--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken.
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1169.46 -1182.71
2 -1168.96 -1180.58
--------------------------------------
TOTAL -1169.18 -1182.13
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.072150 0.000146 0.049802 0.096008 0.071346 1294.05 1397.52 1.000
r(A<->C){all} 0.122725 0.002862 0.028537 0.220576 0.117485 361.51 601.35 1.000
r(A<->G){all} 0.155857 0.003043 0.058435 0.262739 0.149809 412.08 539.40 1.000
r(A<->T){all} 0.144330 0.002125 0.057269 0.231419 0.140092 522.76 611.79 1.000
r(C<->G){all} 0.123211 0.003270 0.023511 0.232255 0.115078 263.49 330.84 1.001
r(C<->T){all} 0.369252 0.005671 0.238934 0.534390 0.365960 386.03 624.53 1.000
r(G<->T){all} 0.084624 0.001545 0.015165 0.161907 0.079509 575.85 680.51 1.001
pi(A){all} 0.262097 0.000290 0.227354 0.294891 0.262107 1187.83 1251.51 1.002
pi(C){all} 0.190247 0.000230 0.161796 0.220878 0.189713 1021.99 1175.95 1.000
pi(G){all} 0.204704 0.000229 0.173343 0.232938 0.204337 1136.60 1251.44 1.000
pi(T){all} 0.342953 0.000323 0.308087 0.377885 0.342292 1262.57 1292.45 1.000
alpha{1,2} 0.971024 0.933348 0.000151 2.906711 0.683960 1039.48 1142.39 1.003
alpha{3} 1.617887 1.422948 0.003574 3.958602 1.327765 1249.98 1372.87 1.000
pinvar{all} 0.232766 0.027763 0.000113 0.546846 0.205748 716.21 785.24 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
Model 1: NearlyNeutral -1111.253616
Model 2: PositiveSelection -1111.247454
Model 7: beta -1111.257287
Model 8: beta&w>1 -1111.254480
Model 2 vs 1 .012324
Model 8 vs 7 .005614
-- Starting log on Wed Oct 26 22:52:39 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=10, Len=219
C1 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C2 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C3 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C5 -MSNGSLTKDEVVNIIKNWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C6 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSTSMMVYVFKM
C7 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C8 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C9 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C10 MSSNGSLTKDEVVIIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
*********** ***:********************** *********
C1 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
C2 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
C3 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
C4 FILWLLWPASMALSIFSAIYPISLASQIISGILAAICAVMWLAYFVQSIR
C5 FILWLLWPASMALSIFSAIYPITIASQIISGILAAICAVMWLAYLVQSIR
C6 FILWLLWPASMALSIFSAIYPITIASQIISGILAAICAVMWLAYLVQSIR
C7 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
C8 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
C9 FILWLLWPASMALSIFSAIYPISLSSQIVSGILAAICAVMWLAYFVQSIR
C10 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
**********************:::***:***************:*****
C1 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C2 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C3 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C4 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C5 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C6 LFMRTGSWWSFN-ESNCLLNVPIGGTTVVRPLVEDSPSVTAVVNDGHLKM
C7 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C8 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C9 LLMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C10 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
*:********** ***********************.*************
C1 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C2 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C3 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C4 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C5 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVLRQSYGTNSVVAIFHRYKA
C6 AGMH-GRCDYDRLPMEITVAKPSVLIALKMVKRQSYRTNSVVAIFHRYKA
C7 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C8 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C9 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C10 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
**** ************************** **** *** *********
C1 GNYRRPTIIQDEELALLRA
C2 GNYRRPTIIQDEELALLRA
C3 GNYRRPTIIQDEELALLRA
C4 GNYRRPTIIQDEELALLRA
C5 GNYRRPTIIQDEELALLRA
C6 GNYRRPTIIQDEELALLRA
C7 GNYRRPTIIQDEELALLRA
C8 GNYRRPTIIQDEELALLRA
C9 GNYRRPTIIQDEELALLRA
C10 GNYRRPTIIQDEELALLRA
*******************
-- Starting log on Wed Oct 26 22:53:14 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.08 sec, SCORE=997, Nseq=10, Len=219
C1 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C2 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C3 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C5 -MSNGSLTKDEVVNIIKNWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C6 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSTSMMVYVFKM
C7 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C8 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C9 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C10 MSSNGSLTKDEVVIIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
*********** ***:********************** *********
C1 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
C2 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
C3 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
C4 FILWLLWPASMALSIFSAIYPISLASQIISGILAAICAVMWLAYFVQSIR
C5 FILWLLWPASMALSIFSAIYPITIASQIISGILAAICAVMWLAYLVQSIR
C6 FILWLLWPASMALSIFSAIYPITIASQIISGILAAICAVMWLAYLVQSIR
C7 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
C8 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
C9 FILWLLWPASMALSIFSAIYPISLSSQIVSGILAAICAVMWLAYFVQSIR
C10 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
**********************:::***:***************:*****
C1 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C2 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C3 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C4 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C5 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C6 LFMRTGSWWSFN-ESNCLLNVPIGGTTVVRPLVEDSPSVTAVVNDGHLKM
C7 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C8 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C9 LLMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C10 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
*:********** ***********************.*************
C1 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C2 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C3 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C4 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C5 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVLRQSYGTNSVVAIFHRYKA
C6 AGMH-GRCDYDRLPMEITVAKPSVLIALKMVKRQSYRTNSVVAIFHRYKA
C7 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C8 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C9 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C10 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
**** ************************** **** *** *********
C1 GNYRRPTIIQDEELALLRA
C2 GNYRRPTIIQDEELALLRA
C3 GNYRRPTIIQDEELALLRA
C4 GNYRRPTIIQDEELALLRA
C5 GNYRRPTIIQDEELALLRA
C6 GNYRRPTIIQDEELALLRA
C7 GNYRRPTIIQDEELALLRA
C8 GNYRRPTIIQDEELALLRA
C9 GNYRRPTIIQDEELALLRA
C10 GNYRRPTIIQDEELALLRA
*******************
-- Starting log on Wed Oct 26 23:05:01 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/gapped_alignment/codeml,B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 10 taxa and 657 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C10
Taxon 3 -> C2
Taxon 4 -> C3
Taxon 5 -> C4
Taxon 6 -> C5
Taxon 7 -> C6
Taxon 8 -> C7
Taxon 9 -> C8
Taxon 10 -> C9
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666825504
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 541521104
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1093011803
Seed = 220943034
Swapseed = 1666825504
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 19 unique site patterns
Division 2 has 13 unique site patterns
Division 3 has 21 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1567.694774 -- 35.653401
Chain 2 -- -1575.673215 -- 35.653401
Chain 3 -- -1481.848146 -- 35.653401
Chain 4 -- -1571.807352 -- 35.653401
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1444.432550 -- 35.653401
Chain 2 -- -1559.387817 -- 35.653401
Chain 3 -- -1572.149425 -- 35.653401
Chain 4 -- -1449.132771 -- 35.653401
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1567.695] (-1575.673) (-1481.848) (-1571.807) * [-1444.433] (-1559.388) (-1572.149) (-1449.133)
1000 -- [-1171.888] (-1188.371) (-1187.018) (-1186.619) * (-1178.105) (-1180.066) (-1175.848) [-1173.769] -- 0:16:39
2000 -- (-1177.675) [-1168.019] (-1177.651) (-1182.609) * (-1172.608) [-1174.181] (-1179.339) (-1173.076) -- 0:08:19
3000 -- [-1178.099] (-1172.123) (-1171.997) (-1174.830) * (-1174.999) (-1179.949) [-1173.238] (-1180.228) -- 0:05:32
4000 -- (-1179.610) [-1175.906] (-1178.679) (-1176.094) * [-1174.825] (-1182.178) (-1171.370) (-1181.795) -- 0:04:09
5000 -- (-1172.625) (-1176.904) (-1189.487) [-1170.018] * (-1178.727) [-1175.771] (-1174.999) (-1174.319) -- 0:06:38
Average standard deviation of split frequencies: 0.082309
6000 -- (-1176.172) [-1172.886] (-1179.620) (-1176.648) * (-1177.097) [-1176.159] (-1170.747) (-1183.714) -- 0:05:31
7000 -- (-1169.921) (-1179.645) [-1177.661] (-1176.893) * [-1183.353] (-1172.833) (-1179.336) (-1184.949) -- 0:04:43
8000 -- (-1176.561) (-1176.899) [-1172.422] (-1174.398) * [-1171.911] (-1172.406) (-1168.627) (-1183.205) -- 0:04:08
9000 -- (-1177.936) (-1175.591) [-1170.807] (-1179.131) * [-1175.436] (-1177.417) (-1181.716) (-1180.526) -- 0:05:30
10000 -- (-1178.114) (-1176.144) [-1167.438] (-1172.635) * [-1175.360] (-1176.308) (-1179.616) (-1184.387) -- 0:04:57
Average standard deviation of split frequencies: 0.062274
11000 -- (-1177.149) (-1170.921) [-1174.638] (-1175.202) * (-1180.546) (-1175.722) [-1179.088] (-1174.814) -- 0:04:29
12000 -- (-1170.961) (-1177.995) (-1178.309) [-1172.594] * [-1168.089] (-1179.913) (-1178.498) (-1176.075) -- 0:04:07
13000 -- (-1169.403) (-1175.312) [-1175.414] (-1175.755) * (-1176.094) (-1183.650) (-1169.452) [-1172.209] -- 0:05:03
14000 -- (-1167.780) [-1174.364] (-1178.806) (-1181.333) * (-1177.641) (-1173.950) [-1172.812] (-1176.557) -- 0:04:41
15000 -- (-1182.060) (-1169.830) [-1181.077] (-1171.886) * (-1183.472) (-1174.650) (-1170.887) [-1174.266] -- 0:04:22
Average standard deviation of split frequencies: 0.042855
16000 -- [-1172.480] (-1179.085) (-1184.494) (-1170.567) * (-1172.904) (-1170.855) [-1166.919] (-1176.724) -- 0:04:06
17000 -- (-1176.553) (-1178.644) [-1170.695] (-1180.448) * [-1173.582] (-1169.498) (-1178.961) (-1172.084) -- 0:04:49
18000 -- [-1169.172] (-1178.668) (-1176.399) (-1177.698) * [-1168.093] (-1175.921) (-1176.975) (-1178.216) -- 0:04:32
19000 -- (-1172.238) (-1178.666) (-1184.175) [-1189.754] * (-1178.362) (-1187.410) (-1168.582) [-1170.900] -- 0:04:18
20000 -- [-1169.593] (-1186.946) (-1172.726) (-1174.352) * (-1167.769) (-1184.320) [-1173.072] (-1186.637) -- 0:04:05
Average standard deviation of split frequencies: 0.044628
21000 -- [-1174.225] (-1177.380) (-1183.623) (-1173.594) * (-1176.291) (-1177.299) [-1181.858] (-1183.018) -- 0:04:39
22000 -- [-1173.315] (-1186.630) (-1179.130) (-1176.510) * (-1172.312) (-1174.055) (-1172.466) [-1171.484] -- 0:04:26
23000 -- (-1174.840) (-1175.601) (-1179.773) [-1174.994] * (-1174.960) [-1173.727] (-1178.690) (-1177.022) -- 0:04:14
24000 -- (-1173.359) [-1177.621] (-1178.245) (-1169.482) * [-1181.788] (-1180.486) (-1175.691) (-1177.139) -- 0:04:04
25000 -- [-1170.871] (-1177.465) (-1180.511) (-1180.428) * (-1174.907) (-1173.050) (-1185.036) [-1168.269] -- 0:04:33
Average standard deviation of split frequencies: 0.041780
26000 -- (-1168.571) (-1177.319) (-1177.563) [-1168.924] * (-1173.040) [-1171.270] (-1181.149) (-1185.037) -- 0:04:22
27000 -- (-1173.388) (-1174.216) (-1181.020) [-1168.283] * (-1177.855) [-1171.940] (-1179.026) (-1173.152) -- 0:04:12
28000 -- (-1169.965) [-1171.062] (-1175.557) (-1175.508) * (-1182.421) (-1176.243) (-1184.977) [-1178.594] -- 0:04:03
29000 -- (-1175.454) (-1178.762) [-1175.644] (-1182.770) * (-1171.809) (-1175.929) (-1185.810) [-1175.913] -- 0:04:27
30000 -- (-1179.523) (-1174.604) [-1181.293] (-1179.299) * (-1181.447) (-1175.772) [-1173.103] (-1171.840) -- 0:04:18
Average standard deviation of split frequencies: 0.039128
31000 -- (-1170.702) [-1180.253] (-1176.920) (-1181.579) * (-1173.497) (-1178.221) (-1174.825) [-1172.517] -- 0:04:10
32000 -- (-1181.777) (-1182.715) [-1166.808] (-1181.920) * (-1180.284) (-1180.694) [-1172.778] (-1170.433) -- 0:04:02
33000 -- (-1176.122) (-1175.384) (-1178.283) [-1173.050] * (-1183.446) (-1173.808) [-1178.083] (-1174.664) -- 0:04:23
34000 -- (-1177.837) (-1181.437) [-1173.119] (-1172.755) * (-1181.228) [-1169.246] (-1175.163) (-1173.151) -- 0:04:15
35000 -- (-1183.449) (-1175.471) [-1171.428] (-1170.945) * (-1174.518) (-1180.188) [-1170.380] (-1175.719) -- 0:04:08
Average standard deviation of split frequencies: 0.031427
36000 -- (-1176.122) [-1178.276] (-1171.340) (-1175.747) * (-1171.016) [-1177.502] (-1182.160) (-1166.886) -- 0:04:27
37000 -- (-1178.681) (-1186.481) [-1174.390] (-1177.238) * (-1172.860) (-1174.014) [-1169.544] (-1177.937) -- 0:04:20
38000 -- (-1180.662) (-1178.062) [-1170.304] (-1172.842) * [-1174.285] (-1176.690) (-1181.743) (-1179.417) -- 0:04:13
39000 -- (-1172.680) (-1172.716) (-1179.516) [-1171.617] * (-1183.010) (-1176.419) (-1178.440) [-1175.505] -- 0:04:06
40000 -- (-1180.976) (-1186.669) [-1173.061] (-1172.058) * (-1174.721) (-1173.449) (-1176.799) [-1172.128] -- 0:04:24
Average standard deviation of split frequencies: 0.023184
41000 -- (-1178.436) (-1177.720) (-1173.689) [-1170.087] * (-1183.043) [-1169.230] (-1170.503) (-1178.055) -- 0:04:17
42000 -- [-1181.194] (-1183.164) (-1168.728) (-1182.397) * (-1174.459) (-1181.150) [-1169.363] (-1169.653) -- 0:04:10
43000 -- (-1185.257) [-1178.418] (-1170.909) (-1173.703) * (-1172.436) [-1169.968] (-1173.129) (-1179.839) -- 0:04:04
44000 -- (-1178.243) [-1173.075] (-1182.041) (-1181.526) * (-1192.669) (-1173.397) (-1183.833) [-1170.184] -- 0:04:20
45000 -- [-1172.877] (-1183.436) (-1180.570) (-1173.890) * (-1183.190) [-1172.322] (-1168.933) (-1175.381) -- 0:04:14
Average standard deviation of split frequencies: 0.030231
46000 -- (-1175.122) (-1179.649) [-1181.492] (-1175.624) * (-1180.592) (-1172.151) [-1176.265] (-1174.208) -- 0:04:08
47000 -- [-1175.676] (-1183.175) (-1178.290) (-1182.670) * (-1178.905) [-1171.466] (-1172.893) (-1184.800) -- 0:04:03
48000 -- [-1167.848] (-1174.471) (-1177.764) (-1174.506) * [-1165.206] (-1172.143) (-1170.496) (-1176.073) -- 0:04:17
49000 -- (-1179.606) (-1179.995) (-1171.488) [-1178.561] * (-1174.364) (-1181.261) (-1178.271) [-1176.201] -- 0:04:12
50000 -- (-1177.187) (-1183.092) (-1175.552) [-1166.788] * (-1176.375) [-1174.390] (-1177.261) (-1172.713) -- 0:04:06
Average standard deviation of split frequencies: 0.033495
51000 -- (-1176.799) [-1172.437] (-1177.214) (-1175.119) * [-1181.709] (-1179.702) (-1169.912) (-1180.420) -- 0:04:20
52000 -- (-1177.226) (-1187.784) [-1172.545] (-1175.548) * [-1173.610] (-1183.532) (-1172.867) (-1180.123) -- 0:04:15
53000 -- (-1179.057) [-1172.203] (-1183.764) (-1176.117) * (-1179.694) [-1170.831] (-1168.718) (-1176.106) -- 0:04:10
54000 -- [-1166.711] (-1178.429) (-1176.176) (-1171.885) * (-1175.377) (-1169.673) (-1175.483) [-1183.218] -- 0:04:05
55000 -- [-1170.734] (-1177.194) (-1175.896) (-1174.234) * (-1174.643) [-1170.182] (-1176.150) (-1172.991) -- 0:04:17
Average standard deviation of split frequencies: 0.035355
56000 -- (-1182.519) (-1170.283) (-1177.758) [-1170.455] * (-1183.131) (-1172.060) (-1182.526) [-1169.477] -- 0:04:12
57000 -- (-1176.182) [-1170.686] (-1179.085) (-1173.148) * (-1178.276) [-1174.508] (-1176.002) (-1175.788) -- 0:04:08
58000 -- (-1173.400) (-1180.147) [-1174.890] (-1186.591) * [-1167.722] (-1171.752) (-1178.248) (-1173.199) -- 0:04:03
59000 -- [-1174.820] (-1177.349) (-1172.344) (-1171.937) * (-1176.144) (-1183.319) [-1179.015] (-1185.715) -- 0:04:15
60000 -- (-1173.697) (-1177.195) [-1182.412] (-1177.832) * (-1176.853) (-1175.664) (-1173.749) [-1168.671] -- 0:04:10
Average standard deviation of split frequencies: 0.038852
61000 -- (-1178.192) (-1171.428) (-1173.070) [-1171.121] * (-1175.364) (-1174.703) (-1180.347) [-1172.753] -- 0:04:06
62000 -- [-1177.935] (-1180.248) (-1172.841) (-1175.590) * (-1178.464) (-1184.555) [-1172.256] (-1190.291) -- 0:04:02
63000 -- (-1187.027) (-1178.186) (-1181.265) [-1179.271] * (-1165.958) (-1184.126) (-1176.542) [-1167.343] -- 0:04:12
64000 -- [-1170.063] (-1178.800) (-1169.239) (-1183.080) * (-1175.448) [-1180.446] (-1177.726) (-1181.554) -- 0:04:08
65000 -- (-1176.358) (-1179.350) (-1179.501) [-1169.637] * (-1183.232) (-1184.126) (-1178.219) [-1181.745] -- 0:04:04
Average standard deviation of split frequencies: 0.041069
66000 -- (-1181.077) (-1184.555) [-1174.047] (-1177.768) * [-1172.140] (-1188.077) (-1179.574) (-1172.867) -- 0:04:00
67000 -- [-1173.449] (-1178.009) (-1177.136) (-1180.044) * [-1171.546] (-1182.216) (-1176.665) (-1173.425) -- 0:04:10
68000 -- (-1175.343) (-1177.148) (-1181.661) [-1175.220] * (-1170.599) (-1182.345) (-1171.729) [-1179.443] -- 0:04:06
69000 -- [-1170.050] (-1183.561) (-1175.720) (-1174.654) * (-1170.905) [-1180.090] (-1180.531) (-1172.552) -- 0:04:02
70000 -- (-1179.266) [-1171.970] (-1181.514) (-1174.770) * (-1179.534) (-1176.966) (-1182.612) [-1176.004] -- 0:03:59
Average standard deviation of split frequencies: 0.035022
71000 -- [-1170.283] (-1175.283) (-1177.616) (-1177.453) * (-1178.597) (-1178.828) [-1171.239] (-1175.676) -- 0:04:08
72000 -- [-1176.159] (-1174.179) (-1176.109) (-1182.919) * (-1182.429) (-1181.088) (-1172.832) [-1171.377] -- 0:04:04
73000 -- (-1171.746) (-1173.400) (-1176.397) [-1175.550] * (-1180.440) (-1195.797) [-1175.658] (-1177.186) -- 0:04:01
74000 -- (-1183.191) [-1168.645] (-1179.949) (-1179.976) * [-1168.681] (-1178.183) (-1180.499) (-1173.102) -- 0:04:10
75000 -- (-1177.634) (-1179.094) (-1171.880) [-1176.256] * (-1184.686) (-1173.803) [-1176.315] (-1173.257) -- 0:04:06
Average standard deviation of split frequencies: 0.028843
76000 -- (-1175.571) (-1171.376) [-1174.477] (-1175.475) * (-1176.862) (-1174.784) (-1175.562) [-1177.927] -- 0:04:03
77000 -- [-1177.206] (-1172.266) (-1174.885) (-1177.888) * (-1178.039) (-1180.077) (-1176.461) [-1172.070] -- 0:03:59
78000 -- (-1181.365) (-1171.072) [-1174.225] (-1173.564) * (-1177.134) (-1183.224) (-1167.931) [-1170.663] -- 0:04:08
79000 -- (-1177.056) (-1175.995) (-1167.892) [-1177.930] * (-1182.686) (-1176.804) [-1178.005] (-1170.129) -- 0:04:04
80000 -- [-1176.555] (-1172.481) (-1173.043) (-1174.685) * (-1177.694) [-1174.522] (-1173.327) (-1173.224) -- 0:04:01
Average standard deviation of split frequencies: 0.031265
81000 -- (-1172.952) (-1170.595) (-1174.877) [-1175.301] * (-1179.529) (-1177.906) [-1178.928] (-1171.796) -- 0:03:58
82000 -- (-1176.944) (-1178.878) (-1172.261) [-1176.160] * [-1173.298] (-1169.629) (-1170.560) (-1174.238) -- 0:04:06
83000 -- [-1171.167] (-1170.217) (-1177.568) (-1184.026) * (-1174.088) (-1179.463) (-1174.251) [-1190.329] -- 0:04:03
84000 -- (-1168.517) (-1172.385) (-1180.086) [-1176.721] * (-1181.192) (-1179.028) [-1177.947] (-1170.878) -- 0:03:59
85000 -- [-1174.512] (-1175.264) (-1170.135) (-1190.162) * (-1169.950) [-1170.565] (-1183.762) (-1178.547) -- 0:03:56
Average standard deviation of split frequencies: 0.029495
86000 -- (-1181.418) (-1184.416) [-1173.832] (-1171.951) * [-1165.091] (-1173.220) (-1179.699) (-1177.197) -- 0:04:04
87000 -- (-1174.308) [-1187.063] (-1176.234) (-1172.143) * (-1176.264) (-1179.215) (-1174.837) [-1173.857] -- 0:04:01
88000 -- [-1172.762] (-1176.332) (-1172.659) (-1170.389) * [-1180.708] (-1177.965) (-1170.675) (-1175.496) -- 0:03:58
89000 -- [-1177.070] (-1180.874) (-1191.610) (-1171.638) * (-1178.140) (-1175.567) (-1179.786) [-1179.566] -- 0:03:55
90000 -- [-1174.719] (-1180.991) (-1181.085) (-1171.165) * [-1168.920] (-1176.013) (-1170.159) (-1174.881) -- 0:04:02
Average standard deviation of split frequencies: 0.029215
91000 -- (-1170.518) (-1175.423) (-1180.005) [-1171.201] * (-1171.941) [-1172.687] (-1178.651) (-1176.695) -- 0:03:59
92000 -- (-1174.082) (-1180.664) (-1178.931) [-1169.789] * [-1179.346] (-1181.078) (-1175.396) (-1186.805) -- 0:03:56
93000 -- (-1175.487) (-1179.448) [-1175.366] (-1179.666) * (-1181.360) (-1167.202) (-1174.130) [-1178.949] -- 0:03:54
94000 -- (-1178.069) [-1173.258] (-1177.356) (-1177.189) * (-1176.653) (-1165.810) (-1171.565) [-1186.546] -- 0:04:00
95000 -- (-1176.189) [-1169.867] (-1177.740) (-1174.199) * (-1175.815) [-1168.534] (-1177.345) (-1179.627) -- 0:03:58
Average standard deviation of split frequencies: 0.027358
96000 -- [-1171.482] (-1188.567) (-1180.651) (-1173.129) * (-1173.712) [-1171.018] (-1172.318) (-1169.830) -- 0:03:55
97000 -- (-1167.094) (-1169.610) [-1181.737] (-1175.722) * (-1168.943) [-1171.623] (-1171.192) (-1170.532) -- 0:03:52
98000 -- (-1168.023) (-1190.020) (-1194.469) [-1167.407] * [-1174.317] (-1172.494) (-1176.838) (-1176.459) -- 0:03:59
99000 -- (-1167.327) [-1178.555] (-1176.085) (-1174.571) * (-1169.055) (-1168.792) [-1175.649] (-1184.766) -- 0:03:56
100000 -- (-1174.098) (-1186.437) [-1184.373] (-1180.572) * (-1178.810) [-1174.529] (-1175.244) (-1180.487) -- 0:03:53
Average standard deviation of split frequencies: 0.026618
101000 -- (-1179.958) [-1174.515] (-1187.254) (-1187.200) * (-1186.426) (-1184.155) [-1173.456] (-1178.389) -- 0:03:51
102000 -- (-1176.385) (-1182.387) (-1173.749) [-1179.975] * (-1173.251) (-1178.127) (-1175.362) [-1174.221] -- 0:03:57
103000 -- (-1171.874) (-1180.816) [-1175.644] (-1172.508) * (-1172.202) [-1172.014] (-1174.059) (-1172.051) -- 0:03:55
104000 -- (-1171.762) [-1173.787] (-1173.418) (-1178.069) * (-1177.105) (-1177.054) (-1180.606) [-1173.361] -- 0:03:52
105000 -- (-1175.064) [-1170.841] (-1173.117) (-1174.429) * (-1182.663) (-1179.425) [-1175.008] (-1177.810) -- 0:03:58
Average standard deviation of split frequencies: 0.024662
106000 -- (-1171.957) (-1173.733) (-1183.843) [-1171.709] * (-1175.779) (-1178.750) (-1178.639) [-1169.286] -- 0:03:56
107000 -- (-1176.273) [-1173.711] (-1176.308) (-1186.397) * [-1168.734] (-1176.915) (-1176.260) (-1175.104) -- 0:03:53
108000 -- (-1174.128) [-1176.796] (-1175.388) (-1183.203) * (-1168.027) (-1186.362) [-1174.134] (-1171.264) -- 0:03:51
109000 -- (-1180.452) (-1177.088) [-1180.690] (-1189.509) * (-1177.231) (-1177.814) (-1180.683) [-1174.957] -- 0:03:57
110000 -- (-1177.062) (-1175.651) (-1179.940) [-1181.023] * (-1176.950) [-1171.177] (-1184.791) (-1182.614) -- 0:03:54
Average standard deviation of split frequencies: 0.025345
111000 -- (-1178.560) (-1180.421) [-1174.936] (-1171.983) * [-1168.957] (-1189.036) (-1180.956) (-1173.766) -- 0:03:52
112000 -- (-1172.070) (-1176.522) (-1170.922) [-1178.198] * (-1174.459) [-1168.719] (-1179.558) (-1174.230) -- 0:03:49
113000 -- (-1174.198) (-1175.389) [-1183.372] (-1181.271) * (-1192.979) (-1177.109) (-1174.652) [-1173.316] -- 0:03:55
114000 -- (-1174.263) (-1177.166) [-1179.147] (-1181.487) * (-1176.866) (-1179.888) [-1178.578] (-1174.186) -- 0:03:53
115000 -- (-1188.012) (-1179.170) (-1170.049) [-1179.654] * (-1175.159) [-1175.343] (-1175.166) (-1176.080) -- 0:03:50
Average standard deviation of split frequencies: 0.023164
116000 -- (-1180.552) (-1174.430) (-1171.291) [-1171.736] * (-1167.813) (-1175.303) [-1169.009] (-1173.193) -- 0:03:48
117000 -- (-1190.214) (-1178.244) (-1164.389) [-1173.041] * (-1176.380) [-1174.841] (-1170.932) (-1180.174) -- 0:03:53
118000 -- (-1187.337) (-1176.014) (-1169.881) [-1172.584] * (-1166.522) (-1178.233) [-1174.200] (-1168.253) -- 0:03:51
119000 -- (-1181.284) (-1172.898) (-1172.605) [-1171.938] * (-1179.404) (-1193.588) [-1175.146] (-1181.047) -- 0:03:49
120000 -- (-1174.836) [-1171.543] (-1183.217) (-1172.017) * [-1170.866] (-1174.652) (-1172.646) (-1167.634) -- 0:03:47
Average standard deviation of split frequencies: 0.023049
121000 -- (-1174.842) (-1175.235) (-1170.886) [-1176.419] * (-1175.154) [-1169.986] (-1173.613) (-1173.568) -- 0:03:52
122000 -- (-1178.372) (-1176.138) (-1177.846) [-1175.814] * (-1174.329) (-1179.049) (-1177.297) [-1170.907] -- 0:03:50
123000 -- (-1174.589) (-1179.884) (-1174.334) [-1166.606] * (-1171.833) (-1170.852) [-1174.803] (-1173.815) -- 0:03:48
124000 -- [-1183.022] (-1179.173) (-1179.274) (-1179.542) * (-1168.744) [-1175.272] (-1186.517) (-1176.099) -- 0:03:46
125000 -- [-1175.925] (-1180.848) (-1180.581) (-1173.790) * (-1181.660) (-1176.218) (-1186.120) [-1172.517] -- 0:03:51
Average standard deviation of split frequencies: 0.020844
126000 -- (-1182.049) (-1182.596) [-1174.062] (-1173.185) * (-1180.537) (-1171.627) [-1171.997] (-1175.677) -- 0:03:48
127000 -- (-1179.249) (-1175.997) [-1168.813] (-1175.220) * (-1177.243) (-1169.986) (-1173.154) [-1174.810] -- 0:03:46
128000 -- [-1169.815] (-1180.891) (-1177.285) (-1183.758) * (-1177.747) [-1172.041] (-1170.846) (-1171.605) -- 0:03:44
129000 -- (-1173.255) [-1173.886] (-1185.036) (-1174.665) * (-1184.761) (-1183.621) [-1177.251] (-1188.517) -- 0:03:49
130000 -- (-1171.127) [-1171.529] (-1170.243) (-1177.363) * [-1172.870] (-1172.002) (-1168.155) (-1176.278) -- 0:03:47
Average standard deviation of split frequencies: 0.018580
131000 -- (-1181.852) (-1175.908) (-1182.444) [-1171.308] * (-1182.399) (-1174.916) [-1177.267] (-1175.313) -- 0:03:45
132000 -- (-1176.145) (-1183.090) (-1180.810) [-1171.497] * (-1179.732) (-1177.826) (-1180.477) [-1169.928] -- 0:03:43
133000 -- [-1177.803] (-1176.380) (-1174.356) (-1180.182) * (-1175.597) [-1172.340] (-1175.068) (-1175.422) -- 0:03:48
134000 -- (-1179.183) (-1176.691) [-1178.364] (-1172.564) * [-1174.749] (-1175.296) (-1181.514) (-1171.467) -- 0:03:46
135000 -- [-1172.745] (-1178.097) (-1179.369) (-1183.830) * (-1174.938) [-1177.192] (-1173.526) (-1183.662) -- 0:03:44
Average standard deviation of split frequencies: 0.018371
136000 -- (-1169.738) (-1183.434) (-1175.847) [-1179.240] * (-1182.556) (-1174.427) [-1172.395] (-1171.327) -- 0:03:42
137000 -- (-1177.126) (-1173.236) [-1175.141] (-1181.915) * (-1174.051) [-1178.594] (-1182.865) (-1176.438) -- 0:03:46
138000 -- (-1176.397) (-1174.481) [-1175.662] (-1177.769) * (-1173.258) (-1171.520) (-1178.507) [-1172.534] -- 0:03:44
139000 -- (-1183.039) (-1172.435) (-1178.806) [-1170.981] * [-1173.103] (-1176.774) (-1174.905) (-1176.542) -- 0:03:42
140000 -- [-1174.289] (-1169.632) (-1177.211) (-1182.855) * (-1170.428) (-1168.701) (-1178.895) [-1167.038] -- 0:03:41
Average standard deviation of split frequencies: 0.020284
141000 -- (-1170.137) [-1170.322] (-1174.953) (-1171.426) * (-1173.816) (-1177.255) (-1173.581) [-1176.837] -- 0:03:45
142000 -- (-1173.134) [-1170.655] (-1178.200) (-1171.652) * (-1176.298) (-1175.519) (-1175.297) [-1176.893] -- 0:03:43
143000 -- (-1175.379) (-1181.866) (-1190.689) [-1175.311] * (-1183.118) [-1176.043] (-1171.989) (-1173.942) -- 0:03:41
144000 -- [-1181.644] (-1169.955) (-1178.275) (-1172.100) * (-1176.832) (-1169.442) (-1175.012) [-1172.737] -- 0:03:45
145000 -- (-1177.186) (-1171.317) [-1176.373] (-1179.498) * (-1176.847) (-1173.996) [-1172.579] (-1187.608) -- 0:03:44
Average standard deviation of split frequencies: 0.017334
146000 -- (-1175.365) (-1180.800) (-1195.301) [-1168.821] * (-1177.095) (-1177.353) (-1178.941) [-1170.943] -- 0:03:42
147000 -- (-1174.261) (-1169.028) (-1179.030) [-1172.424] * (-1180.714) (-1174.304) [-1170.633] (-1186.920) -- 0:03:40
148000 -- (-1176.249) (-1174.397) [-1174.091] (-1176.881) * [-1174.412] (-1178.321) (-1177.958) (-1173.685) -- 0:03:44
149000 -- (-1174.864) [-1174.190] (-1181.156) (-1174.142) * [-1170.501] (-1178.705) (-1184.469) (-1176.462) -- 0:03:42
150000 -- (-1174.829) (-1178.164) [-1178.118] (-1175.314) * [-1178.169] (-1181.370) (-1176.356) (-1178.373) -- 0:03:40
Average standard deviation of split frequencies: 0.017052
151000 -- (-1179.885) (-1170.075) [-1173.473] (-1170.499) * (-1175.398) [-1180.541] (-1176.018) (-1174.255) -- 0:03:39
152000 -- (-1172.213) (-1172.060) (-1172.283) [-1173.667] * (-1176.700) (-1175.479) (-1179.598) [-1171.525] -- 0:03:43
153000 -- (-1183.645) (-1176.710) [-1179.606] (-1175.076) * (-1170.103) (-1177.144) (-1173.209) [-1171.524] -- 0:03:41
154000 -- (-1187.819) (-1176.977) [-1167.829] (-1189.270) * (-1170.094) [-1174.238] (-1169.743) (-1168.662) -- 0:03:39
155000 -- (-1179.885) (-1176.054) [-1178.507] (-1170.387) * [-1173.937] (-1174.270) (-1174.138) (-1175.088) -- 0:03:38
Average standard deviation of split frequencies: 0.016620
156000 -- (-1180.967) (-1170.862) [-1172.514] (-1179.678) * [-1165.060] (-1180.717) (-1182.465) (-1174.637) -- 0:03:41
157000 -- (-1179.836) (-1177.667) [-1170.094] (-1171.246) * (-1171.820) (-1173.292) [-1173.194] (-1176.683) -- 0:03:40
158000 -- (-1178.429) [-1177.540] (-1174.170) (-1171.195) * [-1169.644] (-1171.796) (-1181.110) (-1168.988) -- 0:03:38
159000 -- [-1171.458] (-1172.770) (-1173.182) (-1179.692) * [-1170.918] (-1178.230) (-1174.265) (-1171.260) -- 0:03:36
160000 -- [-1172.702] (-1167.286) (-1181.717) (-1180.847) * (-1172.331) (-1178.225) (-1173.431) [-1174.089] -- 0:03:40
Average standard deviation of split frequencies: 0.017450
161000 -- (-1180.174) [-1179.038] (-1180.340) (-1175.095) * (-1175.743) (-1177.794) (-1177.232) [-1170.183] -- 0:03:38
162000 -- (-1176.129) [-1175.025] (-1182.054) (-1184.767) * (-1173.567) (-1183.117) [-1171.881] (-1186.107) -- 0:03:37
163000 -- (-1178.925) (-1174.830) (-1172.837) [-1170.800] * [-1169.381] (-1173.255) (-1182.389) (-1181.926) -- 0:03:35
164000 -- [-1171.957] (-1173.136) (-1181.081) (-1183.578) * (-1177.009) (-1175.700) [-1179.925] (-1184.696) -- 0:03:39
165000 -- [-1170.215] (-1172.596) (-1181.052) (-1176.206) * (-1179.989) (-1178.990) [-1173.598] (-1173.654) -- 0:03:37
Average standard deviation of split frequencies: 0.015395
166000 -- (-1184.049) (-1177.149) (-1178.372) [-1181.573] * (-1174.143) [-1171.209] (-1178.483) (-1168.201) -- 0:03:36
167000 -- [-1172.431] (-1176.558) (-1174.589) (-1178.915) * (-1176.213) [-1170.562] (-1176.355) (-1169.219) -- 0:03:34
168000 -- (-1172.951) [-1175.877] (-1174.372) (-1177.539) * (-1179.361) (-1176.728) (-1185.727) [-1176.357] -- 0:03:37
169000 -- (-1166.103) (-1174.811) [-1170.293] (-1177.033) * (-1183.459) [-1172.319] (-1170.407) (-1181.983) -- 0:03:36
170000 -- (-1174.341) (-1178.862) [-1176.243] (-1173.615) * (-1178.434) [-1172.130] (-1181.977) (-1182.436) -- 0:03:34
Average standard deviation of split frequencies: 0.017445
171000 -- [-1174.643] (-1182.353) (-1172.838) (-1176.785) * [-1169.450] (-1192.346) (-1175.328) (-1168.551) -- 0:03:33
172000 -- [-1170.538] (-1176.377) (-1178.222) (-1169.568) * (-1178.912) (-1169.733) (-1168.220) [-1170.084] -- 0:03:36
173000 -- [-1172.861] (-1178.671) (-1186.036) (-1178.415) * (-1184.420) [-1171.707] (-1173.896) (-1176.287) -- 0:03:35
174000 -- [-1176.205] (-1178.990) (-1171.908) (-1181.989) * (-1182.727) [-1172.165] (-1174.330) (-1166.550) -- 0:03:33
175000 -- [-1179.700] (-1178.938) (-1172.403) (-1174.395) * (-1175.799) (-1180.011) (-1177.293) [-1168.831] -- 0:03:32
Average standard deviation of split frequencies: 0.016212
176000 -- [-1167.478] (-1178.577) (-1176.660) (-1174.723) * (-1189.429) (-1180.710) [-1179.410] (-1185.519) -- 0:03:35
177000 -- (-1172.714) (-1172.051) (-1170.490) [-1176.193] * (-1172.947) (-1170.770) (-1174.504) [-1173.849] -- 0:03:33
178000 -- (-1178.052) (-1178.317) (-1171.259) [-1175.601] * [-1170.733] (-1171.695) (-1179.550) (-1176.782) -- 0:03:32
179000 -- (-1190.291) (-1182.595) (-1182.819) [-1170.391] * (-1175.928) [-1170.247] (-1185.230) (-1180.232) -- 0:03:35
180000 -- [-1171.322] (-1175.268) (-1170.935) (-1169.650) * [-1168.808] (-1180.432) (-1184.497) (-1184.091) -- 0:03:34
Average standard deviation of split frequencies: 0.016342
181000 -- (-1175.355) (-1174.008) [-1169.074] (-1166.824) * [-1177.131] (-1188.119) (-1174.598) (-1175.246) -- 0:03:32
182000 -- [-1177.585] (-1179.176) (-1181.222) (-1168.487) * (-1182.059) (-1175.712) [-1178.207] (-1180.199) -- 0:03:31
183000 -- (-1174.692) (-1178.401) [-1175.899] (-1173.134) * (-1181.431) (-1176.496) (-1184.339) [-1177.232] -- 0:03:34
184000 -- [-1167.558] (-1182.384) (-1186.781) (-1177.121) * (-1180.480) [-1175.185] (-1179.553) (-1180.161) -- 0:03:32
185000 -- (-1173.741) (-1177.311) (-1176.117) [-1171.240] * (-1181.552) (-1186.490) (-1172.669) [-1173.249] -- 0:03:31
Average standard deviation of split frequencies: 0.017874
186000 -- (-1176.712) [-1184.781] (-1170.173) (-1174.877) * (-1187.171) [-1176.591] (-1175.587) (-1185.899) -- 0:03:30
187000 -- (-1178.658) (-1181.602) [-1172.919] (-1174.850) * (-1184.888) (-1188.126) [-1171.723] (-1173.395) -- 0:03:33
188000 -- [-1171.996] (-1173.814) (-1175.564) (-1175.856) * (-1184.529) (-1179.115) (-1173.388) [-1175.592] -- 0:03:31
189000 -- (-1182.842) [-1177.591] (-1171.718) (-1175.759) * [-1173.587] (-1178.970) (-1167.925) (-1183.528) -- 0:03:30
190000 -- (-1186.456) (-1182.138) (-1174.759) [-1173.882] * (-1180.214) (-1181.999) [-1175.373] (-1173.791) -- 0:03:28
Average standard deviation of split frequencies: 0.018348
191000 -- [-1180.639] (-1175.948) (-1174.516) (-1175.177) * (-1180.787) (-1174.191) (-1177.830) [-1170.627] -- 0:03:31
192000 -- [-1175.137] (-1172.313) (-1175.534) (-1173.939) * (-1179.400) (-1178.952) [-1171.043] (-1174.731) -- 0:03:30
193000 -- (-1180.478) [-1168.607] (-1181.851) (-1179.197) * (-1176.849) (-1171.017) (-1174.779) [-1177.781] -- 0:03:29
194000 -- (-1172.349) [-1170.399] (-1188.133) (-1175.418) * [-1172.144] (-1179.754) (-1174.091) (-1181.848) -- 0:03:27
195000 -- (-1181.518) (-1179.240) (-1178.582) [-1171.373] * (-1176.279) [-1175.285] (-1190.937) (-1174.396) -- 0:03:30
Average standard deviation of split frequencies: 0.019747
196000 -- [-1176.209] (-1183.293) (-1169.012) (-1177.672) * (-1173.635) (-1176.214) [-1176.656] (-1172.301) -- 0:03:29
197000 -- (-1177.687) (-1175.474) (-1179.341) [-1174.891] * (-1181.038) (-1181.869) [-1179.583] (-1174.375) -- 0:03:27
198000 -- [-1171.337] (-1172.652) (-1175.005) (-1169.327) * (-1177.925) [-1166.911] (-1176.975) (-1174.477) -- 0:03:26
199000 -- [-1173.878] (-1172.450) (-1175.170) (-1173.596) * (-1175.066) [-1172.008] (-1172.742) (-1187.175) -- 0:03:29
200000 -- (-1172.476) (-1175.943) [-1174.685] (-1185.555) * [-1167.675] (-1175.901) (-1171.287) (-1173.258) -- 0:03:27
Average standard deviation of split frequencies: 0.020525
201000 -- [-1171.212] (-1178.031) (-1184.964) (-1172.273) * [-1170.182] (-1173.919) (-1170.280) (-1186.085) -- 0:03:26
202000 -- (-1174.516) (-1177.189) [-1179.488] (-1171.073) * (-1180.537) (-1178.023) [-1170.777] (-1177.945) -- 0:03:29
203000 -- (-1175.997) [-1172.057] (-1174.872) (-1177.483) * (-1181.572) (-1181.165) [-1169.135] (-1176.244) -- 0:03:28
204000 -- (-1175.740) (-1183.805) (-1172.790) [-1177.630] * (-1180.899) [-1167.696] (-1170.370) (-1175.777) -- 0:03:26
205000 -- [-1168.070] (-1174.471) (-1176.568) (-1177.354) * (-1181.000) [-1180.587] (-1174.237) (-1184.279) -- 0:03:25
Average standard deviation of split frequencies: 0.019873
206000 -- (-1176.745) [-1168.843] (-1174.405) (-1185.089) * [-1169.126] (-1182.240) (-1181.521) (-1174.688) -- 0:03:28
207000 -- (-1175.477) (-1173.697) [-1178.565] (-1180.732) * (-1171.556) [-1168.922] (-1179.317) (-1172.560) -- 0:03:26
208000 -- (-1179.473) (-1177.303) [-1179.891] (-1187.344) * [-1176.952] (-1181.271) (-1175.143) (-1178.004) -- 0:03:25
209000 -- [-1178.277] (-1177.605) (-1183.664) (-1184.465) * (-1166.215) [-1170.394] (-1168.437) (-1178.362) -- 0:03:24
210000 -- [-1174.372] (-1179.811) (-1172.077) (-1174.450) * (-1172.411) (-1175.265) (-1175.357) [-1171.944] -- 0:03:26
Average standard deviation of split frequencies: 0.020033
211000 -- [-1175.699] (-1173.247) (-1178.688) (-1179.969) * [-1169.735] (-1171.887) (-1180.606) (-1172.004) -- 0:03:25
212000 -- [-1172.001] (-1176.447) (-1188.451) (-1179.794) * [-1172.052] (-1187.911) (-1184.664) (-1171.542) -- 0:03:24
213000 -- (-1168.856) [-1172.883] (-1187.145) (-1177.685) * (-1182.065) (-1176.804) [-1179.693] (-1185.813) -- 0:03:23
214000 -- [-1164.883] (-1170.944) (-1189.365) (-1176.236) * (-1172.878) (-1177.642) [-1178.284] (-1187.916) -- 0:03:25
215000 -- (-1180.519) [-1166.253] (-1175.574) (-1176.077) * (-1170.241) (-1172.470) (-1169.029) [-1171.530] -- 0:03:24
Average standard deviation of split frequencies: 0.020733
216000 -- [-1171.500] (-1165.867) (-1175.828) (-1179.158) * [-1171.479] (-1178.765) (-1168.194) (-1172.427) -- 0:03:23
217000 -- (-1172.630) [-1171.269] (-1174.116) (-1172.776) * (-1173.424) (-1175.343) (-1184.221) [-1171.639] -- 0:03:22
218000 -- [-1171.488] (-1167.973) (-1181.101) (-1174.763) * [-1172.767] (-1177.985) (-1175.917) (-1173.237) -- 0:03:24
219000 -- (-1173.544) [-1176.892] (-1173.453) (-1184.325) * (-1176.145) [-1168.798] (-1171.459) (-1173.667) -- 0:03:23
220000 -- [-1168.142] (-1180.532) (-1179.965) (-1180.587) * [-1171.813] (-1181.975) (-1175.458) (-1173.275) -- 0:03:22
Average standard deviation of split frequencies: 0.019974
221000 -- [-1169.037] (-1186.360) (-1174.698) (-1171.575) * (-1170.954) (-1176.612) (-1186.477) [-1170.845] -- 0:03:20
222000 -- (-1181.641) [-1172.322] (-1169.608) (-1179.681) * (-1188.165) [-1175.822] (-1186.469) (-1177.103) -- 0:03:23
223000 -- (-1174.734) (-1183.454) [-1180.273] (-1186.310) * (-1175.283) (-1181.168) (-1185.854) [-1168.639] -- 0:03:22
224000 -- [-1174.705] (-1176.072) (-1169.834) (-1179.704) * [-1174.379] (-1176.620) (-1175.481) (-1177.586) -- 0:03:20
225000 -- [-1166.894] (-1177.793) (-1179.932) (-1173.206) * (-1172.767) (-1175.305) (-1172.179) [-1165.988] -- 0:03:23
Average standard deviation of split frequencies: 0.018773
226000 -- [-1172.502] (-1175.693) (-1184.989) (-1179.924) * [-1167.919] (-1174.250) (-1175.164) (-1173.367) -- 0:03:22
227000 -- [-1177.395] (-1183.633) (-1190.970) (-1177.287) * [-1173.294] (-1176.256) (-1172.746) (-1177.165) -- 0:03:20
228000 -- (-1180.355) [-1173.291] (-1177.038) (-1169.175) * (-1176.129) [-1170.979] (-1174.400) (-1179.818) -- 0:03:19
229000 -- (-1180.635) (-1173.922) [-1182.456] (-1179.247) * (-1173.332) (-1180.294) [-1174.708] (-1178.069) -- 0:03:22
230000 -- [-1176.257] (-1178.647) (-1180.444) (-1172.029) * (-1181.269) (-1183.353) (-1174.565) [-1178.835] -- 0:03:20
Average standard deviation of split frequencies: 0.019824
231000 -- (-1183.818) [-1174.149] (-1175.388) (-1172.719) * (-1180.532) (-1173.338) (-1178.375) [-1171.502] -- 0:03:19
232000 -- (-1177.137) (-1176.337) (-1172.910) [-1180.230] * (-1179.922) (-1173.866) [-1173.127] (-1175.502) -- 0:03:18
233000 -- (-1173.498) (-1191.198) (-1184.342) [-1172.260] * (-1170.280) [-1173.623] (-1180.196) (-1175.869) -- 0:03:20
234000 -- (-1173.869) [-1172.644] (-1190.373) (-1179.865) * (-1181.606) (-1180.335) (-1181.697) [-1171.746] -- 0:03:19
235000 -- (-1178.199) [-1177.892] (-1180.941) (-1170.941) * (-1185.861) (-1177.319) (-1178.338) [-1172.844] -- 0:03:18
Average standard deviation of split frequencies: 0.020075
236000 -- (-1180.514) [-1172.080] (-1183.551) (-1171.400) * (-1176.929) [-1172.891] (-1170.990) (-1184.738) -- 0:03:17
237000 -- [-1173.955] (-1175.627) (-1180.105) (-1169.876) * (-1177.897) [-1176.907] (-1174.087) (-1177.664) -- 0:03:19
238000 -- [-1172.532] (-1177.372) (-1176.015) (-1187.794) * (-1182.846) [-1177.832] (-1178.522) (-1174.321) -- 0:03:18
239000 -- (-1177.152) (-1175.560) [-1174.576] (-1179.802) * (-1173.062) (-1175.908) (-1170.238) [-1178.558] -- 0:03:17
240000 -- (-1183.889) [-1171.228] (-1175.747) (-1179.137) * (-1172.023) (-1175.962) (-1175.889) [-1172.319] -- 0:03:19
Average standard deviation of split frequencies: 0.020175
241000 -- (-1173.959) (-1174.426) (-1177.654) [-1175.785] * [-1170.309] (-1172.180) (-1169.982) (-1180.642) -- 0:03:18
242000 -- (-1174.092) [-1170.849] (-1179.759) (-1181.851) * (-1176.797) [-1171.636] (-1175.609) (-1178.911) -- 0:03:17
243000 -- (-1172.481) [-1174.402] (-1175.935) (-1177.294) * (-1169.822) [-1179.820] (-1172.568) (-1173.789) -- 0:03:16
244000 -- (-1179.090) (-1176.066) (-1177.107) [-1177.438] * (-1176.648) [-1174.853] (-1171.873) (-1176.625) -- 0:03:18
245000 -- (-1180.362) [-1173.169] (-1186.060) (-1177.990) * (-1184.187) [-1178.837] (-1173.394) (-1171.782) -- 0:03:17
Average standard deviation of split frequencies: 0.019929
246000 -- (-1184.260) [-1171.663] (-1183.485) (-1180.290) * (-1181.354) [-1169.107] (-1176.250) (-1173.783) -- 0:03:16
247000 -- (-1176.462) [-1173.205] (-1179.415) (-1182.253) * [-1169.930] (-1175.223) (-1178.019) (-1180.750) -- 0:03:15
248000 -- [-1173.349] (-1175.570) (-1168.571) (-1185.374) * [-1174.156] (-1172.570) (-1184.674) (-1176.148) -- 0:03:17
249000 -- (-1175.088) (-1190.140) [-1174.298] (-1172.794) * [-1173.343] (-1179.682) (-1186.260) (-1172.357) -- 0:03:16
250000 -- (-1170.153) (-1183.157) [-1180.330] (-1182.829) * [-1172.838] (-1183.435) (-1173.466) (-1176.200) -- 0:03:14
Average standard deviation of split frequencies: 0.019088
251000 -- [-1183.493] (-1179.092) (-1172.718) (-1179.567) * (-1187.781) (-1184.579) [-1177.633] (-1172.829) -- 0:03:13
252000 -- (-1182.388) (-1178.358) (-1180.838) [-1172.690] * (-1181.871) (-1186.162) [-1172.897] (-1180.403) -- 0:03:15
253000 -- [-1174.125] (-1183.938) (-1175.305) (-1177.004) * (-1187.362) (-1175.576) (-1169.449) [-1177.976] -- 0:03:14
254000 -- (-1179.234) (-1170.762) (-1182.997) [-1168.654] * (-1186.976) (-1171.539) [-1175.899] (-1176.750) -- 0:03:13
255000 -- (-1173.896) (-1175.302) (-1185.011) [-1173.079] * (-1179.101) (-1169.794) (-1177.479) [-1174.213] -- 0:03:12
Average standard deviation of split frequencies: 0.019243
256000 -- (-1170.832) [-1168.060] (-1172.422) (-1174.257) * (-1176.913) (-1177.915) [-1177.646] (-1173.273) -- 0:03:14
257000 -- (-1173.697) (-1176.656) [-1171.048] (-1168.718) * [-1176.446] (-1171.413) (-1176.684) (-1185.721) -- 0:03:13
258000 -- (-1177.577) (-1173.742) (-1173.260) [-1176.042] * (-1171.796) [-1173.905] (-1176.596) (-1174.777) -- 0:03:12
259000 -- (-1179.798) [-1173.739] (-1177.657) (-1176.999) * (-1173.073) (-1177.827) (-1172.051) [-1170.721] -- 0:03:11
260000 -- (-1172.883) [-1172.718] (-1182.246) (-1196.823) * (-1172.447) (-1172.556) [-1174.921] (-1171.360) -- 0:03:13
Average standard deviation of split frequencies: 0.019531
261000 -- (-1182.844) (-1184.690) [-1180.280] (-1176.823) * (-1178.818) [-1172.636] (-1174.556) (-1181.539) -- 0:03:12
262000 -- (-1173.638) [-1168.666] (-1172.334) (-1179.193) * (-1171.020) (-1174.171) [-1176.230] (-1173.770) -- 0:03:11
263000 -- [-1175.119] (-1176.414) (-1182.021) (-1178.035) * (-1172.748) [-1170.203] (-1184.396) (-1179.279) -- 0:03:10
264000 -- (-1171.318) (-1172.964) (-1180.381) [-1174.501] * (-1177.495) [-1185.004] (-1173.898) (-1187.595) -- 0:03:12
265000 -- (-1175.417) [-1174.587] (-1184.217) (-1176.342) * (-1175.384) (-1171.711) (-1182.175) [-1173.213] -- 0:03:11
Average standard deviation of split frequencies: 0.020557
266000 -- [-1167.559] (-1180.491) (-1182.941) (-1179.969) * (-1177.096) (-1179.482) [-1171.508] (-1174.933) -- 0:03:10
267000 -- (-1168.647) (-1180.982) [-1178.948] (-1175.016) * (-1183.757) (-1180.756) (-1175.772) [-1169.025] -- 0:03:09
268000 -- [-1176.326] (-1185.251) (-1188.519) (-1177.603) * (-1178.995) (-1175.081) [-1175.189] (-1169.997) -- 0:03:11
269000 -- (-1185.816) (-1181.090) (-1182.048) [-1174.324] * (-1175.194) [-1170.573] (-1171.866) (-1180.021) -- 0:03:10
270000 -- [-1170.920] (-1185.021) (-1184.610) (-1180.755) * (-1185.823) (-1183.434) [-1177.106] (-1173.899) -- 0:03:09
Average standard deviation of split frequencies: 0.020551
271000 -- (-1177.228) (-1175.676) (-1174.142) [-1168.224] * (-1176.503) [-1171.866] (-1168.896) (-1173.328) -- 0:03:08
272000 -- (-1176.272) (-1175.461) (-1180.960) [-1170.221] * (-1176.190) [-1178.331] (-1173.324) (-1169.146) -- 0:03:10
273000 -- (-1177.915) (-1175.790) (-1191.573) [-1168.380] * [-1174.770] (-1179.679) (-1170.667) (-1175.877) -- 0:03:09
274000 -- (-1172.282) (-1174.404) [-1179.275] (-1186.980) * (-1171.450) [-1172.326] (-1180.260) (-1172.022) -- 0:03:08
275000 -- [-1177.555] (-1176.731) (-1175.845) (-1179.381) * [-1174.888] (-1178.747) (-1173.177) (-1172.090) -- 0:03:09
Average standard deviation of split frequencies: 0.021008
276000 -- (-1169.030) (-1175.211) [-1176.479] (-1172.958) * (-1178.399) (-1180.217) [-1175.707] (-1172.973) -- 0:03:08
277000 -- (-1169.274) [-1176.968] (-1179.141) (-1183.606) * (-1177.791) (-1177.083) (-1184.456) [-1184.397] -- 0:03:07
278000 -- [-1170.550] (-1178.164) (-1182.696) (-1175.478) * [-1172.612] (-1181.808) (-1174.406) (-1169.334) -- 0:03:06
279000 -- (-1176.366) (-1168.645) (-1179.271) [-1174.281] * (-1172.012) (-1180.950) [-1169.178] (-1178.751) -- 0:03:08
280000 -- (-1175.738) [-1178.621] (-1178.285) (-1179.248) * (-1175.163) (-1184.210) (-1173.172) [-1173.011] -- 0:03:07
Average standard deviation of split frequencies: 0.019625
281000 -- (-1186.097) [-1171.404] (-1175.663) (-1179.267) * (-1172.812) [-1178.898] (-1167.740) (-1172.771) -- 0:03:06
282000 -- (-1173.231) (-1169.676) [-1175.995] (-1181.815) * (-1185.185) (-1179.242) (-1174.605) [-1173.983] -- 0:03:05
283000 -- [-1174.105] (-1184.796) (-1178.047) (-1180.824) * (-1171.754) (-1179.031) (-1187.565) [-1173.196] -- 0:03:07
284000 -- (-1179.547) [-1166.891] (-1184.877) (-1179.363) * (-1179.051) (-1174.395) (-1176.448) [-1178.337] -- 0:03:06
285000 -- (-1182.867) (-1168.373) [-1170.006] (-1177.850) * (-1179.613) (-1171.714) [-1172.198] (-1177.359) -- 0:03:05
Average standard deviation of split frequencies: 0.019866
286000 -- (-1183.994) (-1177.576) [-1173.857] (-1176.092) * [-1170.664] (-1177.410) (-1173.981) (-1175.019) -- 0:03:04
287000 -- (-1185.222) (-1174.590) [-1171.078] (-1179.540) * (-1174.325) (-1178.362) [-1172.474] (-1181.304) -- 0:03:06
288000 -- (-1172.158) (-1177.687) (-1181.874) [-1176.256] * (-1180.986) (-1172.381) [-1172.932] (-1183.658) -- 0:03:05
289000 -- (-1173.817) (-1181.267) [-1178.117] (-1173.235) * (-1175.375) [-1171.432] (-1172.979) (-1179.067) -- 0:03:04
290000 -- [-1170.698] (-1176.621) (-1174.548) (-1186.481) * [-1168.009] (-1180.510) (-1175.776) (-1181.055) -- 0:03:03
Average standard deviation of split frequencies: 0.018779
291000 -- (-1171.425) (-1181.000) (-1175.888) [-1168.389] * (-1176.001) [-1173.398] (-1177.784) (-1184.788) -- 0:03:05
292000 -- (-1186.373) [-1172.052] (-1177.472) (-1171.490) * [-1174.182] (-1178.185) (-1172.910) (-1178.463) -- 0:03:04
293000 -- (-1175.812) (-1179.833) [-1169.714] (-1187.067) * (-1178.903) (-1177.460) [-1178.287] (-1179.540) -- 0:03:03
294000 -- [-1168.324] (-1175.559) (-1168.500) (-1178.545) * [-1171.861] (-1167.803) (-1174.536) (-1174.306) -- 0:03:02
295000 -- (-1184.750) [-1172.553] (-1182.732) (-1173.079) * (-1171.672) [-1169.642] (-1175.688) (-1173.272) -- 0:03:04
Average standard deviation of split frequencies: 0.017938
296000 -- (-1172.226) [-1168.405] (-1178.917) (-1178.435) * (-1181.573) (-1178.061) (-1170.997) [-1167.345] -- 0:03:03
297000 -- [-1169.933] (-1175.443) (-1176.315) (-1172.828) * (-1171.216) (-1174.203) [-1179.985] (-1180.892) -- 0:03:02
298000 -- (-1178.200) (-1172.797) [-1175.817] (-1176.104) * [-1170.486] (-1181.948) (-1185.474) (-1173.137) -- 0:03:01
299000 -- (-1173.748) [-1175.385] (-1177.878) (-1180.068) * (-1178.152) (-1174.656) (-1186.159) [-1176.061] -- 0:03:02
300000 -- (-1189.059) (-1174.758) [-1176.573] (-1171.099) * [-1172.629] (-1182.613) (-1178.856) (-1178.344) -- 0:03:01
Average standard deviation of split frequencies: 0.017989
301000 -- [-1168.543] (-1177.982) (-1181.561) (-1174.386) * (-1172.308) (-1183.305) [-1175.171] (-1187.148) -- 0:03:01
302000 -- (-1178.171) (-1182.321) (-1176.198) [-1164.786] * (-1175.453) (-1183.990) (-1172.792) [-1172.272] -- 0:03:00
303000 -- [-1170.421] (-1192.886) (-1172.780) (-1176.803) * (-1178.762) (-1183.983) [-1172.053] (-1180.169) -- 0:03:01
304000 -- [-1174.505] (-1181.504) (-1174.614) (-1175.699) * (-1171.682) [-1171.761] (-1185.056) (-1186.492) -- 0:03:00
305000 -- (-1175.043) [-1180.236] (-1173.057) (-1170.489) * (-1172.675) (-1171.126) (-1173.878) [-1171.186] -- 0:03:00
Average standard deviation of split frequencies: 0.017023
306000 -- [-1172.602] (-1175.206) (-1177.718) (-1176.216) * [-1173.248] (-1173.912) (-1187.629) (-1173.672) -- 0:03:01
307000 -- (-1169.970) [-1174.432] (-1173.457) (-1176.759) * (-1172.702) [-1177.931] (-1183.239) (-1178.208) -- 0:03:00
308000 -- [-1166.518] (-1178.502) (-1176.007) (-1172.741) * (-1175.007) [-1169.382] (-1170.983) (-1178.515) -- 0:02:59
309000 -- (-1167.608) (-1193.835) [-1172.556] (-1179.399) * (-1197.068) (-1174.271) [-1171.466] (-1182.200) -- 0:02:58
310000 -- (-1177.945) (-1180.885) (-1166.182) [-1173.524] * (-1187.304) (-1173.909) [-1172.715] (-1177.245) -- 0:03:00
Average standard deviation of split frequencies: 0.017650
311000 -- (-1181.809) [-1179.457] (-1170.140) (-1173.151) * (-1177.903) (-1181.437) (-1176.834) [-1176.407] -- 0:02:59
312000 -- (-1179.524) [-1176.499] (-1180.813) (-1174.226) * (-1177.036) (-1178.271) (-1172.962) [-1176.602] -- 0:02:58
313000 -- (-1179.109) (-1176.274) (-1179.702) [-1171.843] * [-1182.975] (-1177.059) (-1178.255) (-1179.485) -- 0:02:57
314000 -- (-1181.846) (-1184.593) (-1176.179) [-1169.817] * (-1176.742) (-1185.963) [-1172.709] (-1175.723) -- 0:02:59
315000 -- (-1173.323) (-1175.640) (-1177.496) [-1171.136] * (-1168.536) (-1180.544) (-1180.385) [-1171.250] -- 0:02:58
Average standard deviation of split frequencies: 0.017430
316000 -- (-1174.935) (-1173.067) [-1175.334] (-1170.808) * (-1172.542) (-1174.236) (-1175.432) [-1168.519] -- 0:02:57
317000 -- (-1171.638) (-1186.229) [-1176.455] (-1173.941) * (-1173.712) [-1173.040] (-1174.421) (-1175.512) -- 0:02:56
318000 -- (-1186.256) (-1180.751) [-1177.404] (-1169.868) * (-1170.868) [-1179.256] (-1179.356) (-1183.177) -- 0:02:58
319000 -- [-1175.814] (-1179.539) (-1172.125) (-1176.340) * (-1173.450) (-1184.439) [-1172.040] (-1192.245) -- 0:02:57
320000 -- [-1170.019] (-1176.090) (-1181.079) (-1187.422) * (-1184.225) (-1187.585) (-1178.059) [-1174.525] -- 0:02:56
Average standard deviation of split frequencies: 0.016945
321000 -- (-1174.052) (-1173.511) (-1177.702) [-1173.490] * (-1179.553) (-1172.058) [-1176.486] (-1182.664) -- 0:02:55
322000 -- (-1178.899) [-1173.883] (-1180.607) (-1177.084) * [-1179.199] (-1184.660) (-1174.825) (-1186.593) -- 0:02:56
323000 -- (-1179.104) (-1180.582) [-1172.452] (-1183.326) * (-1179.447) (-1179.613) [-1175.701] (-1187.843) -- 0:02:56
324000 -- (-1184.128) [-1174.665] (-1177.974) (-1184.513) * [-1173.894] (-1170.058) (-1172.544) (-1188.730) -- 0:02:55
325000 -- (-1178.156) (-1181.099) [-1175.978] (-1174.843) * [-1168.130] (-1177.201) (-1176.474) (-1181.290) -- 0:02:54
Average standard deviation of split frequencies: 0.017733
326000 -- (-1173.800) (-1185.617) [-1172.713] (-1183.078) * (-1179.436) (-1171.561) [-1171.023] (-1178.624) -- 0:02:55
327000 -- (-1187.050) (-1180.386) (-1176.646) [-1181.691] * (-1171.761) [-1169.774] (-1178.369) (-1180.952) -- 0:02:54
328000 -- (-1172.257) (-1180.037) [-1170.609] (-1173.903) * (-1172.823) (-1171.656) (-1170.701) [-1172.635] -- 0:02:54
329000 -- [-1177.806] (-1170.035) (-1175.857) (-1187.786) * (-1184.548) (-1175.150) (-1175.649) [-1179.539] -- 0:02:53
330000 -- (-1175.544) [-1171.258] (-1179.649) (-1170.062) * (-1173.631) [-1174.770] (-1185.369) (-1182.288) -- 0:02:54
Average standard deviation of split frequencies: 0.018458
331000 -- (-1180.226) (-1178.270) [-1169.250] (-1186.442) * (-1176.759) (-1181.427) (-1171.547) [-1180.449] -- 0:02:53
332000 -- (-1183.079) (-1185.469) (-1175.081) [-1171.221] * (-1178.013) [-1174.613] (-1182.570) (-1174.385) -- 0:02:53
333000 -- [-1170.115] (-1176.376) (-1173.553) (-1171.792) * (-1175.206) [-1169.347] (-1177.066) (-1171.078) -- 0:02:52
334000 -- (-1173.428) (-1174.563) (-1178.534) [-1168.484] * (-1181.117) [-1172.850] (-1185.078) (-1174.568) -- 0:02:53
335000 -- (-1172.690) (-1182.096) (-1173.783) [-1171.473] * (-1174.052) [-1170.352] (-1172.209) (-1171.511) -- 0:02:52
Average standard deviation of split frequencies: 0.018017
336000 -- (-1175.781) (-1181.577) (-1172.726) [-1170.521] * (-1173.468) (-1172.691) (-1187.325) [-1178.398] -- 0:02:51
337000 -- (-1171.856) [-1175.101] (-1174.867) (-1177.313) * [-1174.022] (-1175.500) (-1177.370) (-1175.625) -- 0:02:51
338000 -- [-1167.926] (-1187.565) (-1174.923) (-1177.836) * (-1176.356) (-1172.930) (-1177.786) [-1174.477] -- 0:02:52
339000 -- (-1180.511) (-1174.943) (-1184.387) [-1173.380] * (-1169.674) (-1197.822) [-1176.262] (-1168.917) -- 0:02:51
340000 -- (-1181.195) [-1168.241] (-1173.412) (-1175.279) * (-1172.206) [-1180.789] (-1176.425) (-1169.801) -- 0:02:50
Average standard deviation of split frequencies: 0.019009
341000 -- [-1167.966] (-1175.890) (-1169.468) (-1174.509) * [-1171.087] (-1172.788) (-1179.784) (-1169.598) -- 0:02:51
342000 -- [-1173.034] (-1175.609) (-1173.925) (-1174.207) * [-1170.725] (-1173.978) (-1175.241) (-1179.603) -- 0:02:51
343000 -- [-1173.994] (-1178.499) (-1185.505) (-1171.502) * (-1168.633) [-1172.494] (-1168.438) (-1169.798) -- 0:02:50
344000 -- (-1176.133) (-1180.759) (-1182.913) [-1172.500] * (-1187.023) (-1174.653) [-1169.182] (-1178.392) -- 0:02:49
345000 -- (-1173.335) (-1177.182) (-1177.597) [-1168.274] * (-1180.931) (-1175.263) (-1174.475) [-1173.569] -- 0:02:50
Average standard deviation of split frequencies: 0.019289
346000 -- (-1179.746) (-1177.102) [-1174.710] (-1173.912) * (-1169.810) (-1175.740) (-1174.145) [-1181.872] -- 0:02:50
347000 -- (-1174.525) [-1185.091] (-1180.698) (-1173.748) * (-1180.032) [-1178.343] (-1173.074) (-1181.180) -- 0:02:49
348000 -- [-1174.189] (-1182.315) (-1173.111) (-1177.135) * (-1178.615) (-1169.762) [-1177.632] (-1174.330) -- 0:02:48
349000 -- [-1169.053] (-1180.555) (-1174.160) (-1170.791) * (-1175.093) (-1182.744) [-1170.494] (-1176.909) -- 0:02:49
350000 -- (-1171.576) (-1181.328) [-1171.426] (-1178.016) * (-1175.091) (-1187.155) [-1175.609] (-1171.376) -- 0:02:48
Average standard deviation of split frequencies: 0.018537
351000 -- (-1167.934) [-1169.188] (-1168.044) (-1173.639) * (-1175.091) [-1175.955] (-1170.195) (-1176.758) -- 0:02:48
352000 -- (-1170.183) [-1177.054] (-1167.895) (-1177.165) * [-1182.327] (-1173.279) (-1186.917) (-1175.994) -- 0:02:47
353000 -- [-1171.791] (-1172.584) (-1177.350) (-1185.656) * (-1175.335) (-1178.299) (-1172.668) [-1170.702] -- 0:02:48
354000 -- (-1179.684) (-1180.292) [-1176.588] (-1173.338) * (-1184.755) [-1176.902] (-1169.999) (-1183.198) -- 0:02:47
355000 -- (-1171.698) (-1177.183) [-1168.783] (-1175.033) * [-1179.424] (-1171.231) (-1174.340) (-1174.328) -- 0:02:47
Average standard deviation of split frequencies: 0.019584
356000 -- (-1171.767) (-1183.541) (-1177.410) [-1180.845] * [-1174.861] (-1174.214) (-1175.976) (-1178.048) -- 0:02:46
357000 -- (-1177.975) (-1172.582) [-1179.991] (-1179.786) * (-1173.331) (-1172.127) [-1173.337] (-1171.726) -- 0:02:47
358000 -- [-1181.521] (-1184.176) (-1175.742) (-1174.266) * (-1179.204) [-1179.748] (-1179.826) (-1177.379) -- 0:02:46
359000 -- [-1172.944] (-1178.313) (-1178.480) (-1174.619) * (-1176.588) [-1170.960] (-1200.168) (-1183.464) -- 0:02:46
360000 -- (-1170.672) [-1173.573] (-1184.228) (-1175.854) * (-1178.667) (-1175.082) [-1171.611] (-1180.143) -- 0:02:45
Average standard deviation of split frequencies: 0.019262
361000 -- (-1179.812) [-1179.759] (-1171.904) (-1177.189) * (-1174.397) [-1172.019] (-1171.884) (-1177.527) -- 0:02:46
362000 -- [-1176.803] (-1175.078) (-1182.161) (-1173.099) * (-1179.835) [-1173.665] (-1182.688) (-1172.351) -- 0:02:45
363000 -- [-1172.985] (-1172.880) (-1175.385) (-1175.807) * (-1180.606) [-1171.679] (-1173.365) (-1184.505) -- 0:02:44
364000 -- [-1175.219] (-1174.563) (-1179.501) (-1186.315) * (-1184.919) [-1184.099] (-1171.202) (-1174.982) -- 0:02:45
365000 -- (-1173.672) (-1182.223) (-1171.819) [-1168.820] * (-1178.257) [-1168.280] (-1176.176) (-1182.998) -- 0:02:45
Average standard deviation of split frequencies: 0.019252
366000 -- [-1170.079] (-1182.850) (-1176.947) (-1174.140) * (-1179.456) (-1173.686) (-1174.102) [-1171.546] -- 0:02:44
367000 -- (-1178.457) [-1171.542] (-1183.228) (-1173.787) * (-1174.710) (-1170.659) (-1174.639) [-1172.700] -- 0:02:43
368000 -- (-1173.755) (-1192.575) (-1181.206) [-1174.942] * (-1174.510) (-1177.231) (-1182.297) [-1172.128] -- 0:02:44
369000 -- (-1176.105) (-1176.556) [-1175.453] (-1180.470) * [-1178.400] (-1178.551) (-1172.429) (-1176.168) -- 0:02:44
370000 -- [-1172.296] (-1176.396) (-1181.539) (-1175.665) * (-1178.234) [-1174.450] (-1173.739) (-1177.027) -- 0:02:43
Average standard deviation of split frequencies: 0.019746
371000 -- (-1173.696) [-1167.563] (-1175.094) (-1184.641) * (-1172.082) (-1174.271) [-1182.542] (-1173.110) -- 0:02:42
372000 -- (-1168.893) [-1174.666] (-1174.760) (-1178.132) * [-1170.744] (-1175.379) (-1179.373) (-1183.393) -- 0:02:43
373000 -- (-1175.378) (-1181.933) (-1166.841) [-1171.733] * (-1172.418) (-1187.458) [-1173.787] (-1178.318) -- 0:02:43
374000 -- [-1177.359] (-1171.889) (-1175.595) (-1174.214) * (-1169.765) (-1170.045) (-1183.656) [-1177.019] -- 0:02:42
375000 -- (-1173.474) [-1178.261] (-1172.013) (-1173.614) * (-1176.004) [-1172.016] (-1180.289) (-1188.274) -- 0:02:41
Average standard deviation of split frequencies: 0.018872
376000 -- (-1180.400) (-1171.294) (-1175.804) [-1175.219] * [-1175.727] (-1172.965) (-1168.638) (-1184.595) -- 0:02:42
377000 -- (-1176.943) [-1177.654] (-1175.576) (-1180.607) * (-1178.188) (-1181.764) [-1176.579] (-1175.114) -- 0:02:41
378000 -- (-1180.936) (-1183.483) (-1176.122) [-1168.284] * [-1169.927] (-1178.225) (-1176.963) (-1178.256) -- 0:02:41
379000 -- (-1180.286) (-1176.334) (-1175.937) [-1171.884] * (-1174.746) (-1184.224) (-1169.779) [-1171.517] -- 0:02:40
380000 -- (-1172.497) (-1180.644) (-1178.752) [-1176.712] * (-1183.515) (-1173.726) [-1182.098] (-1179.758) -- 0:02:41
Average standard deviation of split frequencies: 0.018510
381000 -- (-1173.149) [-1177.475] (-1183.083) (-1181.414) * (-1174.161) [-1171.030] (-1187.656) (-1174.627) -- 0:02:40
382000 -- [-1172.245] (-1181.686) (-1189.484) (-1173.404) * (-1175.269) [-1171.685] (-1171.528) (-1172.551) -- 0:02:40
383000 -- [-1179.005] (-1175.702) (-1179.808) (-1172.687) * (-1172.956) (-1178.621) [-1176.863] (-1176.572) -- 0:02:39
384000 -- (-1173.909) (-1174.384) (-1177.806) [-1173.932] * (-1180.381) (-1173.104) (-1175.542) [-1179.460] -- 0:02:40
385000 -- (-1176.765) [-1179.912] (-1177.851) (-1191.961) * (-1182.927) (-1179.283) [-1174.291] (-1179.286) -- 0:02:39
Average standard deviation of split frequencies: 0.018769
386000 -- (-1179.129) (-1170.550) [-1171.213] (-1183.148) * (-1170.526) (-1180.471) (-1172.631) [-1176.473] -- 0:02:39
387000 -- (-1176.389) (-1179.743) [-1166.513] (-1180.875) * (-1182.443) [-1181.686] (-1174.230) (-1184.100) -- 0:02:38
388000 -- (-1178.532) [-1173.054] (-1176.673) (-1181.907) * (-1183.587) (-1172.707) [-1172.381] (-1176.048) -- 0:02:39
389000 -- [-1168.087] (-1177.379) (-1174.497) (-1180.035) * (-1170.680) (-1179.182) (-1187.414) [-1173.781] -- 0:02:38
390000 -- (-1187.962) (-1179.735) [-1174.142] (-1178.601) * (-1170.710) [-1177.265] (-1175.512) (-1177.115) -- 0:02:37
Average standard deviation of split frequencies: 0.018227
391000 -- (-1178.859) (-1178.740) (-1173.982) [-1166.043] * (-1170.720) (-1171.506) (-1177.820) [-1173.061] -- 0:02:38
392000 -- [-1177.181] (-1182.935) (-1178.123) (-1172.597) * (-1170.170) (-1181.850) [-1174.905] (-1172.470) -- 0:02:38
393000 -- (-1168.646) (-1182.843) (-1176.289) [-1176.989] * (-1177.175) [-1170.978] (-1182.117) (-1181.230) -- 0:02:37
394000 -- (-1172.561) [-1177.011] (-1181.557) (-1174.729) * (-1170.073) [-1171.948] (-1180.702) (-1175.638) -- 0:02:36
395000 -- [-1176.786] (-1183.505) (-1166.921) (-1172.158) * (-1178.867) (-1179.086) [-1168.795] (-1172.886) -- 0:02:37
Average standard deviation of split frequencies: 0.017794
396000 -- (-1171.873) (-1182.362) [-1169.724] (-1177.388) * (-1186.024) [-1169.398] (-1168.372) (-1178.283) -- 0:02:37
397000 -- (-1173.621) [-1165.128] (-1180.920) (-1173.554) * (-1180.832) (-1172.642) [-1173.540] (-1171.455) -- 0:02:36
398000 -- [-1174.673] (-1177.170) (-1169.949) (-1175.138) * (-1174.492) [-1170.842] (-1181.209) (-1169.313) -- 0:02:35
399000 -- (-1177.204) (-1178.371) [-1178.133] (-1177.321) * (-1176.758) (-1173.181) (-1174.191) [-1168.354] -- 0:02:36
400000 -- (-1178.196) [-1171.983] (-1172.126) (-1184.767) * (-1174.106) (-1183.499) (-1184.558) [-1175.304] -- 0:02:36
Average standard deviation of split frequencies: 0.017710
401000 -- (-1184.264) [-1171.325] (-1171.468) (-1185.012) * [-1168.708] (-1176.614) (-1176.463) (-1169.690) -- 0:02:35
402000 -- (-1183.233) [-1172.592] (-1175.168) (-1176.509) * [-1173.820] (-1170.022) (-1183.848) (-1180.763) -- 0:02:34
403000 -- (-1178.477) (-1177.590) (-1179.839) [-1174.022] * (-1175.044) (-1173.905) (-1173.228) [-1172.031] -- 0:02:35
404000 -- [-1176.270] (-1183.741) (-1182.410) (-1169.649) * (-1175.323) [-1173.520] (-1176.829) (-1177.045) -- 0:02:34
405000 -- (-1182.849) (-1173.561) [-1168.873] (-1177.525) * [-1165.916] (-1178.855) (-1177.387) (-1176.932) -- 0:02:34
Average standard deviation of split frequencies: 0.016928
406000 -- (-1175.238) (-1183.666) (-1174.697) [-1169.287] * (-1172.491) (-1175.448) (-1173.413) [-1169.530] -- 0:02:33
407000 -- [-1178.550] (-1176.301) (-1174.744) (-1176.807) * (-1173.944) (-1178.370) [-1180.128] (-1177.214) -- 0:02:34
408000 -- (-1173.782) (-1182.681) [-1172.890] (-1180.859) * (-1174.220) [-1179.976] (-1183.938) (-1188.692) -- 0:02:33
409000 -- (-1188.411) [-1175.849] (-1176.612) (-1171.632) * (-1170.814) [-1172.318] (-1182.318) (-1177.709) -- 0:02:33
410000 -- [-1176.113] (-1168.450) (-1176.955) (-1175.496) * (-1179.878) (-1177.115) [-1175.678] (-1177.987) -- 0:02:32
Average standard deviation of split frequencies: 0.016554
411000 -- (-1174.651) (-1182.431) (-1179.691) [-1173.173] * (-1180.593) (-1173.296) (-1183.214) [-1180.158] -- 0:02:33
412000 -- [-1173.704] (-1183.500) (-1180.903) (-1171.644) * (-1174.165) [-1178.051] (-1178.469) (-1174.656) -- 0:02:32
413000 -- (-1190.048) [-1176.279] (-1174.884) (-1175.218) * (-1179.297) (-1178.599) [-1173.408] (-1175.732) -- 0:02:32
414000 -- (-1172.396) [-1170.057] (-1182.841) (-1183.102) * (-1178.392) (-1180.303) [-1169.007] (-1177.871) -- 0:02:32
415000 -- (-1186.150) (-1173.939) (-1184.565) [-1177.695] * (-1181.835) (-1180.795) (-1169.846) [-1172.876] -- 0:02:32
Average standard deviation of split frequencies: 0.016282
416000 -- (-1175.411) [-1183.784] (-1178.299) (-1172.974) * [-1176.567] (-1183.624) (-1172.919) (-1164.580) -- 0:02:31
417000 -- [-1173.888] (-1178.398) (-1177.553) (-1173.943) * [-1171.702] (-1174.007) (-1181.101) (-1176.823) -- 0:02:30
418000 -- (-1189.297) (-1186.472) [-1180.893] (-1169.922) * (-1176.514) (-1173.817) [-1172.057] (-1170.745) -- 0:02:31
419000 -- (-1174.919) (-1183.243) (-1175.123) [-1171.479] * [-1174.055] (-1181.918) (-1173.401) (-1179.018) -- 0:02:31
420000 -- (-1176.098) (-1180.893) (-1174.536) [-1170.133] * (-1184.224) (-1174.187) [-1171.410] (-1181.865) -- 0:02:30
Average standard deviation of split frequencies: 0.016455
421000 -- (-1177.617) [-1174.617] (-1172.510) (-1168.864) * (-1175.711) [-1170.535] (-1182.862) (-1185.353) -- 0:02:29
422000 -- [-1173.202] (-1174.295) (-1177.119) (-1179.074) * (-1173.785) (-1187.453) (-1190.101) [-1170.937] -- 0:02:30
423000 -- (-1181.609) [-1178.651] (-1174.784) (-1176.817) * (-1170.833) (-1175.772) [-1181.700] (-1186.639) -- 0:02:30
424000 -- (-1172.274) [-1168.406] (-1172.654) (-1179.894) * (-1174.872) [-1170.681] (-1173.738) (-1185.395) -- 0:02:29
425000 -- (-1168.290) (-1173.697) (-1178.989) [-1174.692] * (-1169.245) (-1168.933) [-1172.131] (-1183.488) -- 0:02:28
Average standard deviation of split frequencies: 0.016424
426000 -- (-1175.129) (-1179.263) [-1167.045] (-1183.521) * (-1174.102) (-1170.534) [-1177.868] (-1175.325) -- 0:02:29
427000 -- (-1170.807) [-1178.225] (-1166.276) (-1184.515) * (-1170.009) [-1178.706] (-1169.453) (-1172.291) -- 0:02:28
428000 -- [-1178.299] (-1184.086) (-1176.063) (-1175.745) * (-1177.694) (-1175.268) [-1171.375] (-1179.901) -- 0:02:28
429000 -- [-1172.117] (-1179.364) (-1169.733) (-1176.086) * (-1170.558) (-1168.638) (-1177.713) [-1172.130] -- 0:02:27
430000 -- [-1174.785] (-1176.186) (-1170.530) (-1172.911) * (-1174.650) [-1179.893] (-1178.371) (-1178.502) -- 0:02:28
Average standard deviation of split frequencies: 0.015900
431000 -- (-1182.715) (-1187.835) [-1176.710] (-1179.993) * (-1184.887) [-1185.027] (-1177.006) (-1180.409) -- 0:02:27
432000 -- (-1170.467) (-1174.006) (-1168.939) [-1176.253] * (-1176.707) (-1170.465) [-1171.270] (-1176.922) -- 0:02:27
433000 -- (-1188.217) (-1173.905) [-1175.819] (-1173.832) * [-1176.149] (-1182.768) (-1178.962) (-1173.244) -- 0:02:26
434000 -- (-1179.705) (-1173.395) (-1177.676) [-1171.522] * (-1179.502) [-1179.421] (-1168.304) (-1182.831) -- 0:02:27
435000 -- [-1179.165] (-1175.891) (-1177.670) (-1183.988) * (-1173.736) (-1177.102) (-1184.088) [-1168.910] -- 0:02:26
Average standard deviation of split frequencies: 0.015877
436000 -- (-1181.003) (-1177.762) [-1171.965] (-1176.161) * (-1171.975) (-1179.311) [-1176.657] (-1178.875) -- 0:02:26
437000 -- [-1171.343] (-1181.608) (-1177.047) (-1174.980) * (-1176.473) [-1170.130] (-1181.898) (-1174.450) -- 0:02:26
438000 -- [-1173.885] (-1189.593) (-1174.822) (-1175.562) * (-1184.838) (-1175.518) [-1176.615] (-1179.727) -- 0:02:26
439000 -- (-1168.895) (-1185.671) (-1179.674) [-1171.076] * (-1176.455) (-1175.654) [-1169.800] (-1172.171) -- 0:02:25
440000 -- (-1187.910) (-1175.681) (-1170.413) [-1177.868] * [-1166.561] (-1178.033) (-1175.807) (-1173.909) -- 0:02:25
Average standard deviation of split frequencies: 0.015596
441000 -- (-1166.966) [-1171.489] (-1181.741) (-1168.970) * (-1181.717) [-1177.343] (-1173.606) (-1176.386) -- 0:02:25
442000 -- (-1172.944) (-1174.883) [-1174.108] (-1177.190) * [-1179.959] (-1173.714) (-1178.827) (-1180.850) -- 0:02:25
443000 -- (-1170.784) (-1177.399) [-1172.726] (-1167.849) * (-1174.365) [-1171.417] (-1178.282) (-1181.905) -- 0:02:24
444000 -- (-1170.934) (-1174.485) [-1177.547] (-1175.334) * [-1173.797] (-1180.863) (-1167.347) (-1175.532) -- 0:02:24
445000 -- (-1175.660) (-1179.487) (-1176.624) [-1172.447] * (-1178.776) (-1170.075) (-1171.154) [-1177.288] -- 0:02:24
Average standard deviation of split frequencies: 0.015242
446000 -- (-1176.204) (-1178.387) (-1186.038) [-1174.009] * (-1177.467) (-1174.807) (-1172.652) [-1174.847] -- 0:02:24
447000 -- (-1182.253) (-1175.449) [-1179.962] (-1177.107) * (-1173.457) [-1180.346] (-1179.905) (-1182.274) -- 0:02:23
448000 -- [-1179.000] (-1176.659) (-1168.974) (-1174.040) * (-1182.866) [-1172.825] (-1169.692) (-1181.733) -- 0:02:22
449000 -- [-1176.222] (-1175.882) (-1178.283) (-1169.038) * (-1175.793) (-1175.634) (-1174.596) [-1177.166] -- 0:02:23
450000 -- (-1173.618) (-1173.855) (-1172.751) [-1174.243] * [-1175.097] (-1175.478) (-1176.040) (-1176.988) -- 0:02:23
Average standard deviation of split frequencies: 0.015470
451000 -- (-1182.529) (-1178.147) (-1179.169) [-1171.071] * (-1180.772) [-1173.886] (-1181.654) (-1180.298) -- 0:02:22
452000 -- (-1182.429) (-1177.298) [-1169.064] (-1172.137) * (-1186.352) [-1172.177] (-1171.337) (-1179.571) -- 0:02:21
453000 -- (-1174.486) (-1179.921) (-1172.225) [-1174.189] * (-1194.839) (-1178.563) (-1180.609) [-1177.478] -- 0:02:22
454000 -- (-1172.934) (-1183.469) [-1172.526] (-1173.822) * (-1187.081) (-1188.031) [-1170.030] (-1181.388) -- 0:02:21
455000 -- [-1173.021] (-1178.286) (-1178.705) (-1177.980) * (-1181.515) [-1172.087] (-1176.822) (-1179.666) -- 0:02:21
Average standard deviation of split frequencies: 0.015449
456000 -- (-1180.018) [-1173.705] (-1181.144) (-1174.514) * [-1180.168] (-1168.674) (-1177.976) (-1185.893) -- 0:02:20
457000 -- (-1183.158) [-1169.663] (-1188.762) (-1178.570) * [-1176.832] (-1178.712) (-1177.676) (-1172.941) -- 0:02:21
458000 -- (-1176.215) [-1166.690] (-1184.219) (-1187.083) * (-1180.937) (-1176.119) [-1176.535] (-1170.087) -- 0:02:20
459000 -- (-1173.084) [-1172.718] (-1178.092) (-1177.234) * (-1180.591) (-1185.379) (-1178.730) [-1168.927] -- 0:02:20
460000 -- (-1173.914) (-1181.388) [-1171.514] (-1178.280) * [-1172.469] (-1174.738) (-1179.603) (-1173.641) -- 0:02:20
Average standard deviation of split frequencies: 0.015691
461000 -- (-1172.529) [-1174.613] (-1175.016) (-1174.305) * (-1177.983) [-1169.882] (-1177.917) (-1184.800) -- 0:02:20
462000 -- [-1174.534] (-1174.799) (-1182.542) (-1168.824) * (-1183.409) (-1185.007) (-1176.756) [-1175.917] -- 0:02:19
463000 -- [-1173.690] (-1173.256) (-1180.064) (-1176.634) * (-1183.286) [-1172.609] (-1188.474) (-1172.842) -- 0:02:19
464000 -- (-1172.323) (-1170.188) (-1174.135) [-1173.013] * (-1173.745) (-1169.126) (-1176.543) [-1170.700] -- 0:02:19
465000 -- (-1183.748) (-1174.047) (-1189.852) [-1174.351] * (-1178.104) (-1180.633) (-1168.756) [-1181.182] -- 0:02:19
Average standard deviation of split frequencies: 0.015174
466000 -- (-1176.502) (-1181.786) (-1177.509) [-1176.728] * [-1182.415] (-1171.654) (-1173.888) (-1173.054) -- 0:02:18
467000 -- [-1171.023] (-1174.936) (-1182.954) (-1174.387) * [-1175.227] (-1178.987) (-1175.856) (-1174.348) -- 0:02:18
468000 -- (-1177.001) (-1174.584) (-1171.033) [-1174.680] * (-1175.143) (-1175.660) (-1179.825) [-1173.847] -- 0:02:18
469000 -- (-1171.550) (-1177.311) (-1176.843) [-1176.717] * (-1185.704) (-1183.128) (-1181.194) [-1180.183] -- 0:02:18
470000 -- (-1181.133) [-1169.641] (-1178.791) (-1178.706) * (-1168.032) (-1179.599) (-1174.478) [-1172.702] -- 0:02:17
Average standard deviation of split frequencies: 0.014968
471000 -- [-1173.493] (-1172.094) (-1182.779) (-1177.934) * (-1173.057) (-1176.801) [-1172.476] (-1178.293) -- 0:02:17
472000 -- [-1173.063] (-1173.204) (-1180.475) (-1171.439) * [-1178.349] (-1177.464) (-1173.558) (-1177.975) -- 0:02:17
473000 -- [-1174.256] (-1169.430) (-1181.592) (-1186.207) * [-1167.293] (-1171.602) (-1175.876) (-1173.724) -- 0:02:17
474000 -- (-1169.533) [-1171.575] (-1171.810) (-1184.783) * (-1177.244) [-1182.721] (-1172.571) (-1180.491) -- 0:02:16
475000 -- (-1174.667) (-1177.216) (-1185.889) [-1176.508] * (-1177.606) (-1183.988) (-1170.281) [-1172.230] -- 0:02:15
Average standard deviation of split frequencies: 0.016011
476000 -- (-1178.186) (-1182.555) [-1174.404] (-1172.993) * (-1174.978) (-1175.324) (-1172.674) [-1170.214] -- 0:02:16
477000 -- (-1172.836) (-1171.592) (-1175.913) [-1172.986] * (-1185.266) [-1177.248] (-1175.003) (-1174.326) -- 0:02:15
478000 -- (-1191.584) (-1175.724) [-1185.645] (-1173.140) * (-1177.985) [-1166.168] (-1170.440) (-1172.869) -- 0:02:15
479000 -- (-1171.513) [-1171.900] (-1179.006) (-1177.045) * (-1180.249) (-1177.869) [-1171.338] (-1180.156) -- 0:02:15
480000 -- (-1179.072) [-1170.007] (-1173.421) (-1186.094) * (-1176.595) [-1169.756] (-1179.512) (-1174.636) -- 0:02:15
Average standard deviation of split frequencies: 0.014969
481000 -- [-1171.444] (-1170.745) (-1175.238) (-1178.741) * [-1173.081] (-1179.304) (-1177.364) (-1175.391) -- 0:02:14
482000 -- [-1183.221] (-1170.929) (-1176.775) (-1177.820) * (-1180.096) [-1178.358] (-1180.407) (-1176.368) -- 0:02:14
483000 -- [-1176.996] (-1176.801) (-1173.087) (-1171.916) * [-1174.903] (-1179.744) (-1171.756) (-1179.901) -- 0:02:14
484000 -- (-1171.984) (-1172.003) [-1168.694] (-1182.465) * (-1173.958) (-1180.058) [-1175.333] (-1180.187) -- 0:02:14
485000 -- (-1178.902) [-1168.835] (-1174.725) (-1175.051) * (-1175.753) (-1175.443) (-1169.927) [-1173.330] -- 0:02:13
Average standard deviation of split frequencies: 0.014703
486000 -- (-1176.007) (-1180.120) [-1169.406] (-1180.401) * (-1184.727) [-1171.445] (-1174.377) (-1178.963) -- 0:02:13
487000 -- [-1173.656] (-1180.493) (-1174.433) (-1173.821) * [-1173.763] (-1185.735) (-1170.155) (-1175.614) -- 0:02:13
488000 -- [-1173.027] (-1185.103) (-1184.151) (-1181.147) * (-1174.149) (-1197.614) (-1174.129) [-1175.439] -- 0:02:13
489000 -- (-1170.810) (-1172.727) (-1172.746) [-1177.685] * [-1179.620] (-1169.807) (-1169.983) (-1177.984) -- 0:02:12
490000 -- [-1172.246] (-1187.268) (-1175.970) (-1178.839) * (-1174.748) (-1182.387) (-1180.479) [-1176.748] -- 0:02:12
Average standard deviation of split frequencies: 0.014967
491000 -- (-1181.995) (-1185.417) [-1167.638] (-1174.927) * (-1175.180) [-1175.294] (-1171.410) (-1181.489) -- 0:02:12
492000 -- (-1171.307) (-1170.606) [-1165.329] (-1175.485) * (-1177.474) (-1177.839) [-1173.385] (-1176.355) -- 0:02:12
493000 -- (-1173.880) (-1174.259) [-1170.509] (-1171.744) * (-1175.277) (-1173.533) (-1178.977) [-1170.161] -- 0:02:11
494000 -- (-1172.501) [-1174.778] (-1174.549) (-1176.536) * (-1172.566) (-1174.913) [-1173.960] (-1192.136) -- 0:02:11
495000 -- [-1176.297] (-1183.469) (-1175.971) (-1165.353) * (-1172.146) (-1175.952) (-1177.340) [-1177.703] -- 0:02:11
Average standard deviation of split frequencies: 0.014506
496000 -- (-1185.330) [-1172.802] (-1177.485) (-1180.258) * (-1171.032) [-1175.242] (-1195.586) (-1175.731) -- 0:02:11
497000 -- [-1172.202] (-1176.340) (-1180.009) (-1170.991) * (-1179.367) [-1173.412] (-1170.670) (-1183.391) -- 0:02:10
498000 -- (-1168.284) [-1167.400] (-1182.351) (-1177.489) * [-1175.762] (-1165.942) (-1187.115) (-1173.977) -- 0:02:10
499000 -- (-1174.879) (-1176.432) (-1177.591) [-1168.674] * (-1172.510) (-1184.906) [-1172.496] (-1179.748) -- 0:02:10
500000 -- (-1175.037) (-1194.238) [-1179.116] (-1171.210) * (-1167.424) (-1174.871) (-1176.550) [-1176.183] -- 0:02:10
Average standard deviation of split frequencies: 0.014668
501000 -- (-1177.250) [-1175.473] (-1171.669) (-1173.214) * (-1170.223) (-1183.722) [-1177.755] (-1175.080) -- 0:02:09
502000 -- (-1171.700) (-1177.683) [-1169.279] (-1185.218) * (-1172.665) (-1178.549) (-1171.167) [-1177.033] -- 0:02:08
503000 -- (-1172.717) [-1173.163] (-1181.607) (-1170.125) * (-1171.374) (-1179.244) [-1168.276] (-1176.718) -- 0:02:09
504000 -- (-1178.972) (-1172.375) [-1173.786] (-1170.806) * [-1174.848] (-1178.696) (-1177.781) (-1172.032) -- 0:02:08
505000 -- [-1181.719] (-1170.325) (-1182.165) (-1176.121) * (-1170.069) [-1171.305] (-1174.485) (-1179.275) -- 0:02:08
Average standard deviation of split frequencies: 0.014220
506000 -- (-1183.963) (-1174.310) (-1176.429) [-1169.123] * (-1175.387) (-1175.268) (-1173.782) [-1169.224] -- 0:02:07
507000 -- (-1179.229) (-1174.977) [-1182.214] (-1179.246) * [-1175.484] (-1172.621) (-1174.959) (-1174.571) -- 0:02:08
508000 -- (-1178.884) (-1185.000) [-1175.314] (-1177.472) * (-1178.654) (-1185.213) [-1170.193] (-1181.625) -- 0:02:07
509000 -- [-1169.797] (-1175.753) (-1173.471) (-1178.686) * (-1169.697) (-1182.551) [-1178.215] (-1180.396) -- 0:02:07
510000 -- (-1170.372) (-1179.657) (-1177.207) [-1179.837] * [-1167.712] (-1178.025) (-1176.178) (-1182.162) -- 0:02:07
Average standard deviation of split frequencies: 0.014090
511000 -- (-1179.398) (-1179.500) [-1181.887] (-1176.045) * (-1186.938) (-1181.318) (-1176.886) [-1177.142] -- 0:02:07
512000 -- (-1177.365) (-1180.741) [-1172.108] (-1177.126) * (-1176.558) [-1178.162] (-1178.832) (-1171.946) -- 0:02:06
513000 -- [-1174.339] (-1178.144) (-1170.638) (-1170.824) * (-1180.647) [-1176.209] (-1173.157) (-1179.451) -- 0:02:06
514000 -- [-1176.324] (-1172.642) (-1170.614) (-1185.647) * [-1185.182] (-1176.448) (-1196.688) (-1174.338) -- 0:02:06
515000 -- (-1172.753) [-1167.239] (-1182.938) (-1175.726) * (-1177.386) [-1168.437] (-1177.208) (-1174.885) -- 0:02:06
Average standard deviation of split frequencies: 0.014617
516000 -- (-1173.048) [-1178.180] (-1183.658) (-1170.222) * (-1177.193) [-1169.501] (-1172.581) (-1174.719) -- 0:02:05
517000 -- (-1167.490) [-1173.002] (-1186.225) (-1172.798) * [-1172.546] (-1184.854) (-1179.980) (-1173.469) -- 0:02:05
518000 -- (-1175.167) (-1177.160) (-1170.741) [-1175.362] * [-1172.780] (-1181.589) (-1169.266) (-1174.039) -- 0:02:05
519000 -- (-1181.734) (-1180.858) [-1174.793] (-1178.481) * (-1175.134) [-1171.587] (-1182.604) (-1178.607) -- 0:02:05
520000 -- (-1178.111) [-1171.204] (-1181.529) (-1180.948) * (-1179.952) (-1186.672) (-1180.211) [-1168.981] -- 0:02:04
Average standard deviation of split frequencies: 0.013681
521000 -- (-1181.628) (-1179.834) [-1167.489] (-1180.414) * (-1177.856) (-1189.951) [-1170.784] (-1185.487) -- 0:02:04
522000 -- [-1171.613] (-1167.146) (-1186.737) (-1172.134) * (-1177.184) [-1173.501] (-1170.916) (-1174.048) -- 0:02:04
523000 -- (-1192.018) (-1168.854) [-1174.098] (-1180.551) * (-1180.004) (-1171.416) (-1187.696) [-1171.249] -- 0:02:04
524000 -- (-1173.395) (-1169.200) [-1171.873] (-1177.021) * (-1176.612) (-1186.876) [-1173.101] (-1175.723) -- 0:02:03
525000 -- (-1176.528) [-1177.281] (-1175.899) (-1178.691) * (-1168.903) [-1173.033] (-1180.713) (-1173.381) -- 0:02:03
Average standard deviation of split frequencies: 0.013207
526000 -- (-1172.989) (-1181.592) [-1174.207] (-1187.136) * (-1169.392) (-1173.513) (-1177.829) [-1174.035] -- 0:02:03
527000 -- (-1178.598) [-1174.332] (-1169.000) (-1186.804) * [-1170.263] (-1185.556) (-1191.206) (-1175.552) -- 0:02:02
528000 -- (-1175.392) (-1174.001) [-1167.349] (-1179.292) * [-1172.131] (-1170.221) (-1183.155) (-1176.345) -- 0:02:02
529000 -- [-1175.029] (-1180.942) (-1177.783) (-1178.945) * [-1177.097] (-1169.082) (-1176.349) (-1173.398) -- 0:02:01
530000 -- [-1169.756] (-1179.415) (-1175.143) (-1181.730) * (-1172.245) [-1170.893] (-1177.061) (-1188.072) -- 0:02:02
Average standard deviation of split frequencies: 0.013231
531000 -- [-1175.692] (-1181.064) (-1180.447) (-1177.778) * (-1170.704) (-1170.008) [-1171.436] (-1177.997) -- 0:02:01
532000 -- (-1182.034) (-1183.650) (-1174.085) [-1178.095] * (-1170.995) [-1171.857] (-1174.821) (-1176.803) -- 0:02:01
533000 -- [-1166.124] (-1169.580) (-1179.778) (-1174.369) * [-1178.310] (-1188.141) (-1174.102) (-1178.712) -- 0:02:00
534000 -- [-1173.038] (-1182.085) (-1182.851) (-1178.490) * (-1173.880) (-1176.849) (-1183.263) [-1174.156] -- 0:02:01
535000 -- (-1174.658) (-1181.221) (-1170.727) [-1174.410] * [-1168.251] (-1175.554) (-1170.207) (-1171.122) -- 0:02:00
Average standard deviation of split frequencies: 0.013046
536000 -- (-1172.970) (-1177.739) (-1179.887) [-1179.237] * (-1178.599) (-1179.951) [-1165.394] (-1176.002) -- 0:02:00
537000 -- [-1177.797] (-1171.915) (-1170.653) (-1176.695) * (-1178.376) (-1178.462) [-1175.958] (-1181.263) -- 0:01:59
538000 -- (-1180.726) (-1184.335) [-1167.594] (-1168.544) * (-1182.905) [-1172.829] (-1177.340) (-1173.325) -- 0:02:00
539000 -- (-1174.847) (-1169.547) (-1175.947) [-1170.519] * (-1173.768) (-1176.090) (-1184.598) [-1175.088] -- 0:01:59
540000 -- [-1169.647] (-1180.921) (-1173.631) (-1175.552) * (-1175.416) (-1172.613) [-1173.932] (-1183.810) -- 0:01:59
Average standard deviation of split frequencies: 0.013175
541000 -- [-1176.409] (-1168.954) (-1175.599) (-1184.717) * (-1182.023) [-1174.340] (-1181.281) (-1180.540) -- 0:01:59
542000 -- (-1181.275) (-1170.228) [-1170.596] (-1173.851) * (-1179.475) (-1186.800) [-1172.940] (-1179.690) -- 0:01:59
543000 -- [-1166.370] (-1181.171) (-1179.698) (-1174.607) * (-1176.429) (-1182.143) [-1171.166] (-1171.478) -- 0:01:58
544000 -- (-1180.410) [-1173.417] (-1176.285) (-1183.484) * [-1179.355] (-1184.940) (-1172.251) (-1178.084) -- 0:01:58
545000 -- (-1184.575) (-1172.799) [-1175.513] (-1174.312) * (-1177.411) (-1181.835) (-1177.615) [-1177.439] -- 0:01:58
Average standard deviation of split frequencies: 0.012587
546000 -- (-1182.207) [-1173.875] (-1178.903) (-1169.641) * [-1169.591] (-1186.027) (-1178.357) (-1180.783) -- 0:01:58
547000 -- [-1180.376] (-1178.126) (-1171.730) (-1176.569) * (-1175.786) [-1171.300] (-1183.485) (-1176.778) -- 0:01:57
548000 -- (-1168.511) (-1176.268) (-1170.320) [-1171.897] * (-1171.848) [-1175.787] (-1179.176) (-1185.190) -- 0:01:57
549000 -- (-1168.007) [-1167.850] (-1171.553) (-1180.672) * (-1171.969) (-1179.937) (-1174.842) [-1172.821] -- 0:01:57
550000 -- [-1172.880] (-1182.192) (-1185.542) (-1169.207) * (-1192.308) (-1173.556) (-1176.012) [-1170.121] -- 0:01:56
Average standard deviation of split frequencies: 0.013174
551000 -- (-1172.641) (-1174.351) (-1178.580) [-1175.506] * [-1175.033] (-1174.252) (-1180.637) (-1181.682) -- 0:01:56
552000 -- (-1173.542) [-1172.289] (-1185.099) (-1172.716) * (-1173.109) (-1175.631) (-1171.674) [-1172.145] -- 0:01:56
553000 -- (-1177.396) (-1167.600) [-1172.430] (-1182.727) * (-1190.178) [-1170.324] (-1175.381) (-1172.808) -- 0:01:56
554000 -- (-1174.310) (-1175.927) [-1175.371] (-1181.849) * (-1180.271) (-1173.168) [-1170.004] (-1181.089) -- 0:01:55
555000 -- (-1179.193) (-1175.597) [-1172.195] (-1173.241) * [-1170.405] (-1195.689) (-1177.513) (-1171.471) -- 0:01:55
Average standard deviation of split frequencies: 0.012718
556000 -- (-1176.031) (-1175.641) (-1172.124) [-1183.348] * (-1175.296) [-1171.685] (-1176.682) (-1178.586) -- 0:01:54
557000 -- [-1174.854] (-1174.997) (-1171.728) (-1178.785) * (-1173.692) [-1172.944] (-1176.774) (-1176.810) -- 0:01:55
558000 -- [-1173.608] (-1189.790) (-1172.873) (-1178.598) * (-1181.257) (-1168.599) (-1175.171) [-1172.392] -- 0:01:54
559000 -- (-1175.897) (-1172.850) [-1179.797] (-1176.201) * (-1172.751) (-1173.989) (-1175.676) [-1179.712] -- 0:01:54
560000 -- (-1177.039) (-1183.495) (-1179.292) [-1169.704] * (-1168.418) [-1178.921] (-1181.664) (-1174.130) -- 0:01:53
Average standard deviation of split frequencies: 0.012833
561000 -- (-1177.144) (-1176.656) (-1174.265) [-1174.494] * [-1172.342] (-1180.441) (-1171.252) (-1180.220) -- 0:01:54
562000 -- (-1185.184) (-1173.056) (-1178.694) [-1175.879] * (-1174.598) (-1182.053) [-1171.005] (-1175.650) -- 0:01:53
563000 -- (-1178.145) (-1174.507) (-1185.634) [-1171.689] * (-1187.539) (-1172.360) (-1180.500) [-1170.787] -- 0:01:53
564000 -- (-1175.824) [-1178.752] (-1178.761) (-1175.122) * (-1177.320) (-1171.496) [-1172.193] (-1171.199) -- 0:01:52
565000 -- (-1172.544) [-1170.807] (-1181.549) (-1176.709) * (-1174.941) (-1178.122) (-1178.989) [-1173.332] -- 0:01:53
Average standard deviation of split frequencies: 0.012668
566000 -- (-1178.835) (-1173.362) [-1173.336] (-1169.881) * [-1173.721] (-1184.262) (-1182.773) (-1171.780) -- 0:01:52
567000 -- (-1179.609) (-1175.365) [-1176.097] (-1199.431) * (-1171.532) [-1181.207] (-1173.743) (-1180.443) -- 0:01:52
568000 -- (-1173.619) [-1169.575] (-1183.043) (-1177.752) * (-1170.162) [-1171.466] (-1179.186) (-1176.432) -- 0:01:51
569000 -- [-1173.065] (-1177.591) (-1181.273) (-1181.276) * [-1172.494] (-1173.106) (-1180.140) (-1174.990) -- 0:01:52
570000 -- (-1172.089) (-1175.721) (-1178.092) [-1167.047] * (-1169.121) [-1175.176] (-1170.029) (-1178.957) -- 0:01:51
Average standard deviation of split frequencies: 0.012869
571000 -- (-1173.284) (-1180.076) (-1181.819) [-1166.420] * (-1184.983) (-1178.268) (-1183.790) [-1172.366] -- 0:01:51
572000 -- (-1177.513) (-1181.126) (-1183.218) [-1171.849] * (-1170.584) (-1174.157) (-1182.330) [-1166.514] -- 0:01:51
573000 -- (-1176.080) (-1171.329) (-1185.999) [-1174.077] * (-1173.341) [-1175.309] (-1173.939) (-1179.455) -- 0:01:51
574000 -- (-1173.814) (-1175.027) [-1166.668] (-1175.337) * [-1175.863] (-1171.783) (-1177.005) (-1179.929) -- 0:01:50
575000 -- (-1178.384) [-1175.822] (-1181.240) (-1179.615) * (-1179.591) (-1172.588) (-1181.060) [-1177.182] -- 0:01:50
Average standard deviation of split frequencies: 0.012879
576000 -- (-1177.926) [-1175.989] (-1179.025) (-1186.040) * [-1180.434] (-1171.799) (-1181.081) (-1170.465) -- 0:01:50
577000 -- (-1184.591) [-1173.748] (-1182.988) (-1172.238) * (-1188.595) (-1178.487) (-1181.019) [-1173.789] -- 0:01:49
578000 -- (-1171.381) (-1181.848) (-1175.903) [-1177.423] * (-1174.572) (-1170.620) (-1172.402) [-1178.902] -- 0:01:49
579000 -- (-1172.650) (-1177.040) [-1170.596] (-1179.692) * (-1183.492) (-1173.442) [-1173.033] (-1178.019) -- 0:01:49
580000 -- (-1175.817) (-1172.558) (-1175.758) [-1172.798] * (-1174.339) [-1167.982] (-1178.219) (-1183.278) -- 0:01:49
Average standard deviation of split frequencies: 0.012818
581000 -- (-1188.163) (-1174.519) [-1177.715] (-1179.257) * (-1182.651) (-1173.020) (-1178.488) [-1180.094] -- 0:01:48
582000 -- (-1174.015) (-1177.521) (-1176.292) [-1172.945] * (-1173.482) [-1168.865] (-1177.252) (-1175.441) -- 0:01:48
583000 -- (-1178.817) (-1184.014) (-1173.851) [-1170.718] * (-1178.589) (-1174.519) (-1171.972) [-1172.235] -- 0:01:48
584000 -- (-1178.327) [-1170.645] (-1171.621) (-1170.740) * (-1171.757) (-1175.345) (-1186.017) [-1168.197] -- 0:01:48
585000 -- [-1172.775] (-1176.553) (-1184.775) (-1173.992) * (-1178.181) [-1166.237] (-1173.383) (-1181.081) -- 0:01:47
Average standard deviation of split frequencies: 0.012109
586000 -- [-1176.505] (-1180.220) (-1181.447) (-1175.454) * [-1173.362] (-1173.311) (-1171.502) (-1175.618) -- 0:01:47
587000 -- (-1179.398) [-1171.175] (-1186.034) (-1175.967) * (-1182.923) (-1177.888) (-1172.276) [-1171.515] -- 0:01:46
588000 -- (-1176.471) [-1168.362] (-1182.945) (-1178.123) * (-1172.783) (-1176.881) [-1178.385] (-1182.218) -- 0:01:47
589000 -- (-1178.271) [-1175.913] (-1174.389) (-1170.650) * [-1176.011] (-1177.029) (-1185.605) (-1169.953) -- 0:01:46
590000 -- (-1179.872) (-1178.862) (-1172.329) [-1173.897] * [-1171.073] (-1169.663) (-1173.840) (-1177.208) -- 0:01:46
Average standard deviation of split frequencies: 0.011971
591000 -- (-1179.149) (-1176.934) (-1169.201) [-1165.773] * (-1180.447) (-1177.072) (-1182.372) [-1170.820] -- 0:01:45
592000 -- (-1180.617) [-1179.334] (-1172.560) (-1173.878) * (-1181.816) [-1167.865] (-1172.312) (-1174.945) -- 0:01:46
593000 -- (-1168.829) [-1175.663] (-1175.576) (-1176.262) * [-1178.302] (-1178.913) (-1182.650) (-1177.647) -- 0:01:45
594000 -- (-1179.001) (-1180.143) (-1173.109) [-1173.810] * (-1182.076) (-1176.587) [-1168.294] (-1176.024) -- 0:01:45
595000 -- (-1180.419) (-1178.317) [-1169.306] (-1171.797) * (-1188.014) (-1179.045) [-1175.285] (-1168.131) -- 0:01:44
Average standard deviation of split frequencies: 0.012031
596000 -- (-1184.731) [-1180.696] (-1168.587) (-1174.686) * (-1173.479) [-1169.829] (-1176.542) (-1178.426) -- 0:01:45
597000 -- (-1179.602) (-1180.168) [-1182.651] (-1175.263) * [-1175.636] (-1192.590) (-1171.057) (-1173.820) -- 0:01:44
598000 -- (-1175.490) (-1169.389) [-1181.655] (-1183.156) * [-1170.798] (-1172.272) (-1171.307) (-1176.012) -- 0:01:44
599000 -- [-1171.229] (-1188.391) (-1173.170) (-1169.715) * (-1169.181) (-1176.000) [-1170.691] (-1180.877) -- 0:01:43
600000 -- (-1176.412) [-1176.078] (-1184.615) (-1168.853) * (-1183.166) [-1173.952] (-1179.334) (-1183.007) -- 0:01:43
Average standard deviation of split frequencies: 0.011607
601000 -- (-1179.197) (-1176.230) (-1181.498) [-1175.388] * (-1174.176) (-1173.409) [-1176.662] (-1173.339) -- 0:01:43
602000 -- (-1185.417) (-1169.771) (-1174.759) [-1171.648] * [-1169.307] (-1177.595) (-1170.927) (-1186.956) -- 0:01:43
603000 -- (-1180.826) [-1178.089] (-1183.217) (-1178.117) * (-1168.127) (-1175.403) [-1166.597] (-1177.330) -- 0:01:43
604000 -- [-1175.878] (-1180.090) (-1173.860) (-1176.521) * (-1174.856) (-1177.349) [-1168.766] (-1179.510) -- 0:01:42
605000 -- (-1182.189) (-1181.763) [-1175.723] (-1174.089) * (-1177.520) (-1183.167) (-1183.757) [-1175.928] -- 0:01:42
Average standard deviation of split frequencies: 0.011054
606000 -- (-1188.161) [-1174.036] (-1174.071) (-1175.120) * (-1171.471) (-1173.596) [-1171.027] (-1175.019) -- 0:01:42
607000 -- [-1173.563] (-1178.661) (-1189.863) (-1176.499) * (-1184.774) (-1178.315) (-1179.160) [-1172.672] -- 0:01:42
608000 -- (-1180.238) [-1181.410] (-1171.434) (-1172.363) * (-1176.767) (-1171.829) (-1176.745) [-1171.535] -- 0:01:41
609000 -- (-1176.105) (-1172.515) (-1182.360) [-1172.132] * (-1172.733) (-1186.603) (-1180.994) [-1172.568] -- 0:01:41
610000 -- (-1177.956) (-1171.693) (-1172.682) [-1173.776] * [-1180.198] (-1178.225) (-1179.996) (-1172.905) -- 0:01:41
Average standard deviation of split frequencies: 0.010807
611000 -- (-1171.040) (-1177.815) [-1178.186] (-1184.806) * (-1176.114) [-1176.222] (-1176.441) (-1175.569) -- 0:01:41
612000 -- (-1166.967) [-1171.626] (-1180.791) (-1183.165) * (-1177.101) (-1172.937) (-1170.561) [-1172.859] -- 0:01:40
613000 -- (-1183.901) (-1181.107) [-1174.342] (-1179.396) * (-1177.501) (-1179.962) (-1178.280) [-1175.481] -- 0:01:40
614000 -- (-1176.228) (-1172.791) [-1175.717] (-1175.212) * (-1183.731) [-1174.835] (-1177.605) (-1180.758) -- 0:01:39
615000 -- (-1177.551) (-1168.947) (-1183.578) [-1172.507] * (-1166.999) (-1176.283) (-1175.040) [-1170.588] -- 0:01:40
Average standard deviation of split frequencies: 0.010432
616000 -- (-1177.310) (-1181.954) (-1182.246) [-1182.626] * (-1182.006) (-1170.469) (-1185.249) [-1176.473] -- 0:01:39
617000 -- (-1172.974) (-1179.803) [-1175.066] (-1177.198) * (-1178.905) [-1175.641] (-1184.566) (-1179.435) -- 0:01:39
618000 -- (-1180.276) (-1174.899) (-1177.410) [-1169.368] * (-1176.235) (-1167.844) [-1173.163] (-1184.198) -- 0:01:38
619000 -- [-1174.775] (-1176.228) (-1173.439) (-1184.623) * (-1176.036) (-1180.461) (-1173.275) [-1180.400] -- 0:01:39
620000 -- (-1174.195) (-1180.235) [-1171.085] (-1178.810) * (-1174.195) [-1175.243] (-1181.990) (-1171.346) -- 0:01:38
Average standard deviation of split frequencies: 0.010913
621000 -- [-1173.210] (-1180.804) (-1167.745) (-1182.628) * (-1186.103) [-1170.982] (-1173.277) (-1173.330) -- 0:01:38
622000 -- (-1182.313) (-1173.454) (-1169.867) [-1175.751] * (-1184.977) [-1172.740] (-1170.369) (-1183.736) -- 0:01:37
623000 -- (-1172.525) [-1175.203] (-1174.974) (-1180.349) * (-1180.871) (-1175.364) (-1182.691) [-1171.003] -- 0:01:38
624000 -- [-1171.867] (-1177.433) (-1168.815) (-1182.209) * (-1172.091) (-1171.494) (-1180.502) [-1176.866] -- 0:01:37
625000 -- (-1183.797) [-1170.989] (-1174.273) (-1172.473) * (-1173.966) (-1181.985) [-1178.850] (-1179.300) -- 0:01:37
Average standard deviation of split frequencies: 0.010860
626000 -- (-1180.818) [-1170.755] (-1175.504) (-1184.731) * (-1179.394) (-1176.670) [-1176.928] (-1172.623) -- 0:01:36
627000 -- (-1179.179) (-1184.074) [-1167.036] (-1174.931) * (-1178.504) [-1181.029] (-1184.220) (-1174.847) -- 0:01:36
628000 -- (-1177.327) [-1174.220] (-1171.846) (-1181.131) * (-1173.275) [-1175.584] (-1177.321) (-1177.217) -- 0:01:36
629000 -- (-1177.835) (-1181.106) [-1169.339] (-1174.410) * [-1168.915] (-1177.993) (-1180.709) (-1176.238) -- 0:01:36
630000 -- (-1169.443) (-1178.717) [-1173.333] (-1181.614) * (-1171.325) [-1177.363] (-1181.400) (-1177.765) -- 0:01:36
Average standard deviation of split frequencies: 0.010897
631000 -- [-1177.413] (-1185.138) (-1178.024) (-1175.103) * [-1176.566] (-1173.922) (-1185.660) (-1176.803) -- 0:01:35
632000 -- (-1174.213) (-1176.825) [-1173.121] (-1173.502) * (-1174.972) (-1176.862) (-1180.957) [-1181.200] -- 0:01:35
633000 -- [-1174.012] (-1174.705) (-1177.005) (-1183.378) * (-1172.600) [-1173.905] (-1172.939) (-1183.637) -- 0:01:35
634000 -- (-1179.672) (-1176.275) [-1176.426] (-1174.033) * (-1176.078) (-1179.199) [-1177.383] (-1174.983) -- 0:01:35
635000 -- (-1174.809) [-1176.810] (-1173.889) (-1179.775) * [-1179.823] (-1184.350) (-1178.677) (-1184.301) -- 0:01:34
Average standard deviation of split frequencies: 0.010767
636000 -- (-1174.495) (-1168.877) (-1174.480) [-1173.215] * (-1179.160) (-1183.610) [-1178.684] (-1171.710) -- 0:01:34
637000 -- [-1173.680] (-1176.105) (-1173.843) (-1176.599) * [-1176.122] (-1179.179) (-1175.440) (-1182.090) -- 0:01:34
638000 -- (-1178.026) (-1165.162) (-1177.248) [-1179.219] * (-1173.186) [-1175.271] (-1177.845) (-1179.420) -- 0:01:34
639000 -- [-1172.455] (-1177.264) (-1173.280) (-1171.354) * (-1172.816) (-1170.660) (-1194.848) [-1176.407] -- 0:01:33
640000 -- [-1171.552] (-1176.175) (-1174.360) (-1182.342) * [-1168.264] (-1174.584) (-1177.501) (-1176.610) -- 0:01:33
Average standard deviation of split frequencies: 0.010766
641000 -- (-1187.168) [-1173.282] (-1178.892) (-1179.724) * (-1177.960) [-1171.166] (-1172.931) (-1183.386) -- 0:01:32
642000 -- (-1178.678) (-1169.906) [-1172.516] (-1171.912) * [-1177.583] (-1176.878) (-1180.282) (-1178.694) -- 0:01:33
643000 -- (-1171.149) (-1173.937) [-1174.181] (-1174.787) * (-1183.811) [-1167.819] (-1176.507) (-1182.547) -- 0:01:32
644000 -- (-1177.229) (-1172.888) [-1174.952] (-1178.421) * (-1179.400) (-1178.384) [-1180.672] (-1183.908) -- 0:01:32
645000 -- (-1175.085) (-1171.465) (-1177.248) [-1172.166] * [-1177.747] (-1176.795) (-1178.970) (-1181.319) -- 0:01:31
Average standard deviation of split frequencies: 0.010408
646000 -- (-1171.790) (-1178.256) (-1166.158) [-1171.650] * (-1173.448) (-1174.269) (-1171.105) [-1175.973] -- 0:01:32
647000 -- (-1180.650) (-1177.193) (-1180.677) [-1172.556] * [-1171.128] (-1174.073) (-1173.896) (-1170.194) -- 0:01:31
648000 -- [-1177.359] (-1182.407) (-1176.793) (-1174.967) * (-1172.507) (-1180.823) (-1172.578) [-1172.444] -- 0:01:31
649000 -- [-1173.076] (-1171.211) (-1174.324) (-1178.956) * (-1172.124) (-1176.251) [-1181.297] (-1177.186) -- 0:01:30
650000 -- (-1181.016) (-1182.258) (-1173.285) [-1173.386] * (-1174.761) [-1174.766] (-1169.951) (-1184.451) -- 0:01:30
Average standard deviation of split frequencies: 0.010105
651000 -- (-1180.601) (-1178.340) [-1167.251] (-1175.751) * (-1180.264) (-1169.331) (-1173.598) [-1179.547] -- 0:01:30
652000 -- (-1180.332) (-1174.966) [-1166.989] (-1178.523) * (-1178.020) (-1172.325) (-1175.943) [-1174.742] -- 0:01:30
653000 -- (-1178.319) [-1172.080] (-1181.776) (-1177.441) * (-1177.317) [-1174.125] (-1172.046) (-1185.283) -- 0:01:29
654000 -- (-1175.859) (-1171.175) [-1179.195] (-1181.496) * (-1173.154) (-1171.306) [-1169.674] (-1182.267) -- 0:01:29
655000 -- (-1176.022) (-1172.818) (-1179.354) [-1171.063] * (-1179.171) (-1178.081) (-1183.050) [-1176.699] -- 0:01:29
Average standard deviation of split frequencies: 0.010098
656000 -- (-1171.969) (-1179.309) (-1174.607) [-1172.338] * (-1173.532) (-1185.053) (-1177.042) [-1169.315] -- 0:01:29
657000 -- (-1176.049) [-1181.974] (-1183.684) (-1180.764) * (-1177.510) [-1170.847] (-1183.121) (-1174.921) -- 0:01:29
658000 -- (-1172.576) (-1174.717) (-1170.744) [-1174.671] * (-1183.843) [-1175.540] (-1184.920) (-1187.127) -- 0:01:28
659000 -- (-1171.732) [-1171.406] (-1169.812) (-1181.283) * [-1173.024] (-1172.199) (-1174.140) (-1178.268) -- 0:01:28
660000 -- (-1174.069) (-1171.327) [-1170.009] (-1173.848) * (-1180.466) (-1179.010) (-1173.005) [-1175.450] -- 0:01:28
Average standard deviation of split frequencies: 0.010102
661000 -- (-1171.954) (-1173.971) [-1172.859] (-1176.163) * [-1175.900] (-1172.230) (-1178.836) (-1190.173) -- 0:01:28
662000 -- (-1170.533) [-1172.140] (-1181.862) (-1175.611) * [-1177.203] (-1177.978) (-1178.163) (-1176.215) -- 0:01:27
663000 -- (-1178.898) (-1175.946) (-1171.987) [-1176.975] * (-1185.931) [-1173.558] (-1169.722) (-1178.725) -- 0:01:27
664000 -- (-1176.482) (-1182.369) [-1186.127] (-1177.406) * [-1172.222] (-1181.511) (-1173.698) (-1177.251) -- 0:01:27
665000 -- (-1185.236) [-1171.609] (-1174.502) (-1179.363) * [-1172.068] (-1174.695) (-1184.936) (-1176.674) -- 0:01:27
Average standard deviation of split frequencies: 0.009909
666000 -- (-1174.119) (-1172.069) [-1175.114] (-1181.066) * (-1173.625) [-1175.490] (-1179.638) (-1175.205) -- 0:01:26
667000 -- (-1173.929) (-1170.424) (-1181.097) [-1168.804] * (-1175.549) (-1167.738) (-1181.526) [-1174.847] -- 0:01:26
668000 -- [-1173.224] (-1173.179) (-1184.625) (-1173.080) * (-1177.521) [-1173.610] (-1177.681) (-1182.783) -- 0:01:25
669000 -- (-1179.082) [-1182.663] (-1167.015) (-1179.781) * [-1174.858] (-1173.091) (-1173.971) (-1176.010) -- 0:01:26
670000 -- (-1178.307) [-1168.021] (-1179.484) (-1178.937) * [-1175.441] (-1168.202) (-1182.077) (-1174.043) -- 0:01:25
Average standard deviation of split frequencies: 0.009803
671000 -- (-1176.846) (-1177.914) [-1174.864] (-1175.154) * [-1180.709] (-1176.697) (-1175.738) (-1185.718) -- 0:01:25
672000 -- (-1180.069) (-1183.907) [-1171.167] (-1191.571) * (-1184.500) (-1170.243) [-1171.266] (-1173.878) -- 0:01:24
673000 -- [-1175.032] (-1182.795) (-1170.777) (-1173.542) * (-1178.179) (-1177.631) (-1175.821) [-1181.419] -- 0:01:25
674000 -- (-1181.055) [-1167.543] (-1180.436) (-1169.520) * (-1168.887) [-1168.723] (-1173.661) (-1173.099) -- 0:01:24
675000 -- (-1178.979) (-1171.268) (-1168.548) [-1180.986] * (-1172.369) [-1175.140] (-1171.911) (-1182.798) -- 0:01:24
Average standard deviation of split frequencies: 0.009616
676000 -- [-1172.712] (-1171.564) (-1178.399) (-1174.265) * [-1174.061] (-1173.880) (-1183.984) (-1174.675) -- 0:01:23
677000 -- (-1175.495) (-1176.151) (-1171.398) [-1174.142] * (-1170.802) [-1180.934] (-1179.336) (-1176.895) -- 0:01:23
678000 -- (-1170.053) [-1170.812] (-1182.959) (-1182.210) * (-1182.293) [-1170.426] (-1178.819) (-1175.081) -- 0:01:23
679000 -- [-1175.007] (-1176.143) (-1180.338) (-1181.817) * (-1173.290) (-1183.768) (-1175.373) [-1174.735] -- 0:01:23
680000 -- [-1176.233] (-1178.162) (-1176.774) (-1168.668) * (-1181.784) (-1180.014) (-1174.595) [-1169.094] -- 0:01:22
Average standard deviation of split frequencies: 0.009915
681000 -- (-1172.120) [-1170.587] (-1172.217) (-1174.601) * (-1180.052) (-1175.818) (-1174.131) [-1171.123] -- 0:01:22
682000 -- (-1189.977) [-1170.252] (-1182.917) (-1174.103) * (-1180.657) [-1174.799] (-1182.203) (-1174.591) -- 0:01:22
683000 -- (-1182.283) (-1170.861) [-1175.741] (-1177.143) * (-1177.806) (-1175.703) (-1172.580) [-1175.632] -- 0:01:22
684000 -- [-1171.585] (-1175.679) (-1180.317) (-1168.934) * (-1171.694) (-1175.603) (-1175.567) [-1178.910] -- 0:01:21
685000 -- (-1178.742) (-1178.868) (-1179.795) [-1171.133] * (-1183.517) (-1185.188) (-1175.927) [-1170.985] -- 0:01:21
Average standard deviation of split frequencies: 0.009910
686000 -- (-1177.983) (-1171.790) (-1173.939) [-1179.336] * (-1179.949) (-1181.111) [-1175.848] (-1174.346) -- 0:01:21
687000 -- (-1172.838) (-1179.147) (-1170.242) [-1169.655] * [-1172.462] (-1176.747) (-1176.128) (-1172.312) -- 0:01:21
688000 -- [-1172.804] (-1172.124) (-1173.136) (-1173.949) * [-1178.801] (-1177.567) (-1174.256) (-1177.091) -- 0:01:20
689000 -- (-1167.344) [-1167.727] (-1178.536) (-1170.447) * [-1171.352] (-1177.737) (-1170.039) (-1179.104) -- 0:01:20
690000 -- [-1174.062] (-1177.857) (-1176.372) (-1179.785) * (-1173.232) (-1171.980) [-1170.476] (-1176.933) -- 0:01:20
Average standard deviation of split frequencies: 0.010346
691000 -- [-1177.781] (-1182.886) (-1170.823) (-1170.933) * (-1170.415) [-1171.883] (-1174.746) (-1169.226) -- 0:01:20
692000 -- (-1175.615) (-1186.391) [-1176.920] (-1188.109) * (-1174.253) [-1173.666] (-1175.410) (-1185.913) -- 0:01:20
693000 -- (-1177.938) (-1189.177) [-1173.494] (-1172.717) * (-1171.808) (-1176.818) [-1173.895] (-1178.828) -- 0:01:19
694000 -- [-1169.505] (-1192.552) (-1171.066) (-1176.434) * (-1173.027) [-1173.916] (-1179.270) (-1170.540) -- 0:01:19
695000 -- (-1176.719) [-1172.015] (-1175.333) (-1174.031) * (-1173.443) (-1178.925) (-1183.300) [-1172.028] -- 0:01:18
Average standard deviation of split frequencies: 0.010124
696000 -- [-1175.716] (-1177.975) (-1178.740) (-1176.409) * [-1167.930] (-1174.946) (-1176.716) (-1185.612) -- 0:01:19
697000 -- [-1171.779] (-1179.846) (-1178.933) (-1179.247) * (-1172.127) (-1172.193) (-1176.884) [-1169.508] -- 0:01:18
698000 -- (-1174.295) (-1178.097) [-1171.047] (-1169.479) * (-1180.848) (-1185.088) (-1182.020) [-1174.118] -- 0:01:18
699000 -- (-1182.464) (-1186.739) [-1174.568] (-1196.631) * (-1172.097) (-1172.983) (-1179.702) [-1171.558] -- 0:01:17
700000 -- (-1179.557) (-1180.184) (-1173.239) [-1170.193] * [-1175.706] (-1180.251) (-1174.557) (-1177.744) -- 0:01:18
Average standard deviation of split frequencies: 0.010057
701000 -- [-1170.405] (-1170.124) (-1178.607) (-1167.880) * (-1192.476) (-1170.536) (-1174.757) [-1172.536] -- 0:01:17
702000 -- (-1174.724) (-1173.373) (-1178.328) [-1173.670] * [-1178.633] (-1184.175) (-1176.903) (-1176.101) -- 0:01:17
703000 -- (-1174.230) (-1179.824) (-1170.897) [-1169.233] * (-1174.895) (-1180.167) (-1178.533) [-1175.264] -- 0:01:16
704000 -- [-1170.799] (-1176.201) (-1167.895) (-1181.653) * (-1178.153) (-1171.765) [-1177.818] (-1178.467) -- 0:01:16
705000 -- (-1177.141) (-1181.305) (-1185.773) [-1174.186] * (-1177.990) [-1174.411] (-1185.230) (-1179.433) -- 0:01:16
Average standard deviation of split frequencies: 0.009735
706000 -- (-1174.459) (-1174.832) [-1171.237] (-1176.110) * [-1175.352] (-1176.153) (-1176.559) (-1185.651) -- 0:01:16
707000 -- (-1174.845) (-1176.933) [-1172.828] (-1175.342) * [-1179.876] (-1170.001) (-1183.012) (-1181.787) -- 0:01:15
708000 -- [-1170.569] (-1184.247) (-1186.444) (-1179.602) * (-1186.901) (-1171.508) [-1183.138] (-1183.447) -- 0:01:15
709000 -- (-1178.993) (-1177.536) (-1174.473) [-1172.723] * (-1179.402) (-1177.451) [-1172.563] (-1181.678) -- 0:01:15
710000 -- [-1175.779] (-1185.764) (-1175.183) (-1174.749) * (-1174.826) (-1176.015) [-1169.889] (-1176.655) -- 0:01:15
Average standard deviation of split frequencies: 0.009845
711000 -- [-1170.797] (-1170.829) (-1175.436) (-1174.275) * (-1174.159) (-1177.683) (-1177.490) [-1179.303] -- 0:01:14
712000 -- [-1170.746] (-1177.923) (-1166.570) (-1176.657) * (-1175.916) (-1176.305) [-1175.294] (-1170.576) -- 0:01:14
713000 -- (-1183.788) [-1172.840] (-1172.331) (-1179.319) * (-1173.759) (-1174.899) (-1169.939) [-1179.538] -- 0:01:14
714000 -- [-1175.945] (-1178.396) (-1178.477) (-1178.860) * (-1178.260) (-1177.057) (-1179.821) [-1179.307] -- 0:01:14
715000 -- [-1176.011] (-1178.906) (-1171.820) (-1177.221) * (-1180.423) (-1182.079) [-1173.781] (-1174.022) -- 0:01:13
Average standard deviation of split frequencies: 0.009876
716000 -- [-1173.783] (-1176.439) (-1177.453) (-1183.175) * (-1176.723) (-1176.632) [-1181.805] (-1183.705) -- 0:01:13
717000 -- (-1176.351) (-1177.468) [-1169.338] (-1176.301) * (-1170.321) [-1176.074] (-1171.627) (-1176.514) -- 0:01:13
718000 -- (-1174.761) (-1179.523) [-1176.192] (-1180.767) * [-1171.105] (-1182.113) (-1171.093) (-1180.752) -- 0:01:13
719000 -- (-1169.853) [-1174.177] (-1186.077) (-1175.011) * [-1174.461] (-1180.217) (-1183.392) (-1173.560) -- 0:01:12
720000 -- (-1183.039) (-1173.682) (-1182.915) [-1168.457] * (-1180.882) (-1173.974) (-1183.604) [-1176.605] -- 0:01:12
Average standard deviation of split frequencies: 0.009743
721000 -- (-1170.294) (-1181.061) [-1167.952] (-1177.453) * (-1178.549) (-1177.382) (-1182.779) [-1172.952] -- 0:01:12
722000 -- (-1179.358) (-1170.460) [-1176.642] (-1166.896) * (-1174.093) (-1173.758) [-1167.602] (-1173.921) -- 0:01:12
723000 -- (-1179.496) [-1176.617] (-1172.315) (-1176.139) * (-1176.249) [-1170.945] (-1176.511) (-1174.348) -- 0:01:12
724000 -- [-1172.079] (-1173.638) (-1179.815) (-1175.310) * (-1178.770) [-1172.727] (-1169.774) (-1174.120) -- 0:01:11
725000 -- (-1171.152) (-1169.832) (-1173.641) [-1178.007] * (-1173.759) (-1180.610) [-1170.944] (-1172.249) -- 0:01:11
Average standard deviation of split frequencies: 0.009466
726000 -- (-1167.989) (-1176.583) (-1172.512) [-1167.160] * (-1176.824) (-1171.656) [-1172.182] (-1178.488) -- 0:01:10
727000 -- (-1168.116) (-1176.305) (-1181.007) [-1176.871] * (-1174.716) [-1177.388] (-1171.945) (-1170.487) -- 0:01:10
728000 -- (-1179.705) (-1184.988) [-1173.063] (-1179.978) * [-1167.963] (-1171.699) (-1172.815) (-1170.373) -- 0:01:10
729000 -- [-1172.586] (-1172.540) (-1173.674) (-1178.404) * (-1176.508) (-1174.681) (-1173.481) [-1173.252] -- 0:01:10
730000 -- [-1173.802] (-1176.528) (-1169.919) (-1182.840) * [-1174.589] (-1172.946) (-1175.291) (-1184.526) -- 0:01:09
Average standard deviation of split frequencies: 0.009542
731000 -- (-1176.641) [-1177.098] (-1177.935) (-1187.547) * (-1177.050) (-1176.125) [-1175.747] (-1177.698) -- 0:01:09
732000 -- (-1181.227) [-1176.767] (-1181.995) (-1177.032) * (-1178.919) (-1180.733) [-1180.652] (-1170.815) -- 0:01:09
733000 -- (-1170.577) [-1172.343] (-1177.466) (-1174.585) * (-1180.919) (-1177.757) (-1174.111) [-1174.012] -- 0:01:09
734000 -- (-1174.225) (-1177.327) [-1173.714] (-1180.824) * (-1182.364) [-1175.783] (-1174.755) (-1174.185) -- 0:01:08
735000 -- (-1177.953) (-1172.809) [-1171.191] (-1187.373) * (-1179.892) (-1178.015) (-1177.568) [-1175.406] -- 0:01:08
Average standard deviation of split frequencies: 0.009068
736000 -- (-1172.448) [-1185.535] (-1177.332) (-1178.626) * (-1181.599) (-1179.412) [-1170.103] (-1179.658) -- 0:01:08
737000 -- [-1173.908] (-1179.457) (-1174.965) (-1182.768) * (-1174.507) (-1179.017) [-1173.996] (-1186.600) -- 0:01:08
738000 -- (-1186.923) (-1173.187) (-1172.507) [-1167.513] * (-1169.399) (-1185.029) (-1172.930) [-1172.991] -- 0:01:07
739000 -- [-1169.060] (-1186.378) (-1170.283) (-1170.408) * [-1177.535] (-1176.780) (-1175.114) (-1173.960) -- 0:01:07
740000 -- [-1170.057] (-1176.046) (-1175.174) (-1174.171) * (-1179.509) [-1169.985] (-1184.346) (-1175.001) -- 0:01:07
Average standard deviation of split frequencies: 0.008843
741000 -- (-1177.522) (-1169.948) [-1172.484] (-1177.221) * (-1174.675) [-1164.568] (-1176.696) (-1184.535) -- 0:01:07
742000 -- (-1179.171) [-1174.102] (-1182.184) (-1172.091) * (-1169.646) (-1170.186) (-1186.296) [-1175.416] -- 0:01:06
743000 -- (-1176.584) [-1176.444] (-1178.210) (-1175.210) * [-1170.729] (-1177.506) (-1172.075) (-1174.893) -- 0:01:06
744000 -- (-1189.914) (-1180.107) (-1176.461) [-1176.063] * (-1181.868) (-1171.709) (-1187.014) [-1173.221] -- 0:01:06
745000 -- (-1175.041) (-1168.205) (-1174.818) [-1177.269] * [-1174.475] (-1182.181) (-1173.360) (-1178.072) -- 0:01:06
Average standard deviation of split frequencies: 0.008514
746000 -- [-1175.751] (-1183.240) (-1179.252) (-1176.802) * [-1176.353] (-1179.712) (-1180.900) (-1179.956) -- 0:01:06
747000 -- [-1172.890] (-1168.634) (-1180.842) (-1177.953) * (-1169.052) (-1179.869) (-1173.801) [-1176.368] -- 0:01:05
748000 -- [-1172.572] (-1177.430) (-1181.935) (-1171.830) * (-1176.669) (-1183.048) (-1176.982) [-1170.351] -- 0:01:05
749000 -- (-1184.351) (-1174.555) (-1169.729) [-1183.179] * (-1180.380) (-1170.888) (-1171.876) [-1170.776] -- 0:01:05
750000 -- (-1172.878) (-1180.922) (-1177.559) [-1173.108] * [-1178.033] (-1176.921) (-1169.520) (-1176.588) -- 0:01:05
Average standard deviation of split frequencies: 0.008164
751000 -- (-1171.334) (-1185.053) (-1169.697) [-1169.996] * (-1178.366) (-1182.843) (-1173.100) [-1173.269] -- 0:01:04
752000 -- [-1177.199] (-1182.495) (-1177.171) (-1179.035) * [-1169.205] (-1189.566) (-1178.184) (-1171.979) -- 0:01:04
753000 -- (-1186.180) (-1182.651) [-1176.386] (-1174.633) * [-1173.496] (-1174.138) (-1177.776) (-1177.688) -- 0:01:03
754000 -- (-1182.349) (-1171.886) [-1176.770] (-1177.797) * (-1182.065) [-1166.983] (-1175.167) (-1184.188) -- 0:01:03
755000 -- (-1175.240) (-1175.638) (-1182.629) [-1171.269] * (-1176.308) (-1170.125) (-1173.312) [-1179.242] -- 0:01:03
Average standard deviation of split frequencies: 0.007614
756000 -- (-1176.623) (-1177.447) (-1175.126) [-1182.836] * (-1169.676) (-1178.080) [-1170.988] (-1171.778) -- 0:01:03
757000 -- [-1170.609] (-1178.350) (-1183.680) (-1176.836) * (-1174.564) (-1182.557) (-1174.253) [-1169.183] -- 0:01:02
758000 -- (-1172.242) (-1185.331) (-1188.170) [-1170.740] * (-1177.096) [-1176.084] (-1174.446) (-1172.524) -- 0:01:02
759000 -- (-1174.890) (-1178.856) [-1175.182] (-1175.845) * (-1174.578) [-1173.982] (-1170.675) (-1170.781) -- 0:01:02
760000 -- (-1173.599) (-1178.391) [-1171.906] (-1178.253) * [-1179.094] (-1174.887) (-1174.568) (-1177.172) -- 0:01:02
Average standard deviation of split frequencies: 0.007111
761000 -- (-1169.301) (-1183.960) [-1172.727] (-1176.912) * (-1181.725) (-1179.498) [-1174.224] (-1174.101) -- 0:01:01
762000 -- (-1177.318) [-1171.993] (-1185.387) (-1185.475) * (-1183.043) [-1169.961] (-1170.347) (-1174.000) -- 0:01:01
763000 -- (-1178.082) [-1174.434] (-1180.016) (-1183.864) * (-1178.492) (-1176.314) [-1179.370] (-1171.623) -- 0:01:01
764000 -- (-1179.686) (-1180.101) (-1174.734) [-1173.394] * (-1182.190) (-1171.585) (-1168.966) [-1172.784] -- 0:01:01
765000 -- (-1176.234) (-1174.071) (-1180.170) [-1170.823] * [-1175.206] (-1172.421) (-1176.148) (-1187.884) -- 0:01:01
Average standard deviation of split frequencies: 0.007320
766000 -- (-1181.701) (-1183.339) (-1176.196) [-1170.228] * (-1175.825) (-1176.872) (-1168.100) [-1173.771] -- 0:01:00
767000 -- (-1176.674) [-1175.619] (-1184.339) (-1174.731) * (-1171.891) (-1180.166) [-1171.130] (-1167.810) -- 0:01:00
768000 -- (-1175.144) (-1177.813) [-1170.161] (-1175.826) * [-1176.557] (-1173.165) (-1175.125) (-1178.810) -- 0:01:00
769000 -- (-1188.544) [-1173.787] (-1170.426) (-1171.672) * (-1179.185) (-1179.849) [-1172.063] (-1172.377) -- 0:01:00
770000 -- (-1178.917) (-1175.544) [-1174.056] (-1185.758) * [-1173.933] (-1182.846) (-1168.746) (-1174.220) -- 0:00:59
Average standard deviation of split frequencies: 0.007211
771000 -- [-1170.790] (-1179.730) (-1177.269) (-1179.770) * (-1173.637) (-1187.790) [-1169.720] (-1174.788) -- 0:00:59
772000 -- (-1178.279) [-1179.994] (-1190.439) (-1173.221) * [-1178.245] (-1179.905) (-1171.490) (-1178.327) -- 0:00:59
773000 -- [-1176.816] (-1174.893) (-1172.937) (-1172.751) * (-1177.605) (-1174.530) (-1176.036) [-1173.224] -- 0:00:59
774000 -- [-1173.410] (-1184.129) (-1172.395) (-1172.323) * (-1175.078) (-1172.678) (-1183.539) [-1168.232] -- 0:00:58
775000 -- (-1178.004) (-1182.997) [-1179.087] (-1185.466) * (-1174.645) [-1172.356] (-1188.541) (-1180.552) -- 0:00:58
Average standard deviation of split frequencies: 0.007162
776000 -- [-1174.474] (-1180.584) (-1172.473) (-1186.098) * (-1175.857) (-1169.597) [-1170.148] (-1180.581) -- 0:00:58
777000 -- (-1174.492) (-1184.853) [-1170.190] (-1173.195) * [-1179.218] (-1177.151) (-1173.370) (-1182.274) -- 0:00:57
778000 -- (-1175.706) (-1182.612) (-1179.375) [-1166.450] * (-1179.260) (-1177.186) [-1177.579] (-1170.860) -- 0:00:57
779000 -- (-1177.199) [-1171.183] (-1186.498) (-1167.169) * (-1168.796) [-1173.099] (-1179.339) (-1181.163) -- 0:00:57
780000 -- (-1192.937) (-1177.495) (-1176.570) [-1171.898] * [-1175.869] (-1173.411) (-1182.113) (-1170.413) -- 0:00:56
Average standard deviation of split frequencies: 0.007119
781000 -- [-1167.122] (-1178.086) (-1185.866) (-1178.456) * (-1176.234) (-1183.776) [-1173.107] (-1173.343) -- 0:00:56
782000 -- (-1172.975) [-1169.167] (-1191.359) (-1170.228) * [-1171.095] (-1170.002) (-1177.582) (-1180.440) -- 0:00:56
783000 -- (-1177.955) [-1175.536] (-1173.462) (-1177.895) * [-1172.596] (-1177.223) (-1178.376) (-1174.543) -- 0:00:56
784000 -- (-1186.759) [-1172.514] (-1184.751) (-1174.841) * [-1175.458] (-1172.019) (-1173.918) (-1181.780) -- 0:00:55
785000 -- (-1171.053) (-1179.327) (-1185.336) [-1171.044] * (-1175.359) (-1174.826) (-1182.342) [-1177.921] -- 0:00:55
Average standard deviation of split frequencies: 0.006566
786000 -- (-1172.873) [-1173.711] (-1176.382) (-1173.082) * (-1173.055) (-1168.008) (-1178.694) [-1171.788] -- 0:00:55
787000 -- (-1176.635) [-1174.518] (-1174.413) (-1169.694) * [-1170.619] (-1178.658) (-1175.201) (-1174.311) -- 0:00:55
788000 -- (-1172.980) (-1177.461) [-1177.822] (-1174.444) * (-1177.643) [-1178.257] (-1176.198) (-1172.038) -- 0:00:55
789000 -- [-1173.477] (-1178.140) (-1180.889) (-1175.021) * [-1171.259] (-1174.356) (-1169.654) (-1174.717) -- 0:00:54
790000 -- (-1185.131) [-1171.150] (-1170.474) (-1170.922) * (-1188.639) [-1176.672] (-1169.825) (-1181.484) -- 0:00:54
Average standard deviation of split frequencies: 0.006618
791000 -- (-1176.328) [-1171.719] (-1180.683) (-1168.466) * [-1167.725] (-1183.434) (-1186.586) (-1173.238) -- 0:00:54
792000 -- (-1169.166) (-1180.658) (-1170.098) [-1168.462] * [-1171.970] (-1176.280) (-1189.676) (-1174.262) -- 0:00:54
793000 -- (-1169.654) [-1171.676] (-1182.590) (-1175.133) * (-1168.004) (-1181.795) (-1185.673) [-1174.158] -- 0:00:53
794000 -- (-1177.195) (-1173.975) [-1174.253] (-1175.901) * [-1176.235] (-1174.277) (-1179.282) (-1185.624) -- 0:00:53
795000 -- (-1178.700) [-1175.898] (-1173.447) (-1172.213) * (-1180.479) (-1173.551) [-1175.479] (-1184.869) -- 0:00:53
Average standard deviation of split frequencies: 0.006639
796000 -- (-1173.420) (-1172.990) [-1177.613] (-1174.485) * (-1174.290) (-1174.000) [-1171.406] (-1177.834) -- 0:00:53
797000 -- (-1177.512) [-1170.657] (-1176.896) (-1185.836) * (-1176.643) (-1178.159) [-1175.268] (-1173.500) -- 0:00:52
798000 -- (-1179.348) [-1169.368] (-1177.010) (-1181.511) * (-1173.199) (-1174.277) [-1166.322] (-1194.222) -- 0:00:52
799000 -- (-1171.528) (-1174.098) [-1173.851] (-1183.357) * (-1176.297) (-1172.577) [-1174.592] (-1181.333) -- 0:00:52
800000 -- (-1171.932) (-1174.851) [-1178.356] (-1167.992) * (-1173.495) [-1176.342] (-1183.010) (-1177.885) -- 0:00:51
Average standard deviation of split frequencies: 0.006918
801000 -- (-1171.180) (-1173.635) [-1169.047] (-1181.158) * (-1166.075) (-1181.600) (-1192.344) [-1177.897] -- 0:00:51
802000 -- (-1179.215) (-1173.493) (-1175.154) [-1173.215] * [-1170.309] (-1175.898) (-1185.381) (-1181.723) -- 0:00:51
803000 -- (-1172.658) (-1179.902) (-1172.277) [-1174.216] * [-1171.651] (-1179.515) (-1181.948) (-1188.974) -- 0:00:51
804000 -- [-1184.364] (-1182.924) (-1177.850) (-1180.564) * (-1182.582) (-1173.408) [-1172.415] (-1197.374) -- 0:00:50
805000 -- (-1181.039) (-1178.141) (-1172.818) [-1172.649] * (-1172.974) [-1175.098] (-1166.839) (-1176.574) -- 0:00:50
Average standard deviation of split frequencies: 0.006784
806000 -- [-1184.679] (-1176.199) (-1173.876) (-1173.141) * (-1183.421) [-1179.122] (-1184.834) (-1181.908) -- 0:00:50
807000 -- [-1171.307] (-1183.255) (-1184.664) (-1173.608) * [-1173.831] (-1174.407) (-1178.025) (-1169.767) -- 0:00:49
808000 -- [-1174.255] (-1171.038) (-1177.815) (-1169.322) * (-1178.003) [-1171.662] (-1193.234) (-1176.923) -- 0:00:49
809000 -- (-1185.921) (-1190.611) [-1173.433] (-1178.954) * [-1182.037] (-1174.353) (-1184.185) (-1177.017) -- 0:00:49
810000 -- [-1173.847] (-1185.432) (-1173.873) (-1181.330) * [-1183.622] (-1174.345) (-1174.057) (-1176.446) -- 0:00:49
Average standard deviation of split frequencies: 0.006484
811000 -- [-1175.918] (-1182.864) (-1174.740) (-1177.639) * (-1175.729) (-1171.875) (-1184.010) [-1180.573] -- 0:00:49
812000 -- (-1178.850) [-1175.243] (-1170.712) (-1175.783) * [-1169.580] (-1174.852) (-1172.928) (-1182.185) -- 0:00:48
813000 -- (-1184.812) (-1184.462) (-1180.612) [-1180.369] * (-1179.789) [-1171.202] (-1179.604) (-1174.161) -- 0:00:48
814000 -- (-1174.379) (-1183.620) [-1178.924] (-1185.382) * [-1172.733] (-1174.347) (-1167.938) (-1177.476) -- 0:00:48
815000 -- (-1176.625) (-1180.437) (-1175.970) [-1179.402] * (-1173.068) (-1173.697) [-1167.747] (-1174.568) -- 0:00:48
Average standard deviation of split frequencies: 0.006470
816000 -- (-1180.078) (-1190.548) (-1180.325) [-1173.340] * (-1174.063) [-1171.471] (-1174.472) (-1178.881) -- 0:00:47
817000 -- (-1177.622) [-1172.550] (-1179.786) (-1180.137) * (-1182.574) (-1183.837) [-1170.281] (-1174.935) -- 0:00:47
818000 -- (-1181.146) [-1171.294] (-1177.524) (-1174.652) * (-1177.606) [-1180.774] (-1172.323) (-1171.393) -- 0:00:47
819000 -- [-1179.591] (-1175.804) (-1170.745) (-1180.928) * (-1182.134) (-1175.742) [-1166.567] (-1173.795) -- 0:00:47
820000 -- (-1179.897) (-1177.478) (-1182.811) [-1172.636] * (-1174.339) (-1177.342) (-1180.069) [-1171.529] -- 0:00:46
Average standard deviation of split frequencies: 0.006520
821000 -- (-1176.354) [-1174.021] (-1188.048) (-1181.540) * [-1172.905] (-1175.582) (-1177.001) (-1175.159) -- 0:00:46
822000 -- [-1183.667] (-1177.795) (-1185.003) (-1172.608) * [-1174.062] (-1174.948) (-1183.144) (-1174.089) -- 0:00:46
823000 -- (-1176.294) [-1180.507] (-1179.600) (-1170.387) * [-1168.142] (-1172.693) (-1179.058) (-1174.132) -- 0:00:46
824000 -- (-1172.865) (-1183.444) [-1180.204] (-1192.933) * [-1167.860] (-1167.233) (-1171.313) (-1169.253) -- 0:00:45
825000 -- (-1176.963) (-1188.365) (-1175.902) [-1172.401] * (-1183.839) (-1179.162) (-1171.865) [-1174.246] -- 0:00:45
Average standard deviation of split frequencies: 0.006649
826000 -- (-1181.616) (-1177.439) [-1167.620] (-1175.587) * (-1177.691) (-1178.043) [-1171.401] (-1189.027) -- 0:00:45
827000 -- [-1177.993] (-1178.903) (-1181.773) (-1168.365) * (-1170.332) (-1170.617) (-1178.009) [-1176.721] -- 0:00:44
828000 -- (-1187.651) (-1177.007) [-1172.716] (-1171.134) * [-1170.868] (-1170.130) (-1175.623) (-1175.746) -- 0:00:44
829000 -- (-1182.528) (-1183.868) [-1177.293] (-1172.206) * (-1176.019) [-1170.825] (-1172.400) (-1168.233) -- 0:00:44
830000 -- (-1177.585) (-1175.828) (-1177.728) [-1178.479] * [-1169.038] (-1187.154) (-1189.662) (-1171.582) -- 0:00:44
Average standard deviation of split frequencies: 0.006810
831000 -- (-1179.556) (-1177.028) [-1166.904] (-1181.557) * (-1172.760) (-1170.041) (-1176.512) [-1175.905] -- 0:00:43
832000 -- [-1183.332] (-1180.221) (-1168.249) (-1175.032) * (-1173.246) (-1178.939) [-1169.851] (-1177.381) -- 0:00:43
833000 -- (-1181.636) [-1173.709] (-1169.499) (-1193.820) * (-1176.145) (-1175.288) [-1168.362] (-1182.527) -- 0:00:43
834000 -- [-1174.545] (-1180.529) (-1173.402) (-1175.390) * (-1171.400) (-1173.200) (-1176.045) [-1172.558] -- 0:00:43
835000 -- [-1170.589] (-1172.403) (-1177.094) (-1169.609) * (-1174.098) [-1176.958] (-1172.823) (-1173.576) -- 0:00:42
Average standard deviation of split frequencies: 0.006470
836000 -- (-1175.695) (-1183.602) (-1185.850) [-1179.037] * [-1176.542] (-1179.192) (-1170.884) (-1178.238) -- 0:00:42
837000 -- (-1177.764) (-1183.001) [-1178.708] (-1171.749) * [-1175.294] (-1179.268) (-1181.753) (-1175.084) -- 0:00:42
838000 -- (-1175.297) (-1174.812) (-1169.735) [-1171.213] * (-1173.557) [-1172.101] (-1178.489) (-1169.926) -- 0:00:42
839000 -- (-1174.996) [-1176.011] (-1182.982) (-1174.818) * [-1175.641] (-1179.253) (-1172.668) (-1182.083) -- 0:00:41
840000 -- [-1171.029] (-1177.713) (-1179.901) (-1175.742) * [-1174.248] (-1179.408) (-1174.311) (-1182.339) -- 0:00:41
Average standard deviation of split frequencies: 0.006375
841000 -- (-1168.854) [-1174.881] (-1182.847) (-1175.987) * [-1170.034] (-1184.692) (-1175.019) (-1179.887) -- 0:00:41
842000 -- [-1189.392] (-1180.066) (-1174.537) (-1171.737) * (-1175.400) (-1179.359) [-1170.225] (-1185.309) -- 0:00:41
843000 -- (-1172.437) (-1182.404) (-1181.701) [-1177.254] * (-1179.474) (-1173.558) (-1184.528) [-1183.361] -- 0:00:40
844000 -- [-1167.094] (-1172.608) (-1178.798) (-1173.061) * (-1179.919) (-1172.306) [-1174.269] (-1177.561) -- 0:00:40
845000 -- (-1165.845) [-1170.381] (-1173.606) (-1172.568) * (-1183.090) [-1170.170] (-1173.303) (-1182.955) -- 0:00:40
Average standard deviation of split frequencies: 0.006217
846000 -- (-1181.032) (-1171.848) [-1170.995] (-1171.352) * (-1172.202) (-1173.997) [-1177.465] (-1197.425) -- 0:00:40
847000 -- [-1168.567] (-1174.897) (-1186.925) (-1177.703) * [-1171.465] (-1167.383) (-1168.868) (-1172.176) -- 0:00:39
848000 -- (-1178.885) (-1169.303) [-1172.698] (-1183.049) * (-1177.124) (-1179.487) (-1180.493) [-1172.039] -- 0:00:39
849000 -- (-1175.614) (-1179.418) (-1177.607) [-1175.396] * (-1174.460) (-1176.045) (-1182.490) [-1180.622] -- 0:00:39
850000 -- [-1170.194] (-1174.871) (-1182.173) (-1175.971) * (-1176.857) (-1178.754) [-1181.712] (-1175.180) -- 0:00:39
Average standard deviation of split frequencies: 0.006300
851000 -- (-1172.849) [-1172.008] (-1182.941) (-1168.220) * (-1172.863) (-1180.350) (-1173.335) [-1168.750] -- 0:00:38
852000 -- (-1173.434) (-1205.544) (-1173.160) [-1177.742] * (-1171.385) [-1181.615] (-1174.419) (-1179.549) -- 0:00:38
853000 -- (-1177.519) (-1176.643) (-1183.974) [-1176.315] * (-1176.319) [-1174.650] (-1171.505) (-1180.832) -- 0:00:38
854000 -- (-1171.782) [-1171.904] (-1174.067) (-1182.227) * (-1169.647) (-1172.897) [-1173.145] (-1179.728) -- 0:00:37
855000 -- (-1176.892) [-1173.031] (-1180.026) (-1174.342) * (-1188.935) (-1177.290) [-1175.550] (-1179.443) -- 0:00:37
Average standard deviation of split frequencies: 0.006290
856000 -- [-1179.995] (-1179.527) (-1175.160) (-1176.289) * [-1169.737] (-1173.034) (-1174.922) (-1183.594) -- 0:00:37
857000 -- (-1175.582) (-1174.448) (-1170.312) [-1175.704] * (-1183.988) (-1183.524) [-1169.568] (-1177.393) -- 0:00:37
858000 -- (-1175.145) (-1171.493) [-1170.386] (-1183.332) * (-1172.195) (-1175.963) (-1172.618) [-1168.381] -- 0:00:36
859000 -- (-1173.446) (-1179.024) (-1180.455) [-1171.141] * [-1178.767] (-1181.199) (-1184.431) (-1175.068) -- 0:00:36
860000 -- [-1174.622] (-1178.769) (-1181.730) (-1174.541) * (-1170.884) [-1169.997] (-1179.123) (-1171.941) -- 0:00:36
Average standard deviation of split frequencies: 0.006919
861000 -- (-1173.131) (-1167.179) [-1179.287] (-1175.878) * (-1176.173) (-1180.636) [-1170.256] (-1170.001) -- 0:00:36
862000 -- (-1182.975) (-1175.382) [-1170.049] (-1175.234) * [-1174.571] (-1175.161) (-1182.018) (-1182.063) -- 0:00:35
863000 -- (-1184.840) [-1180.614] (-1182.916) (-1170.470) * (-1173.263) (-1182.808) [-1174.621] (-1172.788) -- 0:00:35
864000 -- (-1171.228) [-1178.602] (-1186.042) (-1178.000) * (-1173.190) (-1179.361) [-1170.735] (-1174.452) -- 0:00:35
865000 -- (-1173.699) [-1168.045] (-1181.917) (-1175.332) * (-1180.018) (-1178.402) (-1167.752) [-1177.323] -- 0:00:35
Average standard deviation of split frequencies: 0.006475
866000 -- [-1172.425] (-1180.992) (-1171.515) (-1177.160) * (-1177.056) [-1183.070] (-1173.445) (-1176.246) -- 0:00:34
867000 -- (-1178.025) (-1168.383) (-1174.008) [-1173.981] * (-1170.110) (-1184.460) (-1171.208) [-1171.541] -- 0:00:34
868000 -- (-1176.459) (-1177.879) (-1169.585) [-1177.518] * (-1177.991) (-1182.978) (-1179.947) [-1175.922] -- 0:00:34
869000 -- (-1169.812) (-1181.061) [-1170.637] (-1176.981) * (-1181.296) (-1183.387) [-1179.494] (-1178.179) -- 0:00:34
870000 -- (-1179.704) (-1181.619) (-1180.477) [-1175.814] * (-1179.187) [-1182.923] (-1174.142) (-1179.588) -- 0:00:33
Average standard deviation of split frequencies: 0.006269
871000 -- (-1174.406) (-1183.442) (-1178.888) [-1172.412] * (-1175.815) [-1173.609] (-1175.052) (-1182.532) -- 0:00:33
872000 -- (-1178.648) (-1175.566) (-1179.490) [-1180.932] * (-1173.016) [-1175.499] (-1176.646) (-1171.003) -- 0:00:33
873000 -- (-1178.019) [-1174.364] (-1179.671) (-1174.120) * (-1174.744) (-1174.756) [-1173.249] (-1180.226) -- 0:00:33
874000 -- (-1180.856) (-1172.012) (-1171.337) [-1173.363] * (-1173.818) (-1169.021) (-1175.578) [-1170.694] -- 0:00:32
875000 -- (-1175.216) (-1176.941) [-1173.706] (-1184.514) * (-1188.299) [-1170.777] (-1172.840) (-1170.582) -- 0:00:32
Average standard deviation of split frequencies: 0.006146
876000 -- (-1179.843) (-1174.621) (-1180.517) [-1182.069] * (-1174.432) (-1182.469) [-1173.620] (-1174.768) -- 0:00:32
877000 -- [-1174.506] (-1171.130) (-1177.998) (-1179.614) * (-1175.910) (-1172.576) [-1178.624] (-1182.331) -- 0:00:31
878000 -- (-1182.920) (-1192.053) (-1175.521) [-1173.026] * (-1188.920) (-1176.079) (-1180.618) [-1169.631] -- 0:00:31
879000 -- (-1190.914) [-1175.249] (-1179.527) (-1173.353) * (-1174.220) (-1172.250) [-1173.904] (-1173.645) -- 0:00:31
880000 -- [-1177.697] (-1175.016) (-1172.693) (-1180.684) * (-1174.661) (-1172.087) [-1171.210] (-1175.160) -- 0:00:31
Average standard deviation of split frequencies: 0.006254
881000 -- (-1180.175) [-1172.805] (-1173.977) (-1179.323) * (-1174.756) (-1173.047) (-1181.824) [-1176.567] -- 0:00:30
882000 -- (-1173.338) (-1187.171) (-1168.593) [-1176.810] * (-1170.270) (-1175.048) [-1172.006] (-1172.976) -- 0:00:30
883000 -- (-1174.331) (-1184.562) [-1172.031] (-1180.509) * (-1174.276) (-1178.725) [-1173.557] (-1175.271) -- 0:00:30
884000 -- (-1169.794) (-1171.363) (-1177.620) [-1178.785] * (-1184.358) [-1168.871] (-1177.722) (-1170.557) -- 0:00:30
885000 -- (-1182.458) [-1170.608] (-1174.257) (-1179.227) * (-1184.398) [-1171.301] (-1176.632) (-1188.142) -- 0:00:29
Average standard deviation of split frequencies: 0.006413
886000 -- (-1174.747) (-1169.853) (-1170.680) [-1173.543] * (-1179.732) [-1174.455] (-1174.672) (-1184.923) -- 0:00:29
887000 -- (-1172.424) (-1177.927) (-1180.910) [-1174.088] * (-1175.922) (-1176.769) (-1176.332) [-1183.888] -- 0:00:29
888000 -- (-1178.312) [-1173.017] (-1173.469) (-1177.952) * (-1176.639) [-1174.621] (-1168.869) (-1176.480) -- 0:00:29
889000 -- (-1173.716) (-1176.451) (-1178.499) [-1172.380] * (-1171.908) [-1176.395] (-1168.856) (-1188.203) -- 0:00:28
890000 -- (-1172.182) (-1176.475) (-1170.940) [-1179.780] * (-1177.763) (-1174.309) (-1183.004) [-1181.261] -- 0:00:28
Average standard deviation of split frequencies: 0.006296
891000 -- (-1169.886) (-1179.388) [-1170.079] (-1179.551) * [-1171.464] (-1177.835) (-1173.245) (-1188.808) -- 0:00:28
892000 -- (-1177.553) (-1171.680) (-1174.396) [-1168.431] * [-1178.301] (-1176.173) (-1180.511) (-1175.785) -- 0:00:28
893000 -- (-1186.220) [-1177.193] (-1177.591) (-1178.888) * (-1171.087) [-1176.250] (-1182.707) (-1180.159) -- 0:00:27
894000 -- [-1173.005] (-1183.269) (-1172.788) (-1176.653) * (-1180.557) [-1168.964] (-1168.392) (-1174.143) -- 0:00:27
895000 -- (-1172.442) [-1170.367] (-1175.057) (-1177.993) * (-1185.452) [-1177.928] (-1172.568) (-1174.242) -- 0:00:27
Average standard deviation of split frequencies: 0.006313
896000 -- (-1180.921) [-1174.979] (-1171.972) (-1176.194) * (-1173.872) (-1181.246) (-1175.862) [-1181.459] -- 0:00:27
897000 -- (-1172.130) (-1175.784) [-1173.531] (-1180.815) * [-1173.029] (-1169.681) (-1169.820) (-1175.902) -- 0:00:26
898000 -- [-1174.524] (-1181.008) (-1175.393) (-1175.669) * (-1178.286) (-1185.174) (-1174.297) [-1171.657] -- 0:00:26
899000 -- (-1173.170) (-1176.430) [-1174.457] (-1175.112) * (-1175.286) [-1175.188] (-1173.535) (-1180.166) -- 0:00:26
900000 -- (-1192.505) [-1172.629] (-1176.004) (-1179.789) * (-1173.671) [-1178.947] (-1175.653) (-1181.138) -- 0:00:25
Average standard deviation of split frequencies: 0.006584
901000 -- [-1174.557] (-1174.355) (-1179.697) (-1174.587) * (-1177.916) (-1175.367) [-1174.491] (-1177.224) -- 0:00:25
902000 -- (-1185.537) (-1174.863) (-1177.008) [-1171.360] * (-1176.231) (-1176.756) [-1176.993] (-1183.287) -- 0:00:25
903000 -- (-1177.473) (-1172.958) [-1170.921] (-1171.317) * (-1181.542) (-1172.688) [-1170.568] (-1186.942) -- 0:00:25
904000 -- (-1180.399) (-1170.939) [-1170.337] (-1174.275) * (-1177.233) [-1175.293] (-1173.689) (-1180.717) -- 0:00:24
905000 -- (-1176.418) [-1171.598] (-1175.399) (-1171.693) * (-1173.529) [-1174.307] (-1169.928) (-1179.630) -- 0:00:24
Average standard deviation of split frequencies: 0.006545
906000 -- (-1171.968) (-1180.690) (-1179.210) [-1172.423] * [-1168.680] (-1170.698) (-1178.361) (-1170.268) -- 0:00:24
907000 -- (-1175.551) [-1171.309] (-1183.655) (-1176.893) * [-1178.445] (-1170.425) (-1172.702) (-1171.235) -- 0:00:24
908000 -- (-1177.957) [-1180.915] (-1177.686) (-1184.761) * (-1178.175) (-1173.441) [-1167.794] (-1173.804) -- 0:00:23
909000 -- [-1175.018] (-1174.510) (-1175.585) (-1176.493) * [-1170.777] (-1183.010) (-1175.227) (-1179.889) -- 0:00:23
910000 -- (-1176.744) [-1170.530] (-1171.770) (-1185.893) * [-1179.704] (-1191.919) (-1171.745) (-1171.627) -- 0:00:23
Average standard deviation of split frequencies: 0.006838
911000 -- (-1174.947) [-1177.353] (-1175.550) (-1183.734) * (-1177.664) [-1166.746] (-1187.613) (-1176.706) -- 0:00:23
912000 -- (-1180.125) (-1180.814) (-1185.506) [-1179.551] * (-1173.291) (-1173.658) [-1176.504] (-1180.738) -- 0:00:22
913000 -- (-1177.437) (-1174.013) [-1176.428] (-1185.530) * (-1173.029) [-1173.853] (-1177.369) (-1181.926) -- 0:00:22
914000 -- (-1174.986) [-1180.615] (-1180.419) (-1187.879) * [-1169.073] (-1170.980) (-1173.146) (-1182.868) -- 0:00:22
915000 -- (-1181.378) [-1169.783] (-1182.318) (-1176.035) * [-1169.128] (-1174.601) (-1176.407) (-1173.880) -- 0:00:22
Average standard deviation of split frequencies: 0.006771
916000 -- (-1197.081) (-1168.930) [-1174.429] (-1177.111) * (-1171.559) (-1176.678) [-1179.865] (-1175.112) -- 0:00:21
917000 -- (-1183.704) (-1172.697) (-1174.200) [-1170.657] * (-1188.923) (-1172.948) [-1173.044] (-1172.832) -- 0:00:21
918000 -- [-1168.242] (-1173.051) (-1174.840) (-1170.775) * (-1183.565) (-1167.793) (-1169.762) [-1166.584] -- 0:00:21
919000 -- (-1170.437) [-1177.587] (-1170.644) (-1181.913) * (-1174.641) (-1181.221) (-1176.565) [-1170.624] -- 0:00:21
920000 -- [-1182.399] (-1170.648) (-1179.046) (-1168.751) * [-1173.142] (-1186.677) (-1170.273) (-1185.158) -- 0:00:20
Average standard deviation of split frequencies: 0.006737
921000 -- (-1173.098) [-1168.521] (-1182.217) (-1188.517) * (-1178.707) [-1180.422] (-1182.320) (-1192.019) -- 0:00:20
922000 -- (-1174.526) (-1174.421) [-1171.673] (-1184.457) * (-1172.207) (-1173.514) [-1177.258] (-1174.963) -- 0:00:20
923000 -- [-1170.935] (-1178.043) (-1168.935) (-1177.240) * (-1196.776) (-1182.293) (-1182.092) [-1170.848] -- 0:00:20
924000 -- (-1176.135) (-1170.831) (-1185.518) [-1175.567] * (-1177.984) (-1177.633) (-1181.432) [-1178.695] -- 0:00:19
925000 -- (-1196.289) (-1174.949) (-1177.534) [-1175.579] * [-1174.955] (-1176.966) (-1177.681) (-1176.223) -- 0:00:19
Average standard deviation of split frequencies: 0.006216
926000 -- (-1175.173) (-1176.930) (-1176.446) [-1176.554] * (-1196.844) [-1170.181] (-1171.483) (-1178.254) -- 0:00:19
927000 -- (-1171.874) (-1171.842) [-1176.023] (-1172.856) * (-1186.420) (-1171.158) [-1179.975] (-1176.573) -- 0:00:18
928000 -- [-1172.538] (-1173.764) (-1171.456) (-1182.276) * (-1173.617) [-1170.604] (-1170.937) (-1182.909) -- 0:00:18
929000 -- (-1185.073) [-1173.705] (-1167.721) (-1183.256) * (-1176.806) (-1178.477) (-1178.088) [-1176.239] -- 0:00:18
930000 -- (-1170.480) [-1169.887] (-1174.323) (-1175.139) * (-1171.233) (-1171.609) [-1177.979] (-1177.505) -- 0:00:18
Average standard deviation of split frequencies: 0.006105
931000 -- [-1176.936] (-1181.155) (-1175.796) (-1184.364) * (-1168.572) [-1179.166] (-1169.915) (-1170.573) -- 0:00:17
932000 -- (-1174.435) (-1171.565) [-1176.059] (-1171.337) * (-1178.309) [-1176.919] (-1178.245) (-1179.438) -- 0:00:17
933000 -- (-1174.597) (-1182.811) (-1179.986) [-1177.239] * (-1177.666) (-1185.777) [-1173.187] (-1173.729) -- 0:00:17
934000 -- (-1171.107) (-1177.480) [-1169.519] (-1174.010) * (-1173.633) (-1176.522) (-1170.834) [-1174.074] -- 0:00:17
935000 -- (-1170.279) [-1177.881] (-1180.348) (-1173.666) * (-1172.268) [-1170.351] (-1187.994) (-1171.677) -- 0:00:16
Average standard deviation of split frequencies: 0.006070
936000 -- (-1177.869) (-1174.556) [-1176.289] (-1182.753) * (-1174.402) [-1173.524] (-1180.055) (-1175.447) -- 0:00:16
937000 -- (-1176.103) (-1172.336) (-1174.432) [-1173.228] * (-1175.500) (-1177.616) (-1172.825) [-1176.289] -- 0:00:16
938000 -- (-1173.996) [-1175.889] (-1177.076) (-1170.633) * (-1174.713) (-1177.063) (-1191.907) [-1166.555] -- 0:00:16
939000 -- (-1176.267) [-1173.502] (-1183.019) (-1187.049) * (-1183.998) (-1184.898) (-1187.536) [-1173.120] -- 0:00:15
940000 -- (-1176.531) (-1180.468) [-1173.945] (-1174.718) * (-1186.128) [-1172.204] (-1181.774) (-1171.488) -- 0:00:15
Average standard deviation of split frequencies: 0.006383
941000 -- (-1173.659) [-1174.978] (-1178.871) (-1178.761) * [-1184.710] (-1181.095) (-1176.193) (-1170.813) -- 0:00:15
942000 -- (-1170.391) (-1176.911) (-1175.906) [-1170.399] * (-1175.675) [-1177.235] (-1179.280) (-1175.783) -- 0:00:15
943000 -- [-1177.200] (-1186.283) (-1175.397) (-1170.916) * (-1175.963) (-1171.313) [-1172.817] (-1179.098) -- 0:00:14
944000 -- (-1178.206) (-1173.525) [-1178.702] (-1178.858) * (-1179.087) (-1173.427) [-1174.551] (-1179.758) -- 0:00:14
945000 -- (-1176.974) [-1172.316] (-1168.784) (-1179.161) * (-1176.620) (-1174.198) [-1177.487] (-1179.677) -- 0:00:14
Average standard deviation of split frequencies: 0.006628
946000 -- (-1179.598) [-1175.339] (-1176.768) (-1185.460) * (-1172.999) (-1171.902) (-1178.595) [-1178.879] -- 0:00:14
947000 -- [-1173.725] (-1178.476) (-1176.296) (-1181.738) * (-1171.434) (-1177.916) (-1182.341) [-1171.231] -- 0:00:13
948000 -- (-1179.965) (-1178.370) [-1170.458] (-1176.681) * (-1174.670) (-1172.710) (-1178.114) [-1169.775] -- 0:00:13
949000 -- [-1173.282] (-1183.162) (-1173.865) (-1172.791) * (-1182.298) (-1175.618) (-1176.926) [-1171.561] -- 0:00:13
950000 -- (-1180.334) (-1174.374) [-1178.343] (-1172.850) * [-1174.870] (-1177.425) (-1171.354) (-1173.980) -- 0:00:12
Average standard deviation of split frequencies: 0.006570
951000 -- (-1171.673) (-1182.357) [-1177.357] (-1178.874) * (-1176.055) (-1171.599) [-1170.187] (-1170.639) -- 0:00:12
952000 -- (-1179.711) (-1167.312) [-1174.934] (-1188.241) * (-1182.769) [-1169.611] (-1171.649) (-1186.608) -- 0:00:12
953000 -- (-1174.488) (-1166.312) [-1171.724] (-1171.335) * (-1183.486) [-1174.503] (-1174.606) (-1173.868) -- 0:00:12
954000 -- (-1174.628) (-1175.501) [-1173.994] (-1171.681) * (-1173.999) [-1175.934] (-1172.572) (-1181.372) -- 0:00:11
955000 -- [-1176.948] (-1180.297) (-1176.006) (-1174.384) * (-1172.176) (-1168.897) (-1175.994) [-1169.037] -- 0:00:11
Average standard deviation of split frequencies: 0.006583
956000 -- [-1180.033] (-1176.676) (-1174.173) (-1182.648) * (-1173.905) (-1176.418) [-1176.536] (-1172.757) -- 0:00:11
957000 -- [-1173.006] (-1184.188) (-1175.658) (-1177.705) * (-1181.966) (-1174.245) [-1173.152] (-1175.570) -- 0:00:11
958000 -- (-1179.839) (-1172.745) [-1178.495] (-1171.720) * (-1174.892) (-1177.641) [-1172.203] (-1172.352) -- 0:00:10
959000 -- (-1170.631) (-1184.432) (-1178.086) [-1172.824] * (-1171.651) [-1178.309] (-1183.812) (-1175.815) -- 0:00:10
960000 -- (-1182.434) (-1172.978) (-1177.276) [-1177.800] * (-1169.022) (-1179.172) (-1178.502) [-1176.628] -- 0:00:10
Average standard deviation of split frequencies: 0.006689
961000 -- (-1173.484) [-1166.971] (-1176.638) (-1169.527) * (-1175.062) [-1182.513] (-1167.888) (-1179.851) -- 0:00:10
962000 -- (-1182.566) (-1169.483) (-1175.012) [-1169.309] * (-1171.029) [-1175.461] (-1169.913) (-1180.012) -- 0:00:09
963000 -- [-1170.499] (-1174.663) (-1173.639) (-1178.420) * (-1176.360) [-1174.019] (-1175.989) (-1177.432) -- 0:00:09
964000 -- [-1168.001] (-1180.438) (-1173.839) (-1178.138) * [-1172.395] (-1171.005) (-1176.786) (-1187.399) -- 0:00:09
965000 -- [-1179.181] (-1177.418) (-1175.628) (-1183.627) * [-1183.217] (-1175.743) (-1169.841) (-1182.106) -- 0:00:09
Average standard deviation of split frequencies: 0.006729
966000 -- [-1169.307] (-1174.655) (-1180.378) (-1176.450) * [-1169.758] (-1178.422) (-1181.082) (-1182.159) -- 0:00:08
967000 -- (-1170.159) (-1172.374) (-1172.124) [-1168.097] * (-1175.822) [-1181.723] (-1175.823) (-1181.259) -- 0:00:08
968000 -- (-1172.083) (-1166.825) [-1169.056] (-1174.846) * (-1173.594) (-1169.428) [-1174.375] (-1173.654) -- 0:00:08
969000 -- (-1177.933) (-1185.085) (-1179.161) [-1173.311] * (-1167.907) [-1171.433] (-1177.902) (-1181.099) -- 0:00:08
970000 -- (-1178.061) [-1168.583] (-1180.818) (-1180.128) * (-1179.780) [-1181.589] (-1174.721) (-1176.935) -- 0:00:07
Average standard deviation of split frequencies: 0.006697
971000 -- (-1182.480) (-1175.542) [-1175.036] (-1171.972) * [-1171.510] (-1177.205) (-1181.676) (-1177.964) -- 0:00:07
972000 -- [-1174.945] (-1178.931) (-1172.300) (-1176.654) * [-1175.911] (-1175.307) (-1174.386) (-1169.704) -- 0:00:07
973000 -- [-1183.789] (-1172.689) (-1171.845) (-1176.273) * (-1170.091) [-1179.357] (-1181.066) (-1179.459) -- 0:00:07
974000 -- (-1179.627) (-1176.269) [-1181.636] (-1173.791) * (-1172.776) (-1195.469) (-1171.249) [-1178.774] -- 0:00:06
975000 -- (-1178.587) (-1173.522) [-1170.602] (-1181.509) * [-1173.536] (-1175.143) (-1176.396) (-1176.479) -- 0:00:06
Average standard deviation of split frequencies: 0.006635
976000 -- (-1176.201) (-1174.395) (-1176.194) [-1172.619] * (-1174.795) (-1178.984) [-1173.697] (-1172.796) -- 0:00:06
977000 -- [-1173.133] (-1171.373) (-1177.706) (-1175.596) * (-1186.051) [-1173.644] (-1175.015) (-1176.305) -- 0:00:05
978000 -- (-1174.583) (-1177.507) [-1172.974] (-1177.813) * (-1167.682) [-1175.909] (-1177.947) (-1176.460) -- 0:00:05
979000 -- (-1181.913) (-1185.110) [-1172.869] (-1171.151) * (-1180.185) (-1177.896) (-1178.661) [-1174.319] -- 0:00:05
980000 -- (-1198.992) [-1172.235] (-1168.782) (-1169.590) * (-1175.580) (-1171.475) [-1180.947] (-1180.211) -- 0:00:05
Average standard deviation of split frequencies: 0.006553
981000 -- [-1181.497] (-1176.909) (-1178.506) (-1177.019) * (-1171.389) [-1176.969] (-1183.291) (-1173.313) -- 0:00:04
982000 -- (-1178.584) [-1181.065] (-1180.560) (-1178.742) * (-1171.962) (-1178.863) (-1184.860) [-1171.949] -- 0:00:04
983000 -- [-1170.295] (-1191.061) (-1188.387) (-1173.056) * (-1178.810) (-1172.527) [-1180.492] (-1184.089) -- 0:00:04
984000 -- (-1172.198) (-1179.598) (-1170.055) [-1168.674] * (-1177.154) (-1183.634) (-1173.911) [-1172.628] -- 0:00:04
985000 -- (-1175.007) [-1178.314] (-1179.068) (-1169.601) * (-1172.507) [-1175.196] (-1177.458) (-1173.925) -- 0:00:03
Average standard deviation of split frequencies: 0.006844
986000 -- (-1172.907) [-1171.294] (-1170.370) (-1178.272) * (-1168.458) (-1178.165) [-1178.598] (-1174.696) -- 0:00:03
987000 -- (-1180.653) (-1174.232) (-1178.830) [-1174.156] * (-1180.696) (-1181.111) (-1180.503) [-1177.493] -- 0:00:03
988000 -- (-1176.775) (-1175.777) (-1178.887) [-1176.544] * (-1174.712) [-1169.229] (-1173.616) (-1183.326) -- 0:00:03
989000 -- (-1180.153) [-1176.542] (-1176.401) (-1179.038) * [-1172.553] (-1180.058) (-1171.557) (-1180.162) -- 0:00:02
990000 -- (-1169.341) [-1169.137] (-1179.942) (-1184.941) * (-1172.791) [-1170.169] (-1174.790) (-1177.067) -- 0:00:02
Average standard deviation of split frequencies: 0.006837
991000 -- (-1167.838) (-1174.014) (-1173.530) [-1177.538] * (-1175.301) (-1167.161) [-1173.631] (-1185.562) -- 0:00:02
992000 -- (-1176.872) (-1174.711) (-1169.245) [-1170.898] * (-1174.860) (-1174.855) (-1174.547) [-1174.505] -- 0:00:02
993000 -- [-1169.409] (-1171.625) (-1174.414) (-1182.410) * (-1170.006) (-1174.959) [-1177.057] (-1176.226) -- 0:00:01
994000 -- (-1171.300) (-1179.522) [-1171.695] (-1173.068) * (-1179.715) (-1177.720) [-1173.310] (-1180.675) -- 0:00:01
995000 -- [-1170.633] (-1170.810) (-1186.849) (-1176.785) * (-1177.656) (-1173.378) (-1173.929) [-1173.872] -- 0:00:01
Average standard deviation of split frequencies: 0.006726
996000 -- (-1179.044) (-1177.143) (-1176.098) [-1173.897] * (-1177.339) (-1174.228) [-1172.938] (-1195.200) -- 0:00:01
997000 -- (-1175.632) [-1173.435] (-1171.972) (-1179.672) * (-1172.017) (-1185.797) [-1172.772] (-1176.397) -- 0:00:00
998000 -- (-1174.815) [-1174.589] (-1175.073) (-1177.654) * (-1175.226) (-1174.187) (-1168.011) [-1176.712] -- 0:00:00
999000 -- (-1174.324) [-1173.418] (-1179.054) (-1183.663) * [-1176.083] (-1175.610) (-1174.144) (-1176.895) -- 0:00:00
1000000 -- (-1188.125) (-1172.783) (-1172.144) [-1170.526] * [-1175.152] (-1174.489) (-1181.281) (-1183.710) -- 0:00:00
Average standard deviation of split frequencies: 0.006620
Analysis completed in 4 mins 20 seconds
Analysis used 259.37 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1163.07
Likelihood of best state for "cold" chain of run 2 was -1162.71
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
68.6 % ( 62 %) Dirichlet(Revmat{all})
80.2 % ( 68 %) Slider(Revmat{all})
28.4 % ( 33 %) Dirichlet(Pi{all})
29.8 % ( 23 %) Slider(Pi{all})
79.2 % ( 62 %) Multiplier(Alpha{1,2})
71.7 % ( 44 %) Multiplier(Alpha{3})
90.6 % ( 83 %) Slider(Pinvar{all})
42.2 % ( 43 %) ExtSPR(Tau{all},V{all})
31.1 % ( 23 %) ExtTBR(Tau{all},V{all})
49.4 % ( 43 %) NNI(Tau{all},V{all})
32.1 % ( 32 %) ParsSPR(Tau{all},V{all})
27.2 % ( 20 %) Multiplier(V{all})
64.9 % ( 69 %) Nodeslider(V{all})
26.1 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
68.9 % ( 53 %) Dirichlet(Revmat{all})
81.0 % ( 77 %) Slider(Revmat{all})
28.5 % ( 33 %) Dirichlet(Pi{all})
30.3 % ( 27 %) Slider(Pi{all})
79.7 % ( 59 %) Multiplier(Alpha{1,2})
70.8 % ( 41 %) Multiplier(Alpha{3})
89.3 % ( 72 %) Slider(Pinvar{all})
42.1 % ( 36 %) ExtSPR(Tau{all},V{all})
31.3 % ( 29 %) ExtTBR(Tau{all},V{all})
49.2 % ( 43 %) NNI(Tau{all},V{all})
32.3 % ( 36 %) ParsSPR(Tau{all},V{all})
27.3 % ( 24 %) Multiplier(V{all})
64.9 % ( 65 %) Nodeslider(V{all})
26.1 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.74 0.52 0.35
2 | 166470 0.75 0.55
3 | 166315 166249 0.77
4 | 166918 166874 167174
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.74 0.52 0.35
2 | 166872 0.76 0.55
3 | 166242 166924 0.77
4 | 166371 167117 166474
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1172.06
| 2 1 1 1 1 2 2 |
| 1 1 2 2 1 2 1 |
| 1 2 2 1|
| 2 1* 12 2 11 * 2 1 11 |
| 1 1 2 2 2 2 *2 * 2 1 |
| 1 22 1 1 2 1 1 1 1 * 12 1 22 2|
|* 21 1 2122 1 2 121 12 2 122 * |
| 2 1 2 2 1 2 1 2 1 1 |
| 2 1 1 2 2 1 2 1 2 |
| 2 1 2 21 * 2 1 2 |
| |
| 1 2 1 |
| |
| 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1176.94
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1169.46 -1182.71
2 -1168.96 -1180.58
--------------------------------------
TOTAL -1169.18 -1182.13
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.072150 0.000146 0.049802 0.096008 0.071346 1294.05 1397.52 1.000
r(A<->C){all} 0.122725 0.002862 0.028537 0.220576 0.117485 361.51 601.35 1.000
r(A<->G){all} 0.155857 0.003043 0.058435 0.262739 0.149809 412.08 539.40 1.000
r(A<->T){all} 0.144330 0.002125 0.057269 0.231419 0.140092 522.76 611.79 1.000
r(C<->G){all} 0.123211 0.003270 0.023511 0.232255 0.115078 263.49 330.84 1.001
r(C<->T){all} 0.369252 0.005671 0.238934 0.534390 0.365960 386.03 624.53 1.000
r(G<->T){all} 0.084624 0.001545 0.015165 0.161907 0.079509 575.85 680.51 1.001
pi(A){all} 0.262097 0.000290 0.227354 0.294891 0.262107 1187.83 1251.51 1.002
pi(C){all} 0.190247 0.000230 0.161796 0.220878 0.189713 1021.99 1175.95 1.000
pi(G){all} 0.204704 0.000229 0.173343 0.232938 0.204337 1136.60 1251.44 1.000
pi(T){all} 0.342953 0.000323 0.308087 0.377885 0.342292 1262.57 1292.45 1.000
alpha{1,2} 0.971024 0.933348 0.000151 2.906711 0.683960 1039.48 1142.39 1.003
alpha{3} 1.617887 1.422948 0.003574 3.958602 1.327765 1249.98 1372.87 1.000
pinvar{all} 0.232766 0.027763 0.000113 0.546846 0.205748 716.21 785.24 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C10
3 -- C2
4 -- C3
5 -- C4
6 -- C5
7 -- C6
8 -- C7
9 -- C8
10 -- C9
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
----------------
1 -- .*********
2 -- .*........
3 -- ..*.......
4 -- ...*......
5 -- ....*.....
6 -- .....*....
7 -- ......*...
8 -- .......*..
9 -- ........*.
10 -- .........*
11 -- .....**...
12 -- ....***...
13 -- .*..***.**
14 -- ....***..*
15 -- .*......*.
16 -- ....***.**
17 -- .*..***..*
18 -- .******.**
19 -- ..**......
20 -- .**.******
21 -- ..**...*..
22 -- .*..******
23 -- ...*...*..
24 -- ..*....*..
25 -- .**.***.**
26 -- .*.****.**
27 -- .*.*******
28 -- .*......**
29 -- .*..***.*.
----------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 3002 1.000000 0.000000 1.000000 1.000000 2
13 2824 0.940706 0.004711 0.937375 0.944037 2
14 1886 0.628248 0.000000 0.628248 0.628248 2
15 843 0.280813 0.004240 0.277815 0.283811 2
16 787 0.262159 0.008009 0.256496 0.267821 2
17 767 0.255496 0.003298 0.253165 0.257828 2
18 618 0.205863 0.004711 0.202532 0.209194 2
19 616 0.205197 0.002827 0.203198 0.207195 2
20 593 0.197535 0.021199 0.182545 0.212525 2
21 592 0.197202 0.001884 0.195869 0.198534 2
22 588 0.195869 0.008480 0.189873 0.201865 2
23 587 0.195536 0.007066 0.190540 0.200533 2
24 584 0.194537 0.008480 0.188541 0.200533 2
25 579 0.192871 0.001413 0.191872 0.193871 2
26 554 0.184544 0.014133 0.174550 0.194537 2
27 540 0.179880 0.004711 0.176549 0.183211 2
28 345 0.114923 0.021199 0.099933 0.129913 2
29 308 0.102598 0.009422 0.095936 0.109260 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.001132 0.000001 0.000002 0.003401 0.000795 1.000 2
length{all}[2] 0.002387 0.000003 0.000017 0.005746 0.001957 1.000 2
length{all}[3] 0.001149 0.000001 0.000000 0.003476 0.000786 1.000 2
length{all}[4] 0.001208 0.000002 0.000000 0.003724 0.000806 1.000 2
length{all}[5] 0.001239 0.000002 0.000001 0.003742 0.000863 1.000 2
length{all}[6] 0.009385 0.000012 0.003209 0.016184 0.008973 1.000 2
length{all}[7] 0.004772 0.000006 0.000838 0.009808 0.004355 1.001 2
length{all}[8] 0.001186 0.000001 0.000001 0.003514 0.000811 1.000 2
length{all}[9] 0.001140 0.000001 0.000000 0.003367 0.000786 1.000 2
length{all}[10] 0.003997 0.000005 0.000488 0.008767 0.003562 1.000 2
length{all}[11] 0.009428 0.000012 0.003206 0.016165 0.008952 1.000 2
length{all}[12] 0.027506 0.000046 0.015364 0.040762 0.026677 1.000 2
length{all}[13] 0.002293 0.000003 0.000002 0.005416 0.001952 1.000 2
length{all}[14] 0.002251 0.000003 0.000004 0.005747 0.001853 1.000 2
length{all}[15] 0.001219 0.000001 0.000001 0.003544 0.000854 1.000 2
length{all}[16] 0.001179 0.000002 0.000002 0.003493 0.000789 1.000 2
length{all}[17] 0.001165 0.000001 0.000001 0.003186 0.000855 0.999 2
length{all}[18] 0.001128 0.000001 0.000000 0.003454 0.000807 0.999 2
length{all}[19] 0.001141 0.000001 0.000001 0.003123 0.000812 0.999 2
length{all}[20] 0.001162 0.000001 0.000002 0.003300 0.000841 1.001 2
length{all}[21] 0.001148 0.000001 0.000003 0.003509 0.000764 1.000 2
length{all}[22] 0.001166 0.000001 0.000001 0.003238 0.000831 0.999 2
length{all}[23] 0.001206 0.000001 0.000002 0.003598 0.000831 0.998 2
length{all}[24] 0.001120 0.000001 0.000001 0.003288 0.000810 0.999 2
length{all}[25] 0.001198 0.000001 0.000003 0.003367 0.000850 1.002 2
length{all}[26] 0.001160 0.000002 0.000002 0.003839 0.000754 0.998 2
length{all}[27] 0.001123 0.000001 0.000006 0.003492 0.000753 1.000 2
length{all}[28] 0.001556 0.000002 0.000000 0.004665 0.001095 0.997 2
length{all}[29] 0.001232 0.000001 0.000007 0.003587 0.000803 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006620
Maximum standard deviation of split frequencies = 0.021199
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (3)
|
|----------------------------------------------------------------------- C3 (4)
|
|----------------------------------------------------------------------- C7 (8)
+
| /--------------------------------------------------------- C10 (2)
| |
| | /---------------------------- C4 (5)
| | |
| | /------100-----+ /-------------- C5 (6)
\------94-----+ | \-----100-----+
|------63-----+ \-------------- C6 (7)
| |
| \------------------------------------------- C9 (10)
|
\--------------------------------------------------------- C8 (9)
Phylogram (based on average branch lengths):
/- C1 (1)
|
|- C2 (3)
|
|- C3 (4)
|
|- C7 (8)
+
| /--- C10 (2)
| |
| | /-- C4 (5)
| | |
| | /--------------------------------------+ /------------- C5 (6)
\--+ | \-------------+
|--+ \------ C6 (7)
| |
| \----- C9 (10)
|
\- C8 (9)
|-------------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (383 trees sampled):
50 % credible set contains 35 trees
90 % credible set contains 181 trees
95 % credible set contains 235 trees
99 % credible set contains 353 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Wed Oct 26 22:52:39 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=10, Len=219
C1 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C2 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C3 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C5 -MSNGSLTKDEVVNIIKNWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C6 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSTSMMVYVFKM
C7 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C8 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C9 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
C10 MSSNGSLTKDEVVIIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKM
*********** ***:********************** *********
C1 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
C2 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
C3 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
C4 FILWLLWPASMALSIFSAIYPISLASQIISGILAAICAVMWLAYFVQSIR
C5 FILWLLWPASMALSIFSAIYPITIASQIISGILAAICAVMWLAYLVQSIR
C6 FILWLLWPASMALSIFSAIYPITIASQIISGILAAICAVMWLAYLVQSIR
C7 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
C8 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
C9 FILWLLWPASMALSIFSAIYPISLSSQIVSGILAAICAVMWLAYFVQSIR
C10 FILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIR
**********************:::***:***************:*****
C1 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C2 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C3 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C4 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C5 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C6 LFMRTGSWWSFN-ESNCLLNVPIGGTTVVRPLVEDSPSVTAVVNDGHLKM
C7 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C8 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C9 LLMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
C10 LFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKM
*:********** ***********************.*************
C1 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C2 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C3 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C4 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C5 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVLRQSYGTNSVVAIFHRYKA
C6 AGMH-GRCDYDRLPMEITVAKPSVLIALKMVKRQSYRTNSVVAIFHRYKA
C7 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C8 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C9 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
C10 AGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKA
**** ************************** **** *** *********
C1 GNYRRPTIIQDEELALLRA
C2 GNYRRPTIIQDEELALLRA
C3 GNYRRPTIIQDEELALLRA
C4 GNYRRPTIIQDEELALLRA
C5 GNYRRPTIIQDEELALLRA
C6 GNYRRPTIIQDEELALLRA
C7 GNYRRPTIIQDEELALLRA
C8 GNYRRPTIIQDEELALLRA
C9 GNYRRPTIIQDEELALLRA
C10 GNYRRPTIIQDEELALLRA
*******************
-- Starting log on Wed Oct 26 23:28:36 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/codeml,B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C1 657 sites
reading seq# 2 C2 657 sites
reading seq# 3 C3 657 sites
reading seq# 4 C4 657 sites
reading seq# 5 C5 657 sites
reading seq# 6 C6 657 sites
reading seq# 7 C7 657 sites
reading seq# 8 C8 657 sites
reading seq# 9 C9 657 sites
reading seq#10 C10 657 sitesns = 10 ls = 657
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Sites with gaps or missing data are removed.
3 ambiguity characters in seq. 5
6 ambiguity characters in seq. 6
3 sites are removed. 1 113 155
Sequences read..
Counting site patterns.. 0:00
Compressing, 88 patterns at 216 / 216 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 88 patterns at 216 / 216 sites (100.0%), 0:00
Counting codons..
360 bytes for distance
85888 bytes for conP
7744 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 7, (10, ((4, (5, 6)), 9), 8)); MP score: 40
214720 bytes for conP, adjusted
0.017598 0.063576 0.075221 0.035493 0.012693 0.024127 0.018895 0.010981 0.032866 0.066809 0.047025 0.024086 0.083533 0.042149 0.300000 0.815167 0.429487
ntime & nrate & np: 14 2 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.328512
np = 17
lnL0 = -1239.793202
Iterating by ming2
Initial: fx= 1239.793202
x= 0.01760 0.06358 0.07522 0.03549 0.01269 0.02413 0.01890 0.01098 0.03287 0.06681 0.04703 0.02409 0.08353 0.04215 0.30000 0.81517 0.42949
1 h-m-p 0.0000 0.0001 1738.3154 ++ 1183.961759 m 0.0001 22 | 1/17
2 h-m-p 0.0000 0.0001 680.2450 ++ 1167.232360 m 0.0001 42 | 2/17
3 h-m-p 0.0000 0.0000 2933.1484 ++ 1166.083847 m 0.0000 62 | 3/17
4 h-m-p 0.0000 0.0000 1566.4858 ++ 1163.429971 m 0.0000 82 | 3/17
5 h-m-p 0.0000 0.0000 55146.8003 ++ 1160.954378 m 0.0000 102 | 4/17
6 h-m-p 0.0000 0.0000 3585.2867 ++ 1149.997847 m 0.0000 122 | 5/17
7 h-m-p 0.0000 0.0000 3382.6838 ++ 1146.777127 m 0.0000 142 | 6/17
8 h-m-p 0.0001 0.0010 85.2728 +YCYCCCC 1144.543010 6 0.0005 173 | 6/17
9 h-m-p 0.0001 0.0007 173.4733 YCYCCC 1141.438851 5 0.0004 201 | 6/17
10 h-m-p 0.0002 0.0009 63.9295 ++ 1139.431531 m 0.0009 221 | 6/17
11 h-m-p -0.0000 -0.0000 59.4114
h-m-p: -1.65281214e-20 -8.26406072e-20 5.94114463e+01 1139.431531
.. | 6/17
12 h-m-p 0.0000 0.0002 1727.0420 CYCYCCC 1137.644160 6 0.0000 268 | 6/17
13 h-m-p 0.0000 0.0002 285.8473 +YCYCCC 1133.350920 5 0.0001 298 | 6/17
14 h-m-p 0.0000 0.0000 231.9414 +YYCCCC 1132.613227 5 0.0000 327 | 6/17
15 h-m-p 0.0001 0.0003 139.3490 +YCCCC 1131.628324 4 0.0001 355 | 6/17
16 h-m-p 0.0000 0.0002 483.9844 YCCC 1130.659340 3 0.0001 380 | 6/17
17 h-m-p 0.0001 0.0007 245.6246 CCCC 1129.964686 3 0.0001 406 | 6/17
18 h-m-p 0.0001 0.0011 160.0523 YCCCC 1128.608247 4 0.0003 433 | 6/17
19 h-m-p 0.0004 0.0027 102.2115 ++ 1119.879253 m 0.0027 453 | 6/17
20 h-m-p 0.0006 0.0032 71.3220 CYCCC 1118.475324 4 0.0011 480 | 6/17
21 h-m-p 0.0002 0.0010 216.2580 +YCC 1115.872691 2 0.0008 504 | 6/17
22 h-m-p 0.0040 0.0295 44.6886 YYCCC 1113.767676 4 0.0056 530 | 6/17
23 h-m-p 0.2425 1.2125 0.2500 +YYCYC 1112.363879 4 0.8199 556 | 6/17
24 h-m-p 0.5366 2.8083 0.3819 CC 1111.709328 1 0.5248 589 | 6/17
25 h-m-p 0.8028 4.0138 0.1315 +YC 1111.358443 1 2.0250 622 | 6/17
26 h-m-p 1.4543 7.2715 0.1110 YCCC 1111.277379 3 0.7962 658 | 6/17
27 h-m-p 1.6000 8.0000 0.0356 CC 1111.255788 1 1.7573 691 | 6/17
28 h-m-p 1.6000 8.0000 0.0085 CC 1111.254094 1 1.9884 724 | 6/17
29 h-m-p 1.6000 8.0000 0.0009 CC 1111.253724 1 1.3397 757 | 6/17
30 h-m-p 1.1740 8.0000 0.0010 YC 1111.253665 1 2.1969 789 | 6/17
31 h-m-p 1.6000 8.0000 0.0000 Y 1111.253629 0 3.0486 820 | 6/17
32 h-m-p 0.0844 8.0000 0.0009 ++C 1111.253616 0 1.7728 853 | 6/17
33 h-m-p 1.6000 8.0000 0.0000 C 1111.253616 0 1.5720 884 | 6/17
34 h-m-p 1.6000 8.0000 0.0000 Y 1111.253616 0 3.5825 915 | 6/17
35 h-m-p 1.6000 8.0000 0.0000 C 1111.253616 0 1.5939 946 | 6/17
36 h-m-p 1.6000 8.0000 0.0000 Y 1111.253616 0 0.4000 977 | 6/17
37 h-m-p 0.7165 8.0000 0.0000 ----C 1111.253616 0 0.0007 1012
Out..
lnL = -1111.253616
1013 lfun, 3039 eigenQcodon, 28364 P(t)
end of tree file.
Time used: 0:10
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 7, (10, ((4, (5, 6)), 9), 8)); MP score: 40
0.072648 0.050222 0.012094 0.036010 0.013022 0.013307 0.096518 0.036805 0.017110 0.082027 0.048004 0.091070 0.051478 0.048435 1.959430 1.798962 0.269496 0.432468 1.311601
ntime & nrate & np: 14 3 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 6.211814
np = 19
lnL0 = -1212.698316
Iterating by ming2
Initial: fx= 1212.698316
x= 0.07265 0.05022 0.01209 0.03601 0.01302 0.01331 0.09652 0.03681 0.01711 0.08203 0.04800 0.09107 0.05148 0.04844 1.95943 1.79896 0.26950 0.43247 1.31160
1 h-m-p 0.0000 0.0001 688.3542 ++ 1186.428627 m 0.0001 24 | 1/19
2 h-m-p 0.0000 0.0000 1600.7921 ++ 1178.009681 m 0.0000 46 | 2/19
3 h-m-p 0.0000 0.0000 42797.0301 ++ 1155.596997 m 0.0000 68 | 3/19
4 h-m-p 0.0000 0.0000 7967.2450 ++ 1144.166012 m 0.0000 90 | 4/19
5 h-m-p 0.0000 0.0000 14044.7138 ++ 1142.871355 m 0.0000 112 | 5/19
6 h-m-p 0.0000 0.0000 890.1955 ++ 1135.008462 m 0.0000 134 | 6/19
7 h-m-p 0.0001 0.0004 107.5747 +YCYYCCC 1130.422946 6 0.0004 166 | 6/19
8 h-m-p 0.0003 0.0014 52.7211 +YYCYCCC 1126.862501 6 0.0010 198 | 6/19
9 h-m-p 0.0003 0.0015 36.9816 +YYCYCC 1124.109911 5 0.0010 228 | 6/19
10 h-m-p 0.0001 0.0004 92.5164 YCCCCC 1123.293467 5 0.0002 259 | 6/19
11 h-m-p 0.0009 0.0170 21.0981 +++ 1115.433245 m 0.0170 282 | 7/19
12 h-m-p 0.0044 0.0218 20.2516 +CCC 1113.896683 2 0.0173 309 | 7/19
13 h-m-p 0.0094 0.0472 1.2751 ++ 1113.015338 m 0.0472 331 | 8/19
14 h-m-p 0.0383 0.1913 0.8947 +YCYCCC 1112.354682 5 0.1108 362 | 8/19
15 h-m-p 0.0854 0.7260 1.1607 CCC 1111.912574 2 0.1087 399 | 8/19
16 h-m-p 0.1198 0.5989 1.0078 CCCC 1111.496472 3 0.1671 427 | 8/19
17 h-m-p 0.7050 3.5252 0.1538 YYC 1111.312671 2 0.5911 451 | 8/19
18 h-m-p 0.8624 5.7532 0.1054 YC 1111.289935 1 0.4355 485 | 7/19
19 h-m-p 0.0959 1.5885 0.4789 -YC 1111.289707 1 0.0044 520 | 7/19
20 h-m-p 0.0179 3.6374 0.1171 ++CYC 1111.271566 2 0.3021 559 | 7/19
21 h-m-p 0.3595 8.0000 0.0984 YC 1111.263353 1 0.7817 594 | 7/19
22 h-m-p 1.6000 8.0000 0.0382 YC 1111.259092 1 0.8150 629 | 7/19
23 h-m-p 0.8894 8.0000 0.0350 YC 1111.255107 1 1.4476 664 | 7/19
24 h-m-p 1.6000 8.0000 0.0171 CC 1111.253777 1 1.4364 700 | 7/19
25 h-m-p 1.6000 8.0000 0.0034 YC 1111.253619 1 1.0120 735 | 6/19
26 h-m-p 0.2593 8.0000 0.0131 +Y 1111.253551 0 0.7691 770 | 6/19
27 h-m-p 0.8279 8.0000 0.0122 ++ 1111.252835 m 8.0000 805 | 6/19
28 h-m-p 0.3358 8.0000 0.2897 +YYY 1111.251042 2 1.1926 843 | 6/19
29 h-m-p 1.6000 8.0000 0.1495 CC 1111.249171 1 2.0449 880 | 6/19
30 h-m-p 1.6000 8.0000 0.0469 YC 1111.248906 1 1.0644 916 | 6/19
31 h-m-p 1.0131 8.0000 0.0493 Y 1111.248868 0 0.4522 951 | 6/19
32 h-m-p 1.6000 8.0000 0.0031 Y 1111.248859 0 1.1865 986 | 6/19
33 h-m-p 1.6000 8.0000 0.0018 Y 1111.248856 0 3.6381 1021 | 6/19
34 h-m-p 1.6000 8.0000 0.0022 ++ 1111.248844 m 8.0000 1056 | 6/19
35 h-m-p 0.4023 8.0000 0.0434 +C 1111.248793 0 2.2792 1092 | 6/19
36 h-m-p 0.9386 8.0000 0.1053 C 1111.248721 0 1.1606 1127 | 6/19
37 h-m-p 0.6176 8.0000 0.1978 CY 1111.248598 1 1.0109 1164 | 6/19
38 h-m-p 1.6000 8.0000 0.0276 YC 1111.248512 1 1.0016 1200 | 6/19
39 h-m-p 0.1703 8.0000 0.1623 +Y 1111.248440 0 0.6811 1236 | 6/19
40 h-m-p 1.6000 8.0000 0.0642 C 1111.248343 0 1.9494 1271 | 6/19
41 h-m-p 1.6000 8.0000 0.0737 YC 1111.248268 1 0.8323 1307 | 6/19
42 h-m-p 0.2528 8.0000 0.2425 YC 1111.248204 1 0.5614 1343 | 6/19
43 h-m-p 1.0480 8.0000 0.1299 Y 1111.248153 0 1.0480 1378 | 6/19
44 h-m-p 1.6000 8.0000 0.0567 YC 1111.248094 1 0.9502 1414 | 6/19
45 h-m-p 0.4864 8.0000 0.1108 +Y 1111.248035 0 1.2624 1450 | 6/19
46 h-m-p 1.0592 8.0000 0.1321 C 1111.247978 0 1.0592 1485 | 6/19
47 h-m-p 1.6000 8.0000 0.0613 YC 1111.247931 1 0.8180 1521 | 6/19
48 h-m-p 0.2456 8.0000 0.2040 +Y 1111.247871 0 0.9825 1557 | 6/19
49 h-m-p 1.6000 8.0000 0.0802 C 1111.247816 0 1.9014 1592 | 6/19
50 h-m-p 1.6000 8.0000 0.0455 C 1111.247779 0 1.6000 1627 | 6/19
51 h-m-p 0.2241 8.0000 0.3247 C 1111.247757 0 0.3097 1662 | 6/19
52 h-m-p 0.3601 8.0000 0.2792 C 1111.247722 0 0.5188 1697 | 6/19
53 h-m-p 1.6000 8.0000 0.0752 C 1111.247696 0 1.3084 1732 | 6/19
54 h-m-p 0.5208 8.0000 0.1891 C 1111.247675 0 0.6774 1767 | 6/19
55 h-m-p 0.7620 8.0000 0.1681 C 1111.247642 0 0.9871 1802 | 6/19
56 h-m-p 1.6000 8.0000 0.0513 C 1111.247622 0 1.4462 1837 | 6/19
57 h-m-p 0.2617 8.0000 0.2832 +Y 1111.247595 0 0.7164 1873 | 6/19
58 h-m-p 0.8735 8.0000 0.2323 Y 1111.247583 0 0.8735 1908 | 6/19
59 h-m-p 1.6000 8.0000 0.0104 Y 1111.247567 0 1.1378 1943 | 6/19
60 h-m-p 0.0988 8.0000 0.1199 ++C 1111.247543 0 2.0336 1980 | 6/19
61 h-m-p 1.1603 8.0000 0.2102 C 1111.247529 0 1.1603 2015 | 6/19
62 h-m-p 1.6000 8.0000 0.1301 C 1111.247517 0 1.6000 2050 | 6/19
63 h-m-p 0.4824 8.0000 0.4316 C 1111.247501 0 0.5619 2085 | 6/19
64 h-m-p 0.6920 8.0000 0.3504 Y 1111.247494 0 0.6920 2120 | 6/19
65 h-m-p 1.6000 8.0000 0.0071 Y 1111.247489 0 1.0164 2155 | 6/19
66 h-m-p 0.0610 8.0000 0.1178 +++Y 1111.247480 0 3.2950 2193 | 6/19
67 h-m-p 1.6000 8.0000 0.1128 Y 1111.247473 0 3.4458 2228 | 6/19
68 h-m-p 0.6996 8.0000 0.5554 Y 1111.247468 0 0.6996 2263 | 6/19
69 h-m-p 1.6000 8.0000 0.0806 C 1111.247464 0 1.4494 2298 | 6/19
70 h-m-p 0.5867 8.0000 0.1990 +C 1111.247461 0 2.3468 2334 | 6/19
71 h-m-p 1.6000 8.0000 0.0886 Y 1111.247460 0 1.2417 2369 | 6/19
72 h-m-p 0.3918 8.0000 0.2807 +C 1111.247457 0 2.2710 2405 | 6/19
73 h-m-p 1.6000 8.0000 0.3014 Y 1111.247455 0 3.4945 2440 | 6/19
74 h-m-p 1.6000 8.0000 0.1688 C 1111.247454 0 1.8152 2475 | 6/19
75 h-m-p 0.8930 8.0000 0.3431 C 1111.247454 0 1.3578 2510 | 6/19
76 h-m-p 1.0648 8.0000 0.4376 Y 1111.247454 0 1.9469 2545 | 6/19
77 h-m-p 1.6000 8.0000 0.3801 C 1111.247454 0 1.9796 2580 | 6/19
78 h-m-p 1.6000 8.0000 0.2055 C 1111.247454 0 2.1140 2615 | 6/19
79 h-m-p 0.9027 8.0000 0.4812 +C 1111.247454 0 3.6108 2651 | 6/19
80 h-m-p 1.6000 8.0000 0.3447 C 1111.247454 0 1.6188 2686 | 6/19
81 h-m-p 1.6000 8.0000 0.2028 Y 1111.247454 0 1.0304 2721 | 6/19
82 h-m-p 1.6000 8.0000 0.0454 -C 1111.247454 0 0.1564 2757 | 6/19
83 h-m-p 0.3754 8.0000 0.0189 ---------------.. | 6/19
84 h-m-p 0.0160 8.0000 0.0012 ------------- | 6/19
85 h-m-p 0.0160 8.0000 0.0012 -------------
Out..
lnL = -1111.247454
2898 lfun, 11592 eigenQcodon, 121716 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1118.444999 S = -1069.922337 -44.820803
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 88 patterns 0:52
did 20 / 88 patterns 0:52
did 30 / 88 patterns 0:52
did 40 / 88 patterns 0:52
did 50 / 88 patterns 0:53
did 60 / 88 patterns 0:53
did 70 / 88 patterns 0:53
did 80 / 88 patterns 0:53
did 88 / 88 patterns 0:53end of tree file.
Time used: 0:53
Model 7: beta
TREE # 1
(1, 2, 3, 7, (10, ((4, (5, 6)), 9), 8)); MP score: 40
0.100076 0.044804 0.104804 0.039175 0.078846 0.100982 0.021693 0.063285 0.027272 0.047667 0.016324 0.084336 0.090658 0.046517 1.961059 0.942333 1.210139
ntime & nrate & np: 14 1 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 7.793484
np = 17
lnL0 = -1240.110982
Iterating by ming2
Initial: fx= 1240.110982
x= 0.10008 0.04480 0.10480 0.03917 0.07885 0.10098 0.02169 0.06328 0.02727 0.04767 0.01632 0.08434 0.09066 0.04652 1.96106 0.94233 1.21014
1 h-m-p 0.0000 0.0002 628.6317 ++ 1187.562769 m 0.0002 39 | 1/17
2 h-m-p 0.0000 0.0000 2689.1779 ++ 1170.944462 m 0.0000 76 | 2/17
3 h-m-p 0.0000 0.0000 36233.3620 ++ 1163.483720 m 0.0000 112 | 3/17
4 h-m-p 0.0000 0.0000 12418.5134 ++ 1161.776818 m 0.0000 147 | 4/17
5 h-m-p 0.0000 0.0000 3166.4182 ++ 1127.382333 m 0.0000 181 | 5/17
6 h-m-p 0.0000 0.0000 1107.1064 ++ 1125.664497 m 0.0000 214 | 6/17
7 h-m-p 0.0001 0.0007 67.8481 +CYYCC 1123.279599 4 0.0004 254 | 6/17
8 h-m-p 0.0001 0.0007 44.3425 +YCYCCC 1121.815947 5 0.0004 294 | 6/17
9 h-m-p 0.0000 0.0002 86.1256 YCYCCC 1121.407859 5 0.0001 333 | 6/17
10 h-m-p 0.0001 0.0003 91.5626 +YYCYCC 1120.315231 5 0.0002 372 | 6/17
11 h-m-p 0.0021 0.0471 8.7327 ++CYCCC 1116.642231 4 0.0389 413 | 6/17
12 h-m-p 0.0028 0.0142 23.0861 ++ 1114.414558 m 0.0142 444 | 6/17
13 h-m-p 0.0038 0.0191 22.1141 CCCCC 1113.658521 4 0.0051 483 | 6/17
14 h-m-p 0.0613 0.7884 1.8536 +YYCC 1112.595452 3 0.1840 519 | 6/17
15 h-m-p 0.9151 5.7221 0.3728 YCCC 1112.153394 3 0.3734 555 | 6/17
16 h-m-p 0.2579 2.0714 0.5397 CCCC 1111.917506 3 0.4586 592 | 6/17
17 h-m-p 1.5010 8.0000 0.1649 CCC 1111.893758 2 0.5276 627 | 6/17
18 h-m-p 0.6532 8.0000 0.1332 +YYC 1111.827735 2 2.3251 661 | 6/17
19 h-m-p 0.4050 2.0252 0.7627 YCYYCC 1111.535165 5 1.2419 700 | 6/17
20 h-m-p 0.0632 0.3160 1.9060 +YCYCYC 1111.452303 5 0.1957 740 | 6/17
21 h-m-p 0.0221 0.1105 1.7046 YCYCYC 1111.421664 5 0.0441 779 | 6/17
22 h-m-p 0.2544 1.2719 0.1327 +YCYC 1111.331838 3 0.6877 815 | 6/17
23 h-m-p 0.1547 2.0071 0.5899 CYC 1111.303707 2 0.1137 849 | 6/17
24 h-m-p 1.2235 6.1174 0.0201 YCC 1111.275568 2 0.7362 883 | 6/17
25 h-m-p 0.6466 8.0000 0.0229 CC 1111.264397 1 0.7831 916 | 6/17
26 h-m-p 1.3197 8.0000 0.0136 CC 1111.259021 1 1.9135 949 | 6/17
27 h-m-p 0.9699 7.0425 0.0268 YC 1111.257779 1 0.7014 981 | 6/17
28 h-m-p 1.5480 7.7402 0.0095 YC 1111.257388 1 0.7014 1013 | 6/17
29 h-m-p 1.6000 8.0000 0.0030 C 1111.257353 0 0.3483 1044 | 6/17
30 h-m-p 0.5618 8.0000 0.0019 +C 1111.257313 0 3.3396 1076 | 6/17
31 h-m-p 1.6000 8.0000 0.0009 Y 1111.257306 0 0.9765 1107 | 6/17
32 h-m-p 0.8231 8.0000 0.0011 +C 1111.257290 0 3.3055 1139 | 6/17
33 h-m-p 1.6000 8.0000 0.0018 Y 1111.257289 0 0.2227 1170 | 6/17
34 h-m-p 0.3533 8.0000 0.0011 Y 1111.257289 0 0.2049 1201 | 6/17
35 h-m-p 0.2508 8.0000 0.0009 -----C 1111.257289 0 0.0001 1237 | 6/17
36 h-m-p 0.0160 8.0000 0.0029 -------------.. | 6/17
37 h-m-p 0.0001 0.0481 0.2418 C 1111.257288 0 0.0000 1310 | 6/17
38 h-m-p 0.0012 0.5867 0.1587 -Y 1111.257287 0 0.0001 1342 | 6/17
39 h-m-p 0.0006 0.3102 0.1079 -Y 1111.257287 0 0.0000 1374 | 6/17
40 h-m-p 0.0044 2.1927 0.0189 --Y 1111.257287 0 0.0001 1407 | 6/17
41 h-m-p 0.0028 1.3992 0.0173 --C 1111.257287 0 0.0001 1440 | 6/17
42 h-m-p 0.0160 8.0000 0.0114 --C 1111.257287 0 0.0002 1473 | 6/17
43 h-m-p 0.0045 2.2491 0.0130 --C 1111.257287 0 0.0001 1506 | 6/17
44 h-m-p 0.0087 4.3462 0.0031 --Y 1111.257287 0 0.0003 1539 | 6/17
45 h-m-p 0.0160 8.0000 0.0056 ------C 1111.257287 0 0.0000 1576 | 6/17
46 h-m-p 0.0160 8.0000 0.0014 ------------Y 1111.257287 0 0.0000 1619 | 6/17
47 h-m-p 0.0160 8.0000 0.0025 -------------.. | 6/17
48 h-m-p 0.0160 8.0000 0.0315 -------------
Out..
lnL = -1111.257287
1704 lfun, 18744 eigenQcodon, 238560 P(t)
end of tree file.
Time used: 2:16
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 7, (10, ((4, (5, 6)), 9), 8)); MP score: 40
0.016844 0.097958 0.067367 0.060018 0.094019 0.028435 0.107461 0.073922 0.067732 0.088502 0.096605 0.033478 0.091786 0.072689 1.958599 0.900000 0.771443 1.027789 1.300000
ntime & nrate & np: 14 2 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 7.055351
np = 19
lnL0 = -1241.808321
Iterating by ming2
Initial: fx= 1241.808321
x= 0.01684 0.09796 0.06737 0.06002 0.09402 0.02844 0.10746 0.07392 0.06773 0.08850 0.09661 0.03348 0.09179 0.07269 1.95860 0.90000 0.77144 1.02779 1.30000
1 h-m-p 0.0000 0.0001 537.2304 ++ 1213.266156 m 0.0001 43 | 1/19
2 h-m-p 0.0000 0.0000 272192.7205 ++ 1188.182149 m 0.0000 84 | 1/19
3 h-m-p 0.0000 0.0000 6271.7789 ++ 1156.182559 m 0.0000 124 | 2/19
4 h-m-p 0.0000 0.0000 7642.3298 ++ 1146.774686 m 0.0000 164 | 3/19
5 h-m-p 0.0000 0.0000 3396.5855 ++ 1143.100360 m 0.0000 203 | 4/19
6 h-m-p 0.0000 0.0000 511.6211 ++ 1142.848488 m 0.0000 241 | 5/19
7 h-m-p 0.0000 0.0000 695.9242 ++ 1136.125347 m 0.0000 278 | 6/19
8 h-m-p 0.0001 0.0003 186.8302 +CYCYCCC 1127.671698 6 0.0003 325 | 6/19
9 h-m-p 0.0000 0.0001 110.2616 YCYCCC 1127.263957 5 0.0001 368 | 6/19
10 h-m-p 0.0002 0.0008 37.1787 CYCCC 1127.087539 4 0.0002 410 | 6/19
11 h-m-p 0.0002 0.0043 37.7828 +++ 1123.069397 m 0.0043 446 | 7/19
12 h-m-p 0.0000 0.0000 310238.8638 YCYCCC 1118.731484 5 0.0000 489 | 7/19
13 h-m-p 0.0012 0.0060 20.6674 CCCC 1118.499088 3 0.0015 529 | 7/19
14 h-m-p 0.0064 0.0914 4.8287 +CCCC 1117.577504 3 0.0260 570 | 6/19
15 h-m-p 0.0024 0.0122 33.4745 YYCCC 1116.656832 4 0.0042 610 | 6/19
16 h-m-p 0.0088 0.0442 3.7110 +YCCC 1115.899170 3 0.0234 651 | 6/19
17 h-m-p 0.0531 0.2657 0.8565 +YCC 1115.693242 2 0.2288 690 | 6/19
18 h-m-p 0.2840 1.4201 0.3262 YCCC 1115.603375 3 0.2110 730 | 6/19
19 h-m-p 0.2809 1.4047 0.0853 C 1115.596247 0 0.2807 765 | 6/19
20 h-m-p 0.7111 3.5553 0.0302 --------------C 1115.596247 0 0.0000 814 | 6/19
21 h-m-p 0.0000 0.0001 4153.0950 CC 1115.589383 1 0.0000 851 | 6/19
22 h-m-p 0.7469 8.0000 0.0181 C 1115.588287 0 0.7215 886 | 6/19
23 h-m-p 0.0433 2.9993 0.3021 C 1115.588263 0 0.0094 921 | 6/19
24 h-m-p 0.0032 1.0090 0.8734 ++CC 1115.581358 1 0.0760 960 | 6/19
25 h-m-p 0.0346 0.4283 1.9167 YC 1115.578705 1 0.0279 996 | 6/19
26 h-m-p 0.0144 0.2189 3.7001 CC 1115.574713 1 0.0213 1033 | 6/19
27 h-m-p 0.0125 0.1293 6.3104 YYC 1115.572374 2 0.0108 1070 | 6/19
28 h-m-p 0.7499 5.0651 0.0911 +YCC 1115.132253 2 2.2497 1109 | 6/19
29 h-m-p 1.1106 5.5532 0.0625 CYCC 1114.984996 3 1.5549 1149 | 6/19
30 h-m-p 1.5121 7.5604 0.0266 YCC 1114.818744 2 3.1890 1187 | 6/19
31 h-m-p 0.9346 4.6732 0.0484 YCCC 1114.708782 3 2.1905 1227 | 6/19
32 h-m-p 1.6000 8.0000 0.0235 CCY 1114.660890 2 1.5654 1266 | 6/19
33 h-m-p 1.6000 8.0000 0.0204 CC 1114.624180 1 2.2883 1303 | 6/19
34 h-m-p 0.5123 2.5613 0.0470 ++ 1114.564728 m 2.5613 1338 | 7/19
35 h-m-p 0.2649 1.3244 0.1143 ++ 1114.491762 m 1.3244 1373 | 8/19
36 h-m-p 0.1025 1.2241 1.3526 -CC 1114.490698 1 0.0089 1410 | 8/19
37 h-m-p 0.0369 5.0707 0.3257 +++YYYCYYYYYY 1113.953512 10 3.7174 1456 | 8/19
38 h-m-p 0.3346 1.6729 0.2611 CYYYCYYYYY 1113.823409 9 1.0836 1501 | 8/19
39 h-m-p 1.6000 8.0000 0.1747 YCC 1113.793110 2 1.0938 1537 | 8/19
40 h-m-p 1.0923 5.4616 0.0612 YCCYYCC 1113.692688 6 3.1178 1580 | 8/19
41 h-m-p 1.6000 8.0000 0.0608 ++ 1113.206092 m 8.0000 1613 | 7/19
42 h-m-p 1.2641 6.3206 0.2231 CYC 1112.965066 2 1.0453 1649 | 7/19
43 h-m-p 0.0870 0.4352 0.6388 +CC 1112.813084 1 0.3080 1686 | 6/19
44 h-m-p 0.0468 0.2342 0.8865 -CYYC 1112.788662 3 0.0066 1725 | 6/19
45 h-m-p 0.0186 0.9522 0.3137 C 1112.787948 0 0.0046 1760 | 6/19
46 h-m-p 0.0016 0.2351 0.8868 +++CYYYYC 1112.685062 5 0.1658 1804 | 6/19
47 h-m-p 0.0263 0.1316 0.3285 ++ 1112.629107 m 0.1316 1839 | 7/19
48 h-m-p 0.0525 0.9992 0.8231 CCCC 1112.606125 3 0.0650 1880 | 7/19
49 h-m-p 0.5467 2.7337 0.0612 ----------------.. | 7/19
50 h-m-p 0.0000 0.0005 1391.8061 YYCYYCCC 1111.413271 7 0.0000 1973 | 7/19
51 h-m-p 0.0001 0.0006 17.7717 CC 1111.407245 1 0.0000 2009 | 7/19
52 h-m-p 0.0001 0.0019 11.0405 CC 1111.402830 1 0.0001 2045 | 7/19
53 h-m-p 0.0001 0.0024 10.2651 C 1111.399731 0 0.0001 2079 | 7/19
54 h-m-p 0.0001 0.0199 12.5978 YC 1111.398183 1 0.0001 2114 | 7/19
55 h-m-p 0.0001 0.0280 7.2978 +CC 1111.392081 1 0.0005 2151 | 6/19
56 h-m-p 0.0000 0.0012 162.4989 CC 1111.391343 1 0.0000 2187 | 6/19
57 h-m-p 0.0003 0.0124 4.3497 C 1111.390248 0 0.0003 2222 | 6/19
58 h-m-p 0.0001 0.0175 11.0544 +CC 1111.386822 1 0.0004 2260 | 6/19
59 h-m-p 0.0026 0.1467 1.8520 YC 1111.386363 1 0.0005 2296 | 6/19
60 h-m-p 0.0003 0.0229 2.6777 ++CCCC 1111.374066 3 0.0080 2339 | 6/19
61 h-m-p 0.0142 0.3953 1.5035 ++CYC 1111.255597 2 0.2165 2379 | 6/19
62 h-m-p 0.1549 0.7747 0.0555 +YC 1111.254677 1 0.4598 2416 | 6/19
63 h-m-p 1.4666 7.3332 0.0038 YC 1111.254517 1 1.1599 2452 | 6/19
64 h-m-p 1.6000 8.0000 0.0015 C 1111.254509 0 1.6000 2487 | 6/19
65 h-m-p 1.6000 8.0000 0.0011 +Y 1111.254494 0 4.3604 2523 | 6/19
66 h-m-p 1.6000 8.0000 0.0018 C 1111.254486 0 1.6000 2558 | 6/19
67 h-m-p 1.6000 8.0000 0.0005 Y 1111.254484 0 3.8842 2593 | 6/19
68 h-m-p 1.1920 5.9601 0.0009 Y 1111.254481 0 1.9939 2628 | 6/19
69 h-m-p 0.5575 2.7874 0.0019 C 1111.254480 0 0.7686 2663 | 6/19
70 h-m-p 1.6000 8.0000 0.0003 C 1111.254480 0 0.5885 2698 | 6/19
71 h-m-p 0.7195 7.6228 0.0002 ----Y 1111.254480 0 0.0007 2737 | 6/19
72 h-m-p 0.0107 5.3295 0.0002 -C 1111.254480 0 0.0007 2773 | 6/19
73 h-m-p 0.0054 2.6902 0.0004 ------Y 1111.254480 0 0.0000 2814
Out..
lnL = -1111.254480
2815 lfun, 33780 eigenQcodon, 433510 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1117.528664 S = -1069.917811 -79.982528
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 88 patterns 4:48
did 20 / 88 patterns 4:48
did 30 / 88 patterns 4:48
did 40 / 88 patterns 4:48
did 50 / 88 patterns 4:48
did 60 / 88 patterns 4:49
did 70 / 88 patterns 4:49
did 80 / 88 patterns 4:49
did 88 / 88 patterns 4:49end of tree file.
Time used: 4:49
The loglikelihoods for models M1, M2, M7 and M8 are -1111.253616 -1111.247454 -1111.257287 -1111.254480 respectively
CLUSTAL W (1.8) multiple sequence alignment (ALTER 1.3.3)
B04f_M_ABN10845_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPAS
B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPAS
B07f_M_ABN10863_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPAS
BtTp_GX2012_NA_AIA62358_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPAS
CZ07_M_AWH65894_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 -MSNGSLTKDEVVNIIKNWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPAS
CZ01_M_AWH65883_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSTSMMVYVFKMFILWLLWPAS
HKU4_1_B04f_M_YP_001039959_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPAS
LMH1f_M_ABN10872_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPAS
SM3A_NA_QQD78089_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPAS
SZ140324_M_AWH65905_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVIIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPAS
*********** ***:********************** *******************
B04f_M_ABN10845_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLN
B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLN
B07f_M_ABN10863_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLN
BtTp_GX2012_NA_AIA62358_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MALSIFSAIYPISLASQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLN
CZ07_M_AWH65894_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MALSIFSAIYPITIASQIISGILAAICAVMWLAYLVQSIRLFMRTGSWWSFNPESNCLLN
CZ01_M_AWH65883_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MALSIFSAIYPITIASQIISGILAAICAVMWLAYLVQSIRLFMRTGSWWSFN-ESNCLLN
HKU4_1_B04f_M_YP_001039959_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLN
LMH1f_M_ABN10872_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLN
SM3A_NA_QQD78089_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 MALSIFSAIYPISLSSQIVSGILAAICAVMWLAYFVQSIRLLMRTGSWWSFNPESNCLLN
SZ140324_M_AWH65905_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLN
************:::***:***************:******:********** *******
B04f_M_ABN10845_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 VPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKM
B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 VPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKM
B07f_M_ABN10863_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 VPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKM
BtTp_GX2012_NA_AIA62358_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 VPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKM
CZ07_M_AWH65894_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 VPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKM
CZ01_M_AWH65883_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 VPIGGTTVVRPLVEDSPSVTAVVNDGHLKMAGMH-GRCDYDRLPMEITVAKPSVLIALKM
HKU4_1_B04f_M_YP_001039959_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 VPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKM
LMH1f_M_ABN10872_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 VPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKM
SM3A_NA_QQD78089_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 VPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKM
SZ140324_M_AWH65905_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 VPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKM
****************.***************** *************************
B04f_M_ABN10845_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 VKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA
B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 VKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA
B07f_M_ABN10863_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 VKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA
BtTp_GX2012_NA_AIA62358_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 VKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA
CZ07_M_AWH65894_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 VLRQSYGTNSVVAIFHRYKAGNYRRPTIIQDEELALLRA
CZ01_M_AWH65883_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 VKRQSYRTNSVVAIFHRYKAGNYRRPTIIQDEELALLRA
HKU4_1_B04f_M_YP_001039959_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 VKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA
LMH1f_M_ABN10872_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 VKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA
SM3A_NA_QQD78089_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 VKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA
SZ140324_M_AWH65905_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 VKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA
* **** *** ****************************
>B04f_M_ABN10845_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGTCGTCGAACGGTAGTCTTACCAAAGATGAGGTAGTAAATATTATTAAGGACTGGAATTTTTCATGGTCCATAATATTCCTACTTATTACTATCGTACTCCAATATGGTTATCCATCTAGGAGTATGATGGTTTACGTCTTTAAGATGTTCATATTATGGCTTTTATGGCCAGCTTCTATGGCACTGTCCATATTTAGTGCTATTTATCCTATTAGTTTATCATCCCAGATTATATCTGGCATTCTAGCAGCAATCTGTGCTGTTATGTGGCTAGCGTACTTTGTTCAGAGTATAAGGCTATTTATGCGCACTGGTTCCTGGTGGTCTTTTAATCCAGAATCTAATTGTCTGCTCAATGTCCCAATCGGTGGTACAACAGTTGTTAGGCCCTTGGTCGAAGATTCGACTAGTGTTACTGCTGTTGTCAACGACGGTCATCTTAAGATGGCTGGTATGCACTTTGGTCGCTGTGACTACGATAGACTTCCTATGGAAATCACCGTAGCCAAGCCCTCTGTGCTTATAGCACTTAAGATGGTTAAACGCCAATCATATGGTACAAATTCTGGTGTTGCCATATTCCATAGGTATAAAGCTGGTAATTATAGAAGACCTACTATTATACAAGATGAAGAACTTGCATTGCTTAGGGCA >B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGTCGTCGAACGGTAGTCTTACCAAAGATGAGGTAGTAAATATTATTAAGGACTGGAATTTTTCATGGTCCATAATATTCCTACTTATTACTATCGTACTCCAATATGGTTATCCATCTAGGAGTATGATGGTTTACGTCTTTAAGATGTTCATATTATGGCTTTTATGGCCAGCTTCTATGGCACTGTCCATATTTAGTGCTATTTATCCTATTAGTTTATCATCCCAGATTATATCTGGCATTCTAGCAGCAATCTGTGCTGTTATGTGGCTAGCGTACTTTGTTCAGAGTATAAGGCTATTTATGCGCACTGGTTCCTGGTGGTCTTTTAATCCAGAATCTAATTGTCTGCTCAATGTCCCAATCGGTGGTACAACAGTTGTTAGGCCCTTGGTCGAAGATTCGACTAGTGTTACTGCTGTTGTCAACGACGGTCATCTTAAGATGGCTGGTATGCACTTTGGTCGCTGTGACTACGATAGACTTCCTATGGAAATCACCGTAGCCAAGCCCTCTGTGCTTATAGCACTTAAGATGGTTAAACGCCAATCATATGGTACAAATTCTGGTGTTGCCATATTCCATAGGTATAAAGCTGGTAATTATAGAAGACCTACTATTATACAAGATGAAGAACTTGCATTGCTTAGGGCA >B07f_M_ABN10863_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGTCGTCGAACGGTAGTCTTACCAAAGATGAGGTAGTAAATATTATTAAGGACTGGAATTTTTCATGGTCCATAATATTCCTACTTATTACTATCGTACTCCAATATGGTTATCCATCTAGGAGTATGATGGTTTACGTCTTTAAGATGTTCATATTATGGCTTTTATGGCCAGCTTCTATGGCACTGTCCATATTTAGTGCTATTTATCCTATTAGTTTATCATCCCAGATTATATCTGGCATTCTAGCAGCAATCTGTGCTGTTATGTGGCTAGCGTACTTTGTTCAGAGTATAAGGCTATTTATGCGCACTGGTTCCTGGTGGTCTTTTAATCCAGAATCTAATTGTCTGCTCAATGTCCCAATCGGTGGTACAACAGTTGTTAGGCCCTTGGTCGAAGATTCGACTAGTGTTACTGCTGTTGTCAACGACGGTCATCTTAAGATGGCTGGTATGCACTTTGGTCGCTGTGACTACGATAGACTTCCTATGGAAATCACCGTAGCCAAGCCCTCTGTGCTTATAGCACTTAAGATGGTTAAACGCCAATCATATGGTACAAATTCTGGTGTTGCCATATTCCATAGGTATAAAGCTGGTAATTATAGAAGACCTACTATTATACAAGATGAAGAACTTGCATTGCTTAGGGCA >BtTp_GX2012_NA_AIA62358_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGTCGTCTAACGGTAGTCTTACCAAAGATGAGGTGGTAAATATTATTAAGGACTGGAATTTTTCATGGTCCATAATATTTTTACTTATTACTATCGTACTCCAATATGGTTACCCATCTAGGAGTATGATGGTTTACGTCTTTAAGATGTTCATATTATGGCTTTTATGGCCAGCTTCTATGGCACTATCTATATTTAGTGCTATTTATCCTATAAGTTTAGCATCCCAGATTATATCTGGCATTTTAGCAGCAATATGTGCTGTTATGTGGCTAGCGTACTTCGTTCAGAGTATACGGCTATTTATGCGCACTGGTTCTTGGTGGTCTTTTAATCCAGAATCTAATTGCCTGCTTAATGTCCCAATCGGTGGTACAACAGTTGTTAGACCATTGGTCGAAGATTCGACTAGTGTCACAGCTGTTGTCAACGATGGTCATCTTAAGATGGCTGGTATGCACTTTGGTCGCTGTGACTACGATAGACTTCCTATGGAAATCACCGTAGCCAAGCCCTCTGTGCTTATAGCACTTAAGATGGTTAAACGCCAATCATATGGTACAAATTCTGGCGTTGCCATATTTCATAGGTATAAAGCTGGTAATTATAGAAGACCTACTATTATACAAGATGAAGAACTTGCATTGCTTAGGGCA >CZ07_M_AWH65894_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ---ATGTCTAACGGTAGTCTTACCAAAGATGAGGTGGTAAATATTATAAAAAACTGGAATTTTTCATGGTCCATAATATTTTTACTTATTACTATCGTACTCCAATATGGTTACCCATCTAGGAGTATGATGGTTTACGTCTTTAAGATGTTCATATTATGGCTTTTATGGCCAGCTTCTATGGCACTATCTATATTTAGTGCTATTTATCCTATAACAATAGCATCCCAGATTATATCTGGCATTTTAGCAGCAATATGTGCTGTTATGTGGCTAGCGTACCTCGTTCAGAGTATACGGCTATTTATGCGCACTGGTTCTTGGTGGTCGTTCAATCCAGAATCTAATTGCCTGCTTAATGTCCCAATCGGTGGTACAACAGTTGTTAGACCATTGGTCGAAGATTCGACTAGTGTCACAGCTGTTGTCAACGATGGTCATCTTAAGATGGCTGGTATGCACTTTGGTCGCTGTGACTACGATAGACTTCCTATGGAAATCACCGTAGCCAAGCCCTCTGTGCTTATAGCACTTAAGATGGTTTTACGCCAATCATATGGTACAAATTCTGTCGTTGCCATATTTCATAGGTATAAAGCTGGTAATTATAGAAGACCTACTATTATACAAGATGAAGAACTTGCATTGCTTAGGGCA >CZ01_M_AWH65883_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ATGTCGTCTAACGGTAGTCTTACCAAAGATGAGGTGGTAAATATTATTAAGGACTGGAATTTTTCATGGTCCATAATATTTTTACTTATTACTATCGTACTCCAATATGGTTACCCATCTACGAGTATGATGGTTTACGTCTTTAAGATGTTCATATTATGGCTTTTATGGCCAGCTTCTATGGCACTATCTATATTTAGTGCTATTTATCCTATAACAATAGCATCCCAGATTATATCTGGCATTTTAGCAGCAATATGTGCTGTTATGTGGCTAGCGTACCTCGTTCAGAGTATACGGCTATTTATGCGCACTGGTTCTTGGTGGTCGTTCAAT---GAATCTAATTGCCTGCTTAATGTCCCAATCGGTGGTACAACAGTTGTTAGACCATTGGTCGAAGATTCGCCTAGTGTCACAGCTGTTGTCAACGATGGTCATCTTAAGATGGCTGGTATGCAC---GGTCGCTGTGACTACGATAGACTTCCTATGGAAATCACCGTAGCCAAGCCCTCTGTGCTTATAGCACTTAAGATGGTTAAACGCCAATCATATCGTACAAATTCTGTCGTTGCCATATTTCATAGGTATAAAGCTGGTAATTATAGAAGACCTACTATTATACAAGATGAAGAACTTGCATTGCTTAGGGCA >HKU4_1_B04f_M_YP_001039959_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGTCGTCGAACGGTAGTCTTACCAAAGATGAGGTAGTAAATATTATTAAGGACTGGAATTTTTCATGGTCCATAATATTCCTACTTATTACTATCGTACTCCAATATGGTTATCCATCTAGGAGTATGATGGTTTACGTCTTTAAGATGTTCATATTATGGCTTTTATGGCCAGCTTCTATGGCACTGTCCATATTTAGTGCTATTTATCCTATTAGTTTATCATCCCAGATTATATCTGGCATTCTAGCAGCAATCTGTGCTGTTATGTGGCTAGCGTACTTTGTTCAGAGTATAAGGCTATTTATGCGCACTGGTTCCTGGTGGTCTTTTAATCCAGAATCTAATTGTCTGCTCAATGTCCCAATCGGTGGTACAACAGTTGTTAGGCCCTTGGTCGAAGATTCGACTAGTGTTACTGCTGTTGTCAACGACGGTCATCTTAAGATGGCTGGTATGCACTTTGGTCGCTGTGACTACGATAGACTTCCTATGGAAATCACCGTAGCCAAGCCCTCTGTGCTTATAGCACTTAAGATGGTTAAACGCCAATCATATGGTACAAATTCTGGTGTTGCCATATTCCATAGGTATAAAGCTGGTAATTATAGAAGACCTACTATTATACAAGATGAAGAACTTGCATTGCTTAGGGCA >LMH1f_M_ABN10872_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGTCGTCGAACGGTAGTCTTACCAAAGATGAGGTAGTAAATATTATTAAGGACTGGAATTTTTCATGGTCCATAATATTCCTACTTATTACTATCGTACTCCAATATGGTTATCCATCTAGGAGTATGATGGTTTACGTCTTTAAGATGTTCATATTATGGCTTTTATGGCCAGCTTCTATGGCACTGTCCATATTTAGTGCTATTTATCCTATTAGTTTATCATCCCAGATTATATCTGGCATTCTAGCAGCAATCTGTGCTGTTATGTGGCTAGCGTACTTTGTTCAGAGTATAAGGCTATTTATGCGCACTGGTTCCTGGTGGTCTTTTAATCCAGAATCTAATTGTCTGCTCAATGTCCCAATCGGTGGTACAACAGTTGTTAGGCCCTTGGTCGAAGATTCGACTAGTGTTACTGCTGTTGTCAACGATGGTCATCTTAAGATGGCTGGTATGCACTTTGGTCGCTGTGACTACGATAGACTTCCTATGGAAATCACCGTAGCCAAGCCCTCTGTGCTTATAGCACTTAAGATGGTTAAACGCCAATCATATGGTACAAATTCTGGTGTTGCCATATTCCATAGGTATAAAGCTGGTAATTATAGAAGACCTACTATTATACAAGATGAAGAACTTGCATTGCTTAGGGCA >SM3A_NA_QQD78089_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 ATGTCGTCGAACGGTAGTCTTACCAAAGATGAGGTAGTAAATATTATTAAGGACTGGAATTTTTCATGGTCCATAATATTCCTACTTATTACTATCGTACTCCAATATGGTTATCCATCTAGGAGTATGATGGTTTACGTCTTTAAGATGTTCATATTATGGCTTTTATGGCCAGCTTCTATGGCACTGTCTATATTTAGTGCTATTTATCCTATTAGTTTATCATCCCAGATTGTATCTGGCATTCTAGCAGCAATCTGTGCTGTTATGTGGCTAGCGTACTTTGTTCAGAGTATAAGGCTACTTATGCGCACTGGTTCCTGGTGGTCTTTTAATCCAGAATCTAATTGTCTGCTCAATGTCCCAATCGGTGGTACAACAGTTGTTAGGCCCTTGGTCGAAGATTCGACTAGTGTTACTGCTGTTGTCAACGATGGTCATCTTAAGATGGCTGGTATGCACTTTGGTCGCTGTGACTACGATAGACTTCCTATGGAAATCACCGTAGCCAAGCCCTCTGTGCTTATAGCACTTAAGATGGTTAAACGCCAATCATATGGTACAAATTCTGGTGTTGCCATATTCCATAGGTATAAAGCTGGTAATTATAGAAGACCTACTATTATACAAGATGAAGAACTTGCATTGCTTAGGGCA >SZ140324_M_AWH65905_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 ATGTCGTCGAACGGTAGTCTTACCAAAGATGAGGTAGTAATTATTATTAAGGACTGGAATTTTTCATGGTCCATAATATTCCTACTTATTACTATCGTACTCCAATATGGTTATCCATCTAGGAGTATGATGGTTTACGTCTTTAAGATGTTCATATTATGGCTTTTATGGCCAGCTTCTATGGCACTGTCCATATTTAGTGCTATTTATCCTATTAGTTTATCATCCCAGATTATATCTGGCATTCTAGCAGCAATCTGTGCTGTTATGTGGCTAGCGTACTTTGTTCAGAGTATAAGGCTATTTATGCGCACTGGTTCCTGGTGGTCTTTTAATCCAGAATCTAATTGTCTGCTCAATGTCCCAATCGGTGGTACAACAGTTGTTAGGCCCTTGGTCGAAGATTCGACTAGTGTTACTGCTGTTGTCAACGATGGTCATCTTAAGATGGCTGGTATGCACTTTGGTCGCTGTGACTACGATAGACTTCCTATGGAAATCACCGTAGCCAAGCCCTCTGTGCTTATAGCACTTAAGATGGTTAAACGCCAATCATATGGTACAAATTCTGGTGTTGCCATATTCCATAGGTATAAAGCTGGTAATTATAGAAGACCTACTATTATACAAGATGAAGAACTTGCATTGCTTAGGGCA
>B04f_M_ABN10845_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA >B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA >B07f_M_ABN10863_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA >BtTp_GX2012_NA_AIA62358_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPASMALSIFSAIYPISLASQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA >CZ07_M_AWH65894_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 -MSNGSLTKDEVVNIIKNWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPASMALSIFSAIYPITIASQIISGILAAICAVMWLAYLVQSIRLFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKMVLRQSYGTNSVVAIFHRYKAGNYRRPTIIQDEELALLRA >CZ01_M_AWH65883_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSTSMMVYVFKMFILWLLWPASMALSIFSAIYPITIASQIISGILAAICAVMWLAYLVQSIRLFMRTGSWWSFN-ESNCLLNVPIGGTTVVRPLVEDSPSVTAVVNDGHLKMAGMH-GRCDYDRLPMEITVAKPSVLIALKMVKRQSYRTNSVVAIFHRYKAGNYRRPTIIQDEELALLRA >HKU4_1_B04f_M_YP_001039959_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA >LMH1f_M_ABN10872_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA >SM3A_NA_QQD78089_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPASMALSIFSAIYPISLSSQIVSGILAAICAVMWLAYFVQSIRLLMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA >SZ140324_M_AWH65905_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4 MSSNGSLTKDEVVIIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKMVKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA
Reading sequence file /data//pss_subsets/B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result/original_alignment/codeml/fasta/B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1
Found 10 sequences of length 657
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 2.4%
Found 30 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 4
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 28 polymorphic sites
**p-Value(s)**
----------
NSS: 1.00e+00 (1000 permutations)
Max Chi^2: 1.25e-01 (1000 permutations)
PHI (Permutation): 1.00e+00 (1000 permutations)
PHI (Normal): 1.00e+00
#NEXUS
[ID: 1093011803]
begin taxa;
dimensions ntax=10;
taxlabels
B04f_M_ABN10845_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
SZ140324_M_AWH65905_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4
B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
B07f_M_ABN10863_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
BtTp_GX2012_NA_AIA62358_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4
CZ07_M_AWH65894_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4
CZ01_M_AWH65883_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4
HKU4_1_B04f_M_YP_001039959_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
LMH1f_M_ABN10872_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4
SM3A_NA_QQD78089_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4
;
end;
begin trees;
translate
1 B04f_M_ABN10845_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
2 SZ140324_M_AWH65905_1_2014_04_23_China_Unknown_Tylonycteris_bat_coronavirus_HKU4,
3 B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
4 B07f_M_ABN10863_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
5 BtTp_GX2012_NA_AIA62358_1_2012_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
6 CZ07_M_AWH65894_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4,
7 CZ01_M_AWH65883_1_2012_11_01_China_Unknown_Tylonycteris_bat_coronavirus_HKU4,
8 HKU4_1_B04f_M_YP_001039959_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
9 LMH1f_M_ABN10872_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4,
10 SM3A_NA_QQD78089_1_2010_08_16_Hong_Kong_Bat_Tylonycteris_bat_coronavirus_HKU4
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:7.951590e-04,3:7.861363e-04,4:8.057993e-04,8:8.105836e-04,(2:1.957421e-03,((5:8.625715e-04,(6:8.973022e-03,7:4.354770e-03)1.000:8.952331e-03)1.000:2.667749e-02,10:3.562295e-03)0.628:1.853029e-03,9:7.858434e-04)0.941:1.952290e-03);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:7.951590e-04,3:7.861363e-04,4:8.057993e-04,8:8.105836e-04,(2:1.957421e-03,((5:8.625715e-04,(6:8.973022e-03,7:4.354770e-03):8.952331e-03):2.667749e-02,10:3.562295e-03):1.853029e-03,9:7.858434e-04):1.952290e-03);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1169.46 -1182.71
2 -1168.96 -1180.58
--------------------------------------
TOTAL -1169.18 -1182.13
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.072150 0.000146 0.049802 0.096008 0.071346 1294.05 1397.52 1.000
r(A<->C){all} 0.122725 0.002862 0.028537 0.220576 0.117485 361.51 601.35 1.000
r(A<->G){all} 0.155857 0.003043 0.058435 0.262739 0.149809 412.08 539.40 1.000
r(A<->T){all} 0.144330 0.002125 0.057269 0.231419 0.140092 522.76 611.79 1.000
r(C<->G){all} 0.123211 0.003270 0.023511 0.232255 0.115078 263.49 330.84 1.001
r(C<->T){all} 0.369252 0.005671 0.238934 0.534390 0.365960 386.03 624.53 1.000
r(G<->T){all} 0.084624 0.001545 0.015165 0.161907 0.079509 575.85 680.51 1.001
pi(A){all} 0.262097 0.000290 0.227354 0.294891 0.262107 1187.83 1251.51 1.002
pi(C){all} 0.190247 0.000230 0.161796 0.220878 0.189713 1021.99 1175.95 1.000
pi(G){all} 0.204704 0.000229 0.173343 0.232938 0.204337 1136.60 1251.44 1.000
pi(T){all} 0.342953 0.000323 0.308087 0.377885 0.342292 1262.57 1292.45 1.000
alpha{1,2} 0.971024 0.933348 0.000151 2.906711 0.683960 1039.48 1142.39 1.003
alpha{3} 1.617887 1.422948 0.003574 3.958602 1.327765 1249.98 1372.87 1.000
pinvar{all} 0.232766 0.027763 0.000113 0.546846 0.205748 716.21 785.24 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/B05f_M_ABN10854_1_NA_China_Bat_Tylonycteris_bat_coronavirus_HKU4.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 10 ls = 216
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 6 6 6 7 6 6 | Ser TCT 7 7 7 10 9 9 | Tyr TAT 6 6 6 5 5 5 | Cys TGT 3 3 3 2 2 2
TTC 3 3 3 2 2 2 | TCC 4 4 4 2 2 2 | TAC 3 3 3 4 4 4 | TGC 0 0 0 1 1 1
Leu TTA 3 3 3 5 5 4 | TCA 3 3 3 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 3 3 3 2 2 3 | TAG 0 0 0 0 0 0 | Trp TGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 9 9 9 10 10 10 | Pro CCT 3 3 3 3 3 4 | His CAT 2 2 2 2 2 2 | Arg CGT 0 0 0 0 0 1
CTC 2 2 2 1 2 2 | CCC 2 2 2 1 1 1 | CAC 1 1 1 1 1 1 | CGC 3 3 3 3 3 3
CTA 4 4 4 3 3 3 | CCA 3 3 3 4 4 4 | Gln CAA 3 3 3 3 3 3 | CGA 0 0 0 0 0 0
CTG 2 2 2 1 1 1 | CCG 0 0 0 0 0 0 | CAG 2 2 2 2 2 2 | CGG 0 0 0 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 8 8 8 7 6 7 | Thr ACT 5 5 5 4 4 3 | Asn AAT 7 7 7 7 7 7 | Ser AGT 6 6 6 6 5 5
ATC 4 4 4 3 3 3 | ACC 2 2 2 2 2 2 | AAC 2 2 2 2 3 2 | AGC 0 0 0 0 0 0
ATA 9 9 9 11 13 12 | ACA 3 3 3 4 5 5 | Lys AAA 3 3 3 3 3 3 | Arg AGA 3 3 3 4 4 4
Met ATG 10 10 10 10 11 10 | ACG 0 0 0 0 0 1 | AAG 5 5 5 5 4 5 | AGG 5 5 5 3 3 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 9 9 9 8 8 8 | Ala GCT 6 6 6 6 6 6 | Asp GAT 4 4 4 5 5 5 | Gly GGT 11 11 11 10 10 9
GTC 4 4 4 5 6 6 | GCC 2 2 2 2 2 2 | GAC 3 3 3 2 1 2 | GGC 1 1 1 2 1 1
GTA 4 4 4 3 3 3 | GCA 6 6 6 7 7 7 | Glu GAA 5 5 5 5 5 5 | GGA 0 0 0 0 0 0
GTG 1 1 1 2 2 2 | GCG 1 1 1 1 1 1 | GAG 1 1 1 1 1 1 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------------
Phe TTT 6 6 5 6 | Ser TCT 7 7 8 7 | Tyr TAT 6 6 6 6 | Cys TGT 3 3 3 3
TTC 3 3 3 3 | TCC 4 4 3 4 | TAC 3 3 3 3 | TGC 0 0 0 0
Leu TTA 3 3 3 3 | TCA 3 3 3 3 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 2 2 2 2 | TCG 3 3 3 3 | TAG 0 0 0 0 | Trp TGG 7 7 7 7
------------------------------------------------------------------------------------------------------
Leu CTT 9 9 10 9 | Pro CCT 3 3 3 3 | His CAT 2 2 2 2 | Arg CGT 0 0 0 0
CTC 2 2 2 2 | CCC 2 2 2 2 | CAC 1 1 1 1 | CGC 3 3 3 3
CTA 4 4 4 4 | CCA 3 3 3 3 | Gln CAA 3 3 3 3 | CGA 0 0 0 0
CTG 2 2 2 2 | CCG 0 0 0 0 | CAG 2 2 2 2 | CGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Ile ATT 8 8 8 9 | Thr ACT 5 5 5 5 | Asn AAT 7 7 7 6 | Ser AGT 6 6 6 6
ATC 4 4 4 4 | ACC 2 2 2 2 | AAC 2 2 2 2 | AGC 0 0 0 0
ATA 9 9 8 9 | ACA 3 3 3 3 | Lys AAA 3 3 3 3 | Arg AGA 3 3 3 3
Met ATG 10 10 10 10 | ACG 0 0 0 0 | AAG 5 5 5 5 | AGG 5 5 5 5
------------------------------------------------------------------------------------------------------
Val GTT 9 9 9 9 | Ala GCT 6 6 6 6 | Asp GAT 4 5 5 5 | Gly GGT 11 11 11 11
GTC 4 4 4 4 | GCC 2 2 2 2 | GAC 3 2 2 2 | GGC 1 1 1 1
GTA 4 4 5 4 | GCA 6 6 6 6 | Glu GAA 5 5 5 5 | GGA 0 0 0 0
GTG 1 1 1 1 | GCG 1 1 1 1 | GAG 1 1 1 1 | GGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C1
position 1: T:0.23148 C:0.16667 A:0.33333 G:0.26852
position 2: T:0.37037 C:0.23148 A:0.21759 G:0.18056
position 3: T:0.42593 C:0.16667 A:0.22685 G:0.18056
Average T:0.34259 C:0.18827 A:0.25926 G:0.20988
#2: C2
position 1: T:0.23148 C:0.16667 A:0.33333 G:0.26852
position 2: T:0.37037 C:0.23148 A:0.21759 G:0.18056
position 3: T:0.42593 C:0.16667 A:0.22685 G:0.18056
Average T:0.34259 C:0.18827 A:0.25926 G:0.20988
#3: C3
position 1: T:0.23148 C:0.16667 A:0.33333 G:0.26852
position 2: T:0.37037 C:0.23148 A:0.21759 G:0.18056
position 3: T:0.42593 C:0.16667 A:0.22685 G:0.18056
Average T:0.34259 C:0.18827 A:0.25926 G:0.20988
#4: C4
position 1: T:0.23611 C:0.16204 A:0.32870 G:0.27315
position 2: T:0.37037 C:0.23148 A:0.21759 G:0.18056
position 3: T:0.42593 C:0.15278 A:0.25000 G:0.17130
Average T:0.34414 C:0.18210 A:0.26543 G:0.20833
#5: C5
position 1: T:0.22685 C:0.16667 A:0.33796 G:0.26852
position 2: T:0.38426 C:0.23148 A:0.21296 G:0.17130
position 3: T:0.40741 C:0.15741 A:0.26389 G:0.17130
Average T:0.33951 C:0.18519 A:0.27160 G:0.20370
#6: C6
position 1: T:0.22685 C:0.17593 A:0.32870 G:0.26852
position 2: T:0.37500 C:0.24074 A:0.21759 G:0.16667
position 3: T:0.41204 C:0.15741 A:0.25463 G:0.17593
Average T:0.33796 C:0.19136 A:0.26698 G:0.20370
#7: C7
position 1: T:0.23148 C:0.16667 A:0.33333 G:0.26852
position 2: T:0.37037 C:0.23148 A:0.21759 G:0.18056
position 3: T:0.42593 C:0.16667 A:0.22685 G:0.18056
Average T:0.34259 C:0.18827 A:0.25926 G:0.20988
#8: C8
position 1: T:0.23148 C:0.16667 A:0.33333 G:0.26852
position 2: T:0.37037 C:0.23148 A:0.21759 G:0.18056
position 3: T:0.43056 C:0.16204 A:0.22685 G:0.18056
Average T:0.34414 C:0.18673 A:0.25926 G:0.20988
#9: C9
position 1: T:0.22685 C:0.17130 A:0.32870 G:0.27315
position 2: T:0.37037 C:0.23148 A:0.21759 G:0.18056
position 3: T:0.43519 C:0.15741 A:0.22685 G:0.18056
Average T:0.34414 C:0.18673 A:0.25772 G:0.21142
#10: C10
position 1: T:0.23148 C:0.16667 A:0.33333 G:0.26852
position 2: T:0.37500 C:0.23148 A:0.21296 G:0.18056
position 3: T:0.43056 C:0.16204 A:0.22685 G:0.18056
Average T:0.34568 C:0.18673 A:0.25772 G:0.20988
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 60 | Ser S TCT 78 | Tyr Y TAT 57 | Cys C TGT 27
TTC 27 | TCC 33 | TAC 33 | TGC 3
Leu L TTA 35 | TCA 27 | *** * TAA 0 | *** * TGA 0
TTG 20 | TCG 28 | TAG 0 | Trp W TGG 70
------------------------------------------------------------------------------
Leu L CTT 94 | Pro P CCT 31 | His H CAT 20 | Arg R CGT 1
CTC 19 | CCC 17 | CAC 10 | CGC 30
CTA 37 | CCA 33 | Gln Q CAA 30 | CGA 0
CTG 17 | CCG 0 | CAG 20 | CGG 3
------------------------------------------------------------------------------
Ile I ATT 77 | Thr T ACT 46 | Asn N AAT 69 | Ser S AGT 58
ATC 37 | ACC 20 | AAC 21 | AGC 0
ATA 98 | ACA 35 | Lys K AAA 30 | Arg R AGA 33
Met M ATG 101 | ACG 1 | AAG 49 | AGG 43
------------------------------------------------------------------------------
Val V GTT 87 | Ala A GCT 60 | Asp D GAT 46 | Gly G GGT 106
GTC 45 | GCC 20 | GAC 23 | GGC 11
GTA 38 | GCA 63 | Glu E GAA 50 | GGA 0
GTG 13 | GCG 10 | GAG 10 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.23056 C:0.16759 A:0.33241 G:0.26944
position 2: T:0.37269 C:0.23241 A:0.21667 G:0.17824
position 3: T:0.42454 C:0.16157 A:0.23565 G:0.17824
Average T:0.34259 C:0.18719 A:0.26157 G:0.20864
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 7, (10, ((4, (5, 6)), 9), 8)); MP score: 40
lnL(ntime: 14 np: 17): -1111.253616 +0.000000
11..1 11..2 11..3 11..7 11..12 12..10 12..13 13..14 14..4 14..15 15..5 15..6 13..9 12..8
0.000004 0.000004 0.000004 0.000004 0.004942 0.004947 0.004742 0.112257 0.000004 0.036290 0.035780 0.015178 0.010192 0.000004 1.959430 0.839645 0.016408
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.224353
(1: 0.000004, 2: 0.000004, 3: 0.000004, 7: 0.000004, (10: 0.004947, ((4: 0.000004, (5: 0.035780, 6: 0.015178): 0.036290): 0.112257, 9: 0.010192): 0.004742, 8: 0.000004): 0.004942);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C7: 0.000004, (C10: 0.004947, ((C4: 0.000004, (C5: 0.035780, C6: 0.015178): 0.036290): 0.112257, C9: 0.010192): 0.004742, C8: 0.000004): 0.004942);
Detailed output identifying parameters
kappa (ts/tv) = 1.95943
MLEs of dN/dS (w) for site classes (K=2)
p: 0.83965 0.16035
w: 0.01641 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.000 496.5 151.5 0.1741 0.0000 0.0000 0.0 0.0
11..2 0.000 496.5 151.5 0.1741 0.0000 0.0000 0.0 0.0
11..3 0.000 496.5 151.5 0.1741 0.0000 0.0000 0.0 0.0
11..7 0.000 496.5 151.5 0.1741 0.0000 0.0000 0.0 0.0
11..12 0.005 496.5 151.5 0.1741 0.0008 0.0045 0.4 0.7
12..10 0.005 496.5 151.5 0.1741 0.0008 0.0045 0.4 0.7
12..13 0.005 496.5 151.5 0.1741 0.0007 0.0043 0.4 0.7
13..14 0.112 496.5 151.5 0.1741 0.0177 0.1019 8.8 15.4
14..4 0.000 496.5 151.5 0.1741 0.0000 0.0000 0.0 0.0
14..15 0.036 496.5 151.5 0.1741 0.0057 0.0329 2.8 5.0
15..5 0.036 496.5 151.5 0.1741 0.0057 0.0325 2.8 4.9
15..6 0.015 496.5 151.5 0.1741 0.0024 0.0138 1.2 2.1
13..9 0.010 496.5 151.5 0.1741 0.0016 0.0093 0.8 1.4
12..8 0.000 496.5 151.5 0.1741 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 7, (10, ((4, (5, 6)), 9), 8)); MP score: 40
check convergence..
lnL(ntime: 14 np: 19): -1111.247454 +0.000000
11..1 11..2 11..3 11..7 11..12 12..10 12..13 13..14 14..4 14..15 15..5 15..6 13..9 12..8
0.000004 0.000004 0.000004 0.000004 0.004962 0.004965 0.004713 0.112877 0.000004 0.036454 0.035897 0.015286 0.010277 0.000004 1.961059 0.914898 0.000000 0.056697 1.467378
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.225455
(1: 0.000004, 2: 0.000004, 3: 0.000004, 7: 0.000004, (10: 0.004965, ((4: 0.000004, (5: 0.035897, 6: 0.015286): 0.036454): 0.112877, 9: 0.010277): 0.004713, 8: 0.000004): 0.004962);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C7: 0.000004, (C10: 0.004965, ((C4: 0.000004, (C5: 0.035897, C6: 0.015286): 0.036454): 0.112877, C9: 0.010277): 0.004713, C8: 0.000004): 0.004962);
Detailed output identifying parameters
kappa (ts/tv) = 1.96106
MLEs of dN/dS (w) for site classes (K=3)
p: 0.91490 0.00000 0.08510
w: 0.05670 1.00000 1.46738
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.000 496.5 151.5 0.1767 0.0000 0.0000 0.0 0.0
11..2 0.000 496.5 151.5 0.1767 0.0000 0.0000 0.0 0.0
11..3 0.000 496.5 151.5 0.1767 0.0000 0.0000 0.0 0.0
11..7 0.000 496.5 151.5 0.1767 0.0000 0.0000 0.0 0.0
11..12 0.005 496.5 151.5 0.1767 0.0008 0.0045 0.4 0.7
12..10 0.005 496.5 151.5 0.1767 0.0008 0.0045 0.4 0.7
12..13 0.005 496.5 151.5 0.1767 0.0008 0.0043 0.4 0.6
13..14 0.113 496.5 151.5 0.1767 0.0180 0.1019 8.9 15.4
14..4 0.000 496.5 151.5 0.1767 0.0000 0.0000 0.0 0.0
14..15 0.036 496.5 151.5 0.1767 0.0058 0.0329 2.9 5.0
15..5 0.036 496.5 151.5 0.1767 0.0057 0.0324 2.8 4.9
15..6 0.015 496.5 151.5 0.1767 0.0024 0.0138 1.2 2.1
13..9 0.010 496.5 151.5 0.1767 0.0016 0.0093 0.8 1.4
12..8 0.000 496.5 151.5 0.1767 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 S 0.978* 1.437
17 D 0.618 0.929
40 R 0.608 0.914
72 S 0.642 0.962
73 L 0.582 0.878
74 S 0.618 0.929
78 I 0.552 0.835
94 F 0.572 0.864
135 T 0.501 0.764
179 K 0.973* 1.429
184 G 0.542 0.821
188 G 0.600 0.903
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 S 0.721 2.744 +- 2.065
179 K 0.663 2.528 +- 1.980
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.856 0.143 0.002 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.350 0.239 0.156 0.097 0.060 0.038 0.024 0.016 0.011 0.008
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.010
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.012 0.230
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.035 0.182 0.528
sum of density on p0-p1 = 1.000000
Time used: 0:53
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 7, (10, ((4, (5, 6)), 9), 8)); MP score: 40
check convergence..
lnL(ntime: 14 np: 17): -1111.257287 +0.000000
11..1 11..2 11..3 11..7 11..12 12..10 12..13 13..14 14..4 14..15 15..5 15..6 13..9 12..8
0.000004 0.000004 0.000004 0.000004 0.004940 0.004945 0.004743 0.112115 0.000004 0.036250 0.035751 0.015158 0.010182 0.000004 1.958599 0.016277 0.083318
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.224108
(1: 0.000004, 2: 0.000004, 3: 0.000004, 7: 0.000004, (10: 0.004945, ((4: 0.000004, (5: 0.035751, 6: 0.015158): 0.036250): 0.112115, 9: 0.010182): 0.004743, 8: 0.000004): 0.004940);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C7: 0.000004, (C10: 0.004945, ((C4: 0.000004, (C5: 0.035751, C6: 0.015158): 0.036250): 0.112115, C9: 0.010182): 0.004743, C8: 0.000004): 0.004940);
Detailed output identifying parameters
kappa (ts/tv) = 1.95860
Parameters in M7 (beta):
p = 0.01628 q = 0.08332
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00107 0.73582 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.000 496.5 151.5 0.1737 0.0000 0.0000 0.0 0.0
11..2 0.000 496.5 151.5 0.1737 0.0000 0.0000 0.0 0.0
11..3 0.000 496.5 151.5 0.1737 0.0000 0.0000 0.0 0.0
11..7 0.000 496.5 151.5 0.1737 0.0000 0.0000 0.0 0.0
11..12 0.005 496.5 151.5 0.1737 0.0008 0.0045 0.4 0.7
12..10 0.005 496.5 151.5 0.1737 0.0008 0.0045 0.4 0.7
12..13 0.005 496.5 151.5 0.1737 0.0007 0.0043 0.4 0.7
13..14 0.112 496.5 151.5 0.1737 0.0177 0.1019 8.8 15.4
14..4 0.000 496.5 151.5 0.1737 0.0000 0.0000 0.0 0.0
14..15 0.036 496.5 151.5 0.1737 0.0057 0.0329 2.8 5.0
15..5 0.036 496.5 151.5 0.1737 0.0056 0.0325 2.8 4.9
15..6 0.015 496.5 151.5 0.1737 0.0024 0.0138 1.2 2.1
13..9 0.010 496.5 151.5 0.1737 0.0016 0.0093 0.8 1.4
12..8 0.000 496.5 151.5 0.1737 0.0000 0.0000 0.0 0.0
Time used: 2:16
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 7, (10, ((4, (5, 6)), 9), 8)); MP score: 40
lnL(ntime: 14 np: 19): -1111.254480 +0.000000
11..1 11..2 11..3 11..7 11..12 12..10 12..13 13..14 14..4 14..15 15..5 15..6 13..9 12..8
0.000004 0.000004 0.000004 0.000004 0.004941 0.004947 0.004751 0.112269 0.000004 0.036299 0.035789 0.015177 0.010181 0.000004 1.960571 0.852988 0.005020 0.104521 1.032319
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.224378
(1: 0.000004, 2: 0.000004, 3: 0.000004, 7: 0.000004, (10: 0.004947, ((4: 0.000004, (5: 0.035789, 6: 0.015177): 0.036299): 0.112269, 9: 0.010181): 0.004751, 8: 0.000004): 0.004941);
(C1: 0.000004, C2: 0.000004, C3: 0.000004, C7: 0.000004, (C10: 0.004947, ((C4: 0.000004, (C5: 0.035789, C6: 0.015177): 0.036299): 0.112269, C9: 0.010181): 0.004751, C8: 0.000004): 0.004941);
Detailed output identifying parameters
kappa (ts/tv) = 1.96057
Parameters in M8 (beta&w>1):
p0 = 0.85299 p = 0.00502 q = 0.10452
(p1 = 0.14701) w = 1.03232
MLEs of dN/dS (w) for site classes (K=11)
p: 0.08530 0.08530 0.08530 0.08530 0.08530 0.08530 0.08530 0.08530 0.08530 0.08530 0.14701
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.26985 1.03232
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.000 496.5 151.5 0.1748 0.0000 0.0000 0.0 0.0
11..2 0.000 496.5 151.5 0.1748 0.0000 0.0000 0.0 0.0
11..3 0.000 496.5 151.5 0.1748 0.0000 0.0000 0.0 0.0
11..7 0.000 496.5 151.5 0.1748 0.0000 0.0000 0.0 0.0
11..12 0.005 496.5 151.5 0.1748 0.0008 0.0045 0.4 0.7
12..10 0.005 496.5 151.5 0.1748 0.0008 0.0045 0.4 0.7
12..13 0.005 496.5 151.5 0.1748 0.0008 0.0043 0.4 0.7
13..14 0.112 496.5 151.5 0.1748 0.0178 0.1018 8.8 15.4
14..4 0.000 496.5 151.5 0.1748 0.0000 0.0000 0.0 0.0
14..15 0.036 496.5 151.5 0.1748 0.0058 0.0329 2.9 5.0
15..5 0.036 496.5 151.5 0.1748 0.0057 0.0324 2.8 4.9
15..6 0.015 496.5 151.5 0.1748 0.0024 0.0138 1.2 2.1
13..9 0.010 496.5 151.5 0.1748 0.0016 0.0092 0.8 1.4
12..8 0.000 496.5 151.5 0.1748 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 S 0.955* 0.998
13 N 0.797 0.878
17 D 0.842 0.912
40 R 0.839 0.909
72 S 0.850 0.918
73 L 0.831 0.903
74 S 0.842 0.912
78 I 0.821 0.896
94 F 0.827 0.900
101 F 0.799 0.879
135 T 0.804 0.883
179 K 0.949 0.994
184 G 0.818 0.893
188 G 0.836 0.907
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 S 0.812 2.423 +- 1.639
179 K 0.769 2.308 +- 1.633
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.024 0.976
p : 0.866 0.124 0.009 0.001 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.001 0.019 0.057 0.094 0.123 0.146 0.166 0.186 0.207
ws: 0.403 0.289 0.155 0.076 0.037 0.019 0.010 0.006 0.003 0.002
Time used: 4:49
Model 1: NearlyNeutral -1111.253616 Model 2: PositiveSelection -1111.247454 Model 7: beta -1111.257287 Model 8: beta&w>1 -1111.254480 Model 2 vs 1 .012324 Model 8 vs 7 .005614
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken. # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
