--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken.
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2746.33 -2757.25
2 -2746.30 -2755.89
--------------------------------------
TOTAL -2746.32 -2756.79
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.758356 0.117618 1.209732 2.422642 1.702358 603.78 676.79 1.000
r(A<->C){all} 0.017884 0.000203 0.000003 0.046152 0.014845 734.76 796.80 1.000
r(A<->G){all} 0.382895 0.004558 0.251118 0.512757 0.382036 344.33 447.59 1.000
r(A<->T){all} 0.076631 0.000325 0.041542 0.112264 0.075618 463.55 658.83 1.000
r(C<->G){all} 0.010057 0.000080 0.000001 0.027860 0.007508 768.64 825.75 1.000
r(C<->T){all} 0.506121 0.005617 0.376491 0.669285 0.504561 153.86 242.89 1.000
r(G<->T){all} 0.006412 0.000030 0.000003 0.017079 0.005022 1063.50 1076.73 1.000
pi(A){all} 0.266054 0.000144 0.242359 0.290059 0.265924 1053.91 1202.96 1.000
pi(C){all} 0.166623 0.000097 0.147877 0.185854 0.166476 593.48 934.14 1.000
pi(G){all} 0.237042 0.000143 0.215824 0.262194 0.236852 1179.38 1235.16 1.000
pi(T){all} 0.330280 0.000170 0.304961 0.354783 0.330450 1101.74 1147.73 1.001
alpha{1,2} 0.070701 0.000443 0.014109 0.102596 0.075258 809.04 822.77 1.000
alpha{3} 4.062788 2.273282 1.552859 7.073329 3.833098 1412.76 1426.68 1.000
pinvar{all} 0.261553 0.002079 0.173867 0.351149 0.263047 915.10 1208.05 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
Model 1: NearlyNeutral -2561.765546
Model 2: PositiveSelection -2561.765546
Model 7: beta -2560.679710
Model 8: beta&w>1 -2560.590222
Model 2 vs 1 0
Model 8 vs 7 .178976
-- Starting log on Wed Oct 26 00:49:25 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=337
C1 SLENVAYNVLKSGHFTAIAGELPVAILNDRLYIKEEGVDKLLFTNNTCLP
C2 SLENVAYNVLKSGHFMAVAGELPVAILNDRLYIKEDGVDKLLFTNNTCLP
C3 SLENVAYNVLKSGHFTPVAGELPVAIFNDRLYIREDGVDKLLFTNNTCLP
C4 SLENVAYNVLKSGHFTAVAGELPVAILNDRLYIKEDGADKLLFTNNTCLP
*************** .:********:******:*:*.************
C1 TNVAFELWAKRSVNVVPEVKLLHNLGVTCTYNLVIWDYECNAPLVPNTVG
C2 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYENNAPLVPNTVG
C3 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYEHNAPLVPNTVG
C4 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYESNAPLVPNTVG
**********************:**************** **********
C1 VCTYTDLTKLDDQIVLVDGRQLDSYSKFCQLKNAVYFSPSKPKCICTKGP
C2 ICNYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPSKPKCVCTKGP
C3 VCTYTDLINLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPTKPKCISARGP
C4 ICTYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAIYFSPSKPKCVCTRGP
:*.**** :****:*********:**********:****:****:.::**
C1 PHASINGVIVEAADRGTAFWYAMRKDGAFVQLTDGYFTQSRTLNDFQPRT
C2 THASINGVVVEAPDKGTAFWYAVRKDGAFVQPTDGYFTQSRTLDDFQPRT
C3 MHASINGVVVEAPDKGTAFWYAVRKDGAFVQPADGYFTQSRTLDNFQPRT
C4 THASINGVVVEAPDRGTAFWYAMRKDGAFVQPTDGYFTQSRTVDDFQPRT
*******:***.*:*******:******** :*********:::*****
C1 QLEIDFLDLEQSCFLDKYDLHDLGLEHIAYGQFDGTIGGLHLLIGAVRRK
C2 QLELDFLDLEQSCFLDKYDLHDLGLEHIAYGQFEGTIGGLHLLIGAVRRK
C3 QLELDFLDLDESCFLDRYDLHDLGLEHIAYGQFEGTIGGLHLLLGAVRRR
C4 QLEIDFLDLEQSCFLDKYDLHDLGLEHIVYGQFDGTIGGLHLLIGAVRRK
***:*****::*****:***********.****:*********:*****:
C1 RTANLVMETVLGTDTVTAYAVIDQPTASSKQVCSVFDMVLDDFIELIRAQ
C2 RTANLVMETVLGTDTVTSYAVIDQPTASSKQVCSVFDMILDDFIELIKAQ
C3 RTANLVMETVLGTDTVTSYAVIDQPTAANKQVCSVFDMVLDDFVALIKSQ
C4 RTAHLVMETVLGTDTVTSYAVIDQPTASSKQVCSVVDIILDDFIALIKAQ
***:*************:*********:.******.*::****: **::*
C1 DRSVVSKVVQCCLDFKMFRFMLWCKDGKVATFYPQLQ
C2 DRSVVSKVVQCCLDFKVFRFMLWCKDGKVATFYPQLQ
C3 DRTVVSKVVQCCLDFKMFRFMLWCKDGKIATFYPQLQ
C4 DRSVVSKVVQCCLDFKVFRFMLWCKGGKISTFYPQLQ
**:*************:********.**::*******
-- Starting log on Wed Oct 26 00:50:15 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=4, Len=337
C1 SLENVAYNVLKSGHFTAIAGELPVAILNDRLYIKEEGVDKLLFTNNTCLP
C2 SLENVAYNVLKSGHFMAVAGELPVAILNDRLYIKEDGVDKLLFTNNTCLP
C3 SLENVAYNVLKSGHFTPVAGELPVAIFNDRLYIREDGVDKLLFTNNTCLP
C4 SLENVAYNVLKSGHFTAVAGELPVAILNDRLYIKEDGADKLLFTNNTCLP
*************** .:********:******:*:*.************
C1 TNVAFELWAKRSVNVVPEVKLLHNLGVTCTYNLVIWDYECNAPLVPNTVG
C2 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYENNAPLVPNTVG
C3 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYEHNAPLVPNTVG
C4 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYESNAPLVPNTVG
**********************:**************** **********
C1 VCTYTDLTKLDDQIVLVDGRQLDSYSKFCQLKNAVYFSPSKPKCICTKGP
C2 ICNYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPSKPKCVCTKGP
C3 VCTYTDLINLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPTKPKCISARGP
C4 ICTYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAIYFSPSKPKCVCTRGP
:*.**** :****:*********:**********:****:****:.::**
C1 PHASINGVIVEAADRGTAFWYAMRKDGAFVQLTDGYFTQSRTLNDFQPRT
C2 THASINGVVVEAPDKGTAFWYAVRKDGAFVQPTDGYFTQSRTLDDFQPRT
C3 MHASINGVVVEAPDKGTAFWYAVRKDGAFVQPADGYFTQSRTLDNFQPRT
C4 THASINGVVVEAPDRGTAFWYAMRKDGAFVQPTDGYFTQSRTVDDFQPRT
*******:***.*:*******:******** :*********:::*****
C1 QLEIDFLDLEQSCFLDKYDLHDLGLEHIAYGQFDGTIGGLHLLIGAVRRK
C2 QLELDFLDLEQSCFLDKYDLHDLGLEHIAYGQFEGTIGGLHLLIGAVRRK
C3 QLELDFLDLDESCFLDRYDLHDLGLEHIAYGQFEGTIGGLHLLLGAVRRR
C4 QLEIDFLDLEQSCFLDKYDLHDLGLEHIVYGQFDGTIGGLHLLIGAVRRK
***:*****::*****:***********.****:*********:*****:
C1 RTANLVMETVLGTDTVTAYAVIDQPTASSKQVCSVFDMVLDDFIELIRAQ
C2 RTANLVMETVLGTDTVTSYAVIDQPTASSKQVCSVFDMILDDFIELIKAQ
C3 RTANLVMETVLGTDTVTSYAVIDQPTAANKQVCSVFDMVLDDFVALIKSQ
C4 RTAHLVMETVLGTDTVTSYAVIDQPTASSKQVCSVVDIILDDFIALIKAQ
***:*************:*********:.******.*::****: **::*
C1 DRSVVSKVVQCCLDFKMFRFMLWCKDGKVATFYPQLQ
C2 DRSVVSKVVQCCLDFKVFRFMLWCKDGKVATFYPQLQ
C3 DRTVVSKVVQCCLDFKMFRFMLWCKDGKIATFYPQLQ
C4 DRSVVSKVVQCCLDFKVFRFMLWCKGGKISTFYPQLQ
**:*************:********.**::*******
-- Starting log on Wed Oct 26 01:29:12 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/gapped_alignment/codeml,BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 1011 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666747755
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1694324316
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5047824749
Seed = 1097697093
Swapseed = 1666747755
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.00 % Dirichlet(Revmat{all})
1.00 % Slider(Revmat{all})
1.00 % Dirichlet(Pi{all})
1.00 % Slider(Pi{all})
2.00 % Multiplier(Alpha{1,2})
2.00 % Multiplier(Alpha{3})
2.00 % Slider(Pinvar{all})
10.00 % ExtSPR(Tau{all},V{all})
10.00 % NNI(Tau{all},V{all})
10.00 % ParsSPR(Tau{all},V{all})
40.00 % Multiplier(V{all})
14.00 % Nodeslider(V{all})
6.00 % TLMultiplier(V{all})
Division 1 has 36 unique site patterns
Division 2 has 19 unique site patterns
Division 3 has 83 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -3245.803475 -- 13.556448
Chain 2 -- -3245.803475 -- 13.556448
Chain 3 -- -3245.803475 -- 13.556448
Chain 4 -- -3242.382090 -- 13.556448
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -3245.803475 -- 13.556448
Chain 2 -- -3245.803475 -- 13.556448
Chain 3 -- -3242.382090 -- 13.556448
Chain 4 -- -3242.382090 -- 13.556448
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-3245.803] (-3245.803) (-3245.803) (-3242.382) * [-3245.803] (-3245.803) (-3242.382) (-3242.382)
1000 -- (-2889.376) [-2844.795] (-2882.796) (-2862.395) * (-2884.886) (-2926.338) [-2855.039] (-2878.082) -- 0:00:00
2000 -- (-2800.590) [-2818.315] (-2828.195) (-2833.959) * (-2819.662) (-2843.773) (-2824.162) [-2805.010] -- 0:00:00
3000 -- (-2779.295) [-2771.445] (-2801.951) (-2812.899) * (-2787.221) (-2825.425) [-2782.096] (-2783.593) -- 0:00:00
4000 -- (-2751.545) (-2766.530) [-2759.739] (-2769.166) * (-2771.714) (-2810.902) (-2756.726) [-2754.733] -- 0:04:09
5000 -- [-2749.175] (-2755.141) (-2749.293) (-2761.213) * (-2764.404) (-2777.275) (-2755.279) [-2751.585] -- 0:03:19
Average standard deviation of split frequencies: 0.052378
6000 -- (-2747.754) (-2752.935) (-2756.165) [-2748.785] * (-2759.986) (-2775.384) (-2755.969) [-2751.344] -- 0:02:45
7000 -- [-2749.828] (-2748.054) (-2750.868) (-2746.383) * (-2755.762) (-2757.831) (-2749.443) [-2751.626] -- 0:02:21
8000 -- (-2749.709) (-2749.917) (-2751.862) [-2753.628] * (-2752.238) [-2750.301] (-2745.586) (-2752.786) -- 0:02:04
9000 -- (-2746.805) (-2746.451) [-2746.559] (-2749.682) * (-2753.957) [-2754.243] (-2748.488) (-2752.122) -- 0:03:40
10000 -- [-2749.219] (-2757.213) (-2746.022) (-2745.710) * [-2749.028] (-2750.188) (-2750.744) (-2750.926) -- 0:03:18
Average standard deviation of split frequencies: 0.154680
11000 -- (-2748.891) (-2751.590) (-2748.858) [-2750.890] * (-2753.540) [-2744.674] (-2746.436) (-2754.094) -- 0:02:59
12000 -- [-2751.225] (-2744.697) (-2748.482) (-2747.219) * (-2749.443) (-2749.354) [-2753.274] (-2748.666) -- 0:02:44
13000 -- (-2750.479) (-2746.349) [-2753.224] (-2750.465) * (-2754.601) [-2748.523] (-2752.289) (-2747.665) -- 0:02:31
14000 -- [-2748.319] (-2748.711) (-2756.779) (-2747.419) * (-2749.792) [-2746.822] (-2751.575) (-2756.954) -- 0:03:31
15000 -- [-2753.686] (-2750.911) (-2754.377) (-2745.159) * (-2746.143) [-2748.351] (-2762.396) (-2745.133) -- 0:03:17
Average standard deviation of split frequencies: 0.103120
16000 -- (-2756.933) (-2748.546) [-2750.090] (-2750.876) * [-2750.375] (-2751.750) (-2755.217) (-2750.328) -- 0:03:04
17000 -- (-2753.429) (-2750.896) (-2757.443) [-2753.590] * (-2750.533) [-2749.327] (-2753.125) (-2751.381) -- 0:02:53
18000 -- (-2754.848) (-2755.027) (-2746.926) [-2754.760] * [-2746.273] (-2756.026) (-2748.251) (-2746.279) -- 0:03:38
19000 -- [-2754.338] (-2751.251) (-2754.495) (-2750.031) * [-2745.760] (-2752.651) (-2748.211) (-2760.296) -- 0:03:26
20000 -- (-2755.963) (-2752.868) [-2750.415] (-2747.532) * (-2750.890) [-2747.844] (-2757.402) (-2748.719) -- 0:03:16
Average standard deviation of split frequencies: 0.000000
21000 -- (-2751.742) (-2750.389) (-2750.307) [-2754.834] * [-2756.578] (-2747.403) (-2746.054) (-2749.418) -- 0:03:06
22000 -- (-2753.384) (-2758.500) (-2754.391) [-2747.556] * (-2746.077) (-2747.477) [-2751.095] (-2749.043) -- 0:03:42
23000 -- (-2757.701) (-2753.372) [-2752.116] (-2746.975) * (-2747.527) (-2747.224) (-2751.456) [-2748.385] -- 0:03:32
24000 -- (-2753.056) [-2750.440] (-2758.803) (-2749.245) * (-2750.441) (-2751.350) (-2747.655) [-2745.515] -- 0:03:23
25000 -- (-2754.416) (-2754.878) [-2753.883] (-2752.757) * (-2751.210) (-2750.755) (-2752.987) [-2744.293] -- 0:03:15
Average standard deviation of split frequencies: 0.018131
26000 -- (-2750.866) [-2751.701] (-2746.467) (-2747.349) * (-2749.501) [-2747.375] (-2747.503) (-2752.134) -- 0:03:07
27000 -- [-2745.424] (-2755.835) (-2748.008) (-2748.860) * [-2744.206] (-2743.808) (-2748.679) (-2745.851) -- 0:03:36
28000 -- [-2744.406] (-2748.906) (-2745.369) (-2747.980) * [-2753.066] (-2751.582) (-2754.261) (-2748.847) -- 0:03:28
29000 -- (-2747.560) (-2751.017) [-2747.778] (-2753.562) * (-2746.939) (-2745.949) (-2753.155) [-2746.253] -- 0:03:20
30000 -- (-2746.026) (-2755.403) [-2751.077] (-2749.870) * (-2755.042) (-2755.674) (-2752.390) [-2744.894] -- 0:03:14
Average standard deviation of split frequencies: 0.023058
31000 -- (-2747.135) [-2747.796] (-2753.114) (-2756.405) * [-2753.487] (-2749.078) (-2755.003) (-2752.341) -- 0:03:07
32000 -- (-2751.393) (-2754.849) (-2750.051) [-2753.345] * (-2751.617) [-2745.849] (-2755.036) (-2751.884) -- 0:03:31
33000 -- [-2753.772] (-2753.389) (-2755.756) (-2752.702) * (-2751.255) (-2747.926) [-2746.108] (-2751.446) -- 0:03:25
34000 -- [-2749.569] (-2757.395) (-2746.219) (-2762.460) * [-2749.940] (-2747.413) (-2745.666) (-2763.311) -- 0:03:18
35000 -- [-2750.997] (-2751.844) (-2754.560) (-2753.131) * [-2752.457] (-2748.065) (-2746.703) (-2754.388) -- 0:03:13
Average standard deviation of split frequencies: 0.043649
36000 -- [-2750.624] (-2744.075) (-2752.499) (-2750.433) * (-2755.937) (-2750.576) (-2751.753) [-2750.240] -- 0:03:34
37000 -- (-2749.574) (-2747.955) [-2755.774] (-2752.381) * (-2750.747) [-2748.529] (-2745.270) (-2745.806) -- 0:03:28
38000 -- (-2749.725) [-2755.187] (-2750.050) (-2756.698) * [-2752.798] (-2751.258) (-2750.846) (-2747.220) -- 0:03:22
39000 -- (-2749.609) [-2749.116] (-2750.425) (-2749.249) * (-2754.476) (-2749.633) (-2746.924) [-2748.289] -- 0:03:17
40000 -- (-2747.891) (-2753.536) (-2752.934) [-2752.665] * [-2750.424] (-2748.654) (-2752.776) (-2749.843) -- 0:03:12
Average standard deviation of split frequencies: 0.034776
41000 -- (-2746.665) (-2756.129) [-2751.010] (-2750.197) * (-2757.752) (-2747.789) [-2752.797] (-2749.924) -- 0:03:30
42000 -- (-2748.990) (-2753.360) (-2751.798) [-2747.601] * (-2754.195) (-2745.730) [-2749.763] (-2752.559) -- 0:03:25
43000 -- (-2751.638) (-2753.326) [-2752.017] (-2751.896) * (-2765.068) (-2746.814) (-2751.313) [-2750.008] -- 0:03:20
44000 -- (-2749.222) [-2757.144] (-2748.834) (-2749.268) * (-2765.142) [-2750.202] (-2754.169) (-2751.525) -- 0:03:15
45000 -- (-2760.455) (-2751.275) (-2753.546) [-2748.913] * [-2753.631] (-2753.278) (-2756.350) (-2751.679) -- 0:03:32
Average standard deviation of split frequencies: 0.027328
46000 -- (-2756.834) [-2749.060] (-2750.749) (-2753.929) * (-2754.572) [-2747.908] (-2747.255) (-2752.898) -- 0:03:27
47000 -- [-2751.255] (-2756.152) (-2754.518) (-2754.739) * [-2748.247] (-2752.449) (-2751.527) (-2751.461) -- 0:03:22
48000 -- (-2751.536) (-2750.534) [-2754.556] (-2747.269) * (-2755.327) [-2748.487] (-2746.927) (-2750.662) -- 0:03:18
49000 -- (-2756.155) (-2756.302) (-2749.322) [-2751.327] * (-2756.923) [-2751.307] (-2744.828) (-2760.775) -- 0:03:33
50000 -- [-2750.804] (-2746.932) (-2751.623) (-2747.671) * (-2755.998) [-2748.387] (-2746.326) (-2748.568) -- 0:03:29
Average standard deviation of split frequencies: 0.009304
51000 -- (-2756.239) [-2747.872] (-2748.091) (-2764.995) * (-2750.802) (-2753.558) [-2748.501] (-2758.697) -- 0:03:24
52000 -- (-2750.565) (-2748.519) [-2751.890] (-2751.560) * (-2747.262) (-2756.475) [-2751.273] (-2752.689) -- 0:03:20
53000 -- (-2747.930) (-2752.967) (-2754.659) [-2749.490] * (-2746.599) (-2750.932) [-2748.148] (-2749.110) -- 0:03:16
54000 -- [-2754.786] (-2746.601) (-2752.845) (-2746.101) * [-2750.947] (-2748.515) (-2745.644) (-2750.912) -- 0:03:30
55000 -- [-2747.257] (-2746.746) (-2749.758) (-2755.100) * (-2746.573) (-2751.260) [-2750.719] (-2752.489) -- 0:03:26
Average standard deviation of split frequencies: 0.042090
56000 -- (-2749.854) (-2760.926) (-2747.646) [-2753.119] * (-2752.719) [-2749.359] (-2750.355) (-2757.168) -- 0:03:22
57000 -- (-2754.210) (-2747.652) [-2748.419] (-2748.244) * (-2749.273) (-2752.319) [-2745.173] (-2750.472) -- 0:03:18
58000 -- (-2748.195) [-2749.214] (-2747.803) (-2750.400) * [-2749.544] (-2756.474) (-2749.517) (-2755.700) -- 0:03:31
59000 -- [-2745.577] (-2752.838) (-2750.309) (-2749.605) * (-2751.453) (-2750.917) [-2749.856] (-2746.566) -- 0:03:27
60000 -- (-2753.924) (-2748.801) (-2750.179) [-2744.489] * [-2749.274] (-2756.581) (-2749.108) (-2754.715) -- 0:03:23
Average standard deviation of split frequencies: 0.046622
61000 -- (-2753.215) (-2747.655) [-2750.956] (-2747.800) * (-2753.331) (-2751.974) [-2747.946] (-2748.252) -- 0:03:20
62000 -- (-2750.185) (-2752.277) (-2749.992) [-2748.675] * (-2748.249) (-2749.577) [-2747.031] (-2753.521) -- 0:03:16
63000 -- (-2749.062) (-2756.635) [-2751.581] (-2753.180) * (-2745.167) (-2751.100) [-2751.445] (-2749.642) -- 0:03:28
64000 -- (-2748.007) [-2750.937] (-2758.698) (-2748.861) * (-2748.875) (-2748.916) [-2751.389] (-2753.765) -- 0:03:24
65000 -- (-2744.416) (-2750.967) [-2746.887] (-2749.248) * (-2746.951) [-2756.778] (-2752.578) (-2745.846) -- 0:03:21
Average standard deviation of split frequencies: 0.010714
66000 -- [-2749.729] (-2748.838) (-2749.405) (-2750.060) * (-2749.407) [-2748.155] (-2747.487) (-2746.339) -- 0:03:18
67000 -- (-2754.079) (-2757.059) [-2746.512] (-2753.577) * (-2744.152) [-2749.193] (-2756.782) (-2751.708) -- 0:03:28
68000 -- (-2746.912) (-2754.787) (-2752.545) [-2746.937] * (-2748.717) (-2742.756) (-2760.294) [-2745.848] -- 0:03:25
69000 -- (-2745.860) (-2752.537) [-2749.713] (-2751.877) * (-2750.344) (-2748.929) [-2750.377] (-2747.008) -- 0:03:22
70000 -- (-2750.101) (-2755.789) (-2746.272) [-2746.272] * (-2752.420) [-2750.652] (-2762.794) (-2746.129) -- 0:03:19
Average standard deviation of split frequencies: 0.013342
71000 -- (-2752.196) (-2762.443) (-2746.166) [-2745.092] * (-2757.346) (-2753.538) (-2760.654) [-2748.060] -- 0:03:16
72000 -- (-2753.548) (-2747.146) (-2746.531) [-2749.492] * (-2752.070) (-2753.223) (-2750.656) [-2745.629] -- 0:03:26
73000 -- [-2748.588] (-2753.503) (-2749.227) (-2751.852) * (-2746.590) (-2753.567) (-2754.120) [-2750.251] -- 0:03:23
74000 -- (-2747.340) (-2752.626) (-2752.273) [-2752.828] * (-2754.155) [-2746.565] (-2752.110) (-2748.857) -- 0:03:20
75000 -- (-2749.765) [-2752.453] (-2748.098) (-2751.011) * (-2754.519) [-2745.474] (-2746.939) (-2750.405) -- 0:03:17
Average standard deviation of split frequencies: 0.015507
76000 -- (-2748.002) (-2747.096) (-2751.157) [-2750.178] * [-2748.844] (-2746.122) (-2751.825) (-2748.138) -- 0:03:26
77000 -- (-2749.045) (-2754.615) [-2750.138] (-2752.994) * (-2744.214) [-2746.736] (-2747.679) (-2751.599) -- 0:03:23
78000 -- (-2748.788) [-2754.794] (-2750.178) (-2746.961) * [-2747.125] (-2754.284) (-2751.510) (-2753.534) -- 0:03:20
79000 -- [-2750.347] (-2748.872) (-2749.302) (-2754.459) * (-2752.176) (-2747.428) (-2752.368) [-2745.637] -- 0:03:18
80000 -- (-2752.155) (-2755.914) [-2750.073] (-2746.008) * [-2745.291] (-2754.401) (-2747.539) (-2746.028) -- 0:03:15
Average standard deviation of split frequencies: 0.026297
81000 -- (-2750.734) (-2751.168) (-2749.094) [-2749.410] * (-2750.130) [-2754.864] (-2756.216) (-2748.610) -- 0:03:24
82000 -- (-2754.003) [-2750.435] (-2748.063) (-2750.223) * [-2747.384] (-2752.719) (-2748.122) (-2752.692) -- 0:03:21
83000 -- (-2751.071) [-2752.870] (-2749.917) (-2756.186) * [-2752.911] (-2748.089) (-2754.403) (-2754.409) -- 0:03:18
84000 -- (-2753.236) (-2750.216) [-2750.554] (-2753.757) * (-2750.205) (-2748.170) (-2760.433) [-2744.532] -- 0:03:16
85000 -- (-2749.508) (-2748.236) (-2754.313) [-2749.064] * (-2748.201) (-2746.579) (-2757.805) [-2751.888] -- 0:03:13
Average standard deviation of split frequencies: 0.041111
86000 -- (-2749.889) (-2750.907) (-2752.148) [-2751.408] * [-2749.595] (-2746.469) (-2747.962) (-2746.974) -- 0:03:21
87000 -- (-2755.631) (-2748.760) [-2748.027] (-2755.985) * [-2746.987] (-2747.085) (-2754.162) (-2752.016) -- 0:03:19
88000 -- (-2754.742) (-2752.062) [-2751.218] (-2745.604) * (-2753.137) (-2747.614) (-2752.241) [-2748.351] -- 0:03:16
89000 -- (-2754.557) (-2753.259) [-2746.796] (-2753.795) * (-2743.257) (-2750.621) [-2749.025] (-2751.888) -- 0:03:14
90000 -- (-2749.923) [-2751.011] (-2751.806) (-2748.090) * (-2758.460) (-2746.649) (-2753.971) [-2751.103] -- 0:03:22
Average standard deviation of split frequencies: 0.041595
91000 -- (-2752.573) [-2749.333] (-2749.453) (-2758.758) * (-2747.404) [-2753.568] (-2751.864) (-2745.150) -- 0:03:19
92000 -- (-2752.912) (-2754.579) [-2744.501] (-2749.775) * (-2749.447) (-2754.134) (-2747.645) [-2754.817] -- 0:03:17
93000 -- (-2757.451) [-2745.846] (-2750.750) (-2746.350) * (-2747.478) [-2754.852] (-2747.055) (-2752.735) -- 0:03:15
94000 -- [-2745.812] (-2751.511) (-2747.904) (-2748.837) * (-2748.418) [-2746.385] (-2747.600) (-2750.267) -- 0:03:12
95000 -- [-2747.175] (-2749.478) (-2752.309) (-2754.165) * (-2749.820) (-2746.763) (-2759.505) [-2744.648] -- 0:03:20
Average standard deviation of split frequencies: 0.054015
96000 -- (-2754.340) (-2753.130) [-2748.505] (-2750.545) * (-2753.661) (-2748.575) [-2757.708] (-2746.790) -- 0:03:17
97000 -- [-2747.861] (-2754.390) (-2742.810) (-2747.997) * (-2748.730) [-2756.135] (-2756.250) (-2750.626) -- 0:03:15
98000 -- [-2747.568] (-2758.326) (-2746.552) (-2753.989) * (-2746.570) (-2753.433) (-2753.344) [-2746.303] -- 0:03:13
99000 -- (-2753.627) (-2748.943) [-2753.775] (-2748.621) * [-2746.864] (-2746.361) (-2752.070) (-2746.217) -- 0:03:20
100000 -- [-2750.070] (-2749.682) (-2745.180) (-2752.410) * (-2752.861) [-2749.564] (-2748.066) (-2747.424) -- 0:03:18
Average standard deviation of split frequencies: 0.051511
101000 -- (-2746.674) (-2749.480) [-2747.876] (-2749.882) * (-2748.842) [-2749.261] (-2745.945) (-2752.107) -- 0:03:15
102000 -- (-2749.282) (-2745.890) [-2743.902] (-2752.099) * (-2754.100) [-2743.314] (-2755.653) (-2757.839) -- 0:03:13
103000 -- (-2757.286) [-2752.367] (-2747.983) (-2752.967) * (-2755.590) (-2745.465) (-2746.182) [-2749.115] -- 0:03:11
104000 -- (-2760.036) (-2753.769) [-2749.941] (-2753.680) * (-2749.914) (-2749.253) (-2757.614) [-2752.285] -- 0:03:18
105000 -- (-2757.438) (-2754.919) (-2747.928) [-2747.980] * (-2751.803) [-2753.157] (-2758.077) (-2752.019) -- 0:03:16
Average standard deviation of split frequencies: 0.042249
106000 -- [-2752.344] (-2750.677) (-2748.131) (-2749.745) * (-2755.041) (-2749.942) (-2757.873) [-2745.386] -- 0:03:13
107000 -- (-2754.695) [-2750.289] (-2756.745) (-2750.649) * [-2750.268] (-2748.641) (-2750.658) (-2753.006) -- 0:03:11
108000 -- (-2752.075) [-2745.265] (-2750.992) (-2746.942) * (-2755.166) [-2745.352] (-2753.011) (-2748.200) -- 0:03:18
109000 -- (-2756.685) (-2755.994) (-2752.303) [-2751.269] * (-2747.894) (-2748.945) (-2748.738) [-2745.124] -- 0:03:16
110000 -- [-2750.495] (-2748.618) (-2755.529) (-2748.925) * (-2751.700) (-2747.079) [-2745.337] (-2748.590) -- 0:03:14
Average standard deviation of split frequencies: 0.040467
111000 -- (-2759.982) (-2749.609) (-2747.297) [-2747.455] * (-2748.022) (-2747.943) [-2752.594] (-2749.718) -- 0:03:12
112000 -- (-2755.455) [-2743.905] (-2760.028) (-2749.269) * (-2744.379) (-2750.075) (-2749.430) [-2745.144] -- 0:03:10
113000 -- (-2751.414) [-2746.087] (-2747.397) (-2750.287) * (-2758.540) (-2753.591) (-2746.267) [-2747.725] -- 0:03:16
114000 -- (-2747.255) (-2747.647) [-2752.209] (-2750.792) * (-2747.169) (-2751.176) (-2752.204) [-2748.960] -- 0:03:14
115000 -- [-2744.908] (-2747.734) (-2753.017) (-2750.841) * [-2745.033] (-2744.448) (-2745.955) (-2755.389) -- 0:03:12
Average standard deviation of split frequencies: 0.022351
116000 -- (-2759.854) [-2745.827] (-2750.473) (-2746.684) * (-2755.351) [-2747.888] (-2748.824) (-2753.036) -- 0:03:10
117000 -- (-2749.716) (-2754.349) [-2754.923] (-2749.564) * (-2751.513) [-2744.811] (-2749.986) (-2747.872) -- 0:03:08
118000 -- (-2745.476) [-2749.080] (-2758.685) (-2751.016) * (-2749.750) [-2748.324] (-2754.375) (-2750.102) -- 0:03:14
119000 -- (-2747.873) (-2752.704) (-2751.555) [-2747.283] * [-2750.351] (-2746.807) (-2749.903) (-2751.790) -- 0:03:12
120000 -- (-2752.922) [-2750.664] (-2761.548) (-2758.510) * (-2751.904) [-2746.469] (-2748.664) (-2758.449) -- 0:03:10
Average standard deviation of split frequencies: 0.029300
121000 -- [-2752.909] (-2749.571) (-2767.789) (-2748.032) * (-2744.112) (-2750.311) [-2745.953] (-2755.269) -- 0:03:08
122000 -- (-2749.441) (-2751.895) (-2758.425) [-2745.775] * (-2749.084) [-2747.818] (-2755.766) (-2747.534) -- 0:03:14
123000 -- (-2752.435) (-2751.958) (-2758.406) [-2746.903] * [-2745.172] (-2750.120) (-2748.797) (-2749.205) -- 0:03:12
124000 -- (-2753.741) (-2753.335) (-2759.189) [-2741.073] * (-2747.063) (-2754.155) [-2748.414] (-2747.476) -- 0:03:10
125000 -- (-2752.436) [-2755.444] (-2752.604) (-2746.283) * (-2759.257) [-2747.050] (-2747.279) (-2747.732) -- 0:03:09
Average standard deviation of split frequencies: 0.016836
126000 -- (-2757.596) (-2752.241) (-2751.829) [-2748.503] * (-2750.707) [-2748.250] (-2748.076) (-2747.736) -- 0:03:07
127000 -- (-2751.851) [-2754.803] (-2748.916) (-2749.659) * (-2747.622) (-2749.286) [-2748.584] (-2751.284) -- 0:03:12
128000 -- (-2750.572) (-2748.260) (-2749.784) [-2747.936] * [-2749.198] (-2750.743) (-2748.959) (-2748.386) -- 0:03:10
129000 -- (-2754.394) (-2749.477) (-2747.422) [-2747.668] * (-2751.077) (-2754.885) (-2753.400) [-2748.256] -- 0:03:09
130000 -- (-2758.112) (-2755.177) (-2746.268) [-2744.516] * (-2754.078) (-2753.180) (-2751.087) [-2752.643] -- 0:03:07
Average standard deviation of split frequencies: 0.007215
131000 -- (-2752.035) (-2744.923) [-2746.993] (-2748.773) * [-2749.981] (-2750.314) (-2750.934) (-2745.624) -- 0:03:12
132000 -- (-2754.364) (-2753.507) [-2748.424] (-2749.522) * [-2749.735] (-2758.618) (-2748.250) (-2749.733) -- 0:03:10
133000 -- [-2750.038] (-2750.730) (-2749.501) (-2755.992) * [-2751.692] (-2752.603) (-2751.240) (-2755.148) -- 0:03:09
134000 -- (-2753.723) (-2752.253) (-2751.930) [-2751.659] * [-2753.874] (-2751.156) (-2746.066) (-2746.999) -- 0:03:07
135000 -- (-2754.839) [-2744.036] (-2747.390) (-2747.945) * (-2751.985) (-2747.105) (-2750.495) [-2746.654] -- 0:03:05
Average standard deviation of split frequencies: 0.017331
136000 -- (-2749.664) (-2748.402) [-2746.751] (-2753.368) * (-2748.182) (-2746.964) (-2751.400) [-2748.658] -- 0:03:10
137000 -- (-2750.339) [-2753.360] (-2745.690) (-2748.353) * [-2742.539] (-2754.754) (-2756.265) (-2745.158) -- 0:03:08
138000 -- (-2755.875) (-2750.594) [-2750.115] (-2757.593) * [-2743.260] (-2753.333) (-2748.971) (-2746.578) -- 0:03:07
139000 -- (-2754.065) (-2749.059) [-2751.153] (-2760.070) * [-2745.367] (-2755.159) (-2753.972) (-2747.387) -- 0:03:05
140000 -- (-2750.005) [-2744.581] (-2750.073) (-2752.879) * (-2748.712) (-2751.834) [-2754.581] (-2760.113) -- 0:03:04
Average standard deviation of split frequencies: 0.003351
141000 -- (-2744.673) (-2748.720) [-2753.109] (-2750.777) * (-2746.264) (-2751.740) [-2752.742] (-2746.983) -- 0:03:08
142000 -- [-2742.435] (-2747.981) (-2763.266) (-2748.736) * (-2750.571) (-2751.878) (-2751.531) [-2753.226] -- 0:03:07
143000 -- [-2748.846] (-2746.412) (-2755.199) (-2749.834) * (-2756.587) [-2750.902] (-2750.624) (-2752.136) -- 0:03:05
144000 -- (-2746.732) (-2748.241) (-2746.881) [-2748.408] * (-2757.382) (-2751.003) [-2747.256] (-2749.543) -- 0:03:04
145000 -- [-2745.900] (-2749.116) (-2753.402) (-2754.795) * (-2751.130) [-2749.573] (-2746.802) (-2750.841) -- 0:03:08
Average standard deviation of split frequencies: 0.003229
146000 -- [-2751.653] (-2749.398) (-2750.847) (-2750.102) * (-2748.723) (-2747.649) (-2751.604) [-2746.820] -- 0:03:07
147000 -- [-2752.400] (-2746.385) (-2750.235) (-2757.558) * (-2745.980) (-2756.492) (-2746.993) [-2753.649] -- 0:03:05
148000 -- (-2751.810) (-2744.689) (-2750.942) [-2746.486] * (-2752.791) (-2755.942) [-2749.721] (-2753.869) -- 0:03:04
149000 -- (-2749.543) (-2752.148) [-2750.126] (-2748.206) * (-2751.092) [-2755.517] (-2747.060) (-2752.419) -- 0:03:02
150000 -- [-2751.302] (-2749.985) (-2752.267) (-2751.337) * (-2751.338) (-2749.448) [-2746.319] (-2749.044) -- 0:03:07
Average standard deviation of split frequencies: 0.004693
151000 -- (-2749.654) (-2749.322) [-2748.907] (-2747.487) * [-2751.434] (-2753.528) (-2756.343) (-2748.943) -- 0:03:05
152000 -- [-2753.781] (-2748.797) (-2754.786) (-2752.325) * (-2750.223) [-2746.783] (-2748.729) (-2755.013) -- 0:03:04
153000 -- (-2749.994) (-2752.204) [-2745.639] (-2744.278) * (-2749.567) (-2747.537) (-2750.896) [-2745.474] -- 0:03:02
154000 -- (-2748.042) [-2746.112] (-2750.056) (-2745.853) * (-2750.008) (-2748.961) (-2747.675) [-2745.905] -- 0:03:06
155000 -- (-2751.547) (-2751.935) [-2748.060] (-2744.045) * (-2748.135) (-2745.265) [-2747.090] (-2750.297) -- 0:03:05
Average standard deviation of split frequencies: 0.018131
156000 -- [-2760.913] (-2752.888) (-2751.975) (-2750.575) * (-2752.683) (-2746.830) (-2750.466) [-2752.052] -- 0:03:03
157000 -- (-2747.619) [-2751.704] (-2750.023) (-2744.826) * [-2747.171] (-2750.052) (-2753.225) (-2752.347) -- 0:03:02
158000 -- (-2751.474) (-2751.781) (-2754.159) [-2747.932] * [-2748.330] (-2755.714) (-2748.033) (-2756.983) -- 0:03:01
159000 -- [-2747.545] (-2755.331) (-2751.210) (-2754.660) * (-2754.765) (-2761.001) [-2747.975] (-2762.318) -- 0:03:05
160000 -- (-2748.272) [-2749.202] (-2757.495) (-2763.321) * (-2751.337) (-2745.001) [-2746.958] (-2753.627) -- 0:03:03
Average standard deviation of split frequencies: 0.005868
161000 -- [-2744.454] (-2749.839) (-2753.568) (-2758.077) * (-2747.452) (-2747.816) [-2754.353] (-2751.515) -- 0:03:02
162000 -- (-2750.554) [-2748.619] (-2750.150) (-2750.835) * [-2743.681] (-2747.617) (-2747.551) (-2758.958) -- 0:03:01
163000 -- (-2749.109) (-2749.518) [-2746.014] (-2752.398) * [-2748.066] (-2752.338) (-2751.211) (-2763.505) -- 0:03:04
164000 -- [-2747.656] (-2748.502) (-2748.125) (-2750.320) * (-2747.041) [-2752.162] (-2754.907) (-2751.349) -- 0:03:03
165000 -- (-2749.092) (-2744.749) (-2751.704) [-2749.284] * (-2750.435) [-2750.687] (-2754.747) (-2745.784) -- 0:03:02
Average standard deviation of split frequencies: 0.008519
166000 -- [-2749.868] (-2748.099) (-2753.547) (-2751.154) * (-2754.082) (-2752.197) (-2756.363) [-2748.423] -- 0:03:00
167000 -- (-2749.269) (-2747.538) [-2758.031] (-2746.939) * (-2747.848) (-2757.838) [-2748.777] (-2745.637) -- 0:02:59
168000 -- (-2749.460) (-2755.246) (-2748.945) [-2745.602] * (-2748.664) [-2753.255] (-2749.355) (-2755.634) -- 0:03:03
169000 -- (-2754.008) [-2748.765] (-2751.962) (-2753.780) * [-2746.244] (-2747.482) (-2747.551) (-2746.446) -- 0:03:01
170000 -- (-2751.027) (-2745.149) [-2750.397] (-2751.735) * (-2748.041) (-2749.775) [-2747.366] (-2747.504) -- 0:03:00
Average standard deviation of split frequencies: 0.022097
171000 -- (-2753.052) (-2752.752) (-2750.517) [-2745.794] * [-2748.917] (-2745.776) (-2751.774) (-2752.095) -- 0:02:59
172000 -- (-2751.763) [-2746.443] (-2745.866) (-2749.154) * [-2744.055] (-2746.123) (-2748.771) (-2754.063) -- 0:03:02
173000 -- [-2747.486] (-2752.371) (-2754.274) (-2755.255) * (-2752.139) (-2751.077) [-2745.515] (-2755.220) -- 0:03:01
174000 -- (-2755.023) (-2747.967) (-2747.933) [-2747.245] * (-2751.915) (-2749.491) [-2757.237] (-2753.738) -- 0:03:00
175000 -- (-2748.296) (-2748.675) [-2747.353] (-2747.799) * (-2749.782) [-2746.468] (-2748.519) (-2752.621) -- 0:02:59
Average standard deviation of split frequencies: 0.022767
176000 -- (-2750.224) (-2747.818) [-2744.295] (-2750.794) * (-2748.227) [-2748.760] (-2746.358) (-2751.330) -- 0:02:57
177000 -- (-2749.077) (-2752.306) [-2746.112] (-2753.512) * (-2749.946) (-2747.059) (-2748.120) [-2753.376] -- 0:03:01
178000 -- (-2750.605) (-2743.181) [-2747.354] (-2748.715) * [-2752.487] (-2752.043) (-2753.133) (-2747.310) -- 0:03:00
179000 -- (-2749.371) (-2751.877) (-2751.627) [-2743.438] * [-2746.786] (-2748.305) (-2749.253) (-2750.556) -- 0:02:58
180000 -- (-2752.929) (-2745.451) [-2753.141] (-2755.994) * [-2749.786] (-2747.741) (-2756.987) (-2745.241) -- 0:02:57
Average standard deviation of split frequencies: 0.018265
181000 -- (-2751.753) (-2746.779) [-2753.511] (-2752.426) * (-2753.628) (-2749.847) (-2754.071) [-2751.836] -- 0:03:00
182000 -- (-2745.905) (-2752.674) (-2755.205) [-2747.150] * (-2756.850) (-2748.427) (-2751.419) [-2751.387] -- 0:02:59
183000 -- [-2751.842] (-2751.804) (-2755.174) (-2752.210) * [-2744.955] (-2750.502) (-2751.579) (-2749.645) -- 0:02:58
184000 -- (-2749.332) (-2751.879) [-2752.384] (-2751.591) * (-2756.098) [-2754.628] (-2748.455) (-2755.151) -- 0:02:57
185000 -- (-2749.560) (-2747.547) [-2752.076] (-2745.839) * (-2743.713) (-2744.152) (-2751.719) [-2750.619] -- 0:02:56
Average standard deviation of split frequencies: 0.011405
186000 -- (-2746.870) [-2751.834] (-2746.555) (-2746.108) * (-2751.199) [-2746.583] (-2747.524) (-2749.971) -- 0:02:59
187000 -- (-2749.005) (-2747.060) (-2755.908) [-2747.179] * [-2748.666] (-2750.572) (-2750.093) (-2752.059) -- 0:02:58
188000 -- [-2751.803] (-2746.571) (-2749.247) (-2761.436) * (-2750.758) (-2750.739) [-2750.290] (-2753.730) -- 0:02:57
189000 -- (-2751.742) [-2748.723] (-2749.568) (-2748.467) * [-2747.852] (-2754.278) (-2749.660) (-2750.134) -- 0:02:55
190000 -- (-2745.115) (-2748.657) (-2751.341) [-2748.577] * (-2744.730) (-2751.307) [-2747.336] (-2747.202) -- 0:02:59
Average standard deviation of split frequencies: 0.008653
191000 -- (-2751.959) (-2747.000) (-2749.644) [-2747.525] * [-2748.605] (-2749.982) (-2749.067) (-2744.616) -- 0:02:57
192000 -- (-2749.864) [-2746.617] (-2747.727) (-2755.478) * (-2751.269) (-2753.305) (-2747.518) [-2748.814] -- 0:02:56
193000 -- [-2747.694] (-2747.215) (-2753.304) (-2761.097) * (-2754.175) (-2752.330) [-2752.483] (-2750.207) -- 0:02:55
194000 -- (-2751.179) [-2751.518] (-2753.119) (-2748.951) * [-2751.667] (-2752.404) (-2746.922) (-2750.047) -- 0:02:54
195000 -- (-2751.005) [-2750.134] (-2747.503) (-2747.921) * (-2753.705) (-2751.338) (-2751.957) [-2750.327] -- 0:02:57
Average standard deviation of split frequencies: 0.004810
196000 -- (-2758.856) (-2750.410) (-2761.232) [-2743.433] * (-2755.518) (-2748.735) (-2749.620) [-2746.688] -- 0:02:56
197000 -- (-2760.554) [-2748.136] (-2754.363) (-2752.071) * (-2758.173) [-2753.369] (-2753.094) (-2753.103) -- 0:02:55
198000 -- (-2759.853) (-2749.797) [-2759.136] (-2754.111) * (-2752.281) [-2747.577] (-2750.408) (-2746.942) -- 0:02:54
199000 -- (-2752.203) [-2750.327] (-2750.486) (-2747.776) * (-2755.037) (-2752.144) [-2748.047] (-2749.283) -- 0:02:53
200000 -- (-2758.627) (-2745.606) (-2746.950) [-2745.667] * [-2753.270] (-2751.719) (-2750.485) (-2752.512) -- 0:02:56
Average standard deviation of split frequencies: 0.003524
201000 -- (-2751.824) (-2744.510) (-2752.699) [-2745.380] * [-2749.936] (-2749.247) (-2752.230) (-2747.543) -- 0:02:54
202000 -- (-2751.446) (-2753.665) [-2750.556] (-2747.484) * (-2749.170) (-2750.227) (-2751.062) [-2745.107] -- 0:02:53
203000 -- [-2747.659] (-2751.711) (-2753.749) (-2746.629) * (-2751.221) (-2751.276) [-2749.534] (-2753.143) -- 0:02:52
204000 -- [-2749.565] (-2749.710) (-2753.317) (-2752.721) * (-2751.466) (-2752.939) (-2756.399) [-2754.154] -- 0:02:55
205000 -- (-2752.675) [-2749.202] (-2750.724) (-2752.341) * (-2746.559) (-2750.845) (-2753.855) [-2750.434] -- 0:02:54
Average standard deviation of split frequencies: 0.003433
206000 -- [-2747.454] (-2750.477) (-2756.443) (-2749.474) * (-2746.585) (-2750.492) (-2749.158) [-2745.326] -- 0:02:53
207000 -- (-2749.097) (-2753.863) [-2749.191] (-2751.141) * (-2751.854) [-2747.135] (-2754.902) (-2751.130) -- 0:02:52
208000 -- (-2747.977) (-2751.689) [-2745.799] (-2747.651) * (-2743.297) (-2744.772) (-2753.627) [-2754.067] -- 0:02:51
209000 -- [-2748.699] (-2746.019) (-2747.257) (-2746.203) * (-2747.084) (-2754.204) [-2749.633] (-2756.116) -- 0:02:54
210000 -- (-2746.693) (-2750.353) (-2754.966) [-2750.976] * (-2755.722) [-2748.162] (-2747.861) (-2744.994) -- 0:02:53
Average standard deviation of split frequencies: 0.004475
211000 -- (-2748.533) (-2754.879) (-2750.071) [-2746.465] * (-2746.582) [-2749.432] (-2751.302) (-2747.028) -- 0:02:52
212000 -- (-2748.503) [-2748.418] (-2748.901) (-2758.025) * (-2745.514) (-2760.789) (-2750.776) [-2751.744] -- 0:02:50
213000 -- (-2751.123) [-2747.002] (-2748.243) (-2752.004) * (-2752.417) [-2754.390] (-2755.589) (-2747.584) -- 0:02:53
214000 -- (-2751.078) [-2746.828] (-2748.999) (-2748.463) * [-2751.926] (-2747.860) (-2755.591) (-2755.102) -- 0:02:52
215000 -- (-2750.827) (-2750.473) (-2747.640) [-2753.451] * (-2755.109) (-2749.326) [-2748.292] (-2754.357) -- 0:02:51
Average standard deviation of split frequencies: 0.004365
216000 -- (-2747.516) (-2750.674) [-2748.280] (-2753.837) * [-2753.272] (-2751.776) (-2750.915) (-2748.962) -- 0:02:50
217000 -- (-2750.679) (-2753.604) [-2747.102] (-2749.411) * (-2750.583) [-2746.485] (-2747.426) (-2748.592) -- 0:02:49
218000 -- (-2751.296) (-2748.698) [-2748.815] (-2750.710) * (-2749.133) [-2746.478] (-2746.409) (-2754.325) -- 0:02:52
219000 -- (-2745.767) [-2747.247] (-2746.628) (-2750.627) * (-2750.573) (-2754.121) (-2755.347) [-2749.797] -- 0:02:51
220000 -- (-2746.862) (-2752.353) (-2751.804) [-2748.237] * (-2746.077) (-2749.639) (-2750.034) [-2751.896] -- 0:02:50
Average standard deviation of split frequencies: 0.004273
221000 -- [-2749.454] (-2754.811) (-2747.858) (-2749.718) * (-2748.613) (-2745.560) [-2753.861] (-2747.553) -- 0:02:49
222000 -- (-2747.071) (-2750.769) (-2748.800) [-2753.166] * (-2747.877) (-2748.662) [-2750.235] (-2746.553) -- 0:02:51
223000 -- (-2750.184) [-2751.651] (-2749.783) (-2750.058) * (-2753.076) (-2748.649) (-2748.227) [-2750.044] -- 0:02:50
224000 -- [-2752.055] (-2751.480) (-2751.835) (-2754.027) * [-2746.321] (-2756.896) (-2752.020) (-2745.924) -- 0:02:49
225000 -- (-2754.055) [-2751.009] (-2751.437) (-2755.194) * [-2751.878] (-2743.346) (-2760.160) (-2756.271) -- 0:02:48
Average standard deviation of split frequencies: 0.003129
226000 -- (-2752.548) [-2750.317] (-2749.807) (-2745.941) * (-2750.632) [-2747.453] (-2758.111) (-2756.325) -- 0:02:47
227000 -- (-2754.221) (-2748.873) (-2752.234) [-2751.869] * (-2745.094) [-2746.427] (-2750.703) (-2748.624) -- 0:02:50
228000 -- (-2756.451) [-2752.726] (-2747.227) (-2752.123) * [-2750.342] (-2749.682) (-2748.864) (-2746.830) -- 0:02:49
229000 -- (-2747.354) [-2754.033] (-2748.483) (-2752.711) * (-2748.879) [-2745.203] (-2758.282) (-2750.109) -- 0:02:48
230000 -- [-2746.914] (-2750.366) (-2749.126) (-2754.502) * [-2748.988] (-2747.741) (-2755.092) (-2749.391) -- 0:02:47
Average standard deviation of split frequencies: 0.004087
231000 -- (-2744.363) (-2751.337) (-2753.089) [-2755.896] * (-2744.953) (-2750.980) [-2755.123] (-2756.720) -- 0:02:49
232000 -- (-2750.432) (-2748.911) (-2755.685) [-2750.516] * (-2750.489) [-2751.313] (-2749.292) (-2746.138) -- 0:02:48
233000 -- (-2746.044) [-2751.954] (-2752.857) (-2750.267) * (-2755.394) (-2754.939) (-2748.760) [-2750.805] -- 0:02:47
234000 -- (-2750.028) (-2752.411) (-2757.318) [-2755.737] * (-2751.812) (-2750.908) (-2749.768) [-2747.596] -- 0:02:46
235000 -- [-2748.107] (-2751.309) (-2752.218) (-2753.606) * [-2748.506] (-2748.313) (-2752.487) (-2752.745) -- 0:02:46
Average standard deviation of split frequencies: 0.008989
236000 -- [-2747.765] (-2754.095) (-2755.325) (-2754.835) * (-2748.734) [-2755.019] (-2751.842) (-2746.709) -- 0:02:48
237000 -- [-2749.961] (-2752.681) (-2751.946) (-2752.435) * (-2752.485) (-2750.191) (-2751.467) [-2747.062] -- 0:02:47
238000 -- [-2746.641] (-2747.104) (-2748.378) (-2749.931) * [-2752.448] (-2750.136) (-2757.541) (-2746.483) -- 0:02:46
239000 -- [-2747.203] (-2753.767) (-2751.957) (-2748.287) * (-2747.365) (-2749.422) (-2755.009) [-2752.672] -- 0:02:45
240000 -- [-2753.250] (-2752.891) (-2756.176) (-2744.487) * (-2753.851) (-2757.600) [-2748.733] (-2749.514) -- 0:02:44
Average standard deviation of split frequencies: 0.004897
241000 -- (-2745.945) (-2748.588) [-2747.512] (-2749.972) * (-2752.908) (-2751.606) [-2751.338] (-2751.654) -- 0:02:46
242000 -- [-2747.399] (-2751.790) (-2744.818) (-2751.730) * (-2748.472) (-2753.211) (-2766.268) [-2746.135] -- 0:02:46
243000 -- (-2749.326) [-2750.170] (-2753.748) (-2751.529) * (-2753.242) (-2755.122) (-2749.202) [-2748.000] -- 0:02:45
244000 -- (-2746.024) (-2751.823) [-2748.816] (-2749.699) * (-2749.840) (-2748.155) (-2747.128) [-2750.278] -- 0:02:44
245000 -- [-2751.421] (-2756.213) (-2745.324) (-2742.897) * (-2747.147) [-2748.092] (-2756.410) (-2753.976) -- 0:02:46
Average standard deviation of split frequencies: 0.004791
246000 -- (-2750.663) (-2749.188) (-2747.846) [-2749.209] * (-2752.306) (-2748.695) [-2750.954] (-2756.197) -- 0:02:45
247000 -- (-2751.689) (-2750.737) (-2745.218) [-2749.941] * (-2750.264) (-2753.546) (-2749.614) [-2751.906] -- 0:02:44
248000 -- [-2749.791] (-2744.730) (-2746.787) (-2752.179) * [-2749.293] (-2751.149) (-2754.124) (-2750.601) -- 0:02:43
249000 -- (-2753.675) (-2748.100) (-2745.790) [-2756.107] * [-2748.694] (-2746.191) (-2755.163) (-2750.271) -- 0:02:42
250000 -- (-2747.979) (-2746.578) (-2751.680) [-2746.086] * (-2751.211) (-2748.409) [-2750.830] (-2749.266) -- 0:02:45
Average standard deviation of split frequencies: 0.006582
251000 -- (-2746.975) (-2747.609) [-2748.781] (-2746.033) * [-2749.358] (-2746.154) (-2751.964) (-2752.657) -- 0:02:44
252000 -- (-2749.780) (-2747.633) [-2749.656] (-2752.199) * [-2750.463] (-2751.979) (-2751.007) (-2748.896) -- 0:02:43
253000 -- (-2748.568) [-2748.573] (-2745.708) (-2748.725) * (-2746.345) (-2744.400) (-2750.354) [-2745.820] -- 0:02:42
254000 -- (-2750.242) (-2752.550) [-2747.680] (-2747.588) * (-2748.987) [-2745.692] (-2754.965) (-2749.169) -- 0:02:44
255000 -- (-2749.500) (-2748.190) (-2748.619) [-2750.451] * (-2745.273) (-2761.951) (-2753.082) [-2748.583] -- 0:02:43
Average standard deviation of split frequencies: 0.005524
256000 -- (-2752.788) (-2748.544) [-2752.327] (-2750.197) * [-2746.635] (-2749.393) (-2748.801) (-2745.092) -- 0:02:42
257000 -- (-2756.251) [-2746.485] (-2753.571) (-2755.284) * (-2761.008) [-2746.966] (-2751.974) (-2752.327) -- 0:02:41
258000 -- [-2749.081] (-2751.462) (-2750.379) (-2756.342) * [-2749.353] (-2747.672) (-2754.731) (-2743.182) -- 0:02:41
259000 -- (-2748.608) (-2749.747) (-2749.193) [-2755.275] * (-2746.949) [-2748.977] (-2751.434) (-2756.869) -- 0:02:43
260000 -- (-2752.536) [-2745.911] (-2751.291) (-2760.299) * (-2750.873) (-2744.519) (-2746.688) [-2750.279] -- 0:02:42
Average standard deviation of split frequencies: 0.005425
261000 -- [-2748.075] (-2748.639) (-2755.598) (-2751.551) * (-2753.138) (-2749.348) [-2746.206] (-2751.855) -- 0:02:41
262000 -- (-2748.773) [-2746.505] (-2751.009) (-2758.019) * (-2757.419) (-2747.795) [-2748.486] (-2754.943) -- 0:02:40
263000 -- (-2747.259) (-2743.824) [-2753.405] (-2754.183) * (-2751.308) (-2748.750) [-2748.161] (-2752.600) -- 0:02:42
264000 -- (-2748.913) [-2749.953] (-2754.423) (-2754.335) * [-2754.090] (-2758.601) (-2752.923) (-2748.831) -- 0:02:41
265000 -- (-2751.871) [-2748.269] (-2751.416) (-2756.537) * (-2749.847) (-2749.142) [-2747.915] (-2749.647) -- 0:02:40
Average standard deviation of split frequencies: 0.004430
266000 -- [-2746.440] (-2747.056) (-2754.934) (-2755.619) * [-2747.218] (-2751.320) (-2745.020) (-2756.271) -- 0:02:40
267000 -- (-2750.606) (-2748.659) (-2750.907) [-2748.579] * (-2747.903) (-2753.281) (-2745.999) [-2753.103] -- 0:02:39
268000 -- (-2753.986) (-2744.659) [-2747.748] (-2753.690) * (-2747.272) [-2748.377] (-2751.824) (-2747.633) -- 0:02:41
269000 -- (-2752.654) (-2750.803) [-2747.909] (-2751.212) * (-2745.131) (-2750.086) [-2747.552] (-2752.666) -- 0:02:40
270000 -- [-2752.513] (-2752.221) (-2748.665) (-2750.250) * [-2749.527] (-2749.873) (-2753.698) (-2751.501) -- 0:02:39
Average standard deviation of split frequencies: 0.004354
271000 -- (-2753.211) (-2749.175) (-2750.064) [-2744.978] * (-2747.671) (-2756.414) [-2750.079] (-2745.730) -- 0:02:38
272000 -- (-2751.610) [-2749.719] (-2752.662) (-2754.506) * (-2750.096) (-2749.956) (-2753.093) [-2745.722] -- 0:02:37
273000 -- (-2750.469) [-2744.191] (-2748.714) (-2748.814) * (-2751.787) (-2751.855) (-2747.182) [-2749.107] -- 0:02:39
274000 -- (-2749.871) (-2750.105) (-2751.176) [-2744.178] * (-2747.971) [-2750.192] (-2751.470) (-2753.233) -- 0:02:38
275000 -- (-2753.753) [-2750.662] (-2752.083) (-2755.282) * (-2752.684) [-2745.388] (-2747.526) (-2751.565) -- 0:02:38
Average standard deviation of split frequencies: 0.003416
276000 -- (-2747.331) (-2746.672) (-2754.531) [-2748.740] * (-2751.281) [-2742.892] (-2759.349) (-2750.184) -- 0:02:37
277000 -- [-2749.485] (-2750.185) (-2748.244) (-2754.045) * (-2746.767) (-2759.281) (-2748.081) [-2745.820] -- 0:02:39
278000 -- [-2748.711] (-2749.113) (-2757.988) (-2750.329) * (-2750.684) (-2752.694) [-2755.181] (-2746.118) -- 0:02:38
279000 -- [-2749.925] (-2748.936) (-2748.657) (-2747.145) * (-2748.283) [-2750.300] (-2756.807) (-2748.314) -- 0:02:37
280000 -- (-2748.465) (-2746.883) [-2747.734] (-2747.078) * (-2749.820) (-2749.426) (-2749.958) [-2747.345] -- 0:02:36
Average standard deviation of split frequencies: 0.004199
281000 -- (-2750.579) (-2751.926) [-2745.279] (-2749.347) * (-2748.389) [-2745.416] (-2750.386) (-2750.302) -- 0:02:36
282000 -- (-2748.614) (-2751.041) [-2746.556] (-2747.811) * (-2751.223) [-2745.760] (-2749.626) (-2748.124) -- 0:02:37
283000 -- (-2754.844) [-2752.058] (-2750.154) (-2753.311) * (-2748.296) (-2751.667) [-2746.940] (-2749.803) -- 0:02:37
284000 -- [-2749.066] (-2756.073) (-2749.647) (-2751.902) * (-2755.644) [-2751.330] (-2749.634) (-2747.470) -- 0:02:36
285000 -- (-2753.327) (-2751.194) (-2751.623) [-2754.678] * (-2754.330) (-2755.954) [-2748.502] (-2743.632) -- 0:02:35
Average standard deviation of split frequencies: 0.010714
286000 -- [-2748.620] (-2747.474) (-2748.270) (-2757.389) * (-2756.483) [-2745.266] (-2753.067) (-2749.961) -- 0:02:37
287000 -- [-2753.101] (-2749.915) (-2748.920) (-2747.129) * [-2751.366] (-2743.641) (-2745.666) (-2746.467) -- 0:02:36
288000 -- (-2750.031) (-2747.017) [-2748.664] (-2747.097) * (-2754.311) (-2751.087) (-2755.191) [-2751.566] -- 0:02:35
289000 -- (-2751.305) [-2746.282] (-2748.307) (-2748.876) * (-2757.373) [-2747.837] (-2752.970) (-2749.258) -- 0:02:34
290000 -- (-2752.475) (-2747.976) [-2746.193] (-2745.951) * (-2754.014) [-2749.681] (-2754.111) (-2748.579) -- 0:02:34
Average standard deviation of split frequencies: 0.010542
291000 -- (-2753.133) (-2746.750) (-2745.699) [-2749.509] * (-2746.273) [-2746.708] (-2755.106) (-2748.115) -- 0:02:35
292000 -- (-2753.114) [-2751.597] (-2749.994) (-2748.525) * [-2748.995] (-2746.281) (-2751.170) (-2749.163) -- 0:02:35
293000 -- (-2745.008) (-2752.002) (-2746.305) [-2747.982] * (-2743.668) (-2750.483) (-2747.724) [-2753.113] -- 0:02:34
294000 -- (-2750.525) (-2754.295) (-2749.845) [-2744.528] * (-2750.001) [-2747.891] (-2754.678) (-2751.434) -- 0:02:33
295000 -- (-2753.258) (-2753.598) (-2751.031) [-2750.988] * [-2745.757] (-2755.898) (-2753.532) (-2746.457) -- 0:02:35
Average standard deviation of split frequencies: 0.009555
296000 -- [-2751.569] (-2752.329) (-2745.697) (-2750.050) * [-2745.498] (-2751.084) (-2752.531) (-2748.069) -- 0:02:34
297000 -- (-2759.150) (-2746.437) (-2753.881) [-2747.828] * (-2749.875) (-2746.953) (-2744.978) [-2749.474] -- 0:02:33
298000 -- (-2755.566) (-2751.596) [-2748.717] (-2751.009) * (-2747.767) (-2748.872) (-2742.836) [-2747.536] -- 0:02:33
299000 -- (-2752.869) [-2746.733] (-2756.595) (-2751.339) * [-2753.140] (-2747.417) (-2746.538) (-2744.889) -- 0:02:32
300000 -- (-2751.352) (-2748.432) [-2751.016] (-2750.763) * (-2749.351) (-2760.813) [-2747.982] (-2748.635) -- 0:02:34
Average standard deviation of split frequencies: 0.014895
301000 -- [-2747.768] (-2748.058) (-2754.760) (-2749.169) * (-2750.810) (-2754.251) [-2751.846] (-2750.583) -- 0:02:33
302000 -- (-2744.600) (-2753.262) (-2752.990) [-2745.982] * (-2756.379) [-2747.928] (-2747.914) (-2751.731) -- 0:02:32
303000 -- (-2749.088) (-2754.625) (-2756.640) [-2745.767] * (-2750.427) (-2751.965) (-2743.608) [-2758.818] -- 0:02:31
304000 -- (-2753.413) (-2750.262) [-2748.049] (-2749.726) * [-2746.927] (-2752.837) (-2746.948) (-2755.349) -- 0:02:33
305000 -- (-2749.550) (-2755.984) (-2752.863) [-2746.635] * (-2749.439) (-2751.238) [-2752.780] (-2752.032) -- 0:02:32
Average standard deviation of split frequencies: 0.014635
306000 -- (-2760.942) (-2749.271) (-2748.656) [-2749.683] * [-2743.086] (-2749.473) (-2749.287) (-2749.587) -- 0:02:31
307000 -- (-2748.229) [-2748.331] (-2754.425) (-2752.165) * (-2749.124) [-2745.197] (-2750.274) (-2751.267) -- 0:02:31
308000 -- [-2748.977] (-2752.042) (-2751.509) (-2754.083) * [-2751.031] (-2747.084) (-2752.654) (-2757.174) -- 0:02:30
309000 -- (-2746.086) (-2748.524) [-2755.778] (-2748.022) * [-2747.288] (-2749.307) (-2749.059) (-2758.281) -- 0:02:32
310000 -- (-2751.170) [-2748.793] (-2753.314) (-2749.630) * (-2748.824) [-2743.746] (-2750.979) (-2750.794) -- 0:02:31
Average standard deviation of split frequencies: 0.008346
311000 -- (-2751.519) (-2750.530) (-2748.775) [-2749.100] * (-2749.219) (-2746.165) (-2750.555) [-2744.759] -- 0:02:30
312000 -- (-2753.187) (-2749.157) (-2747.159) [-2753.751] * (-2748.412) [-2745.908] (-2750.771) (-2750.155) -- 0:02:29
313000 -- [-2749.547] (-2748.475) (-2751.841) (-2748.504) * (-2756.785) (-2746.099) (-2744.163) [-2744.243] -- 0:02:31
314000 -- (-2749.997) (-2750.857) [-2747.882] (-2745.159) * (-2753.944) [-2749.339] (-2749.603) (-2753.629) -- 0:02:30
315000 -- [-2752.460] (-2755.112) (-2749.916) (-2754.548) * (-2760.829) [-2747.301] (-2745.835) (-2755.472) -- 0:02:30
Average standard deviation of split frequencies: 0.010443
316000 -- (-2752.970) [-2747.453] (-2746.868) (-2753.423) * (-2748.282) (-2752.031) (-2749.940) [-2745.262] -- 0:02:29
317000 -- (-2751.541) [-2748.325] (-2749.602) (-2756.092) * (-2750.501) [-2752.794] (-2751.059) (-2749.212) -- 0:02:28
318000 -- [-2750.978] (-2754.477) (-2747.225) (-2758.801) * (-2752.945) (-2754.511) [-2751.064] (-2752.464) -- 0:02:30
319000 -- (-2746.553) (-2753.189) (-2747.949) [-2745.432] * (-2751.542) (-2749.543) (-2747.009) [-2751.352] -- 0:02:29
320000 -- (-2748.237) (-2748.333) [-2745.064] (-2749.426) * [-2751.993] (-2747.747) (-2743.261) (-2752.178) -- 0:02:28
Average standard deviation of split frequencies: 0.013966
321000 -- [-2746.378] (-2749.906) (-2745.271) (-2756.717) * (-2751.571) (-2747.046) [-2746.128] (-2754.311) -- 0:02:28
322000 -- (-2747.508) (-2745.662) (-2751.913) [-2745.764] * (-2749.499) (-2746.779) [-2745.219] (-2746.370) -- 0:02:29
323000 -- (-2752.696) (-2746.617) [-2748.103] (-2745.676) * [-2746.645] (-2746.613) (-2751.022) (-2747.454) -- 0:02:28
324000 -- (-2753.357) (-2744.375) [-2753.293] (-2754.372) * (-2746.343) (-2744.924) (-2746.096) [-2753.059] -- 0:02:28
325000 -- (-2748.793) (-2743.271) (-2748.886) [-2748.527] * [-2744.791] (-2755.059) (-2751.020) (-2756.540) -- 0:02:27
Average standard deviation of split frequencies: 0.010845
326000 -- (-2744.183) [-2747.067] (-2751.699) (-2749.337) * [-2744.007] (-2753.883) (-2752.698) (-2747.729) -- 0:02:26
327000 -- (-2749.974) (-2748.659) (-2751.250) [-2748.621] * (-2749.896) (-2749.032) (-2746.937) [-2752.042] -- 0:02:28
328000 -- (-2746.316) [-2747.110] (-2752.677) (-2758.543) * (-2746.329) [-2751.788] (-2749.937) (-2747.865) -- 0:02:27
329000 -- (-2754.285) (-2746.285) (-2747.178) [-2750.761] * (-2745.395) (-2752.702) (-2749.030) [-2745.122] -- 0:02:26
330000 -- (-2756.943) (-2748.852) (-2751.840) [-2751.891] * (-2744.967) [-2749.848] (-2749.993) (-2754.881) -- 0:02:26
Average standard deviation of split frequencies: 0.014969
331000 -- (-2747.472) (-2754.003) [-2752.184] (-2751.822) * (-2746.206) (-2746.879) (-2746.627) [-2746.330] -- 0:02:27
332000 -- (-2755.891) (-2747.323) [-2750.684] (-2753.627) * (-2749.265) (-2755.658) [-2744.581] (-2748.060) -- 0:02:26
333000 -- (-2750.439) (-2751.205) [-2750.857] (-2747.867) * (-2745.955) (-2752.479) (-2745.000) [-2750.864] -- 0:02:26
334000 -- (-2752.782) (-2758.725) [-2750.286] (-2750.142) * (-2741.673) (-2752.755) (-2747.939) [-2753.487] -- 0:02:25
335000 -- [-2753.770] (-2750.579) (-2757.618) (-2752.956) * (-2750.524) (-2750.287) (-2751.748) [-2746.857] -- 0:02:24
Average standard deviation of split frequencies: 0.016836
336000 -- (-2749.583) (-2757.438) [-2747.137] (-2748.493) * (-2745.551) (-2750.961) [-2746.862] (-2748.998) -- 0:02:26
337000 -- (-2752.476) (-2758.138) [-2744.744] (-2746.283) * (-2749.160) (-2748.836) (-2753.787) [-2750.176] -- 0:02:25
338000 -- [-2745.087] (-2753.448) (-2746.698) (-2743.316) * (-2752.465) (-2752.796) [-2750.846] (-2755.997) -- 0:02:24
339000 -- (-2749.947) (-2756.895) [-2745.086] (-2762.812) * (-2750.045) [-2751.109] (-2745.615) (-2750.848) -- 0:02:24
340000 -- (-2756.005) (-2750.376) [-2748.876] (-2751.682) * (-2758.609) [-2750.159] (-2751.580) (-2749.888) -- 0:02:23
Average standard deviation of split frequencies: 0.020065
341000 -- (-2755.344) [-2748.151] (-2751.455) (-2747.797) * [-2750.369] (-2745.703) (-2748.859) (-2758.390) -- 0:02:24
342000 -- [-2751.155] (-2751.903) (-2757.027) (-2755.528) * (-2749.667) [-2749.848] (-2747.793) (-2756.139) -- 0:02:24
343000 -- [-2744.882] (-2751.434) (-2756.281) (-2753.674) * [-2748.139] (-2748.818) (-2744.713) (-2748.639) -- 0:02:23
344000 -- (-2752.335) (-2755.772) (-2746.163) [-2750.749] * [-2747.249] (-2749.944) (-2759.044) (-2744.065) -- 0:02:23
345000 -- (-2746.714) (-2746.418) (-2745.822) [-2750.069] * (-2746.337) (-2753.488) [-2753.430] (-2751.564) -- 0:02:24
Average standard deviation of split frequencies: 0.016349
346000 -- [-2750.464] (-2753.734) (-2751.019) (-2748.261) * (-2750.273) (-2751.337) (-2759.668) [-2747.421] -- 0:02:23
347000 -- [-2750.434] (-2752.589) (-2747.807) (-2746.601) * (-2747.194) (-2759.744) [-2748.075] (-2749.535) -- 0:02:23
348000 -- (-2748.856) (-2747.861) (-2749.880) [-2749.974] * (-2751.968) [-2747.382] (-2749.334) (-2744.740) -- 0:02:22
349000 -- (-2747.288) (-2752.740) [-2745.747] (-2750.079) * (-2745.696) (-2751.108) (-2751.626) [-2752.523] -- 0:02:23
350000 -- [-2745.655] (-2753.155) (-2749.000) (-2751.134) * [-2743.997] (-2751.178) (-2746.396) (-2753.750) -- 0:02:23
Average standard deviation of split frequencies: 0.014787
351000 -- [-2755.006] (-2751.834) (-2749.387) (-2754.119) * (-2749.403) (-2748.695) [-2751.193] (-2753.265) -- 0:02:22
352000 -- (-2750.394) [-2750.842] (-2750.551) (-2748.163) * (-2747.125) (-2754.534) [-2760.715] (-2749.012) -- 0:02:21
353000 -- (-2748.251) (-2750.981) [-2746.519] (-2746.081) * (-2747.778) [-2753.587] (-2743.403) (-2750.196) -- 0:02:21
354000 -- (-2761.839) (-2753.876) (-2748.280) [-2751.208] * (-2749.641) (-2748.818) (-2748.367) [-2744.649] -- 0:02:22
355000 -- (-2747.200) (-2756.743) [-2751.043] (-2748.502) * [-2754.446] (-2747.140) (-2746.688) (-2752.232) -- 0:02:21
Average standard deviation of split frequencies: 0.012580
356000 -- (-2748.420) [-2756.027] (-2747.741) (-2748.635) * (-2751.088) (-2749.248) [-2749.865] (-2751.071) -- 0:02:21
357000 -- (-2748.937) (-2750.609) (-2750.045) [-2750.811] * (-2757.435) (-2752.923) [-2747.575] (-2746.959) -- 0:02:20
358000 -- (-2753.924) (-2745.709) (-2749.218) [-2745.407] * (-2753.211) (-2747.363) [-2744.986] (-2753.240) -- 0:02:19
359000 -- [-2746.216] (-2749.828) (-2745.656) (-2744.520) * (-2752.301) [-2747.754] (-2750.046) (-2747.825) -- 0:02:21
360000 -- (-2745.541) (-2748.366) [-2746.604] (-2751.342) * (-2747.075) (-2745.784) (-2760.013) [-2752.001] -- 0:02:20
Average standard deviation of split frequencies: 0.009803
361000 -- (-2749.515) (-2746.038) (-2749.959) [-2746.447] * (-2749.831) (-2747.313) (-2746.733) [-2746.611] -- 0:02:19
362000 -- (-2746.240) (-2747.457) [-2748.351] (-2745.594) * (-2749.857) (-2748.844) (-2751.436) [-2746.193] -- 0:02:19
363000 -- (-2749.143) [-2745.541] (-2747.503) (-2748.292) * (-2748.456) [-2751.730] (-2745.980) (-2750.735) -- 0:02:20
364000 -- (-2753.212) [-2749.816] (-2753.210) (-2754.215) * [-2749.142] (-2750.319) (-2752.281) (-2744.256) -- 0:02:19
365000 -- [-2750.960] (-2750.993) (-2748.683) (-2752.756) * [-2747.039] (-2742.676) (-2752.025) (-2750.994) -- 0:02:19
Average standard deviation of split frequencies: 0.009660
366000 -- [-2747.266] (-2750.367) (-2755.127) (-2752.322) * (-2747.362) (-2753.608) [-2745.015] (-2745.837) -- 0:02:18
367000 -- (-2751.854) (-2754.447) [-2750.843] (-2752.912) * [-2745.538] (-2748.599) (-2751.841) (-2749.304) -- 0:02:17
368000 -- [-2750.732] (-2747.904) (-2752.735) (-2754.132) * (-2751.385) (-2751.496) [-2753.295] (-2755.160) -- 0:02:19
369000 -- [-2749.670] (-2757.511) (-2747.744) (-2750.960) * [-2748.347] (-2751.929) (-2750.518) (-2752.861) -- 0:02:18
370000 -- [-2746.280] (-2747.131) (-2749.700) (-2753.506) * (-2749.448) [-2748.284] (-2749.597) (-2755.073) -- 0:02:17
Average standard deviation of split frequencies: 0.009538
371000 -- [-2744.374] (-2746.969) (-2748.055) (-2750.159) * (-2750.921) (-2752.945) [-2750.039] (-2749.980) -- 0:02:17
372000 -- (-2750.327) (-2748.401) (-2750.642) [-2745.433] * (-2753.919) [-2746.692] (-2750.335) (-2750.566) -- 0:02:18
373000 -- (-2764.576) [-2749.073] (-2747.065) (-2745.500) * (-2746.325) [-2747.852] (-2745.365) (-2758.640) -- 0:02:17
374000 -- (-2747.742) (-2751.740) (-2744.617) [-2755.384] * (-2753.340) (-2748.223) [-2748.485] (-2751.661) -- 0:02:17
375000 -- (-2753.577) (-2753.620) [-2746.238] (-2748.509) * (-2744.350) [-2749.226] (-2745.625) (-2756.254) -- 0:02:16
Average standard deviation of split frequencies: 0.015672
376000 -- (-2746.970) (-2753.067) [-2745.283] (-2758.159) * [-2746.117] (-2749.097) (-2754.361) (-2756.241) -- 0:02:16
377000 -- (-2754.694) (-2751.187) [-2750.405] (-2751.795) * (-2748.512) (-2747.870) [-2748.447] (-2752.011) -- 0:02:17
378000 -- (-2755.791) (-2750.692) (-2754.878) [-2751.983] * (-2750.545) (-2755.277) [-2752.534] (-2752.510) -- 0:02:16
379000 -- (-2753.674) (-2747.401) [-2747.153] (-2749.896) * [-2748.980] (-2751.245) (-2748.939) (-2750.765) -- 0:02:15
380000 -- (-2753.316) (-2747.844) (-2750.425) [-2751.270] * (-2754.994) [-2756.715] (-2753.129) (-2751.602) -- 0:02:15
Average standard deviation of split frequencies: 0.008049
381000 -- (-2754.690) [-2747.161] (-2749.985) (-2753.250) * (-2749.852) (-2751.040) [-2750.495] (-2753.025) -- 0:02:16
382000 -- (-2751.892) (-2746.607) (-2750.254) [-2744.854] * (-2755.830) [-2747.146] (-2753.916) (-2752.067) -- 0:02:15
383000 -- (-2754.108) (-2752.987) [-2748.055] (-2748.648) * (-2753.825) [-2749.530] (-2747.616) (-2753.358) -- 0:02:15
384000 -- (-2750.743) (-2748.581) [-2752.428] (-2744.743) * (-2755.698) (-2749.340) [-2748.933] (-2744.670) -- 0:02:14
385000 -- [-2748.501] (-2751.461) (-2755.850) (-2751.119) * (-2753.870) (-2753.081) (-2747.370) [-2749.489] -- 0:02:14
Average standard deviation of split frequencies: 0.004885
386000 -- [-2746.024] (-2757.086) (-2748.418) (-2753.466) * [-2754.495] (-2758.206) (-2752.437) (-2748.009) -- 0:02:15
387000 -- [-2749.517] (-2753.065) (-2750.067) (-2750.528) * (-2750.763) (-2751.560) (-2748.757) [-2745.227] -- 0:02:14
388000 -- (-2750.058) (-2753.115) [-2754.104] (-2745.897) * (-2745.617) [-2748.748] (-2747.874) (-2748.126) -- 0:02:14
389000 -- (-2761.196) (-2747.022) (-2754.190) [-2748.576] * [-2750.809] (-2752.384) (-2748.945) (-2754.706) -- 0:02:13
390000 -- (-2748.597) (-2747.341) [-2748.094] (-2748.262) * (-2752.282) [-2750.061] (-2748.248) (-2753.833) -- 0:02:14
Average standard deviation of split frequencies: 0.007843
391000 -- (-2744.323) (-2746.908) (-2751.821) [-2746.001] * [-2749.373] (-2752.992) (-2753.502) (-2756.376) -- 0:02:13
392000 -- [-2746.861] (-2751.395) (-2756.596) (-2746.609) * (-2750.423) (-2755.127) [-2744.812] (-2752.560) -- 0:02:13
393000 -- (-2754.403) (-2751.499) (-2750.435) [-2744.357] * (-2754.676) [-2749.219] (-2755.133) (-2751.032) -- 0:02:12
394000 -- [-2748.310] (-2756.152) (-2752.308) (-2750.310) * [-2757.620] (-2750.262) (-2755.712) (-2752.262) -- 0:02:12
395000 -- (-2747.490) [-2757.087] (-2746.538) (-2746.626) * [-2748.998] (-2752.432) (-2749.447) (-2748.021) -- 0:02:13
Average standard deviation of split frequencies: 0.006547
396000 -- (-2746.843) [-2745.387] (-2747.379) (-2749.816) * (-2742.670) (-2754.709) (-2752.113) [-2747.856] -- 0:02:12
397000 -- (-2745.417) (-2753.468) [-2748.754] (-2753.389) * (-2746.759) (-2751.416) (-2750.895) [-2747.014] -- 0:02:12
398000 -- (-2746.718) (-2753.696) [-2757.338] (-2751.416) * [-2750.295] (-2743.824) (-2750.792) (-2745.867) -- 0:02:11
399000 -- (-2745.528) (-2760.117) (-2753.203) [-2750.425] * (-2750.718) (-2749.450) (-2749.688) [-2753.542] -- 0:02:11
400000 -- [-2751.436] (-2746.625) (-2753.331) (-2751.831) * (-2745.842) (-2750.288) (-2748.625) [-2747.688] -- 0:02:12
Average standard deviation of split frequencies: 0.010001
401000 -- (-2747.947) (-2752.972) [-2757.584] (-2745.206) * (-2749.830) (-2749.623) [-2755.323] (-2755.893) -- 0:02:11
402000 -- (-2747.946) [-2750.213] (-2756.359) (-2749.040) * (-2751.005) [-2750.791] (-2754.840) (-2748.084) -- 0:02:10
403000 -- (-2750.365) (-2748.411) [-2748.220] (-2757.684) * (-2745.847) (-2759.381) [-2761.293] (-2755.353) -- 0:02:10
404000 -- [-2744.618] (-2753.533) (-2751.792) (-2752.758) * [-2758.145] (-2754.363) (-2752.412) (-2755.226) -- 0:02:11
405000 -- (-2749.582) (-2764.559) (-2749.561) [-2749.006] * (-2757.863) (-2761.065) [-2745.261] (-2750.701) -- 0:02:10
Average standard deviation of split frequencies: 0.008708
406000 -- (-2748.760) [-2750.735] (-2748.157) (-2744.172) * (-2755.478) (-2750.798) (-2749.857) [-2750.621] -- 0:02:10
407000 -- (-2750.224) [-2745.291] (-2747.583) (-2752.683) * (-2759.252) (-2747.285) (-2746.216) [-2753.464] -- 0:02:09
408000 -- (-2754.435) [-2746.031] (-2747.048) (-2748.943) * (-2748.255) (-2754.818) [-2744.949] (-2746.485) -- 0:02:09
409000 -- (-2750.997) (-2748.860) (-2754.329) [-2752.058] * (-2750.583) (-2750.262) (-2749.153) [-2749.423] -- 0:02:10
410000 -- (-2763.081) (-2750.550) (-2747.521) [-2747.222] * [-2747.976] (-2746.743) (-2757.176) (-2753.711) -- 0:02:09
Average standard deviation of split frequencies: 0.006313
411000 -- [-2746.745] (-2745.638) (-2746.587) (-2751.816) * [-2750.292] (-2751.190) (-2754.325) (-2750.681) -- 0:02:08
412000 -- (-2749.059) (-2747.369) [-2754.254] (-2752.043) * (-2745.523) (-2752.979) [-2745.638] (-2744.479) -- 0:02:08
413000 -- (-2749.221) (-2754.706) [-2746.414] (-2749.192) * (-2747.287) (-2753.911) [-2750.049] (-2746.440) -- 0:02:09
414000 -- (-2750.325) (-2749.860) [-2749.718] (-2746.601) * (-2748.656) [-2750.775] (-2752.955) (-2746.880) -- 0:02:08
415000 -- (-2748.060) [-2745.713] (-2747.204) (-2752.013) * [-2750.766] (-2745.831) (-2747.240) (-2746.432) -- 0:02:08
Average standard deviation of split frequencies: 0.005099
416000 -- (-2749.181) [-2746.702] (-2750.374) (-2749.624) * (-2747.877) [-2747.660] (-2746.457) (-2746.828) -- 0:02:07
417000 -- (-2751.213) (-2745.347) (-2753.251) [-2755.552] * (-2748.379) [-2748.653] (-2743.580) (-2745.353) -- 0:02:07
418000 -- (-2749.043) [-2746.663] (-2747.648) (-2752.625) * (-2750.210) [-2745.168] (-2745.942) (-2745.851) -- 0:02:08
419000 -- [-2746.657] (-2756.448) (-2752.243) (-2755.720) * [-2748.069] (-2748.566) (-2749.705) (-2745.403) -- 0:02:07
420000 -- [-2745.768] (-2752.010) (-2746.146) (-2752.059) * (-2751.001) (-2747.709) [-2749.251] (-2750.109) -- 0:02:07
Average standard deviation of split frequencies: 0.001681
421000 -- (-2750.237) (-2745.952) [-2745.943] (-2745.716) * (-2757.628) [-2747.314] (-2746.571) (-2751.002) -- 0:02:06
422000 -- (-2750.934) (-2747.733) [-2749.284] (-2749.460) * (-2751.742) [-2746.508] (-2750.294) (-2751.099) -- 0:02:07
423000 -- (-2764.344) (-2756.182) (-2748.380) [-2748.926] * [-2752.908] (-2746.050) (-2746.638) (-2754.285) -- 0:02:06
424000 -- [-2745.026] (-2748.317) (-2749.525) (-2748.368) * [-2747.179] (-2748.457) (-2748.399) (-2750.788) -- 0:02:06
425000 -- [-2750.140] (-2744.421) (-2752.139) (-2751.866) * (-2752.147) (-2749.428) [-2747.688] (-2751.849) -- 0:02:05
Average standard deviation of split frequencies: 0.003320
426000 -- (-2753.554) (-2753.006) (-2746.623) [-2751.438] * (-2755.096) (-2754.507) (-2748.536) [-2753.693] -- 0:02:05
427000 -- (-2747.801) (-2746.584) [-2745.389] (-2756.471) * (-2751.061) [-2756.561] (-2752.361) (-2759.251) -- 0:02:06
428000 -- [-2751.221] (-2752.990) (-2749.062) (-2751.944) * (-2752.316) [-2747.997] (-2752.090) (-2749.963) -- 0:02:05
429000 -- (-2746.785) (-2746.937) (-2748.707) [-2749.337] * (-2750.445) (-2748.076) [-2751.177] (-2750.796) -- 0:02:05
430000 -- [-2754.484] (-2752.380) (-2749.998) (-2749.675) * (-2746.300) (-2747.724) [-2748.901] (-2763.711) -- 0:02:04
Average standard deviation of split frequencies: 0.001095
431000 -- (-2752.540) [-2750.334] (-2752.117) (-2743.170) * (-2745.845) [-2748.892] (-2757.943) (-2756.001) -- 0:02:05
432000 -- (-2749.590) (-2751.439) [-2748.710] (-2748.175) * (-2749.042) [-2747.587] (-2752.446) (-2757.135) -- 0:02:04
433000 -- (-2755.177) [-2748.234] (-2747.589) (-2753.518) * (-2752.264) (-2749.783) [-2745.400] (-2755.232) -- 0:02:04
434000 -- [-2747.845] (-2750.334) (-2750.816) (-2758.309) * (-2753.681) [-2746.898] (-2754.630) (-2750.495) -- 0:02:03
435000 -- [-2744.885] (-2748.052) (-2752.804) (-2751.490) * (-2759.495) (-2747.622) (-2748.889) [-2753.339] -- 0:02:03
Average standard deviation of split frequencies: 0.001081
436000 -- [-2747.199] (-2749.088) (-2752.853) (-2752.761) * (-2748.973) [-2752.598] (-2745.192) (-2758.839) -- 0:02:04
437000 -- (-2750.633) (-2751.532) [-2747.648] (-2750.029) * (-2752.763) [-2745.588] (-2750.229) (-2753.304) -- 0:02:03
438000 -- (-2745.040) (-2760.498) (-2748.614) [-2742.060] * (-2750.969) (-2744.981) (-2748.562) [-2749.680] -- 0:02:03
439000 -- (-2750.757) (-2747.488) [-2744.116] (-2753.637) * [-2749.126] (-2748.657) (-2747.177) (-2758.021) -- 0:02:02
440000 -- (-2752.535) [-2744.772] (-2757.734) (-2752.764) * (-2754.492) (-2752.081) (-2748.300) [-2746.066] -- 0:02:03
Average standard deviation of split frequencies: 0.001605
441000 -- (-2747.475) (-2747.140) [-2749.608] (-2747.866) * (-2752.984) (-2747.992) (-2754.119) [-2746.362] -- 0:02:02
442000 -- (-2752.921) (-2745.153) [-2749.559] (-2750.700) * (-2754.774) [-2746.633] (-2747.437) (-2751.456) -- 0:02:02
443000 -- (-2749.793) (-2749.111) [-2751.670] (-2752.499) * (-2754.192) (-2749.535) (-2752.464) [-2747.138] -- 0:02:01
444000 -- (-2749.366) (-2749.161) [-2747.860] (-2749.230) * (-2757.533) [-2748.760] (-2748.520) (-2752.581) -- 0:02:01
445000 -- (-2747.739) (-2754.040) (-2751.106) [-2745.084] * (-2750.968) (-2750.237) [-2757.417] (-2751.866) -- 0:02:02
Average standard deviation of split frequencies: 0.003171
446000 -- [-2747.256] (-2749.998) (-2748.736) (-2754.163) * (-2756.910) (-2750.474) (-2751.802) [-2753.055] -- 0:02:01
447000 -- (-2762.904) (-2745.026) (-2750.033) [-2749.460] * (-2754.763) [-2747.853] (-2751.982) (-2751.360) -- 0:02:01
448000 -- (-2746.910) (-2748.236) [-2749.237] (-2751.433) * (-2744.902) (-2749.692) (-2743.833) [-2748.398] -- 0:02:00
449000 -- (-2751.019) [-2751.871] (-2748.303) (-2752.107) * (-2748.950) (-2751.559) [-2747.086] (-2757.670) -- 0:02:01
450000 -- (-2749.538) (-2754.488) [-2750.720] (-2750.200) * [-2747.563] (-2746.324) (-2758.770) (-2745.854) -- 0:02:01
Average standard deviation of split frequencies: 0.001046
451000 -- (-2754.039) [-2747.011] (-2749.345) (-2748.277) * (-2752.094) (-2751.539) (-2752.391) [-2752.926] -- 0:02:00
452000 -- (-2749.018) [-2751.288] (-2749.790) (-2749.848) * (-2746.321) [-2752.673] (-2749.090) (-2750.173) -- 0:02:00
453000 -- (-2747.515) [-2746.753] (-2746.629) (-2750.106) * [-2749.316] (-2755.656) (-2748.972) (-2748.009) -- 0:01:59
454000 -- (-2745.261) (-2748.602) [-2748.699] (-2753.766) * (-2747.850) (-2750.451) [-2747.617] (-2750.905) -- 0:02:00
455000 -- (-2749.693) (-2747.123) [-2752.112] (-2745.507) * (-2750.936) [-2748.516] (-2754.657) (-2743.452) -- 0:01:59
Average standard deviation of split frequencies: 0.002068
456000 -- (-2745.226) [-2750.820] (-2751.312) (-2750.553) * (-2744.655) (-2749.141) [-2753.278] (-2751.746) -- 0:01:59
457000 -- (-2746.242) (-2749.943) (-2752.978) [-2754.532] * (-2751.131) [-2753.962] (-2749.884) (-2751.591) -- 0:01:58
458000 -- (-2752.037) (-2747.164) [-2747.566] (-2750.239) * (-2752.767) (-2755.050) [-2746.653] (-2744.924) -- 0:01:58
459000 -- (-2755.405) (-2745.175) (-2749.736) [-2745.483] * (-2748.215) (-2747.654) [-2752.490] (-2750.209) -- 0:01:59
460000 -- (-2755.310) [-2747.090] (-2745.047) (-2754.355) * (-2757.179) (-2750.464) (-2751.317) [-2751.129] -- 0:01:58
Average standard deviation of split frequencies: 0.002558
461000 -- (-2747.453) (-2746.221) [-2746.799] (-2752.427) * [-2747.839] (-2745.695) (-2757.332) (-2748.025) -- 0:01:58
462000 -- (-2755.134) (-2746.842) [-2747.198] (-2748.043) * (-2752.660) (-2753.694) (-2745.164) [-2748.752] -- 0:01:57
463000 -- [-2751.636] (-2744.955) (-2746.199) (-2757.059) * (-2747.783) (-2751.683) (-2756.831) [-2747.786] -- 0:01:58
464000 -- (-2748.043) (-2748.360) [-2750.433] (-2754.073) * (-2751.662) [-2749.574] (-2752.116) (-2753.927) -- 0:01:57
465000 -- (-2749.919) (-2746.124) [-2747.210] (-2750.373) * (-2756.014) [-2752.008] (-2752.324) (-2748.413) -- 0:01:57
Average standard deviation of split frequencies: 0.000506
466000 -- (-2750.606) (-2748.148) (-2755.031) [-2749.531] * (-2746.980) [-2747.467] (-2746.864) (-2750.304) -- 0:01:56
467000 -- (-2751.152) (-2748.569) (-2748.634) [-2752.758] * [-2753.363] (-2748.345) (-2748.083) (-2753.590) -- 0:01:56
468000 -- (-2744.820) (-2750.616) [-2745.311] (-2756.263) * [-2747.113] (-2750.301) (-2745.816) (-2756.183) -- 0:01:57
469000 -- (-2751.956) (-2749.583) [-2746.400] (-2755.590) * (-2751.811) [-2746.192] (-2754.974) (-2749.682) -- 0:01:56
470000 -- (-2752.395) [-2745.742] (-2750.978) (-2748.405) * (-2746.518) (-2747.892) (-2750.836) [-2750.625] -- 0:01:56
Average standard deviation of split frequencies: 0.005509
471000 -- [-2747.566] (-2745.966) (-2748.088) (-2748.040) * (-2752.279) [-2744.864] (-2755.089) (-2757.127) -- 0:01:55
472000 -- [-2747.858] (-2747.050) (-2751.612) (-2747.728) * (-2757.023) (-2749.866) [-2750.631] (-2746.198) -- 0:01:56
473000 -- [-2747.725] (-2747.377) (-2750.941) (-2750.056) * (-2748.868) (-2745.969) (-2746.180) [-2753.187] -- 0:01:55
474000 -- (-2754.541) (-2756.450) (-2749.432) [-2752.820] * (-2757.104) (-2742.715) [-2748.006] (-2753.868) -- 0:01:55
475000 -- (-2755.553) [-2746.865] (-2750.569) (-2747.681) * (-2754.176) [-2746.938] (-2753.125) (-2753.915) -- 0:01:54
Average standard deviation of split frequencies: 0.004457
476000 -- (-2749.354) [-2746.150] (-2747.027) (-2753.081) * (-2749.828) [-2746.371] (-2746.496) (-2750.159) -- 0:01:54
477000 -- (-2751.352) [-2747.004] (-2745.850) (-2748.809) * (-2758.960) (-2746.286) [-2750.654] (-2757.305) -- 0:01:55
478000 -- [-2745.544] (-2751.787) (-2754.765) (-2749.849) * (-2748.509) [-2752.499] (-2748.094) (-2757.747) -- 0:01:54
479000 -- (-2760.422) (-2748.498) (-2753.207) [-2747.707] * (-2753.347) (-2747.767) (-2748.354) [-2747.964] -- 0:01:54
480000 -- (-2751.741) (-2747.989) [-2748.819] (-2752.506) * (-2753.654) [-2748.288] (-2749.547) (-2746.089) -- 0:01:53
Average standard deviation of split frequencies: 0.003923
481000 -- (-2751.656) [-2748.469] (-2763.858) (-2746.894) * (-2760.665) (-2756.342) (-2752.543) [-2745.944] -- 0:01:54
482000 -- [-2750.148] (-2748.903) (-2749.992) (-2749.558) * (-2752.314) [-2750.558] (-2754.169) (-2750.003) -- 0:01:53
483000 -- [-2748.500] (-2753.471) (-2752.727) (-2745.431) * [-2745.281] (-2753.899) (-2746.787) (-2748.742) -- 0:01:53
484000 -- [-2748.973] (-2760.908) (-2752.398) (-2752.461) * (-2748.864) [-2747.741] (-2754.056) (-2747.623) -- 0:01:53
485000 -- [-2747.715] (-2762.105) (-2753.288) (-2746.565) * (-2749.041) (-2746.634) [-2752.320] (-2746.341) -- 0:01:52
Average standard deviation of split frequencies: 0.001455
486000 -- [-2748.128] (-2755.424) (-2750.807) (-2748.558) * (-2752.127) [-2744.216] (-2758.738) (-2749.182) -- 0:01:53
487000 -- [-2751.558] (-2749.395) (-2753.057) (-2750.965) * [-2752.218] (-2750.497) (-2757.261) (-2752.909) -- 0:01:52
488000 -- (-2748.896) (-2749.370) [-2754.411] (-2752.021) * (-2750.101) (-2756.378) (-2753.353) [-2748.719] -- 0:01:52
489000 -- (-2748.994) (-2748.855) (-2752.159) [-2752.060] * (-2750.533) (-2749.050) [-2749.371] (-2748.463) -- 0:01:51
490000 -- (-2754.387) (-2751.190) [-2750.708] (-2749.105) * [-2751.344] (-2745.538) (-2758.150) (-2746.136) -- 0:01:52
Average standard deviation of split frequencies: 0.001921
491000 -- (-2750.644) [-2747.869] (-2748.200) (-2749.832) * (-2752.649) (-2754.528) (-2750.217) [-2752.261] -- 0:01:51
492000 -- [-2748.032] (-2753.201) (-2744.429) (-2751.255) * (-2749.633) (-2744.004) (-2756.148) [-2750.414] -- 0:01:51
493000 -- (-2755.311) (-2755.742) (-2745.583) [-2754.151] * (-2747.662) (-2749.441) [-2753.885] (-2749.575) -- 0:01:51
494000 -- [-2748.149] (-2758.597) (-2747.272) (-2761.977) * [-2748.696] (-2750.735) (-2759.999) (-2749.874) -- 0:01:50
495000 -- (-2754.411) (-2749.006) [-2744.905] (-2747.024) * (-2748.840) (-2748.327) [-2748.187] (-2754.368) -- 0:01:51
Average standard deviation of split frequencies: 0.002376
496000 -- (-2746.425) (-2756.104) [-2745.507] (-2756.224) * (-2751.166) [-2749.258] (-2752.441) (-2754.945) -- 0:01:50
497000 -- [-2745.760] (-2747.801) (-2750.087) (-2749.339) * (-2753.023) (-2755.236) [-2748.772] (-2743.648) -- 0:01:50
498000 -- (-2750.847) (-2749.001) [-2750.567] (-2762.655) * (-2753.630) (-2752.334) (-2752.362) [-2756.832] -- 0:01:49
499000 -- [-2752.315] (-2749.055) (-2745.971) (-2749.108) * (-2744.480) [-2753.022] (-2756.235) (-2746.854) -- 0:01:49
500000 -- (-2747.418) [-2748.249] (-2749.160) (-2747.625) * (-2747.674) [-2744.145] (-2747.752) (-2746.891) -- 0:01:50
Average standard deviation of split frequencies: 0.000942
501000 -- (-2747.025) (-2744.449) (-2748.148) [-2746.716] * [-2748.271] (-2748.445) (-2751.689) (-2748.488) -- 0:01:49
502000 -- (-2748.304) (-2763.352) (-2745.329) [-2747.253] * (-2752.883) (-2745.428) (-2758.326) [-2753.616] -- 0:01:49
503000 -- (-2747.941) [-2754.216] (-2746.717) (-2749.460) * [-2747.999] (-2748.853) (-2748.210) (-2749.431) -- 0:01:48
504000 -- [-2746.244] (-2751.642) (-2751.162) (-2749.853) * [-2750.200] (-2748.911) (-2749.942) (-2750.840) -- 0:01:49
505000 -- (-2756.240) (-2753.444) [-2746.005] (-2750.125) * [-2747.887] (-2746.691) (-2752.923) (-2750.483) -- 0:01:48
Average standard deviation of split frequencies: 0.000932
506000 -- (-2757.604) [-2747.856] (-2745.759) (-2761.183) * (-2749.244) [-2748.071] (-2751.118) (-2749.131) -- 0:01:48
507000 -- [-2748.338] (-2752.549) (-2749.686) (-2754.992) * [-2756.264] (-2749.980) (-2752.060) (-2749.840) -- 0:01:47
508000 -- [-2750.694] (-2746.652) (-2751.756) (-2752.298) * [-2746.012] (-2748.157) (-2751.129) (-2756.371) -- 0:01:47
509000 -- [-2748.078] (-2749.836) (-2745.724) (-2747.200) * (-2751.299) [-2751.192] (-2747.912) (-2750.547) -- 0:01:48
510000 -- [-2746.523] (-2750.826) (-2752.066) (-2752.423) * [-2746.970] (-2751.522) (-2746.472) (-2749.113) -- 0:01:47
Average standard deviation of split frequencies: 0.004154
511000 -- (-2747.471) (-2749.158) (-2756.367) [-2752.848] * (-2750.354) (-2752.609) (-2747.802) [-2756.623] -- 0:01:47
512000 -- (-2748.015) (-2756.079) (-2761.249) [-2752.063] * (-2748.194) [-2754.612] (-2748.897) (-2750.381) -- 0:01:46
513000 -- [-2748.596] (-2748.973) (-2747.830) (-2752.666) * [-2744.853] (-2749.729) (-2753.055) (-2751.911) -- 0:01:47
514000 -- [-2748.261] (-2751.784) (-2745.860) (-2752.282) * (-2748.391) (-2748.877) [-2748.187] (-2747.727) -- 0:01:46
515000 -- [-2745.149] (-2750.159) (-2752.201) (-2744.807) * (-2747.135) (-2751.364) (-2757.198) [-2745.630] -- 0:01:46
Average standard deviation of split frequencies: 0.002741
516000 -- (-2748.468) [-2746.094] (-2747.005) (-2748.830) * (-2749.401) (-2752.980) (-2747.409) [-2748.262] -- 0:01:45
517000 -- (-2748.853) (-2747.239) [-2747.956] (-2757.338) * (-2750.085) (-2751.430) [-2747.955] (-2746.910) -- 0:01:45
518000 -- [-2755.193] (-2752.769) (-2749.776) (-2750.893) * [-2755.552] (-2748.380) (-2752.083) (-2753.064) -- 0:01:46
519000 -- (-2752.432) [-2748.788] (-2755.405) (-2748.542) * (-2750.885) [-2748.301] (-2750.164) (-2749.105) -- 0:01:45
520000 -- [-2751.832] (-2760.894) (-2747.351) (-2749.314) * (-2748.509) (-2749.401) (-2746.633) [-2748.294] -- 0:01:45
Average standard deviation of split frequencies: 0.004527
521000 -- [-2751.419] (-2747.565) (-2748.017) (-2752.727) * (-2759.277) (-2747.595) (-2745.869) [-2747.240] -- 0:01:44
522000 -- (-2752.473) [-2751.815] (-2751.492) (-2756.611) * [-2748.010] (-2751.156) (-2751.306) (-2753.747) -- 0:01:45
523000 -- (-2748.656) (-2750.138) (-2750.148) [-2753.954] * [-2747.554] (-2743.158) (-2752.943) (-2747.778) -- 0:01:44
524000 -- (-2748.876) (-2748.747) [-2753.851] (-2749.344) * (-2752.360) (-2746.348) [-2755.156] (-2749.465) -- 0:01:44
525000 -- (-2749.047) (-2750.966) (-2746.985) [-2752.355] * (-2743.497) (-2756.586) (-2747.478) [-2745.907] -- 0:01:44
Average standard deviation of split frequencies: 0.007170
526000 -- (-2749.267) (-2755.900) (-2743.355) [-2756.781] * (-2744.891) [-2750.625] (-2750.695) (-2752.211) -- 0:01:43
527000 -- (-2751.596) (-2747.334) [-2750.935] (-2751.429) * (-2750.185) [-2747.398] (-2753.997) (-2751.323) -- 0:01:44
528000 -- [-2749.216] (-2753.322) (-2749.337) (-2752.928) * [-2745.100] (-2748.011) (-2751.451) (-2744.114) -- 0:01:43
529000 -- (-2750.474) (-2749.167) (-2749.973) [-2749.710] * (-2748.185) (-2747.369) (-2749.243) [-2746.812] -- 0:01:43
530000 -- (-2755.123) (-2749.720) [-2747.781] (-2749.847) * (-2748.679) (-2743.624) [-2747.551] (-2751.766) -- 0:01:42
Average standard deviation of split frequencies: 0.007107
531000 -- (-2757.828) [-2744.896] (-2748.779) (-2752.947) * [-2744.792] (-2748.868) (-2747.108) (-2749.047) -- 0:01:42
532000 -- (-2748.858) (-2757.940) [-2745.285] (-2755.284) * (-2749.881) [-2753.775] (-2747.864) (-2748.597) -- 0:01:42
533000 -- (-2748.035) (-2752.098) (-2753.903) [-2747.083] * (-2753.942) [-2752.773] (-2749.028) (-2752.937) -- 0:01:42
534000 -- (-2754.993) [-2746.070] (-2746.751) (-2749.808) * (-2757.218) (-2750.635) [-2747.623] (-2752.998) -- 0:01:42
535000 -- (-2752.662) [-2750.745] (-2748.491) (-2747.337) * (-2752.547) (-2748.279) (-2747.494) [-2748.847] -- 0:01:41
Average standard deviation of split frequencies: 0.008355
536000 -- (-2755.550) (-2761.659) [-2748.800] (-2750.046) * (-2754.507) [-2747.330] (-2757.755) (-2750.305) -- 0:01:42
537000 -- [-2750.910] (-2749.141) (-2748.723) (-2748.811) * [-2751.233] (-2747.242) (-2751.956) (-2748.639) -- 0:01:41
538000 -- (-2753.464) [-2747.081] (-2747.867) (-2749.619) * (-2753.949) (-2750.700) [-2746.321] (-2755.260) -- 0:01:41
539000 -- (-2752.461) [-2748.284] (-2747.034) (-2748.836) * (-2751.019) (-2745.678) (-2748.962) [-2750.590] -- 0:01:40
540000 -- (-2757.551) [-2752.566] (-2749.439) (-2749.127) * (-2751.199) [-2751.923] (-2749.562) (-2745.125) -- 0:01:40
Average standard deviation of split frequencies: 0.011771
541000 -- (-2751.250) (-2753.985) (-2753.616) [-2747.074] * (-2746.458) [-2747.414] (-2750.311) (-2753.405) -- 0:01:40
542000 -- (-2756.224) (-2750.237) (-2745.023) [-2745.846] * (-2750.608) (-2749.346) (-2748.569) [-2746.853] -- 0:01:40
543000 -- (-2757.777) (-2756.661) [-2751.957] (-2749.059) * (-2754.017) (-2752.468) (-2755.680) [-2751.583] -- 0:01:40
544000 -- (-2756.156) (-2749.960) (-2751.550) [-2750.347] * [-2747.500] (-2748.637) (-2757.864) (-2745.853) -- 0:01:39
545000 -- [-2748.703] (-2749.639) (-2752.906) (-2747.644) * (-2750.336) [-2749.601] (-2746.817) (-2752.888) -- 0:01:40
Average standard deviation of split frequencies: 0.014246
546000 -- (-2747.497) [-2744.452] (-2750.025) (-2749.591) * (-2750.240) (-2750.127) (-2749.268) [-2745.096] -- 0:01:39
547000 -- [-2750.630] (-2745.612) (-2750.751) (-2746.845) * [-2751.044] (-2745.115) (-2751.681) (-2751.636) -- 0:01:39
548000 -- (-2746.748) [-2746.374] (-2753.327) (-2746.816) * (-2748.863) (-2752.891) [-2745.680] (-2747.745) -- 0:01:38
549000 -- (-2765.964) [-2745.452] (-2750.896) (-2751.121) * (-2754.188) (-2751.145) [-2745.700] (-2751.375) -- 0:01:38
550000 -- [-2750.412] (-2749.932) (-2750.914) (-2752.518) * (-2746.455) (-2746.303) (-2751.546) [-2747.765] -- 0:01:39
Average standard deviation of split frequencies: 0.011557
551000 -- (-2749.719) (-2761.014) (-2754.539) [-2750.920] * [-2749.538] (-2751.605) (-2748.247) (-2748.078) -- 0:01:38
552000 -- (-2759.381) (-2758.285) [-2752.257] (-2746.663) * (-2752.642) [-2747.299] (-2748.067) (-2749.906) -- 0:01:38
553000 -- [-2754.932] (-2753.221) (-2748.273) (-2745.890) * (-2743.516) (-2749.637) [-2747.535] (-2751.078) -- 0:01:37
554000 -- (-2755.653) [-2754.022] (-2749.417) (-2749.243) * (-2750.220) (-2751.230) (-2744.509) [-2757.553] -- 0:01:38
555000 -- (-2748.236) (-2755.204) [-2747.140] (-2752.510) * (-2749.349) [-2750.394] (-2749.693) (-2747.442) -- 0:01:37
Average standard deviation of split frequencies: 0.008902
556000 -- (-2754.708) (-2751.484) (-2751.252) [-2752.045] * (-2749.154) [-2746.484] (-2751.003) (-2746.565) -- 0:01:37
557000 -- (-2747.115) (-2753.202) [-2747.828] (-2750.301) * [-2748.979] (-2750.340) (-2746.041) (-2750.143) -- 0:01:37
558000 -- (-2757.753) (-2757.455) [-2747.144] (-2750.981) * [-2745.260] (-2742.811) (-2748.991) (-2750.686) -- 0:01:36
559000 -- (-2750.212) (-2758.899) (-2747.992) [-2742.251] * (-2746.069) (-2750.971) [-2748.718] (-2752.837) -- 0:01:37
560000 -- (-2756.988) (-2762.390) [-2748.087] (-2750.512) * [-2747.635] (-2751.848) (-2755.781) (-2748.086) -- 0:01:36
Average standard deviation of split frequencies: 0.006306
561000 -- [-2752.783] (-2762.833) (-2749.824) (-2750.231) * (-2747.148) (-2756.797) (-2746.974) [-2750.493] -- 0:01:36
562000 -- (-2747.217) (-2760.151) [-2746.346] (-2751.148) * (-2764.165) [-2748.943] (-2745.681) (-2751.857) -- 0:01:35
563000 -- [-2753.652] (-2756.135) (-2745.505) (-2751.684) * (-2748.916) (-2757.756) [-2743.487] (-2749.497) -- 0:01:36
564000 -- [-2747.981] (-2758.497) (-2754.393) (-2745.157) * (-2751.414) (-2745.216) [-2746.141] (-2751.415) -- 0:01:35
565000 -- [-2748.305] (-2760.443) (-2747.849) (-2752.406) * (-2749.417) (-2746.721) [-2750.353] (-2746.419) -- 0:01:35
Average standard deviation of split frequencies: 0.007079
566000 -- [-2753.072] (-2758.775) (-2752.338) (-2751.365) * (-2747.276) [-2751.334] (-2747.367) (-2751.375) -- 0:01:35
567000 -- (-2748.695) (-2753.718) (-2750.879) [-2748.037] * (-2745.294) (-2757.476) (-2748.755) [-2749.858] -- 0:01:34
568000 -- (-2745.565) [-2748.532] (-2755.219) (-2746.846) * (-2744.811) (-2752.356) (-2746.648) [-2746.319] -- 0:01:35
569000 -- (-2759.003) [-2750.471] (-2748.936) (-2748.639) * (-2749.274) (-2756.514) [-2751.530] (-2756.448) -- 0:01:34
570000 -- [-2746.607] (-2751.780) (-2752.384) (-2748.396) * (-2745.114) [-2749.109] (-2747.928) (-2750.108) -- 0:01:34
Average standard deviation of split frequencies: 0.007848
571000 -- (-2747.275) (-2751.194) (-2745.518) [-2752.733] * (-2750.776) [-2747.553] (-2752.826) (-2750.222) -- 0:01:33
572000 -- (-2745.030) (-2750.129) (-2751.734) [-2754.619] * (-2754.306) (-2749.157) [-2748.711] (-2756.955) -- 0:01:34
573000 -- [-2749.272] (-2752.385) (-2754.622) (-2748.367) * (-2754.340) (-2750.116) [-2749.928] (-2745.574) -- 0:01:33
574000 -- (-2751.268) [-2750.106] (-2746.908) (-2745.702) * (-2752.968) [-2752.288] (-2748.466) (-2748.103) -- 0:01:33
575000 -- (-2751.654) (-2757.032) [-2747.114] (-2745.095) * (-2751.111) (-2751.354) (-2750.121) [-2746.559] -- 0:01:33
Average standard deviation of split frequencies: 0.007366
576000 -- [-2744.868] (-2751.154) (-2749.785) (-2748.766) * (-2750.747) (-2751.200) [-2745.635] (-2747.947) -- 0:01:32
577000 -- (-2747.360) [-2752.228] (-2750.034) (-2754.802) * (-2748.522) (-2752.221) (-2744.479) [-2747.824] -- 0:01:33
578000 -- (-2749.301) (-2752.691) (-2746.334) [-2747.700] * (-2756.207) [-2750.112] (-2746.282) (-2748.053) -- 0:01:32
579000 -- (-2751.780) (-2750.306) (-2753.544) [-2745.265] * [-2750.298] (-2750.023) (-2746.741) (-2746.228) -- 0:01:32
580000 -- (-2748.235) (-2770.672) (-2754.572) [-2747.632] * [-2752.410] (-2747.255) (-2755.133) (-2745.733) -- 0:01:31
Average standard deviation of split frequencies: 0.007712
581000 -- (-2749.792) (-2748.310) (-2753.327) [-2745.931] * (-2753.959) (-2754.480) (-2752.550) [-2746.624] -- 0:01:31
582000 -- (-2750.083) (-2751.607) (-2754.162) [-2746.181] * (-2753.619) [-2747.262] (-2762.271) (-2751.382) -- 0:01:31
583000 -- [-2744.889] (-2745.423) (-2753.211) (-2753.323) * [-2748.446] (-2753.436) (-2753.676) (-2749.479) -- 0:01:31
584000 -- (-2746.318) (-2749.072) (-2752.834) [-2747.926] * (-2747.317) (-2750.190) (-2748.636) [-2749.677] -- 0:01:31
585000 -- [-2746.494] (-2751.909) (-2750.893) (-2753.299) * (-2751.099) [-2749.304] (-2749.154) (-2751.128) -- 0:01:30
Average standard deviation of split frequencies: 0.004827
586000 -- (-2753.806) [-2745.638] (-2750.657) (-2752.075) * [-2751.394] (-2747.783) (-2747.806) (-2751.151) -- 0:01:31
587000 -- (-2755.935) (-2749.193) [-2750.831] (-2747.465) * (-2750.536) [-2744.227] (-2750.541) (-2754.409) -- 0:01:30
588000 -- [-2753.834] (-2747.712) (-2745.194) (-2754.052) * (-2746.174) (-2748.716) (-2748.881) [-2750.974] -- 0:01:30
589000 -- [-2747.544] (-2748.616) (-2748.229) (-2751.715) * (-2753.786) (-2750.238) (-2744.899) [-2751.587] -- 0:01:30
590000 -- (-2750.735) [-2751.185] (-2759.797) (-2755.008) * [-2748.399] (-2753.082) (-2747.498) (-2753.408) -- 0:01:29
Average standard deviation of split frequencies: 0.007183
591000 -- (-2752.759) (-2749.758) [-2747.026] (-2754.138) * [-2742.755] (-2753.574) (-2747.045) (-2749.136) -- 0:01:29
592000 -- (-2746.772) (-2746.611) (-2749.404) [-2749.139] * [-2745.719] (-2753.335) (-2757.259) (-2753.408) -- 0:01:29
593000 -- (-2749.456) [-2746.144] (-2745.159) (-2748.858) * [-2746.752] (-2754.087) (-2750.117) (-2749.958) -- 0:01:29
594000 -- (-2750.379) [-2746.303] (-2752.890) (-2756.408) * (-2747.115) (-2748.665) [-2758.064] (-2748.027) -- 0:01:28
595000 -- [-2757.196] (-2754.364) (-2752.435) (-2746.840) * (-2753.903) (-2750.291) (-2755.690) [-2744.608] -- 0:01:29
Average standard deviation of split frequencies: 0.008305
596000 -- (-2751.802) (-2762.293) (-2755.955) [-2748.836] * (-2753.438) [-2744.941] (-2747.749) (-2751.080) -- 0:01:28
597000 -- (-2752.817) [-2752.783] (-2753.570) (-2751.191) * (-2755.203) [-2746.525] (-2747.072) (-2749.195) -- 0:01:28
598000 -- (-2750.405) (-2754.612) (-2746.512) [-2746.760] * (-2757.922) [-2751.999] (-2751.242) (-2751.662) -- 0:01:28
599000 -- (-2747.448) [-2747.200] (-2750.965) (-2750.673) * (-2746.680) (-2751.378) [-2751.902] (-2749.164) -- 0:01:27
600000 -- (-2752.694) (-2753.311) [-2748.772] (-2749.088) * (-2751.062) (-2752.055) (-2746.172) [-2753.528] -- 0:01:28
Average standard deviation of split frequencies: 0.007456
601000 -- (-2754.190) (-2754.746) [-2750.885] (-2752.294) * (-2756.788) (-2750.265) (-2758.586) [-2746.003] -- 0:01:27
602000 -- (-2749.909) [-2755.847] (-2750.152) (-2753.810) * (-2753.494) [-2748.522] (-2749.637) (-2749.087) -- 0:01:27
603000 -- (-2750.255) (-2748.769) [-2749.476] (-2749.621) * (-2752.067) [-2748.612] (-2748.094) (-2750.616) -- 0:01:26
604000 -- (-2750.844) (-2749.333) [-2748.239] (-2757.844) * (-2750.662) (-2750.999) [-2744.047] (-2747.081) -- 0:01:27
605000 -- (-2747.908) (-2744.901) (-2749.978) [-2747.557] * (-2747.333) (-2751.273) (-2754.928) [-2746.793] -- 0:01:26
Average standard deviation of split frequencies: 0.008946
606000 -- (-2746.069) (-2754.673) [-2745.475] (-2750.275) * (-2748.352) (-2752.249) [-2759.636] (-2750.419) -- 0:01:26
607000 -- [-2745.439] (-2747.660) (-2749.576) (-2747.104) * [-2753.265] (-2751.518) (-2755.111) (-2748.521) -- 0:01:26
608000 -- (-2749.905) [-2749.252] (-2743.992) (-2748.807) * (-2747.124) (-2744.840) (-2755.640) [-2745.293] -- 0:01:25
609000 -- [-2743.916] (-2749.953) (-2747.126) (-2745.448) * [-2746.202] (-2747.459) (-2750.433) (-2750.262) -- 0:01:26
610000 -- [-2745.833] (-2752.160) (-2755.538) (-2744.618) * [-2751.470] (-2751.702) (-2744.888) (-2748.200) -- 0:01:25
Average standard deviation of split frequencies: 0.013509
611000 -- [-2749.843] (-2752.397) (-2750.954) (-2747.587) * (-2757.868) (-2749.222) [-2747.646] (-2752.507) -- 0:01:25
612000 -- (-2750.016) [-2753.214] (-2746.205) (-2752.156) * (-2751.672) (-2749.446) [-2750.449] (-2748.088) -- 0:01:24
613000 -- [-2748.578] (-2751.873) (-2750.288) (-2756.606) * (-2749.094) (-2752.228) (-2752.832) [-2746.287] -- 0:01:25
614000 -- (-2753.009) [-2752.830] (-2751.275) (-2755.969) * (-2746.470) [-2751.591] (-2752.608) (-2744.214) -- 0:01:24
615000 -- (-2746.445) [-2748.488] (-2748.921) (-2753.011) * (-2750.831) [-2750.797] (-2746.986) (-2750.800) -- 0:01:24
Average standard deviation of split frequencies: 0.012244
616000 -- (-2747.288) [-2750.096] (-2747.092) (-2755.333) * (-2742.157) [-2751.776] (-2747.143) (-2749.399) -- 0:01:24
617000 -- (-2751.245) (-2757.853) (-2751.425) [-2751.895] * [-2752.585] (-2756.220) (-2751.962) (-2747.208) -- 0:01:23
618000 -- (-2746.268) [-2749.694] (-2753.265) (-2749.593) * (-2749.051) (-2751.913) [-2747.459] (-2756.286) -- 0:01:24
619000 -- (-2752.547) (-2746.827) [-2746.427] (-2752.572) * (-2748.197) (-2755.323) [-2751.361] (-2750.237) -- 0:01:23
620000 -- [-2748.173] (-2755.154) (-2749.173) (-2750.900) * (-2752.028) (-2755.703) (-2750.271) [-2747.582] -- 0:01:23
Average standard deviation of split frequencies: 0.013671
621000 -- (-2753.197) (-2750.888) (-2748.704) [-2751.182] * (-2754.960) [-2747.721] (-2752.710) (-2754.505) -- 0:01:23
622000 -- (-2744.896) (-2752.841) (-2749.623) [-2750.407] * [-2748.163] (-2746.811) (-2749.636) (-2756.062) -- 0:01:23
623000 -- [-2742.453] (-2746.104) (-2752.965) (-2750.818) * (-2754.369) (-2748.049) [-2744.897] (-2754.404) -- 0:01:22
624000 -- (-2745.799) [-2747.424] (-2757.638) (-2748.824) * (-2752.889) (-2748.344) (-2753.532) [-2748.848] -- 0:01:22
625000 -- (-2750.701) (-2755.194) (-2755.326) [-2748.722] * (-2751.565) [-2745.483] (-2748.743) (-2748.407) -- 0:01:22
Average standard deviation of split frequencies: 0.013931
626000 -- (-2748.671) (-2751.282) [-2748.734] (-2749.830) * (-2746.804) (-2744.313) [-2749.074] (-2751.336) -- 0:01:21
627000 -- (-2760.649) [-2752.703] (-2747.884) (-2753.314) * (-2758.505) (-2746.880) [-2746.420] (-2746.445) -- 0:01:22
628000 -- (-2748.740) (-2750.839) (-2746.040) [-2744.193] * (-2751.842) (-2748.571) [-2745.466] (-2750.174) -- 0:01:21
629000 -- (-2750.316) (-2748.493) [-2748.492] (-2745.225) * (-2746.264) (-2759.888) (-2746.031) [-2748.007] -- 0:01:21
630000 -- [-2750.267] (-2748.200) (-2753.245) (-2744.621) * (-2746.597) (-2748.551) (-2746.577) [-2749.357] -- 0:01:21
Average standard deviation of split frequencies: 0.012333
631000 -- (-2748.837) [-2750.373] (-2748.022) (-2744.090) * [-2752.081] (-2748.250) (-2752.649) (-2747.272) -- 0:01:20
632000 -- [-2751.443] (-2751.294) (-2745.398) (-2748.715) * (-2756.539) (-2748.323) (-2750.499) [-2746.283] -- 0:01:20
633000 -- (-2746.023) (-2752.518) [-2748.190] (-2750.692) * [-2753.211] (-2748.402) (-2746.559) (-2745.807) -- 0:01:20
634000 -- (-2748.541) (-2750.061) [-2742.136] (-2749.378) * (-2754.219) [-2754.135] (-2753.658) (-2749.083) -- 0:01:20
635000 -- [-2746.614] (-2748.742) (-2748.353) (-2754.339) * (-2756.096) [-2745.206] (-2745.608) (-2750.480) -- 0:01:19
Average standard deviation of split frequencies: 0.012971
636000 -- [-2752.389] (-2752.126) (-2748.054) (-2753.863) * (-2759.931) (-2748.721) [-2747.426] (-2752.548) -- 0:01:20
637000 -- (-2752.469) (-2748.804) [-2749.075] (-2751.541) * [-2746.963] (-2755.692) (-2755.654) (-2748.356) -- 0:01:19
638000 -- (-2754.027) (-2753.742) [-2743.944] (-2750.561) * (-2753.626) (-2750.357) (-2755.023) [-2747.640] -- 0:01:19
639000 -- [-2750.142] (-2748.001) (-2749.972) (-2746.872) * (-2748.739) (-2749.493) (-2749.250) [-2748.724] -- 0:01:19
640000 -- [-2754.721] (-2747.455) (-2749.177) (-2746.111) * (-2751.342) (-2749.077) [-2746.536] (-2749.100) -- 0:01:18
Average standard deviation of split frequencies: 0.013612
641000 -- (-2750.920) [-2745.657] (-2751.416) (-2753.999) * (-2756.145) [-2745.844] (-2749.728) (-2746.937) -- 0:01:18
642000 -- (-2747.203) [-2748.203] (-2748.415) (-2749.961) * [-2749.293] (-2754.362) (-2751.671) (-2747.247) -- 0:01:18
643000 -- [-2748.744] (-2755.448) (-2745.910) (-2749.594) * (-2743.673) (-2751.592) [-2746.026] (-2758.023) -- 0:01:18
644000 -- (-2753.149) (-2751.401) [-2745.125] (-2751.539) * (-2756.837) [-2746.834] (-2746.965) (-2751.319) -- 0:01:17
645000 -- (-2749.048) (-2751.035) [-2751.255] (-2750.879) * (-2749.989) [-2748.380] (-2749.528) (-2751.926) -- 0:01:18
Average standard deviation of split frequencies: 0.015689
646000 -- (-2750.243) [-2746.949] (-2756.016) (-2750.607) * [-2750.901] (-2747.149) (-2749.140) (-2747.853) -- 0:01:17
647000 -- (-2746.606) (-2752.096) (-2755.662) [-2747.599] * (-2748.753) [-2747.347] (-2756.041) (-2756.172) -- 0:01:17
648000 -- [-2745.514] (-2748.866) (-2751.198) (-2747.350) * (-2754.344) (-2753.222) (-2748.984) [-2746.363] -- 0:01:17
649000 -- (-2749.072) [-2746.723] (-2751.187) (-2759.290) * (-2750.361) [-2747.226] (-2749.662) (-2746.964) -- 0:01:16
650000 -- (-2749.743) (-2752.902) [-2745.275] (-2757.763) * (-2751.271) (-2746.256) [-2745.621] (-2747.896) -- 0:01:17
Average standard deviation of split frequencies: 0.017750
651000 -- (-2755.805) (-2756.836) [-2746.557] (-2758.508) * (-2754.781) (-2748.165) [-2747.969] (-2747.665) -- 0:01:16
652000 -- (-2754.175) [-2748.543] (-2744.278) (-2751.261) * (-2760.014) (-2748.735) [-2746.666] (-2751.208) -- 0:01:16
653000 -- [-2751.611] (-2749.597) (-2752.019) (-2754.109) * [-2750.310] (-2762.076) (-2751.165) (-2747.932) -- 0:01:15
654000 -- (-2744.326) (-2751.768) (-2753.655) [-2750.594] * (-2746.573) [-2752.948] (-2749.452) (-2753.975) -- 0:01:16
655000 -- (-2745.060) [-2744.825] (-2747.098) (-2750.130) * (-2750.553) [-2747.067] (-2748.979) (-2749.505) -- 0:01:15
Average standard deviation of split frequencies: 0.016169
656000 -- (-2748.386) (-2757.079) (-2746.526) [-2751.663] * (-2750.677) (-2745.970) [-2745.875] (-2751.833) -- 0:01:15
657000 -- (-2748.457) (-2757.467) [-2747.912] (-2749.005) * (-2747.350) (-2754.519) (-2749.797) [-2748.246] -- 0:01:15
658000 -- [-2754.200] (-2751.143) (-2752.016) (-2752.961) * [-2748.477] (-2758.790) (-2747.352) (-2753.712) -- 0:01:14
659000 -- (-2750.585) [-2751.329] (-2750.887) (-2746.780) * [-2750.577] (-2757.386) (-2752.127) (-2753.623) -- 0:01:15
660000 -- (-2749.391) (-2754.365) [-2747.508] (-2751.927) * (-2753.307) (-2750.264) (-2750.258) [-2751.436] -- 0:01:14
Average standard deviation of split frequencies: 0.014984
661000 -- (-2749.908) (-2752.401) [-2745.490] (-2753.721) * (-2747.328) [-2751.420] (-2753.077) (-2748.928) -- 0:01:14
662000 -- [-2749.401] (-2754.774) (-2756.019) (-2748.271) * (-2747.461) [-2750.228] (-2750.032) (-2746.198) -- 0:01:14
663000 -- [-2749.816] (-2745.021) (-2751.036) (-2750.884) * [-2751.455] (-2755.561) (-2744.779) (-2753.038) -- 0:01:13
664000 -- (-2751.311) (-2751.655) [-2750.126] (-2750.853) * [-2750.854] (-2774.475) (-2750.325) (-2753.585) -- 0:01:13
665000 -- (-2750.085) [-2751.649] (-2750.325) (-2754.150) * (-2747.805) [-2753.252] (-2753.318) (-2751.419) -- 0:01:13
Average standard deviation of split frequencies: 0.014864
666000 -- [-2748.928] (-2753.394) (-2749.595) (-2745.228) * (-2755.152) (-2747.143) [-2747.987] (-2755.199) -- 0:01:13
667000 -- [-2743.414] (-2748.190) (-2749.953) (-2752.722) * (-2749.709) (-2757.676) [-2751.736] (-2747.806) -- 0:01:12
668000 -- (-2747.769) (-2749.705) (-2745.031) [-2750.329] * [-2753.113] (-2747.248) (-2748.530) (-2751.599) -- 0:01:13
669000 -- (-2747.230) (-2748.962) [-2750.770] (-2748.413) * (-2754.942) (-2749.535) (-2750.205) [-2749.547] -- 0:01:12
670000 -- [-2748.864] (-2754.648) (-2754.085) (-2756.370) * (-2751.565) (-2748.924) (-2752.047) [-2748.434] -- 0:01:12
Average standard deviation of split frequencies: 0.017572
671000 -- (-2750.290) (-2744.974) (-2749.816) [-2744.621] * (-2753.665) [-2750.332] (-2747.488) (-2753.829) -- 0:01:12
672000 -- (-2747.643) [-2750.479] (-2753.515) (-2756.972) * (-2751.438) [-2750.498] (-2746.072) (-2757.861) -- 0:01:11
673000 -- (-2746.933) (-2746.086) (-2760.630) [-2748.560] * (-2757.478) (-2750.692) [-2752.040] (-2748.238) -- 0:01:11
674000 -- (-2746.585) [-2748.863] (-2750.358) (-2751.424) * [-2751.586] (-2752.830) (-2749.849) (-2744.348) -- 0:01:11
675000 -- (-2758.892) [-2750.953] (-2749.998) (-2748.845) * (-2747.881) (-2748.697) (-2749.311) [-2744.455] -- 0:01:11
Average standard deviation of split frequencies: 0.022664
676000 -- (-2748.818) (-2746.634) [-2751.683] (-2746.813) * [-2748.045] (-2751.256) (-2752.400) (-2750.614) -- 0:01:10
677000 -- [-2748.952] (-2748.563) (-2747.318) (-2753.855) * (-2748.459) (-2752.672) (-2749.878) [-2749.451] -- 0:01:11
678000 -- [-2745.712] (-2751.674) (-2753.664) (-2748.885) * (-2749.783) (-2750.408) (-2749.946) [-2747.649] -- 0:01:10
679000 -- (-2743.731) (-2745.428) (-2752.295) [-2746.600] * (-2748.342) (-2757.425) [-2749.072] (-2750.533) -- 0:01:10
680000 -- (-2753.392) (-2747.803) (-2753.553) [-2750.486] * (-2744.953) [-2752.388] (-2744.388) (-2751.329) -- 0:01:10
Average standard deviation of split frequencies: 0.024240
681000 -- (-2763.329) [-2753.013] (-2755.936) (-2747.557) * (-2751.208) (-2749.032) (-2754.913) [-2748.540] -- 0:01:09
682000 -- (-2760.440) [-2752.558] (-2750.838) (-2746.543) * (-2752.182) (-2750.392) (-2751.660) [-2753.994] -- 0:01:09
683000 -- (-2755.120) (-2755.934) (-2749.871) [-2751.249] * [-2751.373] (-2750.730) (-2750.493) (-2750.718) -- 0:01:09
684000 -- (-2752.342) [-2747.495] (-2750.638) (-2753.875) * (-2749.220) (-2754.312) [-2745.209] (-2747.347) -- 0:01:09
685000 -- (-2759.119) [-2749.099] (-2757.325) (-2758.497) * [-2749.011] (-2748.705) (-2747.092) (-2750.748) -- 0:01:08
Average standard deviation of split frequencies: 0.020272
686000 -- (-2748.885) [-2747.689] (-2753.728) (-2755.795) * (-2750.709) [-2749.588] (-2744.992) (-2750.369) -- 0:01:08
687000 -- [-2745.880] (-2749.388) (-2748.107) (-2750.120) * (-2750.290) [-2745.489] (-2753.233) (-2750.277) -- 0:01:08
688000 -- (-2752.913) [-2753.988] (-2744.838) (-2746.257) * [-2751.415] (-2757.856) (-2748.670) (-2756.522) -- 0:01:08
689000 -- [-2750.994] (-2745.359) (-2747.753) (-2752.796) * (-2751.603) (-2750.927) [-2746.509] (-2756.203) -- 0:01:08
690000 -- (-2748.330) [-2744.731] (-2748.644) (-2754.485) * [-2752.534] (-2747.490) (-2747.793) (-2756.689) -- 0:01:07
Average standard deviation of split frequencies: 0.023547
691000 -- (-2752.725) (-2750.231) (-2752.856) [-2754.603] * [-2748.526] (-2746.087) (-2748.082) (-2749.335) -- 0:01:07
692000 -- (-2746.273) [-2750.295] (-2751.290) (-2750.216) * (-2752.419) [-2749.624] (-2750.580) (-2750.632) -- 0:01:07
693000 -- (-2747.967) [-2754.456] (-2752.956) (-2749.229) * (-2756.359) [-2747.036] (-2757.719) (-2744.319) -- 0:01:07
694000 -- (-2751.174) (-2757.413) [-2746.992] (-2752.112) * (-2750.322) (-2751.442) [-2746.604] (-2746.814) -- 0:01:07
695000 -- (-2752.800) (-2750.692) (-2746.503) [-2747.532] * [-2745.707] (-2749.157) (-2753.492) (-2749.458) -- 0:01:06
Average standard deviation of split frequencies: 0.025060
696000 -- [-2749.393] (-2758.133) (-2745.320) (-2748.108) * (-2748.339) [-2747.017] (-2750.663) (-2749.564) -- 0:01:06
697000 -- [-2747.382] (-2756.061) (-2751.063) (-2750.065) * (-2753.605) (-2750.490) (-2748.478) [-2744.387] -- 0:01:06
698000 -- [-2751.939] (-2750.337) (-2753.604) (-2747.846) * (-2751.805) (-2756.686) (-2747.028) [-2745.581] -- 0:01:06
699000 -- (-2754.639) (-2753.423) (-2754.770) [-2749.499] * (-2749.710) [-2746.277] (-2752.359) (-2747.787) -- 0:01:05
700000 -- [-2746.048] (-2749.601) (-2755.089) (-2750.698) * (-2750.264) (-2753.340) [-2744.926] (-2745.022) -- 0:01:06
Average standard deviation of split frequencies: 0.023548
701000 -- (-2745.319) (-2748.302) (-2750.931) [-2745.845] * [-2756.639] (-2750.812) (-2746.196) (-2753.324) -- 0:01:05
702000 -- (-2752.414) [-2755.635] (-2748.591) (-2745.994) * [-2753.015] (-2748.905) (-2750.249) (-2758.292) -- 0:01:05
703000 -- (-2752.944) (-2747.980) [-2744.888] (-2749.314) * (-2753.644) (-2746.491) (-2749.091) [-2752.138] -- 0:01:05
704000 -- (-2760.423) [-2743.886] (-2751.103) (-2751.569) * [-2748.686] (-2747.090) (-2745.264) (-2746.810) -- 0:01:04
705000 -- (-2750.827) (-2745.572) (-2755.108) [-2755.776] * [-2751.905] (-2751.131) (-2751.680) (-2751.349) -- 0:01:04
Average standard deviation of split frequencies: 0.021701
706000 -- (-2754.040) (-2746.412) (-2745.112) [-2749.525] * [-2750.898] (-2747.021) (-2749.675) (-2751.061) -- 0:01:04
707000 -- (-2749.311) [-2746.385] (-2754.443) (-2749.899) * [-2748.433] (-2750.154) (-2746.702) (-2747.839) -- 0:01:04
708000 -- (-2744.709) [-2746.710] (-2749.362) (-2748.536) * [-2748.855] (-2748.473) (-2753.236) (-2755.717) -- 0:01:03
709000 -- [-2749.688] (-2746.980) (-2747.318) (-2751.219) * [-2751.425] (-2750.210) (-2748.595) (-2755.074) -- 0:01:04
710000 -- (-2750.776) [-2753.895] (-2747.306) (-2746.196) * (-2751.453) [-2751.509] (-2747.902) (-2748.015) -- 0:01:03
Average standard deviation of split frequencies: 0.020895
711000 -- (-2750.496) (-2747.716) (-2753.907) [-2747.941] * [-2745.430] (-2752.113) (-2752.935) (-2748.738) -- 0:01:03
712000 -- [-2748.962] (-2753.070) (-2749.904) (-2746.482) * (-2747.287) (-2750.229) (-2746.007) [-2749.188] -- 0:01:03
713000 -- (-2745.455) (-2751.375) (-2762.728) [-2747.941] * [-2747.526] (-2746.612) (-2749.846) (-2752.207) -- 0:01:02
714000 -- [-2745.956] (-2746.417) (-2749.526) (-2754.522) * [-2749.520] (-2757.899) (-2750.720) (-2754.990) -- 0:01:02
715000 -- [-2748.812] (-2748.191) (-2752.111) (-2758.829) * (-2752.916) (-2755.808) [-2751.101] (-2747.044) -- 0:01:02
Average standard deviation of split frequencies: 0.018435
716000 -- (-2747.993) [-2747.154] (-2748.988) (-2762.333) * (-2751.061) (-2754.276) [-2748.802] (-2752.105) -- 0:01:02
717000 -- (-2753.313) [-2750.759] (-2752.437) (-2765.450) * (-2751.351) [-2748.950] (-2753.255) (-2756.415) -- 0:01:01
718000 -- [-2749.500] (-2750.855) (-2745.657) (-2762.735) * (-2744.529) (-2750.692) [-2752.150] (-2753.479) -- 0:01:02
719000 -- [-2752.434] (-2748.053) (-2749.505) (-2755.130) * (-2752.400) (-2750.897) (-2745.940) [-2750.797] -- 0:01:01
720000 -- (-2749.048) (-2753.223) [-2745.886] (-2755.394) * [-2750.167] (-2748.863) (-2747.566) (-2748.270) -- 0:01:01
Average standard deviation of split frequencies: 0.020932
721000 -- (-2763.599) (-2747.098) (-2749.444) [-2752.889] * [-2753.771] (-2750.666) (-2753.808) (-2745.740) -- 0:01:01
722000 -- [-2751.851] (-2750.707) (-2752.626) (-2751.011) * [-2749.112] (-2749.409) (-2761.377) (-2750.238) -- 0:01:00
723000 -- (-2753.036) [-2749.230] (-2749.928) (-2749.651) * (-2755.461) (-2749.945) [-2754.617] (-2748.546) -- 0:01:00
724000 -- (-2759.540) [-2747.404] (-2748.392) (-2753.200) * [-2745.838] (-2747.290) (-2753.815) (-2748.746) -- 0:01:00
725000 -- [-2747.741] (-2749.466) (-2758.638) (-2746.841) * (-2745.784) [-2747.264] (-2742.397) (-2753.296) -- 0:01:00
Average standard deviation of split frequencies: 0.020454
726000 -- [-2755.638] (-2749.533) (-2749.200) (-2753.807) * (-2751.532) [-2752.180] (-2747.693) (-2746.290) -- 0:01:00
727000 -- [-2749.032] (-2747.178) (-2757.521) (-2753.800) * (-2751.357) (-2751.424) (-2746.146) [-2748.447] -- 0:00:59
728000 -- (-2749.655) [-2746.500] (-2759.612) (-2747.508) * (-2749.606) [-2753.608] (-2749.976) (-2755.091) -- 0:00:59
729000 -- (-2749.855) [-2747.471] (-2757.867) (-2747.894) * (-2752.378) (-2750.945) (-2750.502) [-2747.806] -- 0:00:59
730000 -- (-2750.277) [-2748.687] (-2751.592) (-2749.278) * (-2747.077) [-2753.905] (-2749.698) (-2746.303) -- 0:00:59
Average standard deviation of split frequencies: 0.017097
731000 -- (-2754.931) (-2750.105) (-2747.444) [-2751.477] * (-2747.655) (-2748.791) (-2749.823) [-2745.244] -- 0:00:58
732000 -- [-2749.019] (-2754.348) (-2748.545) (-2748.995) * (-2749.134) (-2746.379) (-2746.768) [-2744.724] -- 0:00:58
733000 -- [-2748.788] (-2749.999) (-2753.341) (-2745.816) * (-2747.568) [-2746.827] (-2747.684) (-2748.060) -- 0:00:58
734000 -- [-2754.231] (-2750.339) (-2750.749) (-2746.188) * (-2747.062) [-2748.154] (-2748.249) (-2750.588) -- 0:00:58
735000 -- [-2750.914] (-2753.282) (-2754.978) (-2751.511) * [-2743.927] (-2748.021) (-2754.390) (-2749.815) -- 0:00:58
Average standard deviation of split frequencies: 0.016012
736000 -- [-2747.478] (-2755.395) (-2750.398) (-2749.175) * (-2746.827) (-2759.326) [-2748.061] (-2747.149) -- 0:00:57
737000 -- (-2755.009) (-2752.207) (-2757.883) [-2751.685] * (-2747.863) (-2747.421) (-2749.757) [-2745.195] -- 0:00:57
738000 -- (-2750.929) (-2747.358) (-2752.132) [-2746.588] * [-2749.507] (-2753.745) (-2752.313) (-2751.930) -- 0:00:57
739000 -- [-2751.265] (-2749.862) (-2748.490) (-2750.673) * [-2748.989] (-2754.065) (-2747.739) (-2752.342) -- 0:00:57
740000 -- (-2749.719) (-2760.524) [-2751.910] (-2752.803) * [-2751.301] (-2751.256) (-2751.226) (-2753.445) -- 0:00:56
Average standard deviation of split frequencies: 0.015275
741000 -- [-2748.555] (-2751.559) (-2746.985) (-2747.974) * (-2750.362) (-2746.432) [-2752.311] (-2747.603) -- 0:00:56
742000 -- (-2746.797) [-2750.259] (-2751.572) (-2750.232) * (-2755.094) [-2746.869] (-2745.202) (-2746.157) -- 0:00:56
743000 -- (-2752.777) (-2750.712) [-2747.663] (-2749.413) * [-2752.005] (-2748.669) (-2748.439) (-2752.209) -- 0:00:56
744000 -- [-2746.622] (-2749.633) (-2747.298) (-2753.501) * [-2746.576] (-2749.402) (-2752.046) (-2754.987) -- 0:00:56
745000 -- (-2753.786) [-2752.345] (-2754.612) (-2749.521) * (-2750.258) (-2753.059) (-2749.476) [-2747.883] -- 0:00:55
Average standard deviation of split frequencies: 0.014534
746000 -- (-2747.036) [-2751.912] (-2752.833) (-2749.953) * [-2743.499] (-2758.908) (-2753.045) (-2751.022) -- 0:00:55
747000 -- (-2751.775) (-2756.470) (-2751.904) [-2752.360] * [-2748.186] (-2752.078) (-2750.263) (-2744.876) -- 0:00:55
748000 -- (-2751.550) (-2750.227) [-2751.822] (-2745.933) * (-2751.371) (-2748.847) (-2750.640) [-2747.874] -- 0:00:55
749000 -- [-2750.704] (-2746.436) (-2752.334) (-2755.199) * (-2745.013) (-2749.603) [-2745.507] (-2748.876) -- 0:00:54
750000 -- [-2760.928] (-2754.342) (-2751.114) (-2751.505) * (-2756.082) (-2753.317) [-2745.366] (-2742.596) -- 0:00:54
Average standard deviation of split frequencies: 0.013188
751000 -- [-2746.895] (-2752.282) (-2753.201) (-2749.006) * (-2754.899) (-2751.035) [-2749.390] (-2745.126) -- 0:00:54
752000 -- [-2745.826] (-2753.098) (-2755.377) (-2751.651) * (-2755.698) (-2748.383) (-2750.428) [-2743.768] -- 0:00:54
753000 -- [-2749.451] (-2747.376) (-2757.980) (-2751.332) * [-2747.298] (-2757.363) (-2747.291) (-2747.500) -- 0:00:54
754000 -- [-2745.823] (-2744.066) (-2748.255) (-2751.430) * (-2747.265) (-2752.333) [-2750.971] (-2749.949) -- 0:00:53
755000 -- [-2748.028] (-2747.406) (-2744.972) (-2746.937) * (-2744.206) [-2750.720] (-2748.880) (-2751.326) -- 0:00:53
Average standard deviation of split frequencies: 0.014342
756000 -- (-2752.904) [-2747.947] (-2749.951) (-2745.319) * [-2749.244] (-2752.150) (-2748.636) (-2745.760) -- 0:00:53
757000 -- (-2757.468) (-2755.424) [-2749.552] (-2747.591) * (-2750.421) [-2748.077] (-2753.652) (-2750.530) -- 0:00:53
758000 -- (-2743.967) (-2750.010) [-2748.163] (-2751.250) * (-2757.562) [-2751.527] (-2751.965) (-2750.596) -- 0:00:52
759000 -- (-2751.552) (-2752.164) [-2750.225] (-2749.630) * [-2757.546] (-2749.184) (-2750.383) (-2753.844) -- 0:00:52
760000 -- (-2754.205) [-2750.148] (-2752.078) (-2754.529) * (-2753.075) (-2746.195) (-2750.609) [-2749.314] -- 0:00:52
Average standard deviation of split frequencies: 0.013014
761000 -- (-2753.661) (-2753.375) (-2752.622) [-2748.384] * (-2751.896) (-2754.203) (-2751.434) [-2751.099] -- 0:00:52
762000 -- (-2747.282) (-2758.724) [-2747.568] (-2743.513) * [-2746.907] (-2751.912) (-2755.823) (-2751.569) -- 0:00:52
763000 -- (-2750.011) (-2752.895) [-2746.314] (-2744.855) * (-2756.924) (-2750.598) [-2748.508] (-2749.955) -- 0:00:51
764000 -- [-2745.657] (-2752.983) (-2753.430) (-2745.516) * (-2755.900) (-2754.218) [-2752.426] (-2749.038) -- 0:00:51
765000 -- (-2753.093) [-2747.497] (-2751.767) (-2750.856) * (-2756.481) (-2752.192) [-2752.607] (-2755.742) -- 0:00:51
Average standard deviation of split frequencies: 0.011077
766000 -- [-2747.281] (-2751.498) (-2750.141) (-2751.499) * [-2750.490] (-2747.422) (-2752.009) (-2755.763) -- 0:00:51
767000 -- (-2753.007) [-2750.554] (-2751.139) (-2748.825) * (-2745.462) (-2757.030) [-2747.700] (-2746.728) -- 0:00:51
768000 -- [-2751.339] (-2747.797) (-2746.555) (-2753.883) * (-2756.142) [-2750.929] (-2749.599) (-2751.896) -- 0:00:51
769000 -- [-2748.280] (-2747.251) (-2750.311) (-2749.672) * (-2755.244) (-2750.096) (-2750.950) [-2748.067] -- 0:00:50
770000 -- (-2751.862) [-2747.844] (-2755.508) (-2748.080) * (-2752.946) (-2761.110) [-2746.091] (-2750.267) -- 0:00:50
Average standard deviation of split frequencies: 0.011622
771000 -- (-2750.774) (-2746.855) [-2759.909] (-2752.467) * (-2751.073) [-2749.248] (-2753.604) (-2748.631) -- 0:00:50
772000 -- [-2753.649] (-2749.287) (-2747.201) (-2755.348) * [-2749.579] (-2747.869) (-2752.744) (-2747.958) -- 0:00:49
773000 -- (-2755.610) (-2749.504) (-2748.974) [-2749.445] * (-2750.225) [-2747.416] (-2746.778) (-2752.172) -- 0:00:49
774000 -- [-2747.713] (-2748.809) (-2754.668) (-2750.986) * [-2749.583] (-2749.618) (-2745.310) (-2751.368) -- 0:00:49
775000 -- (-2754.072) [-2749.455] (-2750.430) (-2754.974) * (-2751.602) (-2749.571) (-2748.709) [-2751.005] -- 0:00:49
Average standard deviation of split frequencies: 0.009416
776000 -- [-2747.902] (-2752.169) (-2750.797) (-2752.075) * (-2750.338) (-2745.154) (-2747.572) [-2747.531] -- 0:00:49
777000 -- (-2750.240) (-2751.939) [-2743.470] (-2757.400) * (-2747.486) (-2754.788) (-2751.709) [-2746.012] -- 0:00:48
778000 -- (-2747.541) (-2748.246) [-2745.211] (-2757.722) * [-2747.745] (-2755.670) (-2752.707) (-2744.990) -- 0:00:48
779000 -- (-2751.080) (-2749.310) (-2750.100) [-2750.396] * [-2747.328] (-2752.542) (-2750.535) (-2753.893) -- 0:00:48
780000 -- (-2752.359) (-2752.781) [-2748.640] (-2756.847) * (-2748.169) (-2748.682) (-2745.444) [-2747.507] -- 0:00:48
Average standard deviation of split frequencies: 0.011171
781000 -- (-2748.649) [-2745.655] (-2750.041) (-2754.488) * (-2746.611) [-2751.464] (-2750.459) (-2754.685) -- 0:00:47
782000 -- (-2746.168) (-2750.563) (-2754.866) [-2750.509] * (-2749.271) [-2757.456] (-2746.123) (-2754.500) -- 0:00:47
783000 -- [-2752.401] (-2755.025) (-2755.975) (-2753.817) * [-2749.082] (-2748.440) (-2751.586) (-2751.554) -- 0:00:47
784000 -- (-2749.102) [-2746.885] (-2749.358) (-2752.317) * (-2747.916) (-2746.249) (-2751.626) [-2750.987] -- 0:00:47
785000 -- (-2749.580) [-2750.987] (-2751.154) (-2757.336) * (-2746.817) (-2748.911) (-2747.557) [-2745.783] -- 0:00:47
Average standard deviation of split frequencies: 0.012595
786000 -- (-2748.510) (-2747.041) [-2749.289] (-2751.518) * (-2748.297) [-2750.392] (-2751.309) (-2748.613) -- 0:00:46
787000 -- (-2750.171) [-2744.302] (-2746.530) (-2750.503) * (-2753.987) (-2751.913) [-2750.684] (-2748.634) -- 0:00:46
788000 -- (-2757.115) (-2745.463) (-2746.272) [-2747.256] * [-2750.006] (-2745.659) (-2747.819) (-2747.695) -- 0:00:46
789000 -- (-2751.212) [-2744.380] (-2753.424) (-2754.451) * (-2749.755) [-2750.990] (-2755.718) (-2751.618) -- 0:00:46
790000 -- (-2751.798) (-2747.340) (-2755.014) [-2747.760] * (-2747.581) (-2752.884) (-2755.515) [-2750.463] -- 0:00:45
Average standard deviation of split frequencies: 0.009539
791000 -- (-2755.830) (-2753.811) (-2749.460) [-2750.868] * (-2749.498) (-2752.478) (-2745.202) [-2749.980] -- 0:00:45
792000 -- (-2753.500) (-2751.124) [-2744.559] (-2748.404) * (-2745.359) (-2750.095) [-2748.362] (-2751.205) -- 0:00:45
793000 -- (-2755.002) (-2749.316) (-2752.216) [-2749.079] * (-2748.554) [-2749.222] (-2756.350) (-2751.151) -- 0:00:45
794000 -- [-2753.407] (-2751.327) (-2758.134) (-2754.248) * (-2748.144) [-2751.027] (-2750.360) (-2749.872) -- 0:00:45
795000 -- (-2756.316) (-2748.655) [-2751.110] (-2756.618) * [-2749.392] (-2755.671) (-2747.434) (-2751.618) -- 0:00:44
Average standard deviation of split frequencies: 0.007995
796000 -- (-2753.805) (-2757.473) (-2751.835) [-2748.529] * (-2749.831) [-2747.961] (-2745.298) (-2748.053) -- 0:00:44
797000 -- (-2747.699) [-2751.902] (-2750.932) (-2744.941) * (-2747.951) (-2749.860) (-2748.130) [-2748.082] -- 0:00:44
798000 -- [-2753.714] (-2754.045) (-2749.942) (-2758.607) * (-2745.964) [-2745.523] (-2753.659) (-2752.211) -- 0:00:44
799000 -- (-2749.783) [-2751.948] (-2751.397) (-2747.037) * (-2750.346) [-2748.005] (-2749.267) (-2750.286) -- 0:00:44
800000 -- (-2752.268) [-2749.994] (-2750.680) (-2747.347) * [-2745.448] (-2745.118) (-2748.573) (-2753.539) -- 0:00:44
Average standard deviation of split frequencies: 0.008243
801000 -- [-2749.663] (-2755.976) (-2748.797) (-2750.670) * (-2746.870) (-2753.088) [-2757.226] (-2754.545) -- 0:00:43
802000 -- (-2747.762) (-2753.488) [-2747.585] (-2749.086) * (-2746.060) [-2745.883] (-2749.514) (-2754.382) -- 0:00:43
803000 -- [-2743.532] (-2752.028) (-2748.848) (-2750.815) * (-2749.011) (-2751.656) [-2750.088] (-2748.690) -- 0:00:43
804000 -- (-2748.677) (-2752.767) (-2754.622) [-2745.797] * (-2751.686) (-2751.265) (-2746.683) [-2752.276] -- 0:00:42
805000 -- (-2750.782) (-2750.682) (-2753.548) [-2749.335] * (-2745.009) (-2753.052) [-2751.223] (-2751.271) -- 0:00:42
Average standard deviation of split frequencies: 0.010820
806000 -- [-2749.236] (-2748.567) (-2754.206) (-2753.420) * (-2749.674) [-2753.201] (-2746.885) (-2755.594) -- 0:00:42
807000 -- (-2748.582) [-2746.668] (-2754.270) (-2749.849) * (-2746.309) [-2748.130] (-2750.317) (-2749.158) -- 0:00:42
808000 -- (-2747.191) (-2751.244) [-2752.607] (-2751.994) * (-2745.861) (-2749.267) [-2745.122] (-2752.827) -- 0:00:42
809000 -- [-2748.507] (-2754.803) (-2751.998) (-2752.113) * (-2746.005) [-2749.813] (-2744.936) (-2754.999) -- 0:00:42
810000 -- (-2748.948) (-2755.350) (-2747.811) [-2746.630] * [-2745.674] (-2749.483) (-2749.405) (-2753.583) -- 0:00:41
Average standard deviation of split frequencies: 0.009304
811000 -- (-2748.092) (-2757.336) (-2747.797) [-2750.976] * (-2753.286) [-2753.416] (-2745.446) (-2750.743) -- 0:00:41
812000 -- (-2756.975) [-2751.949] (-2755.200) (-2749.333) * (-2748.623) (-2748.490) (-2750.048) [-2751.664] -- 0:00:41
813000 -- (-2748.543) (-2750.100) [-2748.534] (-2746.790) * (-2748.364) (-2746.796) (-2751.202) [-2752.028] -- 0:00:40
814000 -- (-2748.802) [-2747.456] (-2747.093) (-2750.082) * (-2745.824) (-2754.269) [-2749.103] (-2752.621) -- 0:00:40
815000 -- (-2756.431) (-2750.878) [-2748.167] (-2751.568) * (-2750.840) (-2759.303) (-2748.647) [-2750.264] -- 0:00:40
Average standard deviation of split frequencies: 0.008377
816000 -- (-2754.604) (-2751.286) [-2751.976] (-2748.107) * [-2744.223] (-2749.284) (-2748.390) (-2747.665) -- 0:00:40
817000 -- (-2755.951) [-2750.324] (-2748.628) (-2750.533) * (-2755.919) [-2745.003] (-2746.614) (-2749.723) -- 0:00:40
818000 -- (-2754.749) [-2751.575] (-2745.026) (-2752.027) * (-2752.690) (-2746.284) (-2749.753) [-2749.239] -- 0:00:39
819000 -- [-2763.831] (-2757.971) (-2748.565) (-2751.795) * (-2750.982) (-2752.843) (-2749.865) [-2749.608] -- 0:00:39
820000 -- (-2749.607) [-2751.303] (-2744.318) (-2748.233) * (-2754.728) (-2752.931) (-2753.543) [-2744.743] -- 0:00:39
Average standard deviation of split frequencies: 0.013499
821000 -- (-2744.669) [-2753.243] (-2745.217) (-2750.498) * [-2749.055] (-2750.082) (-2752.664) (-2752.945) -- 0:00:39
822000 -- (-2751.645) [-2757.117] (-2743.610) (-2749.185) * (-2748.322) (-2751.047) [-2747.739] (-2750.167) -- 0:00:39
823000 -- [-2749.659] (-2745.230) (-2750.846) (-2749.717) * (-2748.188) (-2753.267) (-2751.035) [-2750.566] -- 0:00:38
824000 -- (-2749.727) (-2743.746) (-2748.221) [-2746.180] * (-2745.530) (-2753.396) [-2746.344] (-2750.432) -- 0:00:38
825000 -- [-2745.249] (-2744.718) (-2759.497) (-2749.526) * [-2752.266] (-2751.261) (-2744.698) (-2752.555) -- 0:00:38
Average standard deviation of split frequencies: 0.013982
826000 -- (-2747.577) (-2748.032) (-2745.462) [-2746.381] * (-2751.459) [-2753.713] (-2746.835) (-2751.200) -- 0:00:38
827000 -- (-2752.255) (-2748.112) (-2744.291) [-2748.513] * (-2748.642) [-2746.121] (-2748.683) (-2751.923) -- 0:00:38
828000 -- (-2751.183) (-2745.749) [-2749.993] (-2757.817) * (-2750.102) (-2746.646) (-2750.492) [-2751.805] -- 0:00:37
829000 -- (-2750.211) (-2748.534) (-2747.773) [-2748.056] * (-2748.012) (-2750.040) (-2743.636) [-2746.113] -- 0:00:37
830000 -- (-2749.453) (-2748.460) (-2748.754) [-2748.159] * (-2752.540) [-2749.896] (-2750.789) (-2749.008) -- 0:00:37
Average standard deviation of split frequencies: 0.013620
831000 -- (-2744.557) (-2747.047) [-2746.692] (-2749.087) * (-2747.089) [-2750.248] (-2749.889) (-2745.316) -- 0:00:37
832000 -- (-2747.047) (-2754.441) [-2748.067] (-2749.815) * (-2745.781) (-2751.630) (-2747.072) [-2750.259] -- 0:00:36
833000 -- [-2744.878] (-2746.258) (-2749.188) (-2756.494) * (-2750.470) (-2753.298) (-2753.934) [-2749.826] -- 0:00:36
834000 -- (-2753.747) (-2753.704) [-2748.472] (-2753.122) * (-2752.802) (-2750.253) (-2744.740) [-2747.352] -- 0:00:36
835000 -- [-2746.046] (-2749.523) (-2750.126) (-2757.307) * (-2746.953) [-2752.291] (-2753.099) (-2744.904) -- 0:00:36
Average standard deviation of split frequencies: 0.011842
836000 -- [-2746.201] (-2746.013) (-2748.955) (-2751.492) * (-2748.001) [-2750.728] (-2753.825) (-2749.201) -- 0:00:36
837000 -- (-2747.845) (-2748.522) [-2745.671] (-2753.182) * [-2748.385] (-2750.578) (-2756.076) (-2753.829) -- 0:00:35
838000 -- (-2750.119) [-2745.300] (-2745.932) (-2750.358) * (-2749.731) (-2755.645) [-2748.307] (-2750.007) -- 0:00:35
839000 -- (-2745.922) [-2749.454] (-2755.206) (-2747.941) * (-2753.321) [-2744.607] (-2745.744) (-2753.974) -- 0:00:35
840000 -- (-2749.368) (-2758.039) [-2748.190] (-2744.829) * (-2750.537) (-2751.212) (-2745.332) [-2755.195] -- 0:00:35
Average standard deviation of split frequencies: 0.012897
841000 -- (-2748.004) (-2752.847) [-2751.689] (-2755.095) * [-2750.371] (-2753.792) (-2750.145) (-2745.511) -- 0:00:34
842000 -- (-2746.625) [-2751.835] (-2757.041) (-2747.008) * (-2756.798) (-2746.320) (-2746.154) [-2748.032] -- 0:00:34
843000 -- (-2749.220) (-2757.307) (-2755.462) [-2747.319] * (-2756.835) [-2748.284] (-2748.399) (-2750.085) -- 0:00:34
844000 -- [-2749.493] (-2748.535) (-2754.198) (-2748.025) * (-2760.602) [-2750.882] (-2748.724) (-2751.859) -- 0:00:34
845000 -- (-2751.300) (-2750.792) [-2746.717] (-2750.955) * (-2750.557) [-2749.737] (-2749.788) (-2748.640) -- 0:00:34
Average standard deviation of split frequencies: 0.010587
846000 -- (-2746.520) (-2755.929) (-2751.721) [-2755.405] * [-2754.143] (-2756.517) (-2755.319) (-2752.588) -- 0:00:33
847000 -- (-2754.807) [-2752.521] (-2752.528) (-2747.216) * (-2745.057) (-2760.558) [-2754.036] (-2749.078) -- 0:00:33
848000 -- (-2749.310) [-2749.477] (-2746.161) (-2752.333) * [-2747.387] (-2757.477) (-2753.358) (-2749.831) -- 0:00:33
849000 -- (-2749.669) (-2748.105) (-2751.848) [-2747.443] * (-2747.827) [-2751.258] (-2754.438) (-2747.863) -- 0:00:33
850000 -- [-2753.658] (-2757.256) (-2752.395) (-2752.677) * (-2750.099) (-2745.972) [-2749.646] (-2750.720) -- 0:00:33
Average standard deviation of split frequencies: 0.012191
851000 -- (-2747.239) (-2758.044) (-2745.598) [-2754.439] * (-2761.678) (-2753.762) (-2747.849) [-2744.739] -- 0:00:32
852000 -- (-2755.237) (-2751.273) [-2747.131] (-2748.482) * (-2755.973) [-2746.397] (-2746.444) (-2743.885) -- 0:00:32
853000 -- (-2752.501) (-2751.322) [-2749.017] (-2751.056) * (-2750.787) [-2746.246] (-2743.644) (-2749.441) -- 0:00:32
854000 -- [-2755.044] (-2753.749) (-2746.465) (-2754.036) * (-2752.011) (-2749.079) (-2752.175) [-2752.234] -- 0:00:32
855000 -- (-2754.041) [-2750.387] (-2749.468) (-2758.050) * (-2751.289) (-2750.752) (-2747.529) [-2744.654] -- 0:00:31
Average standard deviation of split frequencies: 0.013768
856000 -- (-2755.982) (-2750.486) (-2756.011) [-2749.475] * [-2749.479] (-2751.678) (-2745.187) (-2748.906) -- 0:00:31
857000 -- [-2753.203] (-2749.285) (-2750.627) (-2745.471) * (-2753.737) (-2752.664) (-2745.364) [-2749.530] -- 0:00:31
858000 -- (-2751.581) (-2743.319) (-2756.539) [-2744.795] * (-2755.774) (-2757.135) (-2755.762) [-2747.726] -- 0:00:31
859000 -- (-2749.528) (-2746.631) (-2755.837) [-2748.852] * [-2748.724] (-2754.378) (-2753.211) (-2757.008) -- 0:00:31
860000 -- (-2747.655) (-2748.856) (-2751.513) [-2751.087] * [-2747.585] (-2747.213) (-2753.801) (-2751.608) -- 0:00:30
Average standard deviation of split frequencies: 0.013967
861000 -- [-2747.390] (-2751.890) (-2748.825) (-2747.709) * (-2749.353) (-2748.766) [-2746.168] (-2758.764) -- 0:00:30
862000 -- (-2751.144) (-2747.683) (-2747.741) [-2744.726] * (-2748.647) (-2747.264) (-2752.216) [-2753.528] -- 0:00:30
863000 -- [-2752.116] (-2755.231) (-2752.000) (-2747.369) * [-2749.772] (-2750.355) (-2751.111) (-2755.287) -- 0:00:30
864000 -- (-2752.937) (-2743.943) (-2748.153) [-2750.403] * (-2755.643) [-2749.627] (-2753.163) (-2751.789) -- 0:00:29
865000 -- [-2745.895] (-2749.620) (-2746.292) (-2748.938) * (-2750.966) (-2747.418) (-2756.719) [-2748.203] -- 0:00:29
Average standard deviation of split frequencies: 0.014153
866000 -- [-2745.982] (-2750.163) (-2745.730) (-2751.706) * (-2756.829) (-2757.359) (-2753.779) [-2744.229] -- 0:00:29
867000 -- [-2746.380] (-2756.220) (-2752.106) (-2754.579) * (-2757.628) [-2747.067] (-2750.908) (-2751.146) -- 0:00:29
868000 -- [-2747.272] (-2757.034) (-2755.303) (-2756.626) * (-2745.892) (-2755.185) (-2746.814) [-2745.742] -- 0:00:29
869000 -- (-2750.888) (-2754.609) [-2745.800] (-2757.921) * (-2751.941) [-2751.017] (-2752.045) (-2750.856) -- 0:00:28
870000 -- (-2764.020) (-2751.935) [-2748.354] (-2752.656) * (-2746.199) (-2751.604) [-2753.196] (-2748.337) -- 0:00:28
Average standard deviation of split frequencies: 0.015160
871000 -- [-2746.901] (-2746.804) (-2745.058) (-2747.537) * (-2752.745) (-2759.924) (-2752.481) [-2755.706] -- 0:00:28
872000 -- (-2745.586) (-2749.702) (-2750.787) [-2746.018] * (-2753.461) (-2747.991) (-2763.037) [-2749.988] -- 0:00:28
873000 -- (-2748.855) [-2751.468] (-2749.552) (-2758.840) * (-2748.711) (-2754.580) (-2752.740) [-2749.996] -- 0:00:27
874000 -- [-2748.137] (-2754.408) (-2749.502) (-2751.611) * (-2751.084) (-2749.107) [-2752.039] (-2753.465) -- 0:00:27
875000 -- (-2750.002) (-2750.113) [-2751.224] (-2747.102) * (-2751.297) (-2752.952) [-2753.800] (-2748.532) -- 0:00:27
Average standard deviation of split frequencies: 0.015337
876000 -- [-2747.878] (-2762.904) (-2750.604) (-2749.610) * (-2748.464) (-2760.898) (-2748.464) [-2748.383] -- 0:00:27
877000 -- (-2752.155) [-2756.101] (-2752.141) (-2757.436) * (-2756.121) [-2748.034] (-2753.220) (-2749.860) -- 0:00:27
878000 -- [-2753.077] (-2750.721) (-2744.677) (-2751.956) * [-2749.444] (-2749.275) (-2752.960) (-2746.621) -- 0:00:26
879000 -- [-2744.786] (-2749.590) (-2745.169) (-2753.405) * (-2755.805) [-2747.127] (-2753.595) (-2747.131) -- 0:00:26
880000 -- (-2752.493) [-2746.250] (-2759.769) (-2749.472) * (-2757.058) (-2751.192) (-2750.563) [-2749.028] -- 0:00:26
Average standard deviation of split frequencies: 0.017397
881000 -- (-2750.388) (-2748.941) [-2752.911] (-2754.599) * [-2751.048] (-2745.049) (-2746.810) (-2751.331) -- 0:00:26
882000 -- (-2756.187) (-2752.879) [-2754.784] (-2748.654) * (-2752.983) (-2745.480) (-2754.566) [-2750.548] -- 0:00:25
883000 -- (-2753.757) [-2752.147] (-2748.903) (-2746.895) * (-2766.948) (-2742.917) (-2751.858) [-2752.504] -- 0:00:25
884000 -- [-2747.000] (-2748.080) (-2754.896) (-2754.644) * (-2756.359) [-2749.246] (-2749.492) (-2748.173) -- 0:00:25
885000 -- (-2752.992) (-2747.896) (-2755.591) [-2747.578] * (-2749.442) (-2746.854) [-2743.509] (-2743.309) -- 0:00:25
Average standard deviation of split frequencies: 0.017824
886000 -- (-2750.846) (-2743.575) (-2757.007) [-2751.319] * (-2752.950) [-2753.862] (-2751.727) (-2748.782) -- 0:00:25
887000 -- (-2748.636) (-2745.264) (-2746.190) [-2750.925] * (-2755.790) [-2750.577] (-2750.947) (-2747.788) -- 0:00:24
888000 -- (-2754.145) (-2750.344) [-2752.199] (-2753.830) * (-2760.486) (-2750.678) [-2745.382] (-2751.144) -- 0:00:24
889000 -- [-2747.830] (-2750.389) (-2752.672) (-2751.600) * (-2747.935) [-2746.806] (-2745.126) (-2747.977) -- 0:00:24
890000 -- (-2749.485) (-2750.978) (-2758.914) [-2756.093] * (-2752.436) (-2747.146) [-2748.165] (-2753.290) -- 0:00:24
Average standard deviation of split frequencies: 0.016143
891000 -- (-2748.857) (-2745.412) (-2752.565) [-2748.057] * [-2748.843] (-2752.899) (-2749.282) (-2754.459) -- 0:00:23
892000 -- (-2748.568) (-2743.562) [-2754.402] (-2756.636) * (-2747.468) [-2745.910] (-2746.703) (-2749.912) -- 0:00:23
893000 -- (-2748.672) [-2744.887] (-2748.471) (-2751.406) * [-2748.863] (-2749.760) (-2752.308) (-2750.766) -- 0:00:23
894000 -- (-2755.643) [-2746.296] (-2759.372) (-2748.135) * (-2759.913) (-2746.871) [-2749.296] (-2752.189) -- 0:00:23
895000 -- (-2751.918) (-2747.849) [-2754.571] (-2751.327) * [-2752.247] (-2758.747) (-2746.749) (-2749.639) -- 0:00:23
Average standard deviation of split frequencies: 0.017099
896000 -- (-2751.319) (-2748.281) (-2747.846) [-2747.884] * (-2750.552) (-2748.927) [-2748.401] (-2750.134) -- 0:00:22
897000 -- (-2748.170) (-2748.565) [-2751.711] (-2748.926) * [-2749.413] (-2752.877) (-2752.983) (-2751.346) -- 0:00:22
898000 -- [-2750.502] (-2748.283) (-2750.051) (-2752.561) * (-2754.575) [-2751.723] (-2751.888) (-2747.643) -- 0:00:22
899000 -- [-2752.674] (-2751.335) (-2745.508) (-2760.792) * [-2753.309] (-2751.219) (-2747.726) (-2744.869) -- 0:00:22
900000 -- (-2748.785) (-2748.083) [-2746.280] (-2761.930) * (-2751.363) (-2753.772) (-2748.711) [-2746.450] -- 0:00:22
Average standard deviation of split frequencies: 0.017272
901000 -- (-2748.945) (-2750.761) [-2750.266] (-2753.316) * [-2750.247] (-2751.600) (-2757.305) (-2750.857) -- 0:00:21
902000 -- (-2753.112) [-2753.749] (-2753.600) (-2757.793) * [-2749.070] (-2748.180) (-2749.572) (-2752.661) -- 0:00:21
903000 -- (-2747.639) [-2749.857] (-2756.904) (-2753.099) * (-2750.900) (-2749.909) [-2752.905] (-2750.135) -- 0:00:21
904000 -- [-2746.798] (-2748.971) (-2747.756) (-2756.225) * (-2746.632) (-2752.722) [-2747.754] (-2753.711) -- 0:00:21
905000 -- (-2745.548) (-2747.610) (-2746.718) [-2752.110] * [-2751.110] (-2751.411) (-2749.490) (-2748.652) -- 0:00:20
Average standard deviation of split frequencies: 0.014309
906000 -- [-2749.015] (-2748.443) (-2752.706) (-2749.169) * (-2749.233) (-2755.592) [-2748.738] (-2754.014) -- 0:00:20
907000 -- (-2750.410) [-2749.872] (-2747.180) (-2749.516) * [-2749.099] (-2747.828) (-2746.303) (-2750.283) -- 0:00:20
908000 -- [-2750.176] (-2756.271) (-2754.274) (-2748.142) * (-2749.019) (-2749.302) [-2751.257] (-2750.267) -- 0:00:20
909000 -- (-2750.614) [-2748.134] (-2751.379) (-2748.967) * (-2751.721) (-2749.105) (-2744.759) [-2752.985] -- 0:00:20
910000 -- (-2756.642) (-2748.613) (-2754.390) [-2750.885] * (-2752.161) [-2747.492] (-2754.459) (-2753.999) -- 0:00:19
Average standard deviation of split frequencies: 0.015012
911000 -- [-2746.522] (-2753.766) (-2753.799) (-2748.982) * [-2748.985] (-2755.819) (-2760.695) (-2749.657) -- 0:00:19
912000 -- (-2749.570) [-2746.454] (-2748.132) (-2750.556) * (-2751.674) (-2750.881) (-2748.726) [-2749.100] -- 0:00:19
913000 -- [-2749.381] (-2749.142) (-2749.632) (-2745.042) * [-2749.147] (-2751.047) (-2749.644) (-2748.877) -- 0:00:19
914000 -- (-2752.946) (-2745.953) (-2749.712) [-2749.882] * (-2759.281) (-2749.383) (-2756.056) [-2746.966] -- 0:00:18
915000 -- (-2755.238) [-2749.198] (-2756.814) (-2751.104) * [-2753.953] (-2748.414) (-2746.972) (-2745.907) -- 0:00:18
Average standard deviation of split frequencies: 0.014410
916000 -- (-2754.240) [-2746.186] (-2753.723) (-2752.625) * (-2754.045) (-2747.421) [-2747.150] (-2756.132) -- 0:00:18
917000 -- (-2754.428) [-2747.839] (-2756.443) (-2751.183) * (-2750.151) (-2748.406) (-2750.372) [-2748.817] -- 0:00:18
918000 -- (-2750.062) (-2752.971) [-2745.688] (-2747.291) * (-2753.460) [-2747.630] (-2751.951) (-2748.289) -- 0:00:18
919000 -- (-2745.980) (-2750.104) (-2751.986) [-2747.651] * (-2747.652) [-2749.369] (-2753.953) (-2748.648) -- 0:00:17
920000 -- [-2746.793] (-2748.309) (-2746.730) (-2746.165) * (-2749.501) (-2754.375) (-2748.011) [-2753.159] -- 0:00:17
Average standard deviation of split frequencies: 0.015617
921000 -- [-2747.781] (-2748.316) (-2754.504) (-2749.332) * (-2748.337) [-2746.933] (-2752.394) (-2750.302) -- 0:00:17
922000 -- [-2749.175] (-2745.967) (-2759.661) (-2752.702) * (-2751.044) (-2753.292) [-2753.919] (-2761.820) -- 0:00:17
923000 -- (-2749.925) [-2749.169] (-2753.321) (-2748.810) * (-2754.181) (-2756.614) (-2753.300) [-2751.667] -- 0:00:16
924000 -- (-2753.844) [-2748.450] (-2748.970) (-2754.278) * (-2751.353) (-2756.141) (-2748.857) [-2749.183] -- 0:00:16
925000 -- (-2745.769) (-2748.070) (-2755.621) [-2747.737] * (-2752.374) (-2756.424) [-2749.294] (-2750.248) -- 0:00:16
Average standard deviation of split frequencies: 0.017054
926000 -- [-2748.811] (-2751.434) (-2748.114) (-2748.448) * (-2748.133) (-2768.469) (-2749.437) [-2751.887] -- 0:00:16
927000 -- (-2748.381) (-2750.026) (-2753.651) [-2749.151] * [-2748.496] (-2751.089) (-2757.033) (-2753.949) -- 0:00:16
928000 -- (-2743.029) (-2755.000) [-2750.791] (-2746.006) * [-2747.304] (-2751.086) (-2754.588) (-2754.214) -- 0:00:15
929000 -- (-2747.494) (-2750.164) [-2749.914] (-2747.757) * (-2757.600) (-2752.179) [-2754.621] (-2755.172) -- 0:00:15
930000 -- (-2748.500) (-2749.716) (-2750.308) [-2749.042] * [-2756.526] (-2750.687) (-2746.393) (-2746.893) -- 0:00:15
Average standard deviation of split frequencies: 0.018741
931000 -- [-2752.043] (-2753.039) (-2746.476) (-2753.276) * (-2749.813) (-2754.033) (-2754.808) [-2749.267] -- 0:00:15
932000 -- (-2749.183) (-2752.212) [-2754.815] (-2749.510) * (-2746.020) (-2755.174) [-2748.466] (-2751.359) -- 0:00:14
933000 -- (-2746.632) (-2746.182) [-2748.911] (-2746.484) * [-2750.960] (-2748.432) (-2750.724) (-2752.734) -- 0:00:14
934000 -- (-2746.556) (-2748.446) (-2752.317) [-2747.907] * (-2751.519) [-2749.858] (-2749.969) (-2755.766) -- 0:00:14
935000 -- (-2752.216) (-2749.044) (-2748.492) [-2750.841] * (-2752.341) (-2751.307) [-2747.767] (-2750.219) -- 0:00:14
Average standard deviation of split frequencies: 0.018886
936000 -- (-2749.011) (-2747.859) (-2752.075) [-2747.372] * [-2745.579] (-2745.786) (-2746.708) (-2751.116) -- 0:00:14
937000 -- (-2754.865) [-2745.940] (-2749.067) (-2751.155) * [-2748.152] (-2750.308) (-2746.571) (-2751.548) -- 0:00:13
938000 -- (-2754.354) (-2763.197) [-2747.972] (-2754.273) * [-2747.792] (-2753.661) (-2755.452) (-2749.071) -- 0:00:13
939000 -- [-2749.647] (-2750.603) (-2753.439) (-2758.807) * (-2745.148) [-2748.611] (-2756.403) (-2753.007) -- 0:00:13
940000 -- (-2753.254) (-2749.303) (-2748.174) [-2750.723] * (-2740.747) (-2745.120) [-2753.540] (-2752.908) -- 0:00:13
Average standard deviation of split frequencies: 0.019544
941000 -- (-2750.939) (-2745.994) [-2749.721] (-2749.244) * [-2750.922] (-2752.130) (-2755.804) (-2755.115) -- 0:00:12
942000 -- (-2758.978) (-2748.673) [-2749.238] (-2746.823) * [-2752.527] (-2747.210) (-2747.491) (-2747.176) -- 0:00:12
943000 -- [-2751.646] (-2756.111) (-2750.120) (-2752.752) * (-2754.394) (-2755.128) (-2746.937) [-2745.685] -- 0:00:12
944000 -- (-2756.158) [-2749.647] (-2754.238) (-2749.492) * (-2757.933) [-2748.126] (-2749.052) (-2750.583) -- 0:00:12
945000 -- (-2758.672) (-2757.598) (-2749.264) [-2747.113] * [-2748.143] (-2755.005) (-2754.405) (-2747.346) -- 0:00:12
Average standard deviation of split frequencies: 0.017690
946000 -- (-2753.793) (-2749.169) [-2748.855] (-2742.787) * [-2748.770] (-2750.003) (-2754.028) (-2747.031) -- 0:00:11
947000 -- (-2753.859) (-2749.524) (-2748.201) [-2745.069] * (-2749.869) (-2749.770) [-2749.115] (-2751.062) -- 0:00:11
948000 -- (-2749.224) (-2751.594) [-2748.335] (-2752.082) * [-2749.252] (-2746.372) (-2752.379) (-2749.457) -- 0:00:11
949000 -- (-2746.039) (-2746.055) (-2747.862) [-2747.224] * (-2751.810) [-2753.323] (-2751.062) (-2750.078) -- 0:00:11
950000 -- (-2758.479) [-2747.753] (-2754.072) (-2749.709) * (-2750.434) (-2754.115) (-2751.582) [-2746.996] -- 0:00:11
Average standard deviation of split frequencies: 0.019587
951000 -- (-2748.244) (-2748.588) [-2750.591] (-2748.952) * (-2752.884) (-2750.789) (-2753.707) [-2749.710] -- 0:00:10
952000 -- (-2747.002) (-2746.901) (-2750.620) [-2753.512] * (-2752.677) [-2752.942] (-2748.772) (-2748.315) -- 0:00:10
953000 -- (-2756.797) [-2752.027] (-2752.313) (-2751.925) * (-2747.515) [-2748.778] (-2756.234) (-2748.511) -- 0:00:10
954000 -- (-2759.765) [-2748.199] (-2751.894) (-2747.686) * (-2750.006) [-2748.581] (-2763.092) (-2752.007) -- 0:00:10
955000 -- (-2753.397) (-2754.232) [-2744.778] (-2750.032) * (-2745.477) (-2751.351) (-2752.537) [-2751.556] -- 0:00:09
Average standard deviation of split frequencies: 0.018738
956000 -- [-2753.281] (-2749.302) (-2747.670) (-2751.222) * (-2750.817) (-2753.311) (-2752.831) [-2746.013] -- 0:00:09
957000 -- [-2751.885] (-2750.718) (-2746.386) (-2752.535) * [-2747.990] (-2743.108) (-2749.508) (-2752.376) -- 0:00:09
958000 -- (-2752.794) (-2756.044) (-2748.991) [-2748.118] * (-2747.972) (-2749.605) (-2748.374) [-2749.119] -- 0:00:09
959000 -- [-2748.784] (-2757.710) (-2752.594) (-2748.565) * [-2747.708] (-2752.368) (-2746.056) (-2749.053) -- 0:00:09
960000 -- (-2746.420) (-2758.259) (-2754.213) [-2749.187] * [-2744.561] (-2747.650) (-2752.084) (-2750.946) -- 0:00:08
Average standard deviation of split frequencies: 0.020364
961000 -- (-2750.934) (-2764.109) (-2747.773) [-2747.769] * (-2754.206) [-2746.721] (-2751.000) (-2750.959) -- 0:00:08
962000 -- (-2751.755) (-2758.918) (-2749.828) [-2751.322] * (-2749.058) (-2750.416) [-2752.523] (-2746.696) -- 0:00:08
963000 -- (-2746.668) (-2749.973) (-2752.255) [-2747.091] * [-2744.437] (-2753.550) (-2744.134) (-2747.816) -- 0:00:08
964000 -- (-2751.557) [-2749.525] (-2747.745) (-2750.839) * (-2755.762) (-2751.383) [-2750.958] (-2746.861) -- 0:00:07
965000 -- [-2750.121] (-2750.829) (-2748.085) (-2747.121) * [-2754.553] (-2749.596) (-2750.310) (-2752.473) -- 0:00:07
Average standard deviation of split frequencies: 0.020740
966000 -- (-2747.518) (-2745.614) (-2750.518) [-2751.748] * (-2748.472) (-2744.291) [-2747.603] (-2745.729) -- 0:00:07
967000 -- (-2748.182) (-2752.740) (-2751.199) [-2748.610] * [-2746.878] (-2748.597) (-2751.088) (-2751.233) -- 0:00:07
968000 -- (-2746.911) [-2753.073] (-2754.092) (-2762.070) * (-2754.817) (-2752.881) (-2748.362) [-2749.181] -- 0:00:07
969000 -- [-2750.378] (-2748.783) (-2751.004) (-2753.987) * (-2746.211) (-2752.808) (-2743.983) [-2746.861] -- 0:00:06
970000 -- (-2749.150) [-2745.752] (-2757.593) (-2748.965) * (-2757.071) [-2746.642] (-2750.049) (-2752.365) -- 0:00:06
Average standard deviation of split frequencies: 0.019183
971000 -- (-2748.718) (-2749.155) [-2747.961] (-2748.142) * (-2747.425) (-2753.830) [-2754.045] (-2749.538) -- 0:00:06
972000 -- [-2746.636] (-2748.084) (-2750.218) (-2746.798) * [-2750.683] (-2759.291) (-2752.525) (-2750.393) -- 0:00:06
973000 -- (-2744.837) [-2749.489] (-2749.621) (-2748.404) * (-2752.530) (-2748.928) [-2751.709] (-2755.164) -- 0:00:05
974000 -- (-2744.604) (-2750.415) [-2747.159] (-2754.102) * (-2748.834) [-2749.512] (-2750.018) (-2751.587) -- 0:00:05
975000 -- (-2760.404) [-2742.880] (-2751.230) (-2746.914) * (-2749.576) (-2745.440) [-2750.264] (-2748.344) -- 0:00:05
Average standard deviation of split frequencies: 0.021252
976000 -- (-2747.270) (-2755.179) [-2746.625] (-2756.522) * (-2754.654) [-2750.179] (-2748.142) (-2748.225) -- 0:00:05
977000 -- (-2747.728) [-2749.004] (-2747.711) (-2753.698) * (-2746.798) (-2752.578) [-2744.925] (-2752.544) -- 0:00:05
978000 -- [-2749.885] (-2749.238) (-2758.453) (-2749.165) * [-2744.114] (-2751.556) (-2748.584) (-2753.555) -- 0:00:04
979000 -- (-2754.116) (-2747.408) (-2750.151) [-2747.413] * [-2747.470] (-2751.092) (-2751.467) (-2748.945) -- 0:00:04
980000 -- (-2749.682) (-2745.770) [-2747.949] (-2751.811) * (-2752.540) (-2752.341) [-2744.784] (-2755.447) -- 0:00:04
Average standard deviation of split frequencies: 0.024035
981000 -- (-2748.311) (-2753.442) (-2758.120) [-2756.272] * (-2762.595) (-2759.923) [-2751.724] (-2750.459) -- 0:00:04
982000 -- (-2753.528) (-2753.928) (-2746.799) [-2746.449] * (-2746.401) (-2754.230) (-2743.926) [-2749.549] -- 0:00:03
983000 -- (-2747.522) (-2758.116) (-2755.068) [-2747.697] * (-2746.549) (-2751.141) (-2747.764) [-2746.675] -- 0:00:03
984000 -- (-2760.062) (-2749.092) [-2746.152] (-2751.088) * [-2749.620] (-2747.293) (-2748.509) (-2749.285) -- 0:00:03
985000 -- [-2746.706] (-2754.165) (-2748.660) (-2751.339) * (-2751.833) [-2748.020] (-2751.258) (-2754.841) -- 0:00:03
Average standard deviation of split frequencies: 0.023188
986000 -- (-2746.965) (-2755.039) [-2751.344] (-2748.293) * (-2754.723) (-2750.100) [-2748.517] (-2754.461) -- 0:00:03
987000 -- (-2750.549) (-2751.835) [-2749.525] (-2749.387) * (-2751.067) (-2757.602) [-2745.454] (-2744.831) -- 0:00:02
988000 -- (-2753.510) [-2753.425] (-2745.934) (-2747.946) * [-2753.206] (-2751.409) (-2747.396) (-2750.540) -- 0:00:02
989000 -- (-2745.134) (-2754.179) (-2748.635) [-2748.461] * [-2750.785] (-2748.793) (-2750.450) (-2754.409) -- 0:00:02
990000 -- (-2746.430) (-2759.630) (-2757.595) [-2749.753] * (-2749.936) (-2747.142) [-2748.329] (-2748.138) -- 0:00:02
Average standard deviation of split frequencies: 0.021413
991000 -- (-2746.260) (-2756.507) [-2749.838] (-2752.865) * (-2746.962) (-2746.166) [-2746.962] (-2747.844) -- 0:00:01
992000 -- (-2747.990) (-2750.341) [-2751.364] (-2750.419) * (-2749.318) [-2747.134] (-2748.855) (-2751.388) -- 0:00:01
993000 -- [-2747.272] (-2754.851) (-2754.074) (-2755.843) * (-2752.112) (-2754.593) (-2749.869) [-2748.385] -- 0:00:01
994000 -- (-2745.379) (-2751.525) [-2749.919] (-2761.457) * [-2746.180] (-2748.221) (-2745.194) (-2750.586) -- 0:00:01
995000 -- (-2744.475) (-2750.618) (-2750.823) [-2751.519] * (-2749.460) [-2746.923] (-2748.721) (-2759.837) -- 0:00:01
Average standard deviation of split frequencies: 0.020588
996000 -- (-2748.174) [-2751.591] (-2755.749) (-2753.081) * (-2748.074) (-2747.126) (-2752.786) [-2748.401] -- 0:00:00
997000 -- (-2749.058) [-2748.240] (-2754.749) (-2751.497) * (-2753.362) (-2752.376) (-2749.583) [-2743.544] -- 0:00:00
998000 -- [-2747.075] (-2747.028) (-2752.347) (-2753.766) * (-2747.973) (-2751.319) (-2747.025) [-2749.116] -- 0:00:00
999000 -- (-2747.809) (-2745.669) [-2747.931] (-2747.149) * [-2751.152] (-2745.808) (-2749.400) (-2749.723) -- 0:00:00
1000000 -- (-2749.440) (-2749.780) (-2745.198) [-2746.586] * [-2745.264] (-2748.443) (-2751.589) (-2745.727) -- 0:00:00
Average standard deviation of split frequencies: 0.021906
Analysis completed in 3 mins 40 seconds
Analysis used 219.93 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2740.87
Likelihood of best state for "cold" chain of run 2 was -2740.84
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
32.2 % ( 19 %) Dirichlet(Revmat{all})
56.2 % ( 46 %) Slider(Revmat{all})
23.8 % ( 27 %) Dirichlet(Pi{all})
25.8 % ( 23 %) Slider(Pi{all})
34.4 % ( 24 %) Multiplier(Alpha{1,2})
47.2 % ( 25 %) Multiplier(Alpha{3})
45.9 % ( 22 %) Slider(Pinvar{all})
33.7 % ( 38 %) ExtSPR(Tau{all},V{all})
34.1 % ( 40 %) NNI(Tau{all},V{all})
38.2 % ( 55 %) ParsSPR(Tau{all},V{all})
25.9 % ( 28 %) Multiplier(V{all})
25.4 % ( 19 %) Nodeslider(V{all})
25.4 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
32.4 % ( 27 %) Dirichlet(Revmat{all})
56.9 % ( 41 %) Slider(Revmat{all})
23.0 % ( 26 %) Dirichlet(Pi{all})
26.4 % ( 28 %) Slider(Pi{all})
33.6 % ( 26 %) Multiplier(Alpha{1,2})
47.3 % ( 28 %) Multiplier(Alpha{3})
45.4 % ( 25 %) Slider(Pinvar{all})
33.9 % ( 37 %) ExtSPR(Tau{all},V{all})
34.2 % ( 40 %) NNI(Tau{all},V{all})
37.7 % ( 41 %) ParsSPR(Tau{all},V{all})
25.9 % ( 26 %) Multiplier(V{all})
25.3 % ( 26 %) Nodeslider(V{all})
25.3 % ( 32 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 166557 0.86 0.73
3 | 166832 166838 0.87
4 | 166575 166219 166979
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.71 0.59
2 | 166901 0.86 0.73
3 | 166999 166584 0.87
4 | 166632 166584 166300
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2747.55
| 1 2 1 |
| 2 2 2 |
|2 2 1 2 2 |
| 1 1 2 |
| 2 1 2 12 2 1 12 2 |
|1 12 1 1 1 2 1 2 21 |
| 1 1 2 *1 1 122 * 2 1 1 1 2 11|
| 2 1 1 2 2 1 2 1 1 2 2|
| 1 2 211 11 1 2 2 2 1 |
| * 1 2 11 2 2 2 2 * * 1 |
| 2 21 22 2 2* |
| 2 2 1 1 221 2 1 1 |
| 1 22 1 |
| 1 1 |
| 2 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2750.63
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2746.33 -2757.25
2 -2746.30 -2755.89
--------------------------------------
TOTAL -2746.32 -2756.79
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.758356 0.117618 1.209732 2.422642 1.702358 603.78 676.79 1.000
r(A<->C){all} 0.017884 0.000203 0.000003 0.046152 0.014845 734.76 796.80 1.000
r(A<->G){all} 0.382895 0.004558 0.251118 0.512757 0.382036 344.33 447.59 1.000
r(A<->T){all} 0.076631 0.000325 0.041542 0.112264 0.075618 463.55 658.83 1.000
r(C<->G){all} 0.010057 0.000080 0.000001 0.027860 0.007508 768.64 825.75 1.000
r(C<->T){all} 0.506121 0.005617 0.376491 0.669285 0.504561 153.86 242.89 1.000
r(G<->T){all} 0.006412 0.000030 0.000003 0.017079 0.005022 1063.50 1076.73 1.000
pi(A){all} 0.266054 0.000144 0.242359 0.290059 0.265924 1053.91 1202.96 1.000
pi(C){all} 0.166623 0.000097 0.147877 0.185854 0.166476 593.48 934.14 1.000
pi(G){all} 0.237042 0.000143 0.215824 0.262194 0.236852 1179.38 1235.16 1.000
pi(T){all} 0.330280 0.000170 0.304961 0.354783 0.330450 1101.74 1147.73 1.001
alpha{1,2} 0.070701 0.000443 0.014109 0.102596 0.075258 809.04 822.77 1.000
alpha{3} 4.062788 2.273282 1.552859 7.073329 3.833098 1412.76 1426.68 1.000
pinvar{all} 0.261553 0.002079 0.173867 0.351149 0.263047 915.10 1208.05 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .*.*
6 -- ..**
----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 1727 0.575283 0.021199 0.560293 0.590273 2
6 1140 0.379747 0.022612 0.363757 0.395736 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.511615 0.019954 0.290593 0.798564 0.489850 1.000 2
length{all}[2] 0.178514 0.003367 0.072531 0.295239 0.173653 1.000 2
length{all}[3] 0.596715 0.022635 0.333882 0.874670 0.576084 1.000 2
length{all}[4] 0.372706 0.010514 0.201810 0.587143 0.357913 1.000 2
length{all}[5] 0.108607 0.003858 0.000615 0.213270 0.100841 1.000 2
length{all}[6] 0.090796 0.002878 0.000091 0.189920 0.083775 0.999 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.021906
Maximum standard deviation of split frequencies = 0.022612
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C3 (3)
+
| /------------------------------------ C2 (2)
\-----------------58----------------+
\------------------------------------ C4 (4)
Phylogram (based on average branch lengths):
/------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C3 (3)
+
| /--------------------- C2 (2)
\------------+
\-------------------------------------------- C4 (4)
|-----------| 0.100 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
90 % credible set contains 2 trees
95 % credible set contains 2 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Wed Oct 26 00:49:25 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=337
C1 SLENVAYNVLKSGHFTAIAGELPVAILNDRLYIKEEGVDKLLFTNNTCLP
C2 SLENVAYNVLKSGHFMAVAGELPVAILNDRLYIKEDGVDKLLFTNNTCLP
C3 SLENVAYNVLKSGHFTPVAGELPVAIFNDRLYIREDGVDKLLFTNNTCLP
C4 SLENVAYNVLKSGHFTAVAGELPVAILNDRLYIKEDGADKLLFTNNTCLP
*************** .:********:******:*:*.************
C1 TNVAFELWAKRSVNVVPEVKLLHNLGVTCTYNLVIWDYECNAPLVPNTVG
C2 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYENNAPLVPNTVG
C3 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYEHNAPLVPNTVG
C4 TNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYESNAPLVPNTVG
**********************:**************** **********
C1 VCTYTDLTKLDDQIVLVDGRQLDSYSKFCQLKNAVYFSPSKPKCICTKGP
C2 ICNYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPSKPKCVCTKGP
C3 VCTYTDLINLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPTKPKCISARGP
C4 ICTYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAIYFSPSKPKCVCTRGP
:*.**** :****:*********:**********:****:****:.::**
C1 PHASINGVIVEAADRGTAFWYAMRKDGAFVQLTDGYFTQSRTLNDFQPRT
C2 THASINGVVVEAPDKGTAFWYAVRKDGAFVQPTDGYFTQSRTLDDFQPRT
C3 MHASINGVVVEAPDKGTAFWYAVRKDGAFVQPADGYFTQSRTLDNFQPRT
C4 THASINGVVVEAPDRGTAFWYAMRKDGAFVQPTDGYFTQSRTVDDFQPRT
*******:***.*:*******:******** :*********:::*****
C1 QLEIDFLDLEQSCFLDKYDLHDLGLEHIAYGQFDGTIGGLHLLIGAVRRK
C2 QLELDFLDLEQSCFLDKYDLHDLGLEHIAYGQFEGTIGGLHLLIGAVRRK
C3 QLELDFLDLDESCFLDRYDLHDLGLEHIAYGQFEGTIGGLHLLLGAVRRR
C4 QLEIDFLDLEQSCFLDKYDLHDLGLEHIVYGQFDGTIGGLHLLIGAVRRK
***:*****::*****:***********.****:*********:*****:
C1 RTANLVMETVLGTDTVTAYAVIDQPTASSKQVCSVFDMVLDDFIELIRAQ
C2 RTANLVMETVLGTDTVTSYAVIDQPTASSKQVCSVFDMILDDFIELIKAQ
C3 RTANLVMETVLGTDTVTSYAVIDQPTAANKQVCSVFDMVLDDFVALIKSQ
C4 RTAHLVMETVLGTDTVTSYAVIDQPTASSKQVCSVVDIILDDFIALIKAQ
***:*************:*********:.******.*::****: **::*
C1 DRSVVSKVVQCCLDFKMFRFMLWCKDGKVATFYPQLQ
C2 DRSVVSKVVQCCLDFKVFRFMLWCKDGKVATFYPQLQ
C3 DRTVVSKVVQCCLDFKMFRFMLWCKDGKIATFYPQLQ
C4 DRSVVSKVVQCCLDFKVFRFMLWCKGGKISTFYPQLQ
**:*************:********.**::*******
-- Starting log on Wed Oct 26 02:10:22 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/codeml,BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C1 1011 sites
reading seq# 2 C2 1011 sites
reading seq# 3 C3 1011 sites
reading seq# 4 C4 1011 sitesns = 4 ls = 1011
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Sequences read..
Counting site patterns.. 0:00
Compressing, 241 patterns at 337 / 337 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 241 patterns at 337 / 337 sites (100.0%), 0:00
Counting codons..
48 bytes for distance
235216 bytes for conP
21208 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 3, (2, 4)); MP score: 340
0.108319 0.109193 0.040510 0.107088 0.052574 0.300000 0.574819 0.149866
ntime & nrate & np: 5 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.947694
np = 8
lnL0 = -3164.530594
Iterating by ming2
Initial: fx= 3164.530594
x= 0.10832 0.10919 0.04051 0.10709 0.05257 0.30000 0.57482 0.14987
1 h-m-p 0.0000 0.0006 1607.4373 +++ 2724.800125 m 0.0006 14 | 0/8
2 h-m-p 0.0000 0.0001 18608.2470 CCCCC 2665.550083 4 0.0000 33 | 0/8
3 h-m-p 0.0001 0.0007 292.0574 +CYCCC 2637.494730 4 0.0006 52 | 0/8
4 h-m-p 0.0015 0.0080 114.3065 ++ 2589.317254 m 0.0080 63 | 0/8
5 h-m-p 0.0011 0.0053 147.7671 CCCC 2583.604859 3 0.0015 80 | 0/8
6 h-m-p 0.0025 0.0163 88.3821 CCCC 2576.062761 3 0.0039 97 | 0/8
7 h-m-p 0.0060 0.0300 31.1740 CCCCC 2573.145156 4 0.0072 116 | 0/8
8 h-m-p 0.0460 0.2468 4.8429 CCC 2572.908149 2 0.0105 131 | 0/8
9 h-m-p 0.0578 0.2890 0.8793 +YYYCCCCC 2565.163907 7 0.2376 154 | 0/8
10 h-m-p 1.0291 5.1455 0.0512 CCC 2564.321289 2 1.5322 177 | 0/8
11 h-m-p 0.4763 8.0000 0.1647 YCCC 2563.643857 3 1.0353 201 | 0/8
12 h-m-p 0.5115 2.5612 0.3334 +YCCC 2561.885655 3 1.3320 226 | 0/8
13 h-m-p 1.6000 8.0000 0.0406 YCC 2561.793782 2 1.1001 248 | 0/8
14 h-m-p 1.6000 8.0000 0.0253 YC 2561.783897 1 0.9567 268 | 0/8
15 h-m-p 1.6000 8.0000 0.0082 CC 2561.774324 1 2.2197 289 | 0/8
16 h-m-p 1.6000 8.0000 0.0044 CC 2561.771295 1 1.8137 310 | 0/8
17 h-m-p 1.6000 8.0000 0.0006 +YC 2561.769186 1 4.9749 331 | 0/8
18 h-m-p 0.4301 8.0000 0.0071 +CC 2561.765684 1 2.4547 353 | 0/8
19 h-m-p 1.6000 8.0000 0.0039 Y 2561.765547 0 1.2664 372 | 0/8
20 h-m-p 1.6000 8.0000 0.0001 Y 2561.765546 0 1.0438 391 | 0/8
21 h-m-p 1.6000 8.0000 0.0000 Y 2561.765546 0 0.9612 410 | 0/8
22 h-m-p 1.6000 8.0000 0.0000 Y 2561.765546 0 0.7194 429 | 0/8
23 h-m-p 1.6000 8.0000 0.0000 ---------------N 2561.765546 0 0.0000 463
Out..
lnL = -2561.765546
464 lfun, 1392 eigenQcodon, 4640 P(t)
end of tree file.
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 3, (2, 4)); MP score: 340
0.044866 0.038198 0.047769 0.101677 0.029772 2.994103 1.416282 0.574397 0.225792 1.511996
ntime & nrate & np: 5 3 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.073437
np = 10
lnL0 = -3120.465763
Iterating by ming2
Initial: fx= 3120.465763
x= 0.04487 0.03820 0.04777 0.10168 0.02977 2.99410 1.41628 0.57440 0.22579 1.51200
1 h-m-p 0.0000 0.0013 3319.4091 ++YCYYCCC 2728.940416 6 0.0003 27 | 0/10
2 h-m-p 0.0001 0.0004 461.5890 ++ 2668.120959 m 0.0004 40 | 0/10
3 h-m-p 0.0014 0.0071 92.4213 ++ 2625.146668 m 0.0071 53 | 0/10
4 h-m-p 0.0035 0.0177 186.9643 YCYCCC 2580.744016 5 0.0074 74 | 0/10
5 h-m-p 0.0022 0.0112 64.3605 YCYCCC 2570.405860 5 0.0061 95 | 0/10
6 h-m-p 0.0137 0.0683 15.2109 YCCC 2569.753142 3 0.0064 113 | 0/10
7 h-m-p 0.0153 0.0767 5.5102 CC 2569.555243 1 0.0129 128 | 0/10
8 h-m-p 0.0085 0.0424 4.9788 ++ 2568.796455 m 0.0424 141 | 1/10
9 h-m-p 0.0680 0.7971 2.0739 +CCCC 2566.807320 3 0.3742 161 | 1/10
10 h-m-p 0.3948 8.0000 1.9662 CYCCC 2565.886612 4 0.3266 181 | 1/10
11 h-m-p 1.5660 8.0000 0.4100 YYC 2564.652838 2 1.1761 196 | 1/10
12 h-m-p 0.4574 2.2868 0.3548 CCCC 2564.040392 3 0.7557 224 | 1/10
13 h-m-p 0.5667 8.0000 0.4730 CCC 2563.683135 2 0.5367 250 | 1/10
14 h-m-p 1.0548 8.0000 0.2407 +YC 2563.109102 1 2.8525 274 | 1/10
15 h-m-p 1.6000 8.0000 0.2683 CCCC 2562.607221 3 2.1206 302 | 1/10
16 h-m-p 1.6000 8.0000 0.1862 CCCC 2562.281533 3 2.5896 330 | 1/10
17 h-m-p 1.6000 8.0000 0.2219 YCYCCC 2561.806229 5 3.9007 360 | 1/10
18 h-m-p 1.6000 8.0000 0.1062 YC 2561.768191 1 0.8845 383 | 1/10
19 h-m-p 1.3289 8.0000 0.0707 YC 2561.765855 1 0.5953 406 | 1/10
20 h-m-p 1.6000 8.0000 0.0168 YC 2561.765560 1 0.7475 429 | 1/10
21 h-m-p 1.6000 8.0000 0.0012 Y 2561.765546 0 1.0271 451 | 1/10
22 h-m-p 1.6000 8.0000 0.0001 Y 2561.765546 0 0.9834 473 | 1/10
23 h-m-p 1.6000 8.0000 0.0000 Y 2561.765546 0 0.7554 495 | 1/10
24 h-m-p 1.6000 8.0000 0.0000 Y 2561.765546 0 0.8561 517 | 1/10
25 h-m-p 1.6000 8.0000 0.0000 C 2561.765546 0 1.6000 539 | 1/10
26 h-m-p 1.6000 8.0000 0.0000 -------Y 2561.765546 0 0.0000 568
Out..
lnL = -2561.765546
569 lfun, 2276 eigenQcodon, 8535 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -2584.117856 S = -2498.594360 -103.156218
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 241 patterns 0:07
did 20 / 241 patterns 0:07
did 30 / 241 patterns 0:07
did 40 / 241 patterns 0:07
did 50 / 241 patterns 0:07
did 60 / 241 patterns 0:07
did 70 / 241 patterns 0:07
did 80 / 241 patterns 0:07
did 90 / 241 patterns 0:07
did 100 / 241 patterns 0:07
did 110 / 241 patterns 0:07
did 120 / 241 patterns 0:07
did 130 / 241 patterns 0:07
did 140 / 241 patterns 0:08
did 150 / 241 patterns 0:08
did 160 / 241 patterns 0:08
did 170 / 241 patterns 0:08
did 180 / 241 patterns 0:08
did 190 / 241 patterns 0:08
did 200 / 241 patterns 0:08
did 210 / 241 patterns 0:08
did 220 / 241 patterns 0:08
did 230 / 241 patterns 0:08
did 240 / 241 patterns 0:08
did 241 / 241 patterns 0:08end of tree file.
Time used: 0:08
Model 7: beta
TREE # 1
(1, 3, (2, 4)); MP score: 340
0.082709 0.025222 0.059855 0.065316 0.055868 2.994103 0.565984 1.133299
ntime & nrate & np: 5 1 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 7.251816
np = 8
lnL0 = -2999.513739
Iterating by ming2
Initial: fx= 2999.513739
x= 0.08271 0.02522 0.05986 0.06532 0.05587 2.99410 0.56598 1.13330
1 h-m-p 0.0000 0.0038 3268.0840 ++YYCYCCC 2664.469574 6 0.0003 24 | 0/8
2 h-m-p 0.0005 0.0027 220.2716 +YYYYYYYYCC 2572.518485 10 0.0022 47 | 0/8
3 h-m-p 0.0011 0.0054 30.9489 +YCCC 2570.909049 3 0.0032 64 | 0/8
4 h-m-p 0.0087 0.0823 11.3562 CCC 2570.761804 2 0.0026 79 | 0/8
5 h-m-p 0.0098 0.0794 2.9698 YC 2570.741807 1 0.0039 91 | 0/8
6 h-m-p 0.0057 0.0749 2.0663 YC 2570.728715 1 0.0039 103 | 0/8
7 h-m-p 0.0160 8.0000 0.8109 ++++CYCC 2563.451954 3 4.2596 123 | 0/8
8 h-m-p 0.0099 0.0494 7.8047 YCCC 2562.536238 3 0.0161 147 | 0/8
9 h-m-p 0.0902 8.0000 1.3940 +YCCC 2562.200097 3 0.2368 164 | 0/8
10 h-m-p 0.9233 8.0000 0.3575 CYC 2561.698025 2 0.9430 178 | 0/8
11 h-m-p 1.1851 8.0000 0.2845 +YC 2561.240181 1 3.2290 199 | 0/8
12 h-m-p 1.6000 8.0000 0.5225 CCC 2560.858460 2 2.0015 222 | 0/8
13 h-m-p 1.6000 8.0000 0.3247 CC 2560.796539 1 1.6587 243 | 0/8
14 h-m-p 1.6000 8.0000 0.1505 YC 2560.762827 1 3.3647 263 | 0/8
15 h-m-p 1.6000 8.0000 0.1094 YCC 2560.736296 2 2.6788 285 | 0/8
16 h-m-p 1.6000 8.0000 0.0322 CC 2560.730188 1 2.1460 306 | 0/8
17 h-m-p 1.3271 8.0000 0.0521 ++ 2560.704962 m 8.0000 325 | 0/8
18 h-m-p 0.6516 8.0000 0.6399 YC 2560.680406 1 1.3532 345 | 0/8
19 h-m-p 1.6000 8.0000 0.0106 YC 2560.679713 1 1.2686 365 | 0/8
20 h-m-p 1.6000 8.0000 0.0048 Y 2560.679710 0 1.1445 384 | 0/8
21 h-m-p 1.6000 8.0000 0.0002 Y 2560.679710 0 1.2059 403 | 0/8
22 h-m-p 1.6000 8.0000 0.0001 C 2560.679710 0 1.4251 422 | 0/8
23 h-m-p 1.6000 8.0000 0.0000 Y 2560.679710 0 1.0331 441 | 0/8
24 h-m-p 1.6000 8.0000 0.0000 -Y 2560.679710 0 0.1000 461
Out..
lnL = -2560.679710
462 lfun, 5082 eigenQcodon, 23100 P(t)
end of tree file.
Time used: 0:20
Model 8: beta&w>1
TREE # 1
(1, 3, (2, 4)); MP score: 340
0.095109 0.084235 0.024939 0.016206 0.050348 2.958120 0.900000 1.113973 1.203382 1.300000
ntime & nrate & np: 5 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.396277
np = 10
lnL0 = -3076.649909
Iterating by ming2
Initial: fx= 3076.649909
x= 0.09511 0.08423 0.02494 0.01621 0.05035 2.95812 0.90000 1.11397 1.20338 1.30000
1 h-m-p 0.0000 0.0004 3786.0801 ++YYYYCC 2783.840816 5 0.0002 23 | 0/10
2 h-m-p 0.0001 0.0003 355.4682 ++ 2751.316926 m 0.0003 36 | 1/10
3 h-m-p 0.0005 0.0046 191.4086 ++ 2620.699043 m 0.0046 49 | 1/10
4 h-m-p 0.0000 0.0000 703603.0241
h-m-p: 6.52216643e-24 3.26108322e-23 7.03603024e+05 2620.699043
.. | 1/10
5 h-m-p 0.0000 0.0022 233.7297 +++YCCCCCC 2574.777899 6 0.0015 87 | 1/10
6 h-m-p 0.0010 0.0050 67.7644 YCCCC 2568.707991 4 0.0026 107 | 1/10
7 h-m-p 0.0009 0.0044 102.7497 YCCC 2567.166782 3 0.0007 125 | 1/10
8 h-m-p 0.0036 0.0179 11.5721 CCC 2566.844045 2 0.0052 142 | 1/10
9 h-m-p 0.0082 0.2630 7.3303 YC 2566.478309 1 0.0182 156 | 1/10
10 h-m-p 0.0078 0.1446 17.1666 YCCC 2565.751613 3 0.0176 174 | 1/10
11 h-m-p 0.0040 0.0198 8.7534 C 2565.685164 0 0.0040 187 | 1/10
12 h-m-p 0.0442 5.6352 0.7878 ++CCCC 2564.650172 3 0.7207 208 | 1/10
13 h-m-p 0.3373 8.0000 1.6834 CYC 2563.613299 2 0.3693 233 | 1/10
14 h-m-p 1.0716 8.0000 0.5801 YCCC 2562.205226 3 1.8776 251 | 1/10
15 h-m-p 1.6000 8.0000 0.5238 YC 2561.276721 1 3.1039 274 | 1/10
16 h-m-p 1.6000 8.0000 0.6272 CYC 2560.925843 2 2.0848 299 | 1/10
17 h-m-p 1.6000 8.0000 0.6387 YCCC 2560.750799 3 2.6939 326 | 1/10
18 h-m-p 1.6000 8.0000 0.4265 CYC 2560.715282 2 1.7966 351 | 1/10
19 h-m-p 1.6000 8.0000 0.2369 YC 2560.702622 1 2.7193 374 | 0/10
20 h-m-p 0.0001 0.0039 4462.6461 C 2560.701369 0 0.0000 396 | 0/10
21 h-m-p 0.3382 4.8168 0.4692 ++ 2560.607037 m 4.8168 409 | 1/10
22 h-m-p 1.6000 8.0000 1.2824 CC 2560.600309 1 0.6234 434 | 1/10
23 h-m-p 0.6615 3.3077 0.3609 YC 2560.594519 1 0.4643 448 | 1/10
24 h-m-p 0.6747 8.0000 0.2484 +CC 2560.590640 1 2.3815 473 | 1/10
25 h-m-p 1.6000 8.0000 0.0922 C 2560.590354 0 1.2882 495 | 1/10
26 h-m-p 1.6000 8.0000 0.0106 Y 2560.590281 0 3.7568 517 | 1/10
27 h-m-p 0.9010 8.0000 0.0440 Y 2560.590224 0 2.2112 539 | 1/10
28 h-m-p 1.6000 8.0000 0.0145 Y 2560.590222 0 1.0700 561 | 1/10
29 h-m-p 1.6000 8.0000 0.0010 Y 2560.590222 0 0.8920 583 | 1/10
30 h-m-p 1.6000 8.0000 0.0002 Y 2560.590222 0 0.2472 605 | 1/10
31 h-m-p 0.3299 8.0000 0.0002 -C 2560.590222 0 0.0206 628 | 1/10
32 h-m-p 0.0238 8.0000 0.0001 +Y 2560.590222 0 0.0954 651 | 1/10
33 h-m-p 0.0899 8.0000 0.0001 ---Y 2560.590222 0 0.0004 676
Out..
lnL = -2560.590222
677 lfun, 8124 eigenQcodon, 37235 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -2594.497391 S = -2499.019617 -123.039160
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 241 patterns 0:40
did 20 / 241 patterns 0:40
did 30 / 241 patterns 0:40
did 40 / 241 patterns 0:40
did 50 / 241 patterns 0:40
did 60 / 241 patterns 0:41
did 70 / 241 patterns 0:41
did 80 / 241 patterns 0:41
did 90 / 241 patterns 0:41
did 100 / 241 patterns 0:41
did 110 / 241 patterns 0:42
did 120 / 241 patterns 0:42
did 130 / 241 patterns 0:42
did 140 / 241 patterns 0:42
did 150 / 241 patterns 0:42
did 160 / 241 patterns 0:43
did 170 / 241 patterns 0:43
did 180 / 241 patterns 0:43
did 190 / 241 patterns 0:43
did 200 / 241 patterns 0:43
did 210 / 241 patterns 0:44
did 220 / 241 patterns 0:44
did 230 / 241 patterns 0:44
did 240 / 241 patterns 0:44
did 241 / 241 patterns 0:44end of tree file.
Time used: 0:44
The loglikelihoods for models M1, M2, M7 and M8 are -2561.765546 -2561.765546 -2560.679710 -2560.590222 respectively
CLUSTAL W (1.8) multiple sequence alignment (ALTER 1.3.3)
BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 SLENVAYNVLKSGHFTAIAGELPVAILNDRLYIKEEGVDKLLFTNNTCLPTNVAFELWAK
BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 SLENVAYNVLKSGHFMAVAGELPVAILNDRLYIKEDGVDKLLFTNNTCLPTNVAFELWAK
BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 SLENVAYNVLKSGHFTPVAGELPVAIFNDRLYIREDGVDKLLFTNNTCLPTNVAFELWAK
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 SLENVAYNVLKSGHFTAVAGELPVAILNDRLYIKEDGADKLLFTNNTCLPTNVAFELWAK
*************** .:********:******:*:*.**********************
BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 RSVNVVPEVKLLHNLGVTCTYNLVIWDYECNAPLVPNTVGVCTYTDLTKLDDQIVLVDGR
BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 RSVNVVPEVKLLRNLGVTCTYNLVIWDYENNAPLVPNTVGICNYTDLTKLDDQVVLVDGR
BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 RSVNVVPEVKLLRNLGVTCTYNLVIWDYEHNAPLVPNTVGVCTYTDLINLDDQVVLVDGR
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 RSVNVVPEVKLLRNLGVTCTYNLVIWDYESNAPLVPNTVGICTYTDLTKLDDQVVLVDGR
************:**************** **********:*.**** :****:******
BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 QLDSYSKFCQLKNAVYFSPSKPKCICTKGPPHASINGVIVEAADRGTAFWYAMRKDGAFV
BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 QLDAYSKFCQLKNAVYFSPSKPKCVCTKGPTHASINGVVVEAPDKGTAFWYAVRKDGAFV
BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 QLDAYSKFCQLKNAVYFSPTKPKCISARGPMHASINGVVVEAPDKGTAFWYAVRKDGAFV
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 QLDAYSKFCQLKNAIYFSPSKPKCVCTRGPTHASINGVVVEAPDRGTAFWYAMRKDGAFV
***:**********:****:****:.::** *******:***.*:*******:*******
BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 QLTDGYFTQSRTLNDFQPRTQLEIDFLDLEQSCFLDKYDLHDLGLEHIAYGQFDGTIGGL
BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 QPTDGYFTQSRTLDDFQPRTQLELDFLDLEQSCFLDKYDLHDLGLEHIAYGQFEGTIGGL
BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 QPADGYFTQSRTLDNFQPRTQLELDFLDLDESCFLDRYDLHDLGLEHIAYGQFEGTIGGL
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 QPTDGYFTQSRTVDDFQPRTQLEIDFLDLEQSCFLDKYDLHDLGLEHIVYGQFDGTIGGL
* :*********:::********:*****::*****:***********.****:******
BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 HLLIGAVRRKRTANLVMETVLGTDTVTAYAVIDQPTASSKQVCSVFDMVLDDFIELIRAQ
BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 HLLIGAVRRKRTANLVMETVLGTDTVTSYAVIDQPTASSKQVCSVFDMILDDFIELIKAQ
BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 HLLLGAVRRRRTANLVMETVLGTDTVTSYAVIDQPTAANKQVCSVFDMVLDDFVALIKSQ
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 HLLIGAVRRKRTAHLVMETVLGTDTVTSYAVIDQPTASSKQVCSVVDIILDDFIALIKAQ
***:*****:***:*************:*********:.******.*::****: **::*
BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 DRSVVSKVVQCCLDFKMFRFMLWCKDGKVATFYPQLQ
BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 DRSVVSKVVQCCLDFKVFRFMLWCKDGKVATFYPQLQ
BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 DRTVVSKVVQCCLDFKMFRFMLWCKDGKIATFYPQLQ
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 DRSVVSKVVQCCLDFKVFRFMLWCKGGKISTFYPQLQ
**:*************:********.**::*******
>BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 TCCTTGGAGAATGTGGCTTACAATGTACTAAAATCTGGACATTTTACGGCTATAGCAGGTGAGTTACCTGTGGCTATTCTTAATGACCGCCTCTATATAAAAGAGGAAGGTGTTGATAAATTGTTATTTACTAACAATACATGCTTGCCTACTAATGTGGCATTTGAGCTGTGGGCGAAGCGATCTGTAAATGTGGTCCCAGAAGTCAAGTTGTTACACAACCTTGGTGTTACGTGTACATATAACTTGGTAATCTGGGATTATGAGTGTAATGCGCCATTAGTGCCTAACACTGTAGGTGTGTGTACTTACACTGACTTAACGAAGTTGGACGATCAGATTGTTTTAGTCGATGGTAGACAGTTGGATTCATATAGTAAGTTTTGTCAGTTGAAAAATGCAGTTTATTTTTCGCCAAGCAAACCGAAGTGCATATGTACTAAAGGTCCTCCACACGCCTCTATAAACGGCGTTATTGTTGAGGCTGCAGATAGAGGTACTGCATTTTGGTATGCTATGAGAAAGGACGGTGCATTTGTGCAACTTACAGATGGGTATTTTACTCAGTCTCGTACGCTGAATGATTTTCAGCCACGTACTCAATTAGAGATTGATTTCCTGGATCTGGAACAGTCATGTTTTCTTGATAAATATGACTTACATGATTTAGGTCTTGAGCATATTGCATATGGTCAATTTGATGGTACCATAGGCGGTTTACATTTGTTAATTGGTGCAGTGCGTCGTAAACGTACTGCAAATTTAGTAATGGAAACTGTGTTAGGTACTGACACAGTGACAGCATATGCTGTCATAGACCAGCCAACTGCATCTAGTAAGCAGGTATGTAGTGTCTTTGACATGGTTTTAGATGATTTTATTGAGCTTATAAGGGCTCAAGATAGGTCAGTGGTTAGTAAAGTAGTTCAATGCTGCCTTGATTTTAAGATGTTTAGATTTATGTTGTGGTGTAAGGATGGCAAGGTAGCCACCTTTTACCCTCAGTTGCAA >BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 TCCTTGGAGAATGTTGCTTACAACGTTCTAAAATCTGGTCACTTCATGGCAGTTGCTGGTGAATTACCTGTGGCCATCCTCAATGACCGCCTCTATATAAAGGAGGATGGTGTTGACAAATTGTTATTTACTAACAATACATGCCTACCCACTAATGTAGCTTTCGAGCTGTGGGCAAAGCGTTCTGTAAATGTGGTACCAGAAGTTAAATTACTACGTAACCTTGGTGTTACGTGTACATATAATTTAGTCATCTGGGATTATGAGAATAATGCACCATTAGTACCTAATACTGTGGGCATTTGTAACTACACTGATCTAACTAAGTTAGACGACCAGGTTGTATTAGTTGATGGCAGACAGCTAGATGCTTACAGCAAGTTTTGTCAGTTGAAGAATGCAGTCTACTTTTCTCCTAGTAAACCAAAGTGCGTGTGTACCAAGGGTCCTACGCATGCGTCTATAAATGGCGTAGTTGTAGAGGCCCCAGATAAGGGCACAGCATTCTGGTATGCAGTGAGAAAAGATGGTGCATTCGTGCAACCTACTGACGGGTATTTTACCCAATCTCGTACACTGGATGATTTTCAGCCACGTACTCAATTAGAGCTAGATTTTCTTGATCTTGAGCAGTCATGTTTTCTTGATAAATATGACTTACATGATCTAGGCTTAGAGCACATCGCGTATGGACAATTTGAAGGAACCATAGGCGGTTTACATTTATTAATAGGTGCAGTGCGTCGGAAACGTACTGCGAATTTAGTTATGGAAACTGTATTAGGAACTGATACCGTTACATCTTATGCTGTCATAGACCAGCCAACTGCTTCTAGTAAGCAAGTTTGTAGTGTTTTTGATATGATTTTAGATGACTTCATCGAGCTTATTAAAGCTCAAGATAGGTCAGTAGTTAGTAAGGTAGTACAGTGCTGCCTAGATTTTAAAGTGTTTAGGTTTATGCTATGGTGTAAGGATGGTAAGGTTGCCACCTTCTATCCACAATTGCAG >BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 TCTTTGGAGAATGTGGCCTACAATGTGTTAAAGTCCGGGCACTTTACACCAGTAGCAGGTGAATTACCTGTAGCTATTTTTAATGACCGCCTCTATATAAGGGAAGACGGTGTTGATAAATTGTTATTTACTAATAATACATGCTTGCCCACTAATGTAGCCTTTGAGCTATGGGCAAAGCGTTCAGTAAATGTAGTACCAGAGGTTAAGTTATTACGTAACTTAGGTGTTACGTGTACATATAACTTAGTCATATGGGACTATGAACATAATGCGCCTTTAGTGCCAAATACTGTTGGCGTTTGTACTTACACTGATTTAATAAATTTGGATGACCAGGTTGTGTTAGTTGACGGCAGGCAGCTAGATGCTTATAGCAAGTTTTGCCAGTTGAAGAATGCCGTCTATTTCTCACCAACTAAGCCTAAATGCATTAGTGCCAGGGGCCCTATGCACGCGTCTATAAATGGCGTAGTCGTAGAAGCGCCAGACAAAGGTACAGCGTTTTGGTATGCGGTGAGAAAGGATGGTGCATTCGTGCAGCCAGCTGATGGTTATTTCACACAGTCTCGTACACTGGACAATTTTCAACCGCGCACTCAATTAGAGTTAGATTTCCTTGATCTTGATGAGTCATGTTTCCTTGATAGATACGACTTGCATGATCTAGGTTTGGAGCATATAGCCTATGGTCAGTTTGAAGGCACCATAGGTGGTTTACATTTGTTATTGGGTGCAGTGCGCCGTAGGCGCACTGCAAACTTGGTTATGGAGACGGTGTTAGGTACTGACACTGTCACCTCTTATGCTGTCATAGACCAGCCGACTGCTGCTAATAAGCAAGTATGTAGTGTCTTTGACATGGTCTTGGATGATTTTGTTGCCTTAATTAAGTCACAAGATAGAACAGTTGTTAGTAAGGTGGTTCAGTGTTGCCTTGATTTTAAGATGTTTAGATTCATGCTGTGGTGTAAAGATGGCAAGATAGCTACCTTTTATCCTCAGTTGCAG >HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 TCTCTAGAGAATGTAGCTTACAATGTCTTAAAGTCAGGCCATTTTACAGCAGTTGCCGGTGAGTTACCGGTAGCTATTTTAAATGACCGACTCTATATAAAGGAGGACGGTGCTGATAAATTGTTGTTTACTAATAATACATGTTTGCCCACTAATGTAGCTTTTGAGCTATGGGCTAAACGTTCAGTGAACGTAGTACCAGAAGTTAAGTTATTACGTAACTTAGGTGTTACGTGTACATATAACTTAGTTATCTGGGATTATGAAAGTAATGCTCCACTAGTGCCAAATACTGTGGGCATTTGTACTTATACTGATTTAACAAAGTTAGATGACCAGGTTGTGCTAGTTGATGGCAGACAGCTAGATGCCTATAGTAAGTTTTGTCAGTTGAAAAATGCCATTTACTTTTCACCTAGTAAACCTAAGTGCGTGTGTACCAGAGGACCAACTCACGCATCTATAAATGGTGTTGTTGTAGAGGCCCCTGATAGAGGTACTGCATTTTGGTATGCTATGAGAAAAGATGGTGCATTTGTGCAACCTACTGATGGCTATTTTACACAGTCCCGTACTGTGGACGATTTTCAGCCACGTACACAATTAGAAATAGATTTCCTTGATCTTGAGCAGTCATGTTTTCTTGATAAATATGACTTACATGATCTAGGTTTAGAACATATCGTGTATGGTCAATTTGATGGAACCATAGGCGGCTTGCATTTATTAATAGGTGCCGTACGCCGTAAGCGCACGGCGCATTTAGTTATGGAGACCGTGCTAGGTACTGACACGGTCACATCTTATGCTGTTATAGACCAACCAACTGCTTCTAGTAAGCAAGTTTGTAGTGTTGTTGATATTATTTTAGATGACTTTATTGCGCTTATAAAAGCTCAAGATAGGTCAGTTGTTAGTAAGGTAGTTCAGTGCTGCTTGGATTTTAAAGTGTTTAGGTTTATGTTATGGTGTAAGGGTGGTAAGATTTCCACCTTTTATCCTCAATTGCAG
>BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 SLENVAYNVLKSGHFTAIAGELPVAILNDRLYIKEEGVDKLLFTNNTCLPTNVAFELWAKRSVNVVPEVKLLHNLGVTCTYNLVIWDYECNAPLVPNTVGVCTYTDLTKLDDQIVLVDGRQLDSYSKFCQLKNAVYFSPSKPKCICTKGPPHASINGVIVEAADRGTAFWYAMRKDGAFVQLTDGYFTQSRTLNDFQPRTQLEIDFLDLEQSCFLDKYDLHDLGLEHIAYGQFDGTIGGLHLLIGAVRRKRTANLVMETVLGTDTVTAYAVIDQPTASSKQVCSVFDMVLDDFIELIRAQDRSVVSKVVQCCLDFKMFRFMLWCKDGKVATFYPQLQ >BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 SLENVAYNVLKSGHFMAVAGELPVAILNDRLYIKEDGVDKLLFTNNTCLPTNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYENNAPLVPNTVGICNYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPSKPKCVCTKGPTHASINGVVVEAPDKGTAFWYAVRKDGAFVQPTDGYFTQSRTLDDFQPRTQLELDFLDLEQSCFLDKYDLHDLGLEHIAYGQFEGTIGGLHLLIGAVRRKRTANLVMETVLGTDTVTSYAVIDQPTASSKQVCSVFDMILDDFIELIKAQDRSVVSKVVQCCLDFKVFRFMLWCKDGKVATFYPQLQ >BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 SLENVAYNVLKSGHFTPVAGELPVAIFNDRLYIREDGVDKLLFTNNTCLPTNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYEHNAPLVPNTVGVCTYTDLINLDDQVVLVDGRQLDAYSKFCQLKNAVYFSPTKPKCISARGPMHASINGVVVEAPDKGTAFWYAVRKDGAFVQPADGYFTQSRTLDNFQPRTQLELDFLDLDESCFLDRYDLHDLGLEHIAYGQFEGTIGGLHLLLGAVRRRRTANLVMETVLGTDTVTSYAVIDQPTAANKQVCSVFDMVLDDFVALIKSQDRTVVSKVVQCCLDFKMFRFMLWCKDGKIATFYPQLQ >HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 SLENVAYNVLKSGHFTAVAGELPVAILNDRLYIKEDGADKLLFTNNTCLPTNVAFELWAKRSVNVVPEVKLLRNLGVTCTYNLVIWDYESNAPLVPNTVGICTYTDLTKLDDQVVLVDGRQLDAYSKFCQLKNAIYFSPSKPKCVCTRGPTHASINGVVVEAPDRGTAFWYAMRKDGAFVQPTDGYFTQSRTVDDFQPRTQLEIDFLDLEQSCFLDKYDLHDLGLEHIVYGQFDGTIGGLHLLIGAVRRKRTAHLVMETVLGTDTVTSYAVIDQPTASSKQVCSVVDIILDDFIALIKAQDRSVVSKVVQCCLDFKVFRFMLWCKGGKISTFYPQLQ
Reading sequence file /data//pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/codeml/fasta/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1
Found 4 sequences of length 1011
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 16.4%
Found 61 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 5
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 189 polymorphic sites
**p-Value(s)**
----------
NSS: 5.00e-03 (1000 permutations)
Max Chi^2: 3.00e-02 (1000 permutations)
PHI (Permutation): 1.00e-03 (1000 permutations)
PHI (Normal): 2.34e-05
#NEXUS
[ID: 5047824749]
begin taxa;
dimensions ntax=4;
taxlabels
BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
;
end;
begin trees;
translate
1 BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9,
2 BF_141I_orf1ab_VIPR_P_124389505_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9,
3 BF_493I_orf1ab_VIPR_P_124389496_19101_20111_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9,
4 HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_19116_20126_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:4.898498e-01,3:5.760842e-01,(2:1.736531e-01,4:3.579128e-01)0.575:1.008413e-01);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:4.898498e-01,3:5.760842e-01,(2:1.736531e-01,4:3.579128e-01):1.008413e-01);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2746.33 -2757.25
2 -2746.30 -2755.89
--------------------------------------
TOTAL -2746.32 -2756.79
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.758356 0.117618 1.209732 2.422642 1.702358 603.78 676.79 1.000
r(A<->C){all} 0.017884 0.000203 0.000003 0.046152 0.014845 734.76 796.80 1.000
r(A<->G){all} 0.382895 0.004558 0.251118 0.512757 0.382036 344.33 447.59 1.000
r(A<->T){all} 0.076631 0.000325 0.041542 0.112264 0.075618 463.55 658.83 1.000
r(C<->G){all} 0.010057 0.000080 0.000001 0.027860 0.007508 768.64 825.75 1.000
r(C<->T){all} 0.506121 0.005617 0.376491 0.669285 0.504561 153.86 242.89 1.000
r(G<->T){all} 0.006412 0.000030 0.000003 0.017079 0.005022 1063.50 1076.73 1.000
pi(A){all} 0.266054 0.000144 0.242359 0.290059 0.265924 1053.91 1202.96 1.000
pi(C){all} 0.166623 0.000097 0.147877 0.185854 0.166476 593.48 934.14 1.000
pi(G){all} 0.237042 0.000143 0.215824 0.262194 0.236852 1179.38 1235.16 1.000
pi(T){all} 0.330280 0.000170 0.304961 0.354783 0.330450 1101.74 1147.73 1.001
alpha{1,2} 0.070701 0.000443 0.014109 0.102596 0.075258 809.04 822.77 1.000
alpha{3} 4.062788 2.273282 1.552859 7.073329 3.833098 1412.76 1426.68 1.000
pinvar{all} 0.261553 0.002079 0.173867 0.351149 0.263047 915.10 1208.05 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/BF_017I_orf1ab_VIPR_P_124389487_19040_20050_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 4 ls = 337
Codon usage in sequences
------------------------------------------------------------------------------------------------------
Phe TTT 17 12 13 16 | Ser TCT 5 7 4 4 | Tyr TAT 10 9 10 11 | Cys TGT 8 7 6 8
TTC 1 6 6 1 | TCC 1 1 1 2 | TAC 3 4 3 2 | TGC 4 4 4 3
Leu TTA 14 16 16 17 | TCA 3 2 4 5 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 11 4 12 7 | TCG 1 0 0 0 | TAG 0 0 0 0 | Trp TGG 4 4 4 4
------------------------------------------------------------------------------------------------------
Leu CTT 7 5 4 4 | Pro CCT 5 5 5 5 | His CAT 4 3 4 5 | Arg CGT 5 6 4 5
CTC 1 2 1 1 | CCC 0 1 1 1 | CAC 2 2 2 1 | CGC 1 1 4 2
CTA 1 9 3 7 | CCA 6 7 6 6 | Gln CAA 6 7 4 7 | CGA 1 0 0 1
CTG 4 2 2 0 | CCG 1 0 2 1 | CAG 9 8 10 8 | CGG 0 1 0 0
------------------------------------------------------------------------------------------------------
Ile ATT 7 3 3 7 | Thr ACT 13 11 11 11 | Asn AAT 10 12 14 10 | Ser AGT 4 4 3 6
ATC 1 4 0 2 | ACC 2 5 3 4 | AAC 5 4 3 3 | AGC 1 1 1 0
ATA 7 5 8 7 | ACA 5 5 7 7 | Lys AAA 9 9 4 8 | Arg AGA 4 2 4 4
Met ATG 5 4 5 3 | ACG 4 2 2 3 | AAG 10 12 12 11 | AGG 2 2 4 2
------------------------------------------------------------------------------------------------------
Val GTT 9 15 12 16 | Ala GCT 7 7 7 10 | Asp GAT 18 19 16 19 | Gly GGT 14 9 12 12
GTC 5 3 7 2 | GCC 2 3 6 5 | GAC 8 8 11 8 | GGC 3 6 6 6
GTA 8 11 9 8 | GCA 11 8 5 4 | Glu GAA 4 4 5 4 | GGA 1 3 0 2
GTG 11 8 9 10 | GCG 2 3 5 2 | GAG 9 9 7 7 | GGG 1 1 1 0
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C1
position 1: T:0.24332 C:0.15727 A:0.26409 G:0.33531
position 2: T:0.32344 C:0.20178 A:0.31751 G:0.15727
position 3: T:0.42433 C:0.11869 A:0.23739 G:0.21958
Average T:0.33037 C:0.15925 A:0.27300 G:0.23739
#2: C2
position 1: T:0.22552 C:0.17507 A:0.25223 G:0.34718
position 2: T:0.32344 C:0.19881 A:0.32641 G:0.15134
position 3: T:0.39763 C:0.16320 A:0.26113 G:0.17804
Average T:0.31553 C:0.17903 A:0.27992 G:0.22552
#3: C3
position 1: T:0.24629 C:0.15430 A:0.24926 G:0.35015
position 2: T:0.32641 C:0.20475 A:0.31157 G:0.15727
position 3: T:0.37982 C:0.17507 A:0.22255 G:0.22255
Average T:0.31751 C:0.17804 A:0.26113 G:0.24332
#4: C4
position 1: T:0.23739 C:0.16024 A:0.26113 G:0.34125
position 2: T:0.32047 C:0.20772 A:0.30861 G:0.16320
position 3: T:0.44214 C:0.12760 A:0.25816 G:0.17211
Average T:0.33333 C:0.16518 A:0.27596 G:0.22552
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 58 | Ser S TCT 20 | Tyr Y TAT 40 | Cys C TGT 29
TTC 14 | TCC 5 | TAC 12 | TGC 15
Leu L TTA 63 | TCA 14 | *** * TAA 0 | *** * TGA 0
TTG 34 | TCG 1 | TAG 0 | Trp W TGG 16
------------------------------------------------------------------------------
Leu L CTT 20 | Pro P CCT 20 | His H CAT 16 | Arg R CGT 20
CTC 5 | CCC 3 | CAC 7 | CGC 8
CTA 20 | CCA 25 | Gln Q CAA 24 | CGA 2
CTG 8 | CCG 4 | CAG 35 | CGG 1
------------------------------------------------------------------------------
Ile I ATT 20 | Thr T ACT 46 | Asn N AAT 46 | Ser S AGT 17
ATC 7 | ACC 14 | AAC 15 | AGC 3
ATA 27 | ACA 24 | Lys K AAA 30 | Arg R AGA 14
Met M ATG 17 | ACG 11 | AAG 45 | AGG 10
------------------------------------------------------------------------------
Val V GTT 52 | Ala A GCT 31 | Asp D GAT 72 | Gly G GGT 47
GTC 17 | GCC 16 | GAC 35 | GGC 21
GTA 36 | GCA 28 | Glu E GAA 17 | GGA 6
GTG 38 | GCG 12 | GAG 32 | GGG 3
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.23813 C:0.16172 A:0.25668 G:0.34347
position 2: T:0.32344 C:0.20326 A:0.31602 G:0.15727
position 3: T:0.41098 C:0.14614 A:0.24481 G:0.19807
Average T:0.32418 C:0.17038 A:0.27250 G:0.23294
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 3, (2, 4)); MP score: 340
lnL(ntime: 5 np: 8): -2561.765546 +0.000000
5..1 5..3 5..6 6..2 6..4
0.483431 0.551825 0.083662 0.258686 0.382562 2.994103 0.990816 0.038518
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.760166
(1: 0.483431, 3: 0.551825, (2: 0.258686, 4: 0.382562): 0.083662);
(C1: 0.483431, C3: 0.551825, (C2: 0.258686, C4: 0.382562): 0.083662);
Detailed output identifying parameters
kappa (ts/tv) = 2.99410
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99082 0.00918
w: 0.03852 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.483 766.4 244.6 0.0473 0.0275 0.5800 21.0 141.9
5..3 0.552 766.4 244.6 0.0473 0.0313 0.6621 24.0 161.9
5..6 0.084 766.4 244.6 0.0473 0.0048 0.1004 3.6 24.6
6..2 0.259 766.4 244.6 0.0473 0.0147 0.3104 11.3 75.9
6..4 0.383 766.4 244.6 0.0473 0.0217 0.4590 16.7 112.3
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 3, (2, 4)); MP score: 340
lnL(ntime: 5 np: 10): -2561.765546 +0.000000
5..1 5..3 5..6 6..2 6..4
0.483431 0.551825 0.083662 0.258686 0.382562 2.994103 0.990817 0.006432 0.038518 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.760166
(1: 0.483431, 3: 0.551825, (2: 0.258686, 4: 0.382562): 0.083662);
(C1: 0.483431, C3: 0.551825, (C2: 0.258686, C4: 0.382562): 0.083662);
Detailed output identifying parameters
kappa (ts/tv) = 2.99410
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99082 0.00643 0.00275
w: 0.03852 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.483 766.4 244.6 0.0473 0.0275 0.5800 21.0 141.9
5..3 0.552 766.4 244.6 0.0473 0.0313 0.6621 24.0 161.9
5..6 0.084 766.4 244.6 0.0473 0.0048 0.1004 3.6 24.6
6..2 0.259 766.4 244.6 0.0473 0.0147 0.3104 11.3 75.9
6..4 0.383 766.4 244.6 0.0473 0.0217 0.4590 16.7 112.3
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.480 0.114 0.070 0.057 0.052 0.049 0.047 0.045 0.044 0.043
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 0:08
Model 7: beta (10 categories)
TREE # 1: (1, 3, (2, 4)); MP score: 340
lnL(ntime: 5 np: 8): -2560.679710 +0.000000
5..1 5..3 5..6 6..2 6..4
0.491319 0.559781 0.073006 0.260176 0.381411 2.958120 0.489609 9.896205
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.765693
(1: 0.491319, 3: 0.559781, (2: 0.260176, 4: 0.381411): 0.073006);
(C1: 0.491319, C3: 0.559781, (C2: 0.260176, C4: 0.381411): 0.073006);
Detailed output identifying parameters
kappa (ts/tv) = 2.95812
Parameters in M7 (beta):
p = 0.48961 q = 9.89621
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00018 0.00170 0.00491 0.01007 0.01757 0.02813 0.04299 0.06474 0.09999 0.17831
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.491 766.8 244.2 0.0449 0.0267 0.5943 20.4 145.1
5..3 0.560 766.8 244.2 0.0449 0.0304 0.6771 23.3 165.4
5..6 0.073 766.8 244.2 0.0449 0.0040 0.0883 3.0 21.6
6..2 0.260 766.8 244.2 0.0449 0.0141 0.3147 10.8 76.9
6..4 0.381 766.8 244.2 0.0449 0.0207 0.4614 15.9 112.7
Time used: 0:20
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 3, (2, 4)); MP score: 340
lnL(ntime: 5 np: 10): -2560.590222 +0.000000
5..1 5..3 5..6 6..2 6..4
0.489960 0.558484 0.074451 0.260453 0.381907 2.970047 0.996725 0.642356 13.848642 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.765255
(1: 0.489960, 3: 0.558484, (2: 0.260453, 4: 0.381907): 0.074451);
(C1: 0.489960, C3: 0.558484, (C2: 0.260453, C4: 0.381907): 0.074451);
Detailed output identifying parameters
kappa (ts/tv) = 2.97005
Parameters in M8 (beta&w>1):
p0 = 0.99672 p = 0.64236 q = 13.84864
(p1 = 0.00328) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09967 0.09967 0.09967 0.09967 0.09967 0.09967 0.09967 0.09967 0.09967 0.09967 0.00328
w: 0.00059 0.00332 0.00759 0.01340 0.02098 0.03083 0.04388 0.06211 0.09057 0.15205 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.490 766.7 244.3 0.0457 0.0270 0.5911 20.7 144.4
5..3 0.558 766.7 244.3 0.0457 0.0308 0.6737 23.6 164.6
5..6 0.074 766.7 244.3 0.0457 0.0041 0.0898 3.1 21.9
6..2 0.260 766.7 244.3 0.0457 0.0143 0.3142 11.0 76.8
6..4 0.382 766.7 244.3 0.0457 0.0210 0.4607 16.1 112.6
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.015 0.141 0.843
ws: 0.554 0.108 0.062 0.049 0.043 0.040 0.038 0.037 0.035 0.035
Time used: 0:44
Model 1: NearlyNeutral -2561.765546 Model 2: PositiveSelection -2561.765546 Model 7: beta -2560.679710 Model 8: beta&w>1 -2560.590222 Model 2 vs 1 0 Model 8 vs 7 .178976
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken. # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
