040) (-674.206) * (-664.915) [-668.652] (-663.347) (-667.718) -- 0:01:17
Average standard deviation of split frequencies: 0.005439
711000 -- [-661.814] (-663.480) (-671.678) (-678.441) * (-666.867) [-667.018] (-666.489) (-667.772) -- 0:01:16
712000 -- (-668.396) (-667.152) (-664.483) [-669.667] * (-668.894) (-669.328) [-662.646] (-672.184) -- 0:01:16
713000 -- [-669.029] (-673.820) (-669.057) (-686.655) * (-661.510) (-670.319) [-667.257] (-672.391) -- 0:01:16
714000 -- (-668.023) [-662.319] (-667.492) (-672.375) * (-675.581) (-672.466) (-669.091) [-662.134] -- 0:01:16
715000 -- (-663.200) (-667.749) (-672.949) [-664.340] * [-664.628] (-672.204) (-668.618) (-665.739) -- 0:01:16
Average standard deviation of split frequencies: 0.004782
716000 -- (-666.034) (-663.728) (-660.580) [-677.803] * [-669.260] (-674.692) (-672.636) (-677.758) -- 0:01:15
717000 -- [-664.487] (-675.166) (-672.583) (-672.590) * (-671.010) (-673.858) (-663.728) [-662.258] -- 0:01:15
718000 -- [-661.342] (-665.616) (-667.791) (-661.631) * (-666.279) (-674.960) [-658.646] (-662.589) -- 0:01:15
719000 -- (-664.060) (-661.802) [-667.316] (-665.957) * (-671.449) (-661.755) [-666.650] (-676.081) -- 0:01:15
720000 -- (-673.037) (-658.483) [-661.919] (-666.229) * (-672.934) (-669.322) [-665.228] (-669.261) -- 0:01:14
Average standard deviation of split frequencies: 0.004579
721000 -- (-664.735) [-667.877] (-667.043) (-667.518) * (-669.539) [-665.025] (-664.348) (-676.132) -- 0:01:14
722000 -- [-663.741] (-670.908) (-676.670) (-672.924) * (-663.448) (-664.570) (-666.462) [-668.350] -- 0:01:13
723000 -- (-665.834) (-673.509) [-661.006] (-669.028) * (-680.673) [-662.367] (-672.200) (-673.259) -- 0:01:13
724000 -- (-670.512) (-662.468) (-663.834) [-668.036] * (-665.002) (-662.924) [-668.494] (-670.029) -- 0:01:13
725000 -- (-668.998) (-662.908) (-668.841) [-662.280] * (-667.242) [-665.649] (-667.754) (-665.638) -- 0:01:13
Average standard deviation of split frequencies: 0.005649
726000 -- [-662.781] (-669.311) (-668.076) (-664.715) * [-665.708] (-671.271) (-672.341) (-682.677) -- 0:01:12
727000 -- [-669.183] (-668.097) (-666.534) (-679.447) * (-672.617) [-663.251] (-663.892) (-675.131) -- 0:01:12
728000 -- (-670.959) (-668.115) (-671.569) [-666.446] * [-670.868] (-661.284) (-665.856) (-669.110) -- 0:01:12
729000 -- [-666.181] (-673.647) (-673.904) (-674.195) * (-666.435) [-669.190] (-668.952) (-675.120) -- 0:01:12
730000 -- (-664.489) (-677.393) [-665.800] (-666.795) * [-672.131] (-665.211) (-666.074) (-659.889) -- 0:01:12
Average standard deviation of split frequencies: 0.005484
731000 -- (-666.849) (-668.757) [-671.565] (-664.665) * (-666.192) (-668.286) [-664.382] (-668.376) -- 0:01:11
732000 -- (-666.778) (-677.478) [-666.373] (-666.223) * [-667.015] (-664.080) (-662.802) (-671.427) -- 0:01:11
733000 -- (-665.493) (-680.091) (-666.410) [-666.881] * (-667.870) (-665.454) [-665.122] (-673.255) -- 0:01:11
734000 -- (-665.955) (-672.207) (-668.727) [-670.272] * (-661.721) (-668.118) (-671.196) [-666.504] -- 0:01:11
735000 -- (-664.121) [-669.272] (-663.181) (-662.383) * [-669.828] (-669.664) (-667.418) (-669.297) -- 0:01:10
Average standard deviation of split frequencies: 0.004888
736000 -- [-661.988] (-665.453) (-664.544) (-661.604) * (-659.698) [-663.039] (-661.094) (-664.423) -- 0:01:10
737000 -- (-663.080) (-672.163) [-662.853] (-670.760) * (-665.666) (-663.697) (-670.615) [-663.319] -- 0:01:09
738000 -- (-665.503) (-674.608) (-675.200) [-663.900] * [-663.002] (-673.872) (-660.183) (-671.328) -- 0:01:09
739000 -- (-658.593) (-673.216) [-661.460] (-672.869) * [-671.747] (-665.772) (-669.152) (-669.802) -- 0:01:09
740000 -- (-670.624) (-668.735) [-661.765] (-679.697) * (-664.782) (-661.687) (-670.396) [-667.630] -- 0:01:09
Average standard deviation of split frequencies: 0.004757
741000 -- [-668.594] (-666.673) (-662.323) (-665.552) * [-662.418] (-674.748) (-676.193) (-671.142) -- 0:01:08
742000 -- [-660.582] (-667.997) (-661.850) (-665.290) * [-663.534] (-671.851) (-681.769) (-665.413) -- 0:01:08
743000 -- (-669.877) (-667.614) (-668.609) [-671.395] * (-668.661) [-665.950] (-667.930) (-666.133) -- 0:01:08
744000 -- [-661.967] (-668.088) (-676.643) (-667.739) * (-664.252) [-669.268] (-662.742) (-672.148) -- 0:01:08
745000 -- (-668.155) [-664.718] (-671.071) (-666.864) * (-670.601) (-672.090) (-664.525) [-670.395] -- 0:01:08
Average standard deviation of split frequencies: 0.004789
746000 -- (-670.515) [-662.830] (-673.732) (-674.618) * (-665.202) (-666.277) [-666.164] (-675.265) -- 0:01:07
747000 -- [-664.607] (-663.778) (-669.971) (-668.449) * (-668.977) (-667.622) (-673.996) [-667.787] -- 0:01:07
748000 -- (-663.197) (-663.583) (-664.873) [-659.270] * (-670.929) [-672.027] (-665.934) (-675.842) -- 0:01:07
749000 -- (-666.913) (-668.908) (-663.411) [-663.248] * (-668.336) (-666.339) [-662.189] (-665.066) -- 0:01:07
750000 -- [-664.388] (-664.571) (-669.951) (-666.655) * (-667.327) [-671.095] (-665.579) (-667.752) -- 0:01:06
Average standard deviation of split frequencies: 0.005118
751000 -- [-664.652] (-660.669) (-664.753) (-671.578) * (-677.546) (-662.395) (-669.687) [-668.223] -- 0:01:06
752000 -- (-673.448) (-659.649) [-661.779] (-656.595) * [-661.990] (-666.353) (-664.193) (-663.886) -- 0:01:05
753000 -- (-671.066) (-669.606) (-663.765) [-670.011] * (-661.715) (-670.019) (-672.172) [-667.083] -- 0:01:05
754000 -- (-668.288) (-670.860) [-668.849] (-666.748) * [-660.840] (-666.558) (-670.259) (-667.326) -- 0:01:05
755000 -- (-665.002) (-666.145) [-661.388] (-669.566) * (-666.682) (-671.797) (-667.672) [-668.953] -- 0:01:05
Average standard deviation of split frequencies: 0.005394
756000 -- [-660.492] (-664.796) (-664.831) (-663.800) * (-669.171) [-667.445] (-669.720) (-679.381) -- 0:01:04
757000 -- (-669.913) (-671.117) [-665.923] (-663.450) * (-666.776) (-670.102) (-673.398) [-669.678] -- 0:01:04
758000 -- (-666.363) (-678.436) (-672.047) [-674.494] * [-667.823] (-669.648) (-671.685) (-678.410) -- 0:01:04
759000 -- (-666.385) (-675.449) [-663.347] (-666.009) * (-667.657) (-665.447) [-661.622] (-669.544) -- 0:01:04
760000 -- (-667.540) [-669.392] (-663.821) (-664.318) * [-668.801] (-670.500) (-663.807) (-668.215) -- 0:01:03
Average standard deviation of split frequencies: 0.005609
761000 -- [-666.109] (-671.127) (-665.762) (-677.817) * [-670.273] (-664.325) (-669.747) (-670.096) -- 0:01:03
762000 -- (-667.312) (-664.373) [-664.815] (-672.759) * (-677.833) [-668.121] (-669.612) (-666.707) -- 0:01:03
763000 -- (-666.494) (-670.973) [-662.977] (-666.155) * (-668.670) [-665.412] (-666.544) (-664.676) -- 0:01:03
764000 -- (-675.375) (-668.585) [-667.472] (-671.297) * (-671.688) (-665.554) [-664.759] (-675.361) -- 0:01:03
765000 -- (-669.563) (-666.718) [-663.333] (-671.248) * [-669.149] (-663.137) (-666.269) (-667.683) -- 0:01:02
Average standard deviation of split frequencies: 0.005693
766000 -- (-663.012) (-660.835) (-674.700) [-665.836] * (-675.900) (-673.886) (-662.920) [-666.051] -- 0:01:02
767000 -- (-670.147) (-668.899) (-667.329) [-669.573] * (-671.148) [-667.164] (-666.924) (-665.811) -- 0:01:01
768000 -- (-672.370) (-665.701) (-664.977) [-665.554] * [-663.978] (-672.523) (-661.834) (-675.880) -- 0:01:01
769000 -- (-677.422) [-669.538] (-671.681) (-668.217) * [-668.645] (-661.002) (-666.808) (-662.736) -- 0:01:01
770000 -- (-670.386) [-675.033] (-662.869) (-677.580) * (-671.873) [-663.000] (-674.110) (-668.059) -- 0:01:01
Average standard deviation of split frequencies: 0.005627
771000 -- (-667.500) (-669.720) (-666.199) [-665.745] * (-668.825) (-668.919) [-660.113] (-661.633) -- 0:01:00
772000 -- (-669.053) [-664.616] (-667.537) (-672.839) * [-671.109] (-661.419) (-665.138) (-668.942) -- 0:01:00
773000 -- (-668.237) [-663.300] (-672.830) (-669.397) * (-660.776) (-665.592) (-682.106) [-665.950] -- 0:01:00
774000 -- [-671.646] (-671.536) (-673.890) (-671.557) * [-667.256] (-662.528) (-668.795) (-660.184) -- 0:01:00
775000 -- [-678.777] (-668.520) (-664.093) (-673.722) * [-664.257] (-668.651) (-674.895) (-662.266) -- 0:00:59
Average standard deviation of split frequencies: 0.005680
776000 -- [-661.082] (-670.593) (-675.098) (-662.630) * (-671.964) [-665.995] (-661.674) (-668.386) -- 0:00:59
777000 -- (-673.156) (-666.614) (-665.169) [-670.076] * (-669.058) (-660.300) [-666.011] (-672.877) -- 0:00:59
778000 -- [-662.619] (-668.910) (-665.729) (-673.729) * (-670.344) (-661.994) (-668.236) [-665.948] -- 0:00:59
779000 -- (-660.682) [-661.554] (-675.961) (-670.849) * (-673.485) [-665.722] (-665.511) (-667.864) -- 0:00:59
780000 -- (-663.460) [-666.178] (-679.478) (-669.537) * (-661.966) (-670.754) [-663.584] (-668.235) -- 0:00:58
Average standard deviation of split frequencies: 0.005223
781000 -- [-664.964] (-676.757) (-674.936) (-664.409) * (-665.784) (-674.297) [-661.719] (-666.106) -- 0:00:58
782000 -- (-660.521) [-668.694] (-669.640) (-666.644) * (-669.073) (-664.274) (-667.769) [-671.222] -- 0:00:57
783000 -- [-665.751] (-666.673) (-669.495) (-665.499) * (-668.740) (-666.735) (-659.856) [-666.605] -- 0:00:57
784000 -- (-664.254) (-675.627) [-666.883] (-666.572) * (-669.280) [-663.367] (-673.925) (-665.175) -- 0:00:57
785000 -- (-673.138) [-664.014] (-673.869) (-673.712) * (-665.437) (-667.385) (-670.206) [-669.163] -- 0:00:57
Average standard deviation of split frequencies: 0.005428
786000 -- [-663.648] (-672.331) (-665.881) (-672.319) * (-669.980) [-675.202] (-667.068) (-667.097) -- 0:00:56
787000 -- (-662.946) (-667.503) [-666.081] (-665.767) * (-668.167) [-669.374] (-672.749) (-672.120) -- 0:00:56
788000 -- [-671.267] (-670.392) (-670.185) (-674.982) * [-664.652] (-663.534) (-670.376) (-670.959) -- 0:00:56
789000 -- (-671.265) (-669.735) (-668.902) [-664.594] * (-669.678) (-662.827) (-668.716) [-662.582] -- 0:00:56
790000 -- [-667.775] (-668.073) (-672.651) (-669.039) * [-665.775] (-674.748) (-663.654) (-671.653) -- 0:00:56
Average standard deviation of split frequencies: 0.005664
791000 -- (-666.637) (-665.520) [-663.112] (-669.310) * (-668.120) [-666.141] (-667.260) (-663.901) -- 0:00:55
792000 -- (-668.046) (-658.636) [-671.158] (-669.697) * [-667.435] (-671.135) (-673.257) (-671.043) -- 0:00:55
793000 -- [-670.099] (-667.084) (-672.678) (-671.436) * [-666.130] (-668.422) (-668.891) (-663.690) -- 0:00:55
794000 -- (-671.341) (-660.084) [-662.816] (-666.756) * [-663.377] (-664.389) (-661.780) (-672.113) -- 0:00:55
795000 -- (-665.943) (-668.446) [-663.827] (-676.307) * [-669.716] (-663.663) (-667.071) (-673.090) -- 0:00:54
Average standard deviation of split frequencies: 0.005656
796000 -- (-672.176) (-674.126) [-666.916] (-673.178) * (-669.911) (-663.137) [-664.819] (-670.119) -- 0:00:54
797000 -- (-669.222) [-663.080] (-665.621) (-664.006) * (-672.508) (-671.192) (-671.113) [-666.536] -- 0:00:53
798000 -- [-668.392] (-665.316) (-665.131) (-666.463) * (-671.280) (-664.341) [-658.498] (-666.045) -- 0:00:53
799000 -- [-668.900] (-658.597) (-673.037) (-667.207) * (-664.104) (-668.622) (-663.224) [-670.340] -- 0:00:53
800000 -- (-668.521) [-664.341] (-683.953) (-667.347) * (-670.226) (-665.790) (-663.819) [-663.849] -- 0:00:53
Average standard deviation of split frequencies: 0.005505
801000 -- [-658.229] (-666.306) (-664.432) (-669.079) * [-668.174] (-666.009) (-675.618) (-665.804) -- 0:00:53
802000 -- (-672.028) (-660.935) [-661.583] (-668.484) * (-661.211) (-666.975) [-663.033] (-665.143) -- 0:00:52
803000 -- (-662.355) [-666.368] (-668.494) (-679.943) * (-666.741) [-659.368] (-662.624) (-662.621) -- 0:00:52
804000 -- (-679.831) (-668.454) [-660.686] (-674.404) * [-665.066] (-672.027) (-669.418) (-663.841) -- 0:00:52
805000 -- (-669.143) [-669.085] (-672.166) (-669.572) * (-670.408) (-675.340) [-666.404] (-664.687) -- 0:00:52
Average standard deviation of split frequencies: 0.005410
806000 -- (-673.438) [-661.655] (-669.153) (-668.473) * (-663.166) (-672.153) [-665.739] (-663.833) -- 0:00:51
807000 -- [-667.123] (-668.208) (-668.295) (-664.464) * (-670.756) (-664.193) [-667.360] (-673.078) -- 0:00:51
808000 -- [-668.902] (-668.408) (-663.990) (-666.057) * (-670.861) (-669.745) (-664.270) [-668.359] -- 0:00:51
809000 -- [-664.409] (-666.731) (-667.830) (-664.586) * (-665.818) (-673.522) [-661.998] (-669.494) -- 0:00:50
810000 -- [-665.112] (-667.195) (-669.170) (-665.531) * (-673.145) (-673.760) (-664.970) [-670.460] -- 0:00:50
Average standard deviation of split frequencies: 0.005379
811000 -- (-662.177) (-677.412) [-664.385] (-661.271) * (-673.718) (-666.556) [-670.874] (-665.459) -- 0:00:50
812000 -- [-665.266] (-667.108) (-669.212) (-669.847) * (-666.965) [-666.138] (-662.294) (-665.965) -- 0:00:50
813000 -- [-661.922] (-663.865) (-674.192) (-664.442) * (-661.345) [-662.285] (-663.924) (-670.634) -- 0:00:49
814000 -- (-661.752) (-668.003) (-673.704) [-664.764] * (-667.421) (-664.209) (-658.392) [-666.522] -- 0:00:49
815000 -- [-663.512] (-666.198) (-663.132) (-665.742) * (-663.592) [-664.249] (-667.015) (-658.606) -- 0:00:49
Average standard deviation of split frequencies: 0.005373
816000 -- [-662.018] (-661.823) (-673.876) (-667.361) * (-662.501) (-669.515) (-665.118) [-665.250] -- 0:00:49
817000 -- (-666.072) [-664.987] (-665.567) (-676.174) * (-667.845) (-677.585) [-673.672] (-664.659) -- 0:00:48
818000 -- (-666.608) (-671.958) [-662.152] (-676.282) * (-675.070) (-669.654) [-665.871] (-660.416) -- 0:00:48
819000 -- (-676.952) (-674.741) (-672.087) [-660.580] * (-671.489) [-665.942] (-669.054) (-662.886) -- 0:00:48
820000 -- (-665.723) (-671.494) [-665.232] (-672.522) * [-666.043] (-670.576) (-674.292) (-663.477) -- 0:00:48
Average standard deviation of split frequencies: 0.005285
821000 -- (-662.083) [-661.580] (-668.240) (-662.607) * (-662.210) (-673.324) (-663.790) [-665.186] -- 0:00:47
822000 -- (-666.237) (-665.949) (-666.034) [-667.534] * [-667.162] (-669.232) (-669.003) (-668.380) -- 0:00:47
823000 -- [-659.409] (-675.726) (-673.009) (-671.484) * [-668.074] (-677.465) (-663.918) (-670.560) -- 0:00:47
824000 -- [-660.676] (-670.949) (-670.559) (-663.375) * [-667.143] (-665.390) (-670.379) (-669.448) -- 0:00:46
825000 -- [-666.828] (-670.774) (-663.354) (-678.346) * [-668.053] (-664.511) (-677.554) (-673.735) -- 0:00:46
Average standard deviation of split frequencies: 0.005279
826000 -- [-671.768] (-668.803) (-666.190) (-671.820) * (-668.283) (-670.415) [-664.663] (-666.601) -- 0:00:46
827000 -- [-670.412] (-664.623) (-667.662) (-665.059) * (-659.024) (-669.912) [-667.685] (-677.168) -- 0:00:46
828000 -- (-665.144) (-669.195) [-665.215] (-670.489) * [-661.039] (-675.008) (-674.048) (-669.860) -- 0:00:45
829000 -- (-672.814) (-666.351) (-673.258) [-664.847] * (-667.598) [-665.879] (-668.541) (-676.362) -- 0:00:45
830000 -- [-666.469] (-677.502) (-664.281) (-669.594) * [-665.154] (-677.862) (-662.696) (-674.505) -- 0:00:45
Average standard deviation of split frequencies: 0.005051
831000 -- (-664.476) (-664.282) (-664.460) [-660.525] * (-668.026) (-677.999) (-667.278) [-665.222] -- 0:00:45
832000 -- [-670.533] (-662.644) (-677.830) (-667.411) * (-671.526) (-673.168) [-669.016] (-667.278) -- 0:00:44
833000 -- [-663.341] (-657.879) (-673.503) (-666.560) * (-662.907) (-679.310) [-661.840] (-668.082) -- 0:00:44
834000 -- (-671.573) [-663.201] (-677.414) (-668.458) * [-659.978] (-664.808) (-676.787) (-668.529) -- 0:00:44
835000 -- (-678.142) [-663.571] (-674.386) (-664.336) * (-675.008) (-666.767) (-673.073) [-662.644] -- 0:00:44
Average standard deviation of split frequencies: 0.004990
836000 -- (-672.317) (-666.713) (-672.900) [-666.306] * [-663.978] (-665.949) (-673.212) (-673.094) -- 0:00:43
837000 -- (-671.245) (-665.275) [-666.652] (-669.543) * (-666.135) [-669.145] (-669.169) (-666.364) -- 0:00:43
838000 -- (-664.618) [-662.140] (-669.665) (-663.600) * (-662.508) (-665.818) (-673.295) [-664.516] -- 0:00:43
839000 -- (-660.660) (-661.181) [-664.121] (-669.462) * [-665.055] (-671.219) (-670.775) (-668.367) -- 0:00:42
840000 -- [-669.131] (-667.995) (-672.161) (-667.931) * (-670.249) [-666.015] (-670.511) (-664.912) -- 0:00:42
Average standard deviation of split frequencies: 0.005047
841000 -- (-664.751) (-661.234) [-665.617] (-666.431) * (-668.319) (-672.636) [-660.772] (-671.849) -- 0:00:42
842000 -- (-675.058) (-667.889) [-664.882] (-671.423) * [-675.806] (-665.299) (-660.322) (-667.330) -- 0:00:42
843000 -- (-658.544) [-660.741] (-672.950) (-668.106) * (-676.579) [-662.064] (-668.354) (-666.252) -- 0:00:41
844000 -- (-660.365) (-667.286) [-665.936] (-673.006) * (-666.169) [-665.613] (-671.431) (-668.743) -- 0:00:41
845000 -- (-663.631) [-665.863] (-665.628) (-663.390) * (-666.802) (-675.282) [-660.388] (-666.066) -- 0:00:41
Average standard deviation of split frequencies: 0.004597
846000 -- (-670.580) [-663.785] (-670.291) (-670.698) * (-662.392) (-663.450) (-674.006) [-666.220] -- 0:00:41
847000 -- (-677.215) (-666.401) [-659.847] (-670.338) * [-668.109] (-666.954) (-669.073) (-668.661) -- 0:00:40
848000 -- [-666.218] (-669.217) (-669.674) (-677.824) * (-670.041) (-668.011) (-671.281) [-661.860] -- 0:00:40
849000 -- [-672.428] (-673.157) (-665.400) (-671.062) * (-666.254) [-659.813] (-663.094) (-671.483) -- 0:00:40
850000 -- (-677.425) (-660.091) (-675.695) [-670.209] * [-660.896] (-665.788) (-671.049) (-676.618) -- 0:00:40
Average standard deviation of split frequencies: 0.004378
851000 -- (-671.264) (-667.117) [-668.910] (-680.102) * (-668.225) [-663.132] (-676.300) (-665.226) -- 0:00:39
852000 -- (-669.389) (-670.753) [-661.309] (-663.928) * (-668.538) (-678.465) [-678.194] (-667.137) -- 0:00:39
853000 -- [-663.929] (-660.531) (-668.810) (-663.993) * (-660.083) (-665.663) [-668.788] (-662.824) -- 0:00:39
854000 -- (-663.812) (-677.239) (-667.758) [-663.150] * [-662.794] (-665.985) (-667.703) (-668.966) -- 0:00:38
855000 -- [-682.280] (-668.742) (-673.936) (-665.436) * (-664.078) (-672.101) (-672.380) [-668.488] -- 0:00:38
Average standard deviation of split frequencies: 0.004461
856000 -- [-670.467] (-670.292) (-672.692) (-668.678) * (-677.369) [-666.913] (-660.769) (-670.633) -- 0:00:38
857000 -- (-666.474) (-666.788) [-672.006] (-670.111) * (-667.124) (-662.053) (-673.079) [-662.794] -- 0:00:38
858000 -- (-673.017) [-663.478] (-670.766) (-668.268) * (-672.867) [-663.685] (-673.414) (-672.625) -- 0:00:37
859000 -- (-662.188) (-669.972) (-673.084) [-665.994] * (-663.569) [-663.324] (-669.476) (-667.218) -- 0:00:37
860000 -- [-667.438] (-671.536) (-676.640) (-662.069) * (-673.168) (-671.833) (-667.435) [-669.877] -- 0:00:37
Average standard deviation of split frequencies: 0.004163
861000 -- (-666.725) (-667.401) [-666.252] (-674.389) * [-664.281] (-670.971) (-668.690) (-666.454) -- 0:00:37
862000 -- [-667.816] (-675.632) (-661.543) (-665.592) * (-669.185) (-662.100) (-662.218) [-667.086] -- 0:00:36
863000 -- (-671.329) (-661.259) (-668.307) [-666.887] * (-671.466) (-669.955) (-669.168) [-663.170] -- 0:00:36
864000 -- (-663.927) (-674.072) (-670.798) [-665.671] * [-669.787] (-669.180) (-667.949) (-664.794) -- 0:00:36
865000 -- (-669.246) [-665.638] (-665.624) (-671.465) * (-662.057) [-671.782] (-667.147) (-666.090) -- 0:00:36
Average standard deviation of split frequencies: 0.004191
866000 -- [-671.932] (-665.398) (-670.767) (-671.371) * (-671.441) (-665.936) [-662.107] (-669.529) -- 0:00:35
867000 -- [-675.489] (-667.295) (-671.172) (-665.371) * (-670.771) (-669.601) [-671.960] (-676.812) -- 0:00:35
868000 -- [-672.285] (-669.531) (-663.962) (-672.549) * (-671.237) (-669.467) (-670.191) [-667.427] -- 0:00:35
869000 -- (-671.241) [-661.140] (-669.655) (-668.170) * (-675.857) (-669.443) [-660.255] (-662.685) -- 0:00:34
870000 -- (-662.028) (-664.941) [-664.377] (-668.802) * [-670.585] (-677.151) (-662.775) (-666.944) -- 0:00:34
Average standard deviation of split frequencies: 0.004115
871000 -- (-675.294) [-666.330] (-662.535) (-669.482) * [-662.785] (-678.225) (-671.812) (-670.873) -- 0:00:34
872000 -- [-658.227] (-671.722) (-675.994) (-665.840) * (-664.971) (-670.996) (-668.654) [-667.329] -- 0:00:34
873000 -- (-665.573) (-663.028) [-668.504] (-670.171) * [-667.995] (-666.795) (-664.375) (-666.378) -- 0:00:33
874000 -- [-662.237] (-669.813) (-666.886) (-668.154) * [-664.897] (-675.461) (-665.019) (-662.925) -- 0:00:33
875000 -- (-667.499) [-665.715] (-663.835) (-669.494) * [-666.752] (-678.798) (-664.695) (-659.806) -- 0:00:33
Average standard deviation of split frequencies: 0.003852
876000 -- (-663.765) (-662.623) [-661.403] (-664.923) * [-662.141] (-664.221) (-667.784) (-669.058) -- 0:00:33
877000 -- (-672.992) (-679.571) [-664.643] (-669.901) * (-661.494) (-669.918) (-663.222) [-663.338] -- 0:00:32
878000 -- (-662.791) [-663.978] (-666.591) (-666.064) * (-670.979) (-675.167) (-669.211) [-666.510] -- 0:00:32
879000 -- (-668.561) (-672.861) [-659.723] (-668.775) * (-670.849) (-664.945) (-668.123) [-663.606] -- 0:00:32
880000 -- [-668.592] (-667.742) (-672.505) (-669.727) * (-664.368) [-671.501] (-672.057) (-665.406) -- 0:00:32
Average standard deviation of split frequencies: 0.003944
881000 -- [-668.814] (-664.667) (-665.583) (-665.995) * (-671.575) (-678.455) [-661.245] (-664.382) -- 0:00:31
882000 -- (-666.399) (-672.819) (-675.336) [-667.681] * (-664.083) [-668.467] (-669.035) (-667.773) -- 0:00:31
883000 -- (-664.409) (-668.080) [-665.787] (-667.647) * (-664.477) (-670.688) (-667.913) [-666.188] -- 0:00:31
884000 -- (-668.301) (-670.486) (-664.424) [-661.963] * (-667.674) (-667.261) [-674.423] (-681.481) -- 0:00:30
885000 -- (-671.115) (-678.421) (-663.515) [-659.084] * (-670.853) (-663.803) [-668.148] (-671.062) -- 0:00:30
Average standard deviation of split frequencies: 0.004656
886000 -- [-667.953] (-669.788) (-670.265) (-667.344) * (-674.966) (-669.807) [-662.644] (-681.154) -- 0:00:30
887000 -- (-669.139) [-672.287] (-676.877) (-670.078) * [-661.187] (-664.701) (-665.294) (-670.297) -- 0:00:30
888000 -- [-670.575] (-671.751) (-671.307) (-666.708) * (-665.590) [-665.748] (-663.441) (-666.052) -- 0:00:29
889000 -- (-664.843) [-667.853] (-672.300) (-665.143) * [-669.092] (-669.360) (-668.286) (-666.668) -- 0:00:29
890000 -- (-669.960) [-661.945] (-667.478) (-670.997) * (-667.202) (-669.153) (-667.862) [-668.484] -- 0:00:29
Average standard deviation of split frequencies: 0.004373
891000 -- [-664.457] (-669.530) (-665.604) (-677.224) * (-671.002) (-665.754) (-667.574) [-662.992] -- 0:00:29
892000 -- [-666.805] (-658.204) (-663.001) (-672.109) * (-663.754) [-662.958] (-666.448) (-664.446) -- 0:00:28
893000 -- [-660.683] (-674.325) (-670.717) (-666.823) * (-662.024) (-665.225) [-669.959] (-674.513) -- 0:00:28
894000 -- (-662.550) [-665.069] (-666.397) (-667.803) * (-667.438) (-671.038) [-663.591] (-673.457) -- 0:00:28
895000 -- (-662.957) [-663.712] (-667.354) (-677.341) * (-663.320) [-672.419] (-668.733) (-676.574) -- 0:00:28
Average standard deviation of split frequencies: 0.004788
896000 -- (-667.492) (-666.286) [-668.498] (-667.904) * [-661.939] (-665.822) (-662.082) (-662.256) -- 0:00:27
897000 -- (-671.308) (-664.146) [-671.072] (-676.019) * (-660.462) (-670.025) [-679.965] (-679.150) -- 0:00:27
898000 -- (-669.496) (-669.365) (-670.461) [-663.211] * (-676.239) (-667.987) [-660.336] (-666.170) -- 0:00:27
899000 -- (-665.208) [-663.897] (-666.833) (-666.232) * [-665.895] (-680.391) (-670.567) (-669.705) -- 0:00:26
900000 -- (-662.562) [-667.790] (-668.909) (-665.707) * [-671.674] (-671.323) (-665.121) (-667.219) -- 0:00:26
Average standard deviation of split frequencies: 0.004946
901000 -- (-668.788) [-667.906] (-662.986) (-667.484) * (-675.999) [-663.555] (-670.156) (-669.668) -- 0:00:26
902000 -- (-674.966) (-670.050) (-673.343) [-669.719] * (-669.727) [-664.931] (-671.244) (-665.597) -- 0:00:26
903000 -- (-673.267) (-670.105) [-672.149] (-668.370) * (-662.583) (-667.779) [-662.234] (-666.963) -- 0:00:25
904000 -- (-678.756) (-668.319) [-661.196] (-668.818) * (-664.922) (-672.017) (-662.107) [-666.350] -- 0:00:25
905000 -- (-669.541) [-665.507] (-661.661) (-665.739) * (-659.581) [-667.475] (-666.403) (-670.128) -- 0:00:25
Average standard deviation of split frequencies: 0.004787
906000 -- (-674.248) (-669.216) [-673.902] (-672.746) * (-668.632) (-666.573) (-663.858) [-664.932] -- 0:00:25
907000 -- [-667.014] (-670.583) (-667.868) (-666.366) * [-666.129] (-663.245) (-670.043) (-667.258) -- 0:00:24
908000 -- (-667.026) (-672.348) [-664.890] (-666.113) * [-662.252] (-674.722) (-661.047) (-673.570) -- 0:00:24
909000 -- (-668.218) [-658.674] (-672.133) (-669.504) * [-667.110] (-664.611) (-666.634) (-674.944) -- 0:00:24
910000 -- [-663.728] (-668.622) (-669.236) (-673.349) * (-675.328) (-666.297) (-667.364) [-666.347] -- 0:00:24
Average standard deviation of split frequencies: 0.004633
911000 -- (-671.631) (-671.600) (-664.087) [-670.328] * (-668.430) (-679.313) [-664.543] (-661.858) -- 0:00:23
912000 -- (-668.002) (-662.054) (-674.228) [-664.873] * (-670.758) (-668.008) [-666.782] (-677.400) -- 0:00:23
913000 -- [-666.349] (-662.208) (-667.820) (-669.571) * (-668.758) (-674.295) [-669.128] (-668.687) -- 0:00:23
914000 -- (-670.110) [-675.288] (-664.545) (-668.013) * (-667.896) (-669.967) [-667.966] (-664.722) -- 0:00:22
915000 -- (-668.734) (-670.667) [-667.144] (-669.896) * (-663.564) (-671.192) (-662.912) [-663.389] -- 0:00:22
Average standard deviation of split frequencies: 0.004415
916000 -- (-665.282) [-664.638] (-660.640) (-661.389) * (-665.249) (-666.524) (-668.564) [-665.874] -- 0:00:22
917000 -- (-671.272) (-670.841) [-662.145] (-669.445) * (-669.894) (-668.067) [-664.469] (-671.294) -- 0:00:22
918000 -- (-669.750) [-664.467] (-673.047) (-669.464) * (-672.482) (-663.754) [-663.411] (-668.012) -- 0:00:21
919000 -- (-662.488) [-662.847] (-667.903) (-670.807) * (-668.169) [-662.777] (-661.317) (-663.673) -- 0:00:21
920000 -- [-663.521] (-671.455) (-667.991) (-669.913) * [-662.802] (-664.108) (-675.142) (-668.017) -- 0:00:21
Average standard deviation of split frequencies: 0.004339
921000 -- (-670.418) (-665.538) [-662.132] (-671.710) * (-661.919) (-671.686) (-658.177) [-664.514] -- 0:00:21
922000 -- (-668.140) [-663.074] (-666.214) (-665.564) * [-658.847] (-673.502) (-666.916) (-661.280) -- 0:00:20
923000 -- (-668.271) (-677.035) [-659.778] (-671.183) * (-671.207) (-668.958) [-665.143] (-667.543) -- 0:00:20
924000 -- (-668.859) (-662.054) [-670.774] (-663.470) * (-678.054) (-669.588) [-664.453] (-675.164) -- 0:00:20
925000 -- (-680.491) (-662.256) (-673.357) [-666.316] * (-665.869) (-670.723) [-666.724] (-674.861) -- 0:00:20
Average standard deviation of split frequencies: 0.004475
926000 -- (-669.878) (-662.973) (-669.109) [-663.727] * [-666.965] (-662.560) (-668.292) (-663.675) -- 0:00:19
927000 -- (-664.852) (-657.866) (-660.276) [-662.522] * (-669.015) [-665.120] (-669.984) (-663.778) -- 0:00:19
928000 -- (-668.339) [-663.797] (-669.333) (-665.142) * (-663.985) (-666.163) (-685.703) [-662.602] -- 0:00:19
929000 -- (-672.481) [-663.074] (-673.825) (-673.226) * (-670.028) (-663.668) [-671.951] (-665.935) -- 0:00:18
930000 -- (-669.926) (-666.659) (-672.749) [-669.055] * (-676.382) [-668.389] (-666.641) (-664.866) -- 0:00:18
Average standard deviation of split frequencies: 0.004239
931000 -- (-667.479) (-665.825) [-662.538] (-670.777) * [-661.531] (-668.420) (-672.298) (-670.083) -- 0:00:18
932000 -- (-668.590) (-666.185) [-664.704] (-669.233) * (-670.560) (-663.360) [-666.122] (-674.373) -- 0:00:18
933000 -- (-667.238) (-663.062) [-665.526] (-672.381) * (-672.586) [-667.800] (-673.777) (-667.856) -- 0:00:17
934000 -- (-681.360) (-665.112) [-666.600] (-668.246) * (-670.782) [-668.591] (-668.851) (-667.017) -- 0:00:17
935000 -- [-664.129] (-667.103) (-675.950) (-668.982) * (-665.357) (-672.576) (-664.366) [-664.341] -- 0:00:17
Average standard deviation of split frequencies: 0.004162
936000 -- (-668.959) [-662.910] (-669.400) (-670.110) * [-666.458] (-662.063) (-663.022) (-662.789) -- 0:00:17
937000 -- (-663.896) [-664.694] (-666.657) (-673.314) * (-666.349) [-665.936] (-666.494) (-669.815) -- 0:00:16
938000 -- (-668.479) (-666.821) (-666.922) [-663.699] * (-671.860) (-668.322) (-664.290) [-669.940] -- 0:00:16
939000 -- (-666.711) (-665.961) (-672.959) [-663.792] * [-663.936] (-669.431) (-663.582) (-674.726) -- 0:00:16
940000 -- [-661.732] (-672.733) (-665.121) (-668.641) * (-665.894) [-669.195] (-672.031) (-674.625) -- 0:00:16
Average standard deviation of split frequencies: 0.004088
941000 -- (-662.932) (-670.734) (-661.697) [-663.883] * [-667.161] (-666.012) (-671.643) (-672.739) -- 0:00:15
942000 -- (-664.316) (-665.976) [-670.357] (-664.472) * (-667.193) (-664.038) [-668.524] (-667.070) -- 0:00:15
943000 -- (-666.241) (-663.927) [-662.861] (-665.122) * [-675.508] (-662.009) (-670.362) (-673.559) -- 0:00:15
944000 -- (-675.981) (-670.529) [-667.568] (-667.054) * (-667.258) (-670.484) [-666.194] (-664.302) -- 0:00:14
945000 -- (-664.346) (-664.832) [-660.140] (-677.263) * [-665.986] (-660.623) (-661.984) (-664.485) -- 0:00:14
Average standard deviation of split frequencies: 0.004144
946000 -- (-662.633) [-660.304] (-665.682) (-670.770) * (-670.214) (-668.810) [-658.882] (-666.419) -- 0:00:14
947000 -- (-662.670) (-676.683) (-670.124) [-667.666] * (-665.809) (-669.172) (-672.192) [-663.021] -- 0:00:14
948000 -- (-666.711) (-672.544) [-668.396] (-669.486) * [-663.482] (-665.594) (-668.282) (-663.729) -- 0:00:13
949000 -- (-662.310) [-664.511] (-668.300) (-669.771) * (-667.354) (-667.959) [-665.192] (-676.749) -- 0:00:13
950000 -- (-663.133) (-667.892) [-664.268] (-672.246) * [-663.863] (-664.049) (-666.959) (-669.487) -- 0:00:13
Average standard deviation of split frequencies: 0.004306
951000 -- (-666.707) [-663.755] (-669.329) (-675.809) * (-672.286) [-665.789] (-669.255) (-666.962) -- 0:00:13
952000 -- (-671.165) [-666.424] (-664.421) (-667.779) * [-660.870] (-670.797) (-669.730) (-666.710) -- 0:00:12
953000 -- [-665.123] (-666.807) (-672.822) (-674.294) * (-672.955) (-665.258) (-667.773) [-664.896] -- 0:00:12
954000 -- (-665.546) (-671.333) (-674.089) [-668.531] * [-678.421] (-657.806) (-669.238) (-665.744) -- 0:00:12
955000 -- [-666.558] (-670.484) (-666.834) (-671.682) * [-671.778] (-668.071) (-663.181) (-665.456) -- 0:00:12
Average standard deviation of split frequencies: 0.004126
956000 -- (-668.776) [-676.954] (-669.375) (-671.996) * (-660.559) (-671.694) [-663.152] (-668.721) -- 0:00:11
957000 -- [-662.628] (-678.559) (-677.527) (-681.091) * [-667.653] (-666.998) (-670.086) (-671.464) -- 0:00:11
958000 -- (-667.140) (-667.838) (-668.250) [-660.913] * (-673.099) (-665.406) [-666.501] (-674.855) -- 0:00:11
959000 -- (-663.708) (-664.867) [-667.805] (-671.107) * [-662.667] (-672.506) (-669.142) (-676.014) -- 0:00:10
960000 -- [-668.636] (-675.121) (-664.540) (-665.428) * (-671.771) (-670.551) [-665.369] (-667.700) -- 0:00:10
Average standard deviation of split frequencies: 0.004132
961000 -- (-672.380) (-670.262) (-666.870) [-663.120] * (-664.959) (-669.325) [-666.488] (-667.470) -- 0:00:10
962000 -- (-662.200) (-668.864) [-665.446] (-675.912) * [-665.700] (-674.265) (-670.862) (-678.243) -- 0:00:10
963000 -- (-671.666) [-669.312] (-659.308) (-674.406) * (-668.431) (-672.224) (-670.935) [-670.175] -- 0:00:09
964000 -- [-662.668] (-668.796) (-665.194) (-678.528) * [-662.055] (-667.764) (-670.892) (-675.835) -- 0:00:09
965000 -- (-667.659) [-665.260] (-660.074) (-672.444) * (-661.705) (-667.695) (-667.743) [-668.496] -- 0:00:09
Average standard deviation of split frequencies: 0.004135
966000 -- (-663.803) [-662.044] (-667.920) (-667.581) * (-667.475) [-667.327] (-670.679) (-663.745) -- 0:00:09
967000 -- (-668.524) [-670.926] (-674.607) (-667.750) * [-662.171] (-679.148) (-666.687) (-666.997) -- 0:00:08
968000 -- (-671.217) [-662.589] (-666.040) (-676.324) * [-660.009] (-671.070) (-668.878) (-668.549) -- 0:00:08
969000 -- (-668.683) (-668.274) [-662.792] (-661.501) * (-671.132) (-665.077) (-666.881) [-667.577] -- 0:00:08
970000 -- (-666.798) [-664.093] (-666.807) (-671.927) * (-665.701) (-663.198) (-671.070) [-669.631] -- 0:00:08
Average standard deviation of split frequencies: 0.004166
971000 -- (-669.970) (-663.863) (-659.894) [-666.084] * [-664.661] (-673.576) (-663.338) (-659.315) -- 0:00:07
972000 -- [-670.390] (-668.415) (-662.259) (-670.530) * [-664.073] (-669.700) (-665.002) (-673.940) -- 0:00:07
973000 -- [-660.249] (-667.902) (-664.593) (-670.000) * [-673.478] (-664.131) (-668.746) (-671.695) -- 0:00:07
974000 -- (-666.490) (-664.948) [-669.626] (-665.223) * (-663.673) (-672.840) [-666.185] (-672.665) -- 0:00:06
975000 -- [-666.958] (-665.904) (-682.221) (-665.467) * [-665.648] (-667.852) (-667.552) (-677.353) -- 0:00:06
Average standard deviation of split frequencies: 0.004245
976000 -- (-665.817) (-664.490) [-668.263] (-669.854) * (-665.796) [-665.672] (-667.991) (-668.128) -- 0:00:06
977000 -- (-667.971) (-665.478) (-667.196) [-667.246] * (-675.146) (-664.420) [-668.881] (-670.576) -- 0:00:06
978000 -- (-673.741) (-664.008) [-662.627] (-670.440) * [-665.462] (-669.073) (-669.869) (-670.867) -- 0:00:05
979000 -- (-663.686) (-667.427) (-670.193) [-665.648] * (-673.568) (-668.191) (-665.585) [-666.257] -- 0:00:05
980000 -- (-667.718) (-669.942) (-667.746) [-667.777] * (-676.029) (-670.771) (-667.693) [-668.990] -- 0:00:05
Average standard deviation of split frequencies: 0.004326
981000 -- (-667.824) (-670.571) [-659.656] (-679.927) * [-663.477] (-682.006) (-666.404) (-675.769) -- 0:00:05
982000 -- (-668.196) [-666.069] (-674.664) (-666.541) * (-668.539) (-665.365) (-662.512) [-663.933] -- 0:00:04
983000 -- [-664.018] (-665.809) (-664.629) (-664.378) * (-671.868) (-660.579) [-663.939] (-663.151) -- 0:00:04
984000 -- (-675.168) (-662.780) [-668.015] (-667.581) * (-667.538) (-665.616) [-664.194] (-671.112) -- 0:00:04
985000 -- [-664.614] (-666.659) (-662.160) (-671.241) * (-664.336) [-662.887] (-670.068) (-662.796) -- 0:00:04
Average standard deviation of split frequencies: 0.004177
986000 -- (-669.210) (-666.256) [-661.469] (-667.353) * (-664.698) [-665.716] (-673.159) (-667.279) -- 0:00:03
987000 -- (-663.009) (-670.634) [-658.491] (-663.389) * (-672.747) [-662.975] (-661.904) (-681.884) -- 0:00:03
988000 -- (-662.393) (-666.344) (-673.539) [-665.007] * (-663.023) (-669.160) [-663.205] (-669.430) -- 0:00:03
989000 -- (-664.263) (-666.922) (-670.060) [-665.853] * (-670.880) (-669.348) [-667.448] (-666.505) -- 0:00:02
990000 -- (-663.938) [-661.334] (-665.474) (-665.123) * [-665.068] (-673.325) (-668.820) (-667.002) -- 0:00:02
Average standard deviation of split frequencies: 0.004333
991000 -- [-662.055] (-680.147) (-669.288) (-672.972) * [-666.467] (-678.234) (-669.941) (-664.296) -- 0:00:02
992000 -- (-669.377) (-667.999) (-674.523) [-667.518] * (-674.792) (-683.276) [-675.425] (-670.167) -- 0:00:02
993000 -- (-668.693) (-674.799) (-671.895) [-665.371] * (-665.873) [-667.943] (-664.481) (-669.037) -- 0:00:01
994000 -- [-666.490] (-670.064) (-668.552) (-665.187) * (-665.972) [-667.665] (-669.998) (-673.454) -- 0:00:01
995000 -- (-663.876) [-662.814] (-674.804) (-664.338) * (-661.118) [-664.746] (-673.895) (-670.883) -- 0:00:01
Average standard deviation of split frequencies: 0.004185
996000 -- [-669.875] (-669.886) (-663.976) (-660.044) * [-668.256] (-671.333) (-669.426) (-670.418) -- 0:00:01
997000 -- (-659.561) (-668.758) (-666.277) [-666.524] * [-660.122] (-672.242) (-664.669) (-663.913) -- 0:00:00
998000 -- (-667.588) (-672.110) (-660.450) [-661.455] * (-660.476) [-668.021] (-664.779) (-666.389) -- 0:00:00
999000 -- [-663.317] (-664.519) (-669.050) (-680.840) * [-665.036] (-668.470) (-673.798) (-665.736) -- 0:00:00
1000000 -- [-666.882] (-661.210) (-665.984) (-661.712) * (-668.143) (-666.109) [-666.827] (-673.880) -- 0:00:00
Average standard deviation of split frequencies: 0.004438
Analysis completed in 4 mins 27 seconds
Analysis used 266.88 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -653.74
Likelihood of best state for "cold" chain of run 2 was -653.66
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
67.5 % ( 69 %) Dirichlet(Revmat{all})
80.3 % ( 63 %) Slider(Revmat{all})
39.0 % ( 31 %) Dirichlet(Pi{all})
39.2 % ( 29 %) Slider(Pi{all})
74.3 % ( 47 %) Multiplier(Alpha{1,2})
65.8 % ( 43 %) Multiplier(Alpha{3})
86.8 % ( 69 %) Slider(Pinvar{all})
40.3 % ( 34 %) ExtSPR(Tau{all},V{all})
30.9 % ( 41 %) ExtTBR(Tau{all},V{all})
42.8 % ( 51 %) NNI(Tau{all},V{all})
44.2 % ( 41 %) ParsSPR(Tau{all},V{all})
27.2 % ( 27 %) Multiplier(V{all})
57.8 % ( 58 %) Nodeslider(V{all})
26.2 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
68.0 % ( 73 %) Dirichlet(Revmat{all})
80.1 % ( 74 %) Slider(Revmat{all})
38.6 % ( 28 %) Dirichlet(Pi{all})
38.1 % ( 26 %) Slider(Pi{all})
73.9 % ( 43 %) Multiplier(Alpha{1,2})
66.1 % ( 39 %) Multiplier(Alpha{3})
86.6 % ( 83 %) Slider(Pinvar{all})
40.6 % ( 41 %) ExtSPR(Tau{all},V{all})
30.9 % ( 29 %) ExtTBR(Tau{all},V{all})
42.8 % ( 38 %) NNI(Tau{all},V{all})
44.4 % ( 45 %) ParsSPR(Tau{all},V{all})
27.2 % ( 28 %) Multiplier(V{all})
57.6 % ( 62 %) Nodeslider(V{all})
26.1 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.75 0.53 0.37
2 | 166884 0.77 0.57
3 | 166172 167694 0.78
4 | 166531 166016 166703
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.75 0.54 0.37
2 | 167058 0.77 0.57
3 | 166354 167277 0.78
4 | 166435 166814 166062
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -663.92
| 21 2 |
| 2 1 1 |
| 1 1 1 1 2 1 |
| * 2 2 2 1 1 2 1 1 |
| 12 1 1 2 1 1 1 21 |
| 1 2 21 2 1 12 12 1 1*|
| 212 2 121 22122 2 2 212 2 |
| 2 1 1 2 * 2 1 22 2 * |
| 1 11 22 1 1 2 |
|1 2 1 1 2 2 1 1 2 1 2 |
| 1 2 1 12 1 |
| 1 1 2 21 2 2 2 1 2 |
| 2 1 1 |
| 2 2 2 |
|2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -667.87
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -661.20 -675.31
2 -661.42 -674.82
--------------------------------------
TOTAL -661.31 -675.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.244417 0.001925 0.166413 0.333500 0.241348 1347.97 1379.67 1.000
r(A<->C){all} 0.130756 0.002910 0.034473 0.232751 0.124507 547.35 611.46 1.001
r(A<->G){all} 0.151664 0.003032 0.051761 0.257343 0.147630 536.08 614.59 1.001
r(A<->T){all} 0.107938 0.001444 0.037894 0.183019 0.103776 501.22 658.85 1.000
r(C<->G){all} 0.194736 0.004460 0.070312 0.322834 0.190441 595.91 620.68 1.000
r(C<->T){all} 0.305273 0.004349 0.185833 0.437422 0.303200 678.59 692.81 1.000
r(G<->T){all} 0.109632 0.001903 0.035757 0.201501 0.104854 426.53 570.62 1.000
pi(A){all} 0.256399 0.000603 0.211168 0.305750 0.255863 1142.95 1208.62 1.000
pi(C){all} 0.196613 0.000483 0.153181 0.240209 0.196081 862.43 1000.99 1.000
pi(G){all} 0.176108 0.000482 0.133979 0.217289 0.175082 1074.12 1168.91 1.000
pi(T){all} 0.370880 0.000760 0.321745 0.426653 0.369967 1141.06 1180.20 1.000
alpha{1,2} 0.660894 0.486095 0.001693 2.010291 0.442134 1107.58 1143.40 1.001
alpha{3} 1.954139 1.360016 0.304380 4.298999 1.691177 1110.77 1305.88 1.000
pinvar{all} 0.187144 0.017825 0.000136 0.440395 0.162519 955.53 1021.50 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C10
3 -- C2
4 -- C3
5 -- C4
6 -- C5
7 -- C6
8 -- C7
9 -- C8
10 -- C9
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
----------------
1 -- .*********
2 -- .*........
3 -- ..*.......
4 -- ...*......
5 -- ....*.....
6 -- .....*....
7 -- ......*...
8 -- .......*..
9 -- ........*.
10 -- .........*
11 -- .....**...
12 -- .*..***.*.
13 -- ....***...
14 -- .*......*.
15 -- ..**......
16 -- .......*.*
17 -- ..**...*.*
18 -- .********.
19 -- .*..***.**
20 -- ..*....*..
21 -- .*..*****.
22 -- ...*.....*
23 -- .*.****.*.
24 -- .******.**
25 -- ..*......*
26 -- .**.***.*.
27 -- ...*...*..
28 -- .*.*******
29 -- .**.******
----------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 3002 1.000000 0.000000 1.000000 1.000000 2
13 3002 1.000000 0.000000 1.000000 1.000000 2
14 3001 0.999667 0.000471 0.999334 1.000000 2
15 472 0.157229 0.004711 0.153897 0.160560 2
16 451 0.150233 0.003298 0.147901 0.152565 2
17 449 0.149567 0.005182 0.145903 0.153231 2
18 443 0.147568 0.002355 0.145903 0.149234 2
19 438 0.145903 0.001884 0.144570 0.147235 2
20 435 0.144903 0.006124 0.140573 0.149234 2
21 433 0.144237 0.000471 0.143904 0.144570 2
22 433 0.144237 0.001413 0.143238 0.145237 2
23 427 0.142239 0.008951 0.135909 0.148568 2
24 425 0.141572 0.014604 0.131246 0.151899 2
25 423 0.140906 0.008009 0.135243 0.146569 2
26 412 0.137242 0.006595 0.132578 0.141905 2
27 412 0.137242 0.011306 0.129247 0.145237 2
28 399 0.132911 0.001413 0.131912 0.133911 2
29 398 0.132578 0.007537 0.127249 0.137908 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.003099 0.000010 0.000001 0.009226 0.002213 1.001 2
length{all}[2] 0.013734 0.000053 0.001797 0.028215 0.012548 1.000 2
length{all}[3] 0.002998 0.000009 0.000002 0.008763 0.002051 1.001 2
length{all}[4] 0.003036 0.000010 0.000000 0.009091 0.002049 1.001 2
length{all}[5] 0.004435 0.000018 0.000001 0.012753 0.003219 1.001 2
length{all}[6] 0.023011 0.000086 0.008310 0.042265 0.021826 1.000 2
length{all}[7] 0.003276 0.000011 0.000000 0.009825 0.002302 1.000 2
length{all}[8] 0.003067 0.000010 0.000000 0.009063 0.002138 1.000 2
length{all}[9] 0.005692 0.000025 0.000000 0.015728 0.004295 1.001 2
length{all}[10] 0.003112 0.000010 0.000001 0.009520 0.002143 1.000 2
length{all}[11] 0.032976 0.000144 0.012749 0.056837 0.031446 1.000 2
length{all}[12] 0.040756 0.000220 0.014567 0.070644 0.038996 1.000 2
length{all}[13] 0.060719 0.000347 0.029538 0.098507 0.058303 1.000 2
length{all}[14] 0.035331 0.000185 0.012327 0.062223 0.033552 1.000 2
length{all}[15] 0.002887 0.000008 0.000000 0.008196 0.002142 1.003 2
length{all}[16] 0.003223 0.000009 0.000002 0.009441 0.002309 0.998 2
length{all}[17] 0.003189 0.000010 0.000001 0.009691 0.002102 0.999 2
length{all}[18] 0.002983 0.000008 0.000010 0.008363 0.002058 0.998 2
length{all}[19] 0.002959 0.000009 0.000001 0.009376 0.001971 0.999 2
length{all}[20] 0.003012 0.000008 0.000020 0.008399 0.002117 1.000 2
length{all}[21] 0.002953 0.000009 0.000028 0.009764 0.001860 1.001 2
length{all}[22] 0.002965 0.000009 0.000000 0.009168 0.002027 1.006 2
length{all}[23] 0.003224 0.000011 0.000000 0.009428 0.002161 0.999 2
length{all}[24] 0.002787 0.000008 0.000021 0.007774 0.002026 0.998 2
length{all}[25] 0.002971 0.000010 0.000001 0.009437 0.002082 0.998 2
length{all}[26] 0.003176 0.000010 0.000032 0.008856 0.002460 0.999 2
length{all}[27] 0.003205 0.000012 0.000003 0.009716 0.002222 1.000 2
length{all}[28] 0.003086 0.000009 0.000004 0.009088 0.002111 0.999 2
length{all}[29] 0.003244 0.000010 0.000007 0.009659 0.002398 1.002 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004438
Maximum standard deviation of split frequencies = 0.014604
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (3)
|
|----------------------------------------------------------------------- C3 (4)
|
|----------------------------------------------------------------------- C7 (8)
+
|----------------------------------------------------------------------- C9 (10)
|
| /------------------ C10 (2)
| /----------------100---------------+
| | \------------------ C8 (9)
| |
\-------100-------+ /----------------------------------- C4 (5)
| |
\-------100-------+ /------------------ C5 (6)
\-------100------+
\------------------ C6 (7)
Phylogram (based on average branch lengths):
/- C1 (1)
|
|- C2 (3)
|
|- C3 (4)
|
|- C7 (8)
+
|- C9 (10)
|
| /------ C10 (2)
| /---------------+
| | \-- C8 (9)
| |
\------------------+ /- C4 (5)
| |
\---------------------------+ /---------- C5 (6)
\--------------+
\- C6 (7)
|--------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (106 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Wed Oct 26 22:52:41 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=10, Len=91
C1 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C2 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C3 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C4 MVSFNVTAILLVLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C5 ---MNVTAILLQNVANAFSNPLYVPEHCVGMPGTLFQACIRQTMVDTTGM
C6 ---MNVTAILLQNVANAFSNPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C7 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C8 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGM
C9 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGM
C10 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSATLFQACIRQTMVDTTGM
:*.***:* :*****:******** **..*****************
C1 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C2 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C3 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C4 YTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV
C5 YTNSAMSYDGTTIPFDIHGIVHEDHYTDTKPTPLSDVGFSV
C6 YTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV
C7 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C8 YTNSAMSHDGITIPFDRDGIVHEEHYTETNPTPLSDVGFSV
C9 YTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
C10 YTNSDMSHDGITIPFDRDGIVHEEHYTETNPTPLFDAGFSV
**** **:** ***** .*****:***:*:**** *.****
-- Starting log on Wed Oct 26 23:28:37 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/codeml,B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C1 273 sites
reading seq# 2 C2 273 sites
reading seq# 3 C3 273 sites
reading seq# 4 C4 273 sites
reading seq# 5 C5 273 sites
reading seq# 6 C6 273 sites
reading seq# 7 C7 273 sites
reading seq# 8 C8 273 sites
reading seq# 9 C9 273 sites
reading seq#10 C10 273 sitesns = 10 ls = 273
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Sites with gaps or missing data are removed.
9 ambiguity characters in seq. 5
9 ambiguity characters in seq. 6
3 sites are removed. 1 2 3
Sequences read..
Counting site patterns.. 0:00
Compressing, 61 patterns at 88 / 88 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 61 patterns at 88 / 88 sites (100.0%), 0:00
Counting codons..
360 bytes for distance
59536 bytes for conP
5368 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 7, 9, ((10, 8), (4, (5, 6)))); MP score: 47
148840 bytes for conP, adjusted
0.047674 0.097313 0.030375 0.060728 0.038435 0.109335 0.076483 0.045864 0.010918 0.092664 0.057202 0.082863 0.084335 0.048008 0.300000 0.832925 0.127072
ntime & nrate & np: 14 2 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 16.714489
np = 17
lnL0 = -665.589111
Iterating by ming2
Initial: fx= 665.589111
x= 0.04767 0.09731 0.03037 0.06073 0.03844 0.10933 0.07648 0.04586 0.01092 0.09266 0.05720 0.08286 0.08433 0.04801 0.30000 0.83293 0.12707
1 h-m-p 0.0000 0.0003 236.2996 +++ 651.820593 m 0.0003 23 | 1/17
2 h-m-p 0.0000 0.0000 1381.6124 ++ 645.334516 m 0.0000 43 | 2/17
3 h-m-p 0.0000 0.0000 1067.0103 ++ 640.994085 m 0.0000 63 | 3/17
4 h-m-p 0.0000 0.0002 167.2506 ++ 636.366073 m 0.0002 83 | 4/17
5 h-m-p 0.0000 0.0000 241.5960 ++ 635.303302 m 0.0000 103 | 5/17
6 h-m-p 0.0000 0.0000 8019.9737 ++ 632.361574 m 0.0000 123 | 6/17
7 h-m-p 0.0000 0.0000 655.2419 ++ 632.007888 m 0.0000 143 | 7/17
8 h-m-p 0.0000 0.0001 864.8481 ++ 628.077628 m 0.0001 163 | 8/17
9 h-m-p 0.0009 0.0184 30.0070 +YCCC 625.949188 3 0.0055 189 | 8/17
10 h-m-p 0.0014 0.0071 27.0469 YCCCC 625.149237 4 0.0028 216 | 8/17
11 h-m-p 0.0015 0.0077 13.0145 CCCC 624.983037 3 0.0020 242 | 8/17
12 h-m-p 0.0055 0.0273 3.1714 CCCC 624.809939 3 0.0086 268 | 8/17
13 h-m-p 0.0078 0.0837 3.5338 +YYCC 623.266206 3 0.0272 293 | 8/17
14 h-m-p 0.0143 0.0714 2.6266 CCCC 622.241759 3 0.0204 319 | 7/17
15 h-m-p 0.0038 0.0191 11.2705 -YCC 622.223193 2 0.0005 343 | 7/17
16 h-m-p 0.0129 0.6505 0.3971 ++YYCYCCCC 620.110326 7 0.2844 376 | 7/17
17 h-m-p 0.0069 0.0346 0.7873 ++ 619.238311 m 0.0346 406 | 7/17
18 h-m-p -0.0000 -0.0000 0.4515
h-m-p: -6.01125721e-18 -3.00562861e-17 4.51530339e-01 619.238311
.. | 7/17
19 h-m-p 0.0000 0.0088 35.5777 +++YCCC 618.164364 3 0.0019 471 | 7/17
20 h-m-p 0.0000 0.0001 71.0295 ++ 617.937891 m 0.0001 491 | 8/17
21 h-m-p 0.0002 0.0392 41.9606 ++CYCC 617.418629 3 0.0023 518 | 8/17
22 h-m-p 0.0019 0.0093 28.8940 CYCCC 616.580193 4 0.0032 545 | 8/17
23 h-m-p 0.0017 0.0165 54.1062 +YYCC 614.898016 3 0.0052 570 | 8/17
24 h-m-p 0.0034 0.0172 14.0995 YYCC 614.712056 3 0.0031 594 | 8/17
25 h-m-p 0.0018 0.0090 20.9183 CCCC 614.558561 3 0.0022 620 | 8/17
26 h-m-p 0.0064 0.0318 4.9484 YCCC 614.525829 3 0.0034 645 | 8/17
27 h-m-p 0.0164 0.2684 1.0240 YC 614.517533 1 0.0070 666 | 8/17
28 h-m-p 0.0094 0.2970 0.7680 YC 614.479616 1 0.0194 687 | 8/17
29 h-m-p 0.0027 0.3849 5.5131 ++CYC 613.461111 2 0.0500 721 | 8/17
30 h-m-p 1.4848 7.4239 0.1335 CYC 613.135754 2 1.3886 744 | 8/17
31 h-m-p 1.6000 8.0000 0.0489 CC 613.094418 1 1.6335 775 | 8/17
32 h-m-p 1.6000 8.0000 0.0213 YC 613.090223 1 1.2136 805 | 8/17
33 h-m-p 1.6000 8.0000 0.0062 YC 613.089818 1 0.9227 835 | 8/17
34 h-m-p 1.6000 8.0000 0.0012 Y 613.089803 0 1.2117 864 | 8/17
35 h-m-p 1.6000 8.0000 0.0000 Y 613.089803 0 1.0279 893 | 8/17
36 h-m-p 1.6000 8.0000 0.0000 Y 613.089803 0 1.0849 922 | 8/17
37 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 8/17
38 h-m-p 0.0160 8.0000 0.0003 ------------- | 8/17
39 h-m-p 0.0160 8.0000 0.0003 -------------
Out..
lnL = -613.089803
1046 lfun, 3138 eigenQcodon, 29288 P(t)
end of tree file.
Time used: 0:10
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 7, 9, ((10, 8), (4, (5, 6)))); MP score: 47
0.076022 0.013490 0.075316 0.020728 0.104922 0.077536 0.085256 0.053425 0.056297 0.019005 0.077371 0.056517 0.074868 0.048001 1.768098 1.451022 0.302060 0.174186 1.523106
ntime & nrate & np: 14 3 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 6.245667
np = 19
lnL0 = -678.368251
Iterating by ming2
Initial: fx= 678.368251
x= 0.07602 0.01349 0.07532 0.02073 0.10492 0.07754 0.08526 0.05343 0.05630 0.01901 0.07737 0.05652 0.07487 0.04800 1.76810 1.45102 0.30206 0.17419 1.52311
1 h-m-p 0.0000 0.0002 639.8052 +++ 648.545027 m 0.0002 44 | 1/19
2 h-m-p 0.0000 0.0001 204.3399 ++ 645.012752 m 0.0001 85 | 2/19
3 h-m-p 0.0000 0.0000 5962.2485 ++ 633.594621 m 0.0000 125 | 3/19
4 h-m-p 0.0000 0.0000 1689.8108 ++ 624.895072 m 0.0000 164 | 4/19
5 h-m-p 0.0000 0.0000 2854.0222 ++ 624.739709 m 0.0000 202 | 5/19
6 h-m-p 0.0000 0.0000 687.5171 ++ 624.578429 m 0.0000 239 | 6/19
7 h-m-p 0.0000 0.0002 214.3707 +++ 621.189805 m 0.0002 276 | 7/19
8 h-m-p 0.0000 0.0000 86.0424 ++ 621.132185 m 0.0000 311 | 8/19
9 h-m-p 0.0001 0.0130 12.7282 ++++ 620.037576 m 0.0130 347 | 9/19
10 h-m-p 0.0164 0.0821 4.4918 YCC 619.743352 2 0.0113 383 | 8/19
11 h-m-p 0.0006 0.0083 88.6061 YCCC 619.447924 3 0.0010 420 | 8/19
12 h-m-p 0.0010 0.0081 85.0339 +YCCC 617.746466 3 0.0050 459 | 8/19
13 h-m-p 0.0063 0.0317 4.9132 ++ 617.113261 m 0.0317 492 | 9/19
14 h-m-p 0.0454 0.8189 0.8309 +YC 616.810186 1 0.1137 527 | 9/19
15 h-m-p 0.3532 5.8797 0.2674 +CCC 614.712853 2 1.6366 564 | 9/19
16 h-m-p 1.1156 5.5778 0.3402 CCCC 613.681667 3 1.4600 602 | 9/19
17 h-m-p 0.8276 4.2166 0.6002 YYCC 613.242010 3 0.7338 638 | 9/19
18 h-m-p 0.8925 4.4624 0.3428 YC 613.134623 1 0.3835 671 | 9/19
19 h-m-p 1.6000 8.0000 0.0664 YCC 613.106120 2 1.0032 706 | 9/19
20 h-m-p 1.6000 8.0000 0.0286 YC 613.097745 1 1.1817 739 | 9/19
21 h-m-p 1.6000 8.0000 0.0113 CC 613.093875 1 2.0861 773 | 9/19
22 h-m-p 1.5231 8.0000 0.0155 CC 613.090664 1 2.2762 807 | 9/19
23 h-m-p 1.6000 8.0000 0.0098 CC 613.090089 1 1.3561 841 | 9/19
24 h-m-p 1.6000 8.0000 0.0018 CC 613.089902 1 2.4701 875 | 9/19
25 h-m-p 1.3673 8.0000 0.0033 CC 613.089808 1 1.8532 909 | 9/19
26 h-m-p 1.6000 8.0000 0.0009 Y 613.089803 0 1.1681 941 | 9/19
27 h-m-p 1.6000 8.0000 0.0000 Y 613.089803 0 1.0825 973 | 9/19
28 h-m-p 1.6000 8.0000 0.0000 ----C 613.089803 0 0.0016 1009
Out..
lnL = -613.089803
1010 lfun, 4040 eigenQcodon, 42420 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -620.458427 S = -574.276311 -54.883616
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 61 patterns 0:24
did 20 / 61 patterns 0:24
did 30 / 61 patterns 0:24
did 40 / 61 patterns 0:24
did 50 / 61 patterns 0:24
did 60 / 61 patterns 0:24
did 61 / 61 patterns 0:24end of tree file.
Time used: 0:24
Model 7: beta
TREE # 1
(1, 2, 3, 7, 9, ((10, 8), (4, (5, 6)))); MP score: 47
0.012435 0.085891 0.059974 0.077395 0.024836 0.021981 0.018030 0.024885 0.069389 0.064666 0.036512 0.065496 0.028817 0.077385 1.768096 1.121742 1.823295
ntime & nrate & np: 14 1 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 8.014363
np = 17
lnL0 = -680.248919
Iterating by ming2
Initial: fx= 680.248919
x= 0.01243 0.08589 0.05997 0.07740 0.02484 0.02198 0.01803 0.02488 0.06939 0.06467 0.03651 0.06550 0.02882 0.07738 1.76810 1.12174 1.82330
1 h-m-p 0.0000 0.0002 627.7609 ++ 650.558803 m 0.0002 39 | 1/17
2 h-m-p 0.0000 0.0001 245.8763 ++ 643.424978 m 0.0001 76 | 2/17
3 h-m-p 0.0000 0.0001 826.6038 ++ 631.370787 m 0.0001 112 | 3/17
4 h-m-p 0.0000 0.0000 13056.4402 ++ 629.954419 m 0.0000 147 | 4/17
5 h-m-p 0.0000 0.0002 180.5096 ++ 625.393762 m 0.0002 181 | 5/17
6 h-m-p 0.0000 0.0000 211.7905 ++ 624.998458 m 0.0000 214 | 6/17
7 h-m-p 0.0000 0.0000 266.4590 ++ 624.337636 m 0.0000 246 | 7/17
8 h-m-p 0.0004 0.0100 8.8852 +CCC 624.220379 2 0.0021 282 | 7/17
9 h-m-p 0.0009 0.0598 20.4745 ++CYYYYYYYYY 618.451890 9 0.0365 324 | 7/17
10 h-m-p 0.0060 0.0298 7.0012 YCCC 617.886716 3 0.0097 359 | 7/17
11 h-m-p 0.0122 0.0609 2.0076 ++ 617.414285 m 0.0609 389 | 8/17
12 h-m-p 0.1748 0.8740 0.4603 CYCCC 616.818204 4 0.2836 426 | 7/17
13 h-m-p 0.0004 0.0019 145.1306 CCC 616.631845 2 0.0004 459 | 7/17
14 h-m-p 0.0909 0.5598 0.6427 ++ 614.705766 m 0.5598 489 | 8/17
15 h-m-p 0.6510 7.9439 0.5523 YYCCC 613.784669 4 0.8964 525 | 8/17
16 h-m-p 0.6237 3.1187 0.7184 YYCCCC 613.270639 5 0.6454 562 | 8/17
17 h-m-p 0.9855 4.9275 0.1726 YYC 613.120313 2 0.7600 593 | 8/17
18 h-m-p 1.6000 8.0000 0.0602 CCC 613.025729 2 1.3495 626 | 8/17
19 h-m-p 0.9540 8.0000 0.0851 CC 613.009760 1 0.9566 657 | 8/17
20 h-m-p 1.6000 8.0000 0.0451 YC 613.008049 1 0.7292 687 | 8/17
21 h-m-p 1.6000 8.0000 0.0020 C 613.007818 0 1.8275 716 | 8/17
22 h-m-p 0.9957 8.0000 0.0037 C 613.007780 0 1.4007 745 | 8/17
23 h-m-p 1.6000 8.0000 0.0013 C 613.007775 0 1.8963 774 | 8/17
24 h-m-p 1.6000 8.0000 0.0002 C 613.007774 0 1.3757 803 | 8/17
25 h-m-p 1.6000 8.0000 0.0001 C 613.007774 0 2.4309 832 | 8/17
26 h-m-p 1.6000 8.0000 0.0000 C 613.007774 0 1.6832 861 | 8/17
27 h-m-p 1.6000 8.0000 0.0000 Y 613.007774 0 1.6000 890 | 8/17
28 h-m-p 1.6000 8.0000 0.0000 -Y 613.007774 0 0.1000 920 | 8/17
29 h-m-p 0.6008 8.0000 0.0000 ---------------C 613.007774 0 0.0000 964
Out..
lnL = -613.007774
965 lfun, 10615 eigenQcodon, 135100 P(t)
end of tree file.
Time used: 1:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 7, 9, ((10, 8), (4, (5, 6)))); MP score: 47
0.029077 0.049234 0.029304 0.051475 0.075221 0.081827 0.033034 0.043859 0.085202 0.030747 0.068565 0.015274 0.076316 0.012517 1.749878 0.900000 0.885021 1.730404 1.300000
ntime & nrate & np: 14 2 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 7.385733
np = 19
lnL0 = -678.565114
Iterating by ming2
Initial: fx= 678.565114
x= 0.02908 0.04923 0.02930 0.05148 0.07522 0.08183 0.03303 0.04386 0.08520 0.03075 0.06856 0.01527 0.07632 0.01252 1.74988 0.90000 0.88502 1.73040 1.30000
1 h-m-p 0.0000 0.0002 686.2876 +++ 643.849987 m 0.0002 44 | 1/19
2 h-m-p 0.0000 0.0002 228.6064 ++ 635.104571 m 0.0002 85 | 2/19
3 h-m-p 0.0000 0.0000 3067.0786 ++ 635.006227 m 0.0000 125 | 3/19
4 h-m-p 0.0000 0.0001 1026.8691 ++ 627.027847 m 0.0001 164 | 4/19
5 h-m-p 0.0000 0.0000 233.1482 ++ 626.253088 m 0.0000 202 | 5/19
6 h-m-p 0.0000 0.0002 242.1146 ++ 622.230434 m 0.0002 239 | 6/19
7 h-m-p 0.0001 0.0003 18.8070 ++ 622.064517 m 0.0003 275 | 7/19
8 h-m-p 0.0001 0.0006 65.2686 ++ 620.853667 m 0.0006 310 | 8/19
9 h-m-p 0.0000 0.0000 4201.9137 ++ 619.949754 m 0.0000 344 | 9/19
10 h-m-p 0.0033 0.0345 15.2848 YCCC 618.960093 3 0.0081 382 | 9/19
11 h-m-p 0.0066 0.0408 18.7607 CYCCC 617.579921 4 0.0120 421 | 9/19
12 h-m-p 0.0114 0.0570 9.1059 YCCCCC 617.138462 5 0.0137 462 | 8/19
13 h-m-p 0.0015 0.0077 55.8295 YCCC 616.951590 3 0.0009 499 | 8/19
14 h-m-p 0.0484 1.5669 1.0456 +CYC 616.422366 2 0.1974 536 | 8/19
15 h-m-p 0.1747 1.7577 1.1812 +YYCCC 615.192951 4 0.5515 576 | 8/19
16 h-m-p 0.7467 3.7336 0.2676 +YCCC 613.407304 3 1.9871 615 | 8/19
17 h-m-p 0.5761 2.8806 0.8368 YYYC 613.063783 3 0.5321 651 | 8/19
18 h-m-p 0.8978 8.0000 0.4960 CYC 612.829514 2 0.8887 687 | 8/19
19 h-m-p 1.2278 6.1390 0.1848 CCC 612.625425 2 1.4352 724 | 8/19
20 h-m-p 1.6000 8.0000 0.1284 CCC 612.585546 2 1.6967 761 | 8/19
21 h-m-p 1.6000 8.0000 0.0249 CCC 612.569836 2 1.8682 798 | 8/19
22 h-m-p 1.6000 8.0000 0.0177 CC 612.565189 1 1.7467 833 | 8/19
23 h-m-p 0.6894 8.0000 0.0449 +CC 612.560823 1 3.0544 869 | 8/19
24 h-m-p 1.6000 8.0000 0.0410 CC 612.559400 1 2.0878 904 | 8/19
25 h-m-p 1.6000 8.0000 0.0303 +C 612.556340 0 6.3159 938 | 8/19
26 h-m-p 1.6000 8.0000 0.0713 YC 612.553285 1 3.5271 972 | 8/19
27 h-m-p 1.6000 8.0000 0.0801 CC 612.551789 1 1.8997 1007 | 8/19
28 h-m-p 1.6000 8.0000 0.0349 CC 612.551462 1 2.2157 1042 | 8/19
29 h-m-p 1.6000 8.0000 0.0101 CC 612.551347 1 2.0863 1077 | 8/19
30 h-m-p 1.6000 8.0000 0.0072 C 612.551322 0 1.9746 1110 | 8/19
31 h-m-p 1.6000 8.0000 0.0047 C 612.551320 0 1.2858 1143 | 8/19
32 h-m-p 1.6000 8.0000 0.0007 C 612.551320 0 1.3229 1176 | 8/19
33 h-m-p 1.6000 8.0000 0.0000 Y 612.551320 0 1.6000 1209 | 8/19
34 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 8/19
35 h-m-p 0.0160 8.0000 0.0002 -------------
Out..
lnL = -612.551320
1301 lfun, 15612 eigenQcodon, 200354 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -618.950342 S = -574.234678 -47.349999
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 61 patterns 2:13
did 20 / 61 patterns 2:13
did 30 / 61 patterns 2:14
did 40 / 61 patterns 2:14
did 50 / 61 patterns 2:14
did 60 / 61 patterns 2:14
did 61 / 61 patterns 2:14end of tree file.
Time used: 2:14
The loglikelihoods for models M1, M2, M7 and M8 are -613.089803 -613.089803 -613.007774 -612.551320 respectively
CLUSTAL W (1.8) multiple sequence alignment (ALTER 1.3.3)
B04f_NS3a_ABN10840_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGMYTNSAMSHDG
B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGMYTNSAMSHDG
B07f_NS3a_ABN10858_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGMYTNSAMSHDG
BtTp_GX2012_NA_AIA62353_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNVTAILLVLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGMYTNSAMSYDG
CZ01_orf3_AWH65878_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ---MNVTAILLQNVANAFSNPLYVPEHCVGMPGTLFQACIRQTMVDTTGMYTNSAMSYDG
CZ07_orf3_AWH65889_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ---MNVTAILLQNVANAFSNPLYVPEHCVGMSGTLFQACIRQTMVDTTGMYTNSAMSYDG
HKU4_1_B04f_NS3a_YP_001039954_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGMYTNSAMSHDG
LMH1f_NS3a_ABN10867_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGMYTNSAMSHDG
SM3A_NA_QQD78084_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGMYTNSAMSHDG
SZ140324_orf3_AWH65900_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSATLFQACIRQTMVDTTGMYTNSDMSHDG
:*.***:* :*****:******** **..********************* **:**
B04f_NS3a_ABN10840_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 VTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 VTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
B07f_NS3a_ABN10858_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 VTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
BtTp_GX2012_NA_AIA62353_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 TTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV
CZ01_orf3_AWH65878_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 TTIPFDIHGIVHEDHYTDTKPTPLSDVGFSV
CZ07_orf3_AWH65889_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 TTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV
HKU4_1_B04f_NS3a_YP_001039954_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 VTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
LMH1f_NS3a_ABN10867_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ITIPFDRDGIVHEEHYTETNPTPLSDVGFSV
SM3A_NA_QQD78084_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 VTIPFDRDGIVHEDHYTETNPTPLFDAGFSV
SZ140324_orf3_AWH65900_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ITIPFDRDGIVHEEHYTETNPTPLFDAGFSV
***** .*****:***:*:**** *.****
>B04f_NS3a_ABN10840_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGTTTCTTTTAATGCTACTGCTATTCTTCTTTTATTACTTGCTAATGCTTTTTCTAAACCTTTATATGTCCCTGAGCATTGTGGTGGCATGTCTGGCACTCTCTTTCAGGCTTGTATTAGACAAACTATGGTTGATACAACCGGTATGTACACCAATTCAGCTATGTCACATGATGGTGTTACAATACCATTTGATAGAGATGGCATTGTACATGAAGATCATTACACTGAAACAAACCCTACACCACTTTTTGATGCTGGGTTTTCCGTA >B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGTTTCTTTTAATGCTACTGCTATTCTTCTTTTATTACTTGCTAATGCTTTTTCTAAACCTTTATATGTCCCTGAGCATTGTGGTGGCATGTCTGGCACTCTCTTTCAGGCTTGTATTAGACAAACTATGGTTGATACAACCGGTATGTACACCAATTCAGCTATGTCACATGATGGTGTTACAATACCATTTGATAGAGATGGCATTGTACATGAAGATCATTACACTGAAACAAACCCTACACCACTTTTTGATGCTGGGTTTTCCGTA >B07f_NS3a_ABN10858_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGTTTCTTTTAATGCTACTGCTATTCTTCTTTTATTACTTGCTAATGCTTTTTCTAAACCTTTATATGTCCCTGAGCATTGTGGTGGCATGTCTGGCACTCTCTTTCAGGCTTGTATTAGACAAACTATGGTTGATACAACCGGTATGTACACCAATTCAGCTATGTCACATGATGGTGTTACAATACCATTTGATAGAGATGGCATTGTACATGAAGATCATTACACTGAAACAAACCCTACACCACTTTTTGATGCTGGGTTTTCCGTA >BtTp_GX2012_NA_AIA62353_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGTTTCTTTTAACGTTACTGCTATTCTTCTCGTATTAGTTGCTAATGCTTTTTCTAAACCCTTATATGTTCCTGAACATTGTGTTGGCATGTCTGGCACTTTGTTTCAAGCTTGTATTAGACAAACTATGGTTGATACAACAGGTATGTACACCAATTCAGCTATGTCATATGATGGTACTACAATACCATTCGATAGAGATGGCATTGTACATGAGGATCATTACACTGATACAAAACCTACACCCTTGTCTGATGTTGGTTTTTCCGTA >CZ01_orf3_AWH65878_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ---------ATGAACGTTACTGCTATTCTTCTCCAAAACGTTGCTAATGCTTTTTCTAATCCCTTATATGTTCCTGAACATTGTGTTGGCATGCCCGGGACTTTGTTTCAAGCTTGTATTAGACAAACTATGGTTGATACAACAGGTATGTACACCAATTCAGCTATGTCATATGATGGTACTACAATACCATTCGATATTCATGGCATTGTACATGAGGATCATTACACTGATACTAAACCTACACCCTTGTCTGATGTTGGTTTTTCCGTA >CZ07_orf3_AWH65889_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ---------ATGAACGTTACTGCTATTCTTCTCCAAAACGTTGCTAATGCTTTTTCTAATCCCTTATATGTTCCTGAACATTGTGTTGGCATGTCTGGCACTTTGTTTCAAGCTTGTATTAGACAAACTATGGTTGATACAACAGGTATGTACACCAATTCAGCTATGTCATATGATGGTACTACAATACCATTCGATAGAGATGGCATTGTACATGAGGATCATTACACTGATACTAAACCTACACCCTTGTCTGATGTTGGTTTTTCCGTA >HKU4_1_B04f_NS3a_YP_001039954_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGTTTCTTTTAATGCTACTGCTATTCTTCTTTTATTACTTGCTAATGCTTTTTCTAAACCTTTATATGTCCCTGAGCATTGTGGTGGCATGTCTGGCACTCTCTTTCAGGCTTGTATTAGACAAACTATGGTTGATACAACCGGTATGTACACCAATTCAGCTATGTCACATGATGGTGTTACAATACCATTTGATAGAGATGGCATTGTACATGAAGATCATTACACTGAAACAAACCCTACACCACTTTTTGATGCTGGGTTTTCCGTA >LMH1f_NS3a_ABN10867_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGTTTCTTTTAATGCTACTGCTATTTTTCTTTTATTAGTTGCTAATGCTTTTTCTAAACCATTGTATGTACCTGAACATTGTGTTGGCATGTCTGGCACTTTGTTTCAAGCTTGTATTAGACAAACTATGGTTGATACAACTGGTATGTATACCAACTCAGCTATGTCACATGATGGTATTACAATACCATTCGATAGGGATGGCATTGTACATGAAGAGCATTATACTGAAACAAACCCTACACCACTTTCTGATGTTGGGTTTTCCGTA >SM3A_NA_QQD78084_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGGTTTCTTTTAATGCTACTGCTATTCTTCTTTTATTACTTGCTAATGCTTTTTCTAAACCTTTATATGTCCCTGAGCATTGTGGTGGCATGTCTGGCACTCTCTTTCAGGCTTGTATTAGACAAACTATGGTTGATACAACCGGTATGTACACCAATTCAGCTATGTCACATGATGGTGTTACAATACCATTTGATAGAGATGGCATTGTACATGAAGATCATTACACTGAAACAAACCCTACACCACTTTTTGATGCTGGGTTTTCCGTA >SZ140324_orf3_AWH65900_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ATGGTTTCTTTTAATGCTACTGCTATTTTTCTTTTATTAGTTGCTAATGCTTTTTCTAAACCATTGTATGTACCTGAACATTGTGTTGGCATGTCTGCCACTTTGTTTCAAGCTTGTATTAGACAAACTATGGTTGATACAACTGGTATGTATACCAACTCAGATATGTCACATGATGGTATTACAATACCATTCGATAGGGATGGCATTGTACATGAAGAGCATTATACTGAAACAAACCCTACACCACTTTTTGATGCTGGGTTTTCCGTA
>B04f_NS3a_ABN10840_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGMYTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV >B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGMYTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV >B07f_NS3a_ABN10858_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGMYTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV >BtTp_GX2012_NA_AIA62353_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNVTAILLVLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGMYTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV >CZ01_orf3_AWH65878_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ---MNVTAILLQNVANAFSNPLYVPEHCVGMPGTLFQACIRQTMVDTTGMYTNSAMSYDGTTIPFDIHGIVHEDHYTDTKPTPLSDVGFSV >CZ07_orf3_AWH65889_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ---MNVTAILLQNVANAFSNPLYVPEHCVGMSGTLFQACIRQTMVDTTGMYTNSAMSYDGTTIPFDRDGIVHEDHYTDTKPTPLSDVGFSV >HKU4_1_B04f_NS3a_YP_001039954_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGMYTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV >LMH1f_NS3a_ABN10867_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSGTLFQACIRQTMVDTTGMYTNSAMSHDGITIPFDRDGIVHEEHYTETNPTPLSDVGFSV >SM3A_NA_QQD78084_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAILLLLLANAFSKPLYVPEHCGGMSGTLFQACIRQTMVDTTGMYTNSAMSHDGVTIPFDRDGIVHEDHYTETNPTPLFDAGFSV >SZ140324_orf3_AWH65900_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MVSFNATAIFLLLVANAFSKPLYVPEHCVGMSATLFQACIRQTMVDTTGMYTNSDMSHDGITIPFDRDGIVHEEHYTETNPTPLFDAGFSV
Reading sequence file /data//pss_subsets/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/codeml/fasta/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1
Found 10 sequences of length 273
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 7.7%
Found 41 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 12
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 32 polymorphic sites
**p-Value(s)**
----------
NSS: 1.50e-02 (1000 permutations)
Max Chi^2: 1.90e-02 (1000 permutations)
PHI (Permutation): 3.22e-01 (1000 permutations)
PHI (Normal): 2.94e-01
#NEXUS
[ID: 1508476915]
begin taxa;
dimensions ntax=10;
taxlabels
B04f_NS3a_ABN10840_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
SZ140324_orf3_AWH65900_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4
B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
B07f_NS3a_ABN10858_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
BtTp_GX2012_NA_AIA62353_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4
CZ01_orf3_AWH65878_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4
CZ07_orf3_AWH65889_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4
HKU4_1_B04f_NS3a_YP_001039954_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
LMH1f_NS3a_ABN10867_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
SM3A_NA_QQD78084_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4
;
end;
begin trees;
translate
1 B04f_NS3a_ABN10840_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
2 SZ140324_orf3_AWH65900_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4,
3 B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
4 B07f_NS3a_ABN10858_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
5 BtTp_GX2012_NA_AIA62353_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
6 CZ01_orf3_AWH65878_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4,
7 CZ07_orf3_AWH65889_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4,
8 HKU4_1_B04f_NS3a_YP_001039954_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
9 LMH1f_NS3a_ABN10867_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
10 SM3A_NA_QQD78084_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:2.212628e-03,3:2.051457e-03,4:2.048651e-03,8:2.137912e-03,10:2.143065e-03,((2:1.254786e-02,9:4.295325e-03)1.000:3.355157e-02,(5:3.218741e-03,(6:2.182614e-02,7:2.301800e-03)1.000:3.144612e-02)1.000:5.830277e-02)1.000:3.899615e-02);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:2.212628e-03,3:2.051457e-03,4:2.048651e-03,8:2.137912e-03,10:2.143065e-03,((2:1.254786e-02,9:4.295325e-03):3.355157e-02,(5:3.218741e-03,(6:2.182614e-02,7:2.301800e-03):3.144612e-02):5.830277e-02):3.899615e-02);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -661.20 -675.31
2 -661.42 -674.82
--------------------------------------
TOTAL -661.31 -675.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.244417 0.001925 0.166413 0.333500 0.241348 1347.97 1379.67 1.000
r(A<->C){all} 0.130756 0.002910 0.034473 0.232751 0.124507 547.35 611.46 1.001
r(A<->G){all} 0.151664 0.003032 0.051761 0.257343 0.147630 536.08 614.59 1.001
r(A<->T){all} 0.107938 0.001444 0.037894 0.183019 0.103776 501.22 658.85 1.000
r(C<->G){all} 0.194736 0.004460 0.070312 0.322834 0.190441 595.91 620.68 1.000
r(C<->T){all} 0.305273 0.004349 0.185833 0.437422 0.303200 678.59 692.81 1.000
r(G<->T){all} 0.109632 0.001903 0.035757 0.201501 0.104854 426.53 570.62 1.000
pi(A){all} 0.256399 0.000603 0.211168 0.305750 0.255863 1142.95 1208.62 1.000
pi(C){all} 0.196613 0.000483 0.153181 0.240209 0.196081 862.43 1000.99 1.000
pi(G){all} 0.176108 0.000482 0.133979 0.217289 0.175082 1074.12 1168.91 1.000
pi(T){all} 0.370880 0.000760 0.321745 0.426653 0.369967 1141.06 1180.20 1.000
alpha{1,2} 0.660894 0.486095 0.001693 2.010291 0.442134 1107.58 1143.40 1.001
alpha{3} 1.954139 1.360016 0.304380 4.298999 1.691177 1110.77 1305.88 1.000
pinvar{all} 0.187144 0.017825 0.000136 0.440395 0.162519 955.53 1021.50 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/B05f_NS3a_ABN10849_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 10 ls = 88
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 6 6 6 4 3 3 | Ser TCT 2 2 2 3 2 3 | Tyr TAT 1 1 1 2 2 2 | Cys TGT 2 2 2 2 2 2
TTC 0 0 0 1 1 1 | TCC 1 1 1 1 1 1 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 3 3 3 2 1 1 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 2 2 2 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 4 4 4 1 1 1 | Pro CCT 3 3 3 2 2 2 | His CAT 4 4 4 3 4 3 | Arg CGT 0 0 0 0 0 0
CTC 1 1 1 1 1 1 | CCC 0 0 0 2 3 2 | CAC 0 0 0 0 0 0 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 2 2 2 1 1 1 | Gln CAA 1 1 1 2 3 3 | CGA 0 0 0 0 0 0
CTG 0 0 0 0 0 0 | CCG 0 0 0 0 0 0 | CAG 1 1 1 0 0 0 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 4 3 | Thr ACT 4 4 4 5 6 6 | Asn AAT 3 3 3 2 3 3 | Ser AGT 0 0 0 0 0 0
ATC 0 0 0 0 0 0 | ACC 2 2 2 1 1 1 | AAC 1 1 1 1 2 2 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 1 | ACA 4 4 4 5 4 4 | Lys AAA 1 1 1 2 1 1 | Arg AGA 2 2 2 2 1 2
Met ATG 4 4 4 4 5 5 | ACG 0 0 0 0 0 0 | AAG 0 0 0 0 0 0 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 6 6 6 | Ala GCT 7 7 7 5 5 5 | Asp GAT 6 6 6 7 6 7 | Gly GGT 3 3 3 3 3 3
GTC 1 1 1 0 0 0 | GCC 0 0 0 0 0 0 | GAC 0 0 0 0 0 0 | GGC 3 3 3 3 2 3
GTA 2 2 2 3 2 2 | GCA 0 0 0 0 0 0 | Glu GAA 2 2 2 1 1 1 | GGA 0 0 0 0 0 0
GTG 0 0 0 0 0 0 | GCG 0 0 0 0 0 0 | GAG 1 1 1 1 1 1 | GGG 1 1 1 0 1 0
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------------
Phe TTT 6 5 6 6 | Ser TCT 2 3 2 2 | Tyr TAT 1 3 1 3 | Cys TGT 2 2 2 2
TTC 0 1 0 1 | TCC 1 1 1 1 | TAC 2 0 2 0 | TGC 0 0 0 0
Leu TTA 3 2 3 2 | TCA 2 2 2 2 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 0 2 0 2 | TCG 0 0 0 0 | TAG 0 0 0 0 | Trp TGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Leu CTT 4 2 4 2 | Pro CCT 3 2 3 2 | His CAT 4 4 4 4 | Arg CGT 0 0 0 0
CTC 1 0 1 0 | CCC 0 0 0 0 | CAC 0 0 0 0 | CGC 0 0 0 0
CTA 0 0 0 0 | CCA 2 3 2 3 | Gln CAA 1 2 1 2 | CGA 0 0 0 0
CTG 0 0 0 0 | CCG 0 0 0 0 | CAG 1 0 1 0 | CGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Ile ATT 3 4 3 4 | Thr ACT 4 5 4 5 | Asn AAT 3 2 3 2 | Ser AGT 0 0 0 0
ATC 0 0 0 0 | ACC 2 1 2 1 | AAC 1 2 1 2 | AGC 0 0 0 0
ATA 1 1 1 1 | ACA 4 4 4 4 | Lys AAA 1 1 1 1 | Arg AGA 2 1 2 1
Met ATG 4 4 4 4 | ACG 0 0 0 0 | AAG 0 0 0 0 | AGG 0 1 0 1
------------------------------------------------------------------------------------------------------
Val GTT 2 4 2 3 | Ala GCT 7 6 7 6 | Asp GAT 6 5 6 6 | Gly GGT 3 2 3 2
GTC 1 0 1 0 | GCC 0 0 0 1 | GAC 0 0 0 0 | GGC 3 3 3 2
GTA 2 3 2 3 | GCA 0 0 0 0 | Glu GAA 2 3 2 3 | GGA 0 0 0 0
GTG 0 0 0 0 | GCG 0 0 0 0 | GAG 1 1 1 1 | GGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C1
position 1: T:0.21591 C:0.18182 A:0.28409 G:0.31818
position 2: T:0.30682 C:0.30682 A:0.26136 G:0.12500
position 3: T:0.56818 C:0.12500 A:0.22727 G:0.07955
Average T:0.36364 C:0.20455 A:0.25758 G:0.17424
#2: C2
position 1: T:0.21591 C:0.18182 A:0.28409 G:0.31818
position 2: T:0.30682 C:0.30682 A:0.26136 G:0.12500
position 3: T:0.56818 C:0.12500 A:0.22727 G:0.07955
Average T:0.36364 C:0.20455 A:0.25758 G:0.17424
#3: C3
position 1: T:0.21591 C:0.18182 A:0.28409 G:0.31818
position 2: T:0.30682 C:0.30682 A:0.26136 G:0.12500
position 3: T:0.56818 C:0.12500 A:0.22727 G:0.07955
Average T:0.36364 C:0.20455 A:0.25758 G:0.17424
#4: C4
position 1: T:0.23864 C:0.13636 A:0.29545 G:0.32955
position 2: T:0.31818 C:0.30682 A:0.26136 G:0.11364
position 3: T:0.54545 C:0.13636 A:0.23864 G:0.07955
Average T:0.36742 C:0.19318 A:0.26515 G:0.17424
#5: C5
position 1: T:0.20455 C:0.17045 A:0.31818 G:0.30682
position 2: T:0.30682 C:0.30682 A:0.28409 G:0.10227
position 3: T:0.55682 C:0.14773 A:0.19318 G:0.10227
Average T:0.35606 C:0.20833 A:0.26515 G:0.17045
#6: C6
position 1: T:0.21591 C:0.14773 A:0.31818 G:0.31818
position 2: T:0.29545 C:0.30682 A:0.28409 G:0.11364
position 3: T:0.55682 C:0.14773 A:0.20455 G:0.09091
Average T:0.35606 C:0.20076 A:0.26894 G:0.17424
#7: C7
position 1: T:0.21591 C:0.18182 A:0.28409 G:0.31818
position 2: T:0.30682 C:0.30682 A:0.26136 G:0.12500
position 3: T:0.56818 C:0.12500 A:0.22727 G:0.07955
Average T:0.36364 C:0.20455 A:0.25758 G:0.17424
#8: C8
position 1: T:0.23864 C:0.14773 A:0.29545 G:0.31818
position 2: T:0.31818 C:0.30682 A:0.26136 G:0.11364
position 3: T:0.55682 C:0.09091 A:0.25000 G:0.10227
Average T:0.37121 C:0.18182 A:0.26894 G:0.17803
#9: C9
position 1: T:0.21591 C:0.18182 A:0.28409 G:0.31818
position 2: T:0.30682 C:0.30682 A:0.26136 G:0.12500
position 3: T:0.56818 C:0.12500 A:0.22727 G:0.07955
Average T:0.36364 C:0.20455 A:0.25758 G:0.17424
#10: C10
position 1: T:0.23864 C:0.14773 A:0.29545 G:0.31818
position 2: T:0.31818 C:0.30682 A:0.27273 G:0.10227
position 3: T:0.55682 C:0.09091 A:0.25000 G:0.10227
Average T:0.37121 C:0.18182 A:0.27273 G:0.17424
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 51 | Ser S TCT 23 | Tyr Y TAT 17 | Cys C TGT 20
TTC 5 | TCC 10 | TAC 16 | TGC 0
Leu L TTA 23 | TCA 20 | *** * TAA 0 | *** * TGA 0
TTG 10 | TCG 0 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 27 | Pro P CCT 25 | His H CAT 38 | Arg R CGT 0
CTC 8 | CCC 7 | CAC 0 | CGC 0
CTA 0 | CCA 19 | Gln Q CAA 17 | CGA 0
CTG 0 | CCG 0 | CAG 5 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 33 | Thr T ACT 47 | Asn N AAT 27 | Ser S AGT 0
ATC 0 | ACC 15 | AAC 14 | AGC 0
ATA 10 | ACA 41 | Lys K AAA 11 | Arg R AGA 17
Met M ATG 42 | ACG 0 | AAG 0 | AGG 2
------------------------------------------------------------------------------
Val V GTT 35 | Ala A GCT 62 | Asp D GAT 61 | Gly G GGT 28
GTC 5 | GCC 1 | GAC 0 | GGC 28
GTA 23 | GCA 0 | Glu E GAA 19 | GGA 0
GTG 0 | GCG 0 | GAG 10 | GGG 8
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.22159 C:0.16591 A:0.29432 G:0.31818
position 2: T:0.30909 C:0.30682 A:0.26705 G:0.11705
position 3: T:0.56136 C:0.12386 A:0.22727 G:0.08750
Average T:0.36402 C:0.19886 A:0.26288 G:0.17424
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 7, 9, ((10, 8), (4, (5, 6)))); MP score: 47
check convergence..
lnL(ntime: 14 np: 17): -613.089803 +0.000000
11..1 11..2 11..3 11..7 11..9 11..12 12..13 13..10 13..8 12..14 14..4 14..15 15..5 15..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.169110 0.124411 0.051696 0.000004 0.225254 0.000004 0.122043 0.078186 0.000004 1.768098 0.893149 0.099836
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.770731
(1: 0.000004, 2: 0.000004, 3: 0.000004, 7: 0.000004, 9: 0.000004, ((10: 0.051696, 8: 0.000004): 0.124411, (4: 0.000004, (5: 0.078186, 6: 0.000004): 0.122043): 0.225254): 0.169110);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C7: 0.000004, C9: 0.000004, ((C10: 0.051696, C8: 0.000004): 0.124411, (C4: 0.000004, (C5: 0.078186, C6: 0.000004): 0.122043): 0.225254): 0.169110);
Detailed output identifying parameters
kappa (ts/tv) = 1.76810
MLEs of dN/dS (w) for site classes (K=2)
p: 0.89315 0.10685
w: 0.09984 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.000 218.2 45.8 0.1960 0.0000 0.0000 0.0 0.0
11..2 0.000 218.2 45.8 0.1960 0.0000 0.0000 0.0 0.0
11..3 0.000 218.2 45.8 0.1960 0.0000 0.0000 0.0 0.0
11..7 0.000 218.2 45.8 0.1960 0.0000 0.0000 0.0 0.0
11..9 0.000 218.2 45.8 0.1960 0.0000 0.0000 0.0 0.0
11..12 0.169 218.2 45.8 0.1960 0.0329 0.1680 7.2 7.7
12..13 0.124 218.2 45.8 0.1960 0.0242 0.1236 5.3 5.7
13..10 0.052 218.2 45.8 0.1960 0.0101 0.0513 2.2 2.4
13..8 0.000 218.2 45.8 0.1960 0.0000 0.0000 0.0 0.0
12..14 0.225 218.2 45.8 0.1960 0.0439 0.2237 9.6 10.3
14..4 0.000 218.2 45.8 0.1960 0.0000 0.0000 0.0 0.0
14..15 0.122 218.2 45.8 0.1960 0.0238 0.1212 5.2 5.6
15..5 0.078 218.2 45.8 0.1960 0.0152 0.0777 3.3 3.6
15..6 0.000 218.2 45.8 0.1960 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 7, 9, ((10, 8), (4, (5, 6)))); MP score: 47
lnL(ntime: 14 np: 19): -613.089803 +0.000000
11..1 11..2 11..3 11..7 11..9 11..12 12..13 13..10 13..8 12..14 14..4 14..15 15..5 15..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.169110 0.124411 0.051696 0.000004 0.225253 0.000004 0.122043 0.078186 0.000004 1.768096 0.893150 0.056855 0.099836 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.770730
(1: 0.000004, 2: 0.000004, 3: 0.000004, 7: 0.000004, 9: 0.000004, ((10: 0.051696, 8: 0.000004): 0.124411, (4: 0.000004, (5: 0.078186, 6: 0.000004): 0.122043): 0.225253): 0.169110);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C7: 0.000004, C9: 0.000004, ((C10: 0.051696, C8: 0.000004): 0.124411, (C4: 0.000004, (C5: 0.078186, C6: 0.000004): 0.122043): 0.225253): 0.169110);
Detailed output identifying parameters
kappa (ts/tv) = 1.76810
MLEs of dN/dS (w) for site classes (K=3)
p: 0.89315 0.05686 0.05000
w: 0.09984 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.000 218.2 45.8 0.1960 0.0000 0.0000 0.0 0.0
11..2 0.000 218.2 45.8 0.1960 0.0000 0.0000 0.0 0.0
11..3 0.000 218.2 45.8 0.1960 0.0000 0.0000 0.0 0.0
11..7 0.000 218.2 45.8 0.1960 0.0000 0.0000 0.0 0.0
11..9 0.000 218.2 45.8 0.1960 0.0000 0.0000 0.0 0.0
11..12 0.169 218.2 45.8 0.1960 0.0329 0.1680 7.2 7.7
12..13 0.124 218.2 45.8 0.1960 0.0242 0.1236 5.3 5.7
13..10 0.052 218.2 45.8 0.1960 0.0101 0.0513 2.2 2.4
13..8 0.000 218.2 45.8 0.1960 0.0000 0.0000 0.0 0.0
12..14 0.225 218.2 45.8 0.1960 0.0439 0.2237 9.6 10.3
14..4 0.000 218.2 45.8 0.1960 0.0000 0.0000 0.0 0.0
14..15 0.122 218.2 45.8 0.1960 0.0238 0.1212 5.2 5.6
15..5 0.078 218.2 45.8 0.1960 0.0152 0.0777 3.3 3.6
15..6 0.000 218.2 45.8 0.1960 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
9 L 0.632 2.634 +- 2.121
10 L 0.532 2.223 +- 1.947
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.327 0.668 0.005 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.290 0.203 0.155 0.110 0.076 0.053 0.039 0.030 0.024 0.020
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.056
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.036 0.231
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.005 0.022 0.120 0.518
sum of density on p0-p1 = 1.000000
Time used: 0:24
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 7, 9, ((10, 8), (4, (5, 6)))); MP score: 47
lnL(ntime: 14 np: 17): -613.007774 +0.000000
11..1 11..2 11..3 11..7 11..9 11..12 12..13 13..10 13..8 12..14 14..4 14..15 15..5 15..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.169288 0.121627 0.051427 0.000004 0.221914 0.000004 0.119327 0.076902 0.000004 1.749878 0.333496 1.431529
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.760516
(1: 0.000004, 2: 0.000004, 3: 0.000004, 7: 0.000004, 9: 0.000004, ((10: 0.051427, 8: 0.000004): 0.121627, (4: 0.000004, (5: 0.076902, 6: 0.000004): 0.119327): 0.221914): 0.169288);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C7: 0.000004, C9: 0.000004, ((C10: 0.051427, C8: 0.000004): 0.121627, (C4: 0.000004, (C5: 0.076902, C6: 0.000004): 0.119327): 0.221914): 0.169288);
Detailed output identifying parameters
kappa (ts/tv) = 1.74988
Parameters in M7 (beta):
p = 0.33350 q = 1.43153
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00008 0.00214 0.00991 0.02733 0.05867 0.10890 0.18448 0.29492 0.45743 0.71905
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.000 218.2 45.8 0.1863 0.0000 0.0000 0.0 0.0
11..2 0.000 218.2 45.8 0.1863 0.0000 0.0000 0.0 0.0
11..3 0.000 218.2 45.8 0.1863 0.0000 0.0000 0.0 0.0
11..7 0.000 218.2 45.8 0.1863 0.0000 0.0000 0.0 0.0
11..9 0.000 218.2 45.8 0.1863 0.0000 0.0000 0.0 0.0
11..12 0.169 218.2 45.8 0.1863 0.0321 0.1723 7.0 7.9
12..13 0.122 218.2 45.8 0.1863 0.0231 0.1238 5.0 5.7
13..10 0.051 218.2 45.8 0.1863 0.0098 0.0523 2.1 2.4
13..8 0.000 218.2 45.8 0.1863 0.0000 0.0000 0.0 0.0
12..14 0.222 218.2 45.8 0.1863 0.0421 0.2259 9.2 10.3
14..4 0.000 218.2 45.8 0.1863 0.0000 0.0000 0.0 0.0
14..15 0.119 218.2 45.8 0.1863 0.0226 0.1215 4.9 5.6
15..5 0.077 218.2 45.8 0.1863 0.0146 0.0783 3.2 3.6
15..6 0.000 218.2 45.8 0.1863 0.0000 0.0000 0.0 0.0
Time used: 1:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 7, 9, ((10, 8), (4, (5, 6)))); MP score: 47
check convergence..
lnL(ntime: 14 np: 19): -612.551320 +0.000000
11..1 11..2 11..3 11..7 11..9 11..12 12..13 13..10 13..8 12..14 14..4 14..15 15..5 15..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.178113 0.127780 0.053805 0.000004 0.232879 0.000004 0.127724 0.081427 0.000004 1.847887 0.975754 0.702616 3.916553 2.698913
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.801760
(1: 0.000004, 2: 0.000004, 3: 0.000004, 7: 0.000004, 9: 0.000004, ((10: 0.053805, 8: 0.000004): 0.127780, (4: 0.000004, (5: 0.081427, 6: 0.000004): 0.127724): 0.232879): 0.178113);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C7: 0.000004, C9: 0.000004, ((C10: 0.053805, C8: 0.000004): 0.127780, (C4: 0.000004, (C5: 0.081427, C6: 0.000004): 0.127724): 0.232879): 0.178113);
Detailed output identifying parameters
kappa (ts/tv) = 1.84789
Parameters in M8 (beta&w>1):
p0 = 0.97575 p = 0.70262 q = 3.91655
(p1 = 0.02425) w = 2.69891
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09758 0.09758 0.09758 0.09758 0.09758 0.09758 0.09758 0.09758 0.09758 0.09758 0.02425
w: 0.00327 0.01598 0.03411 0.05729 0.08605 0.12167 0.16656 0.22556 0.31038 0.46828 2.69891
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.000 218.0 46.0 0.2107 0.0000 0.0000 0.0 0.0
11..2 0.000 218.0 46.0 0.2107 0.0000 0.0000 0.0 0.0
11..3 0.000 218.0 46.0 0.2107 0.0000 0.0000 0.0 0.0
11..7 0.000 218.0 46.0 0.2107 0.0000 0.0000 0.0 0.0
11..9 0.000 218.0 46.0 0.2107 0.0000 0.0000 0.0 0.0
11..12 0.178 218.0 46.0 0.2107 0.0359 0.1705 7.8 7.8
12..13 0.128 218.0 46.0 0.2107 0.0258 0.1223 5.6 5.6
13..10 0.054 218.0 46.0 0.2107 0.0109 0.0515 2.4 2.4
13..8 0.000 218.0 46.0 0.2107 0.0000 0.0000 0.0 0.0
12..14 0.233 218.0 46.0 0.2107 0.0470 0.2230 10.2 10.2
14..4 0.000 218.0 46.0 0.2107 0.0000 0.0000 0.0 0.0
14..15 0.128 218.0 46.0 0.2107 0.0258 0.1223 5.6 5.6
15..5 0.081 218.0 46.0 0.2107 0.0164 0.0780 3.6 3.6
15..6 0.000 218.0 46.0 0.2107 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
9 L 0.805 2.248
10 L 0.665 1.917
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
9 L 0.754 2.609 +- 2.003
10 L 0.659 2.274 +- 1.889
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.040 0.959
p : 0.457 0.460 0.077 0.005 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.010 0.059 0.085 0.091 0.100 0.121 0.149 0.178 0.207
ws: 0.352 0.227 0.153 0.098 0.062 0.039 0.026 0.018 0.014 0.011
Time used: 2:14
Model 1: NearlyNeutral -613.089803 Model 2: PositiveSelection -613.089803 Model 7: beta -613.007774 Model 8: beta&w>1 -612.551320 Model 2 vs 1 0 Model 8 vs 7 .912908
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken. # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
