--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken.
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1882.95 -1890.84
2 -1883.10 -1894.20
--------------------------------------
TOTAL -1883.02 -1893.54
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.593403 0.119181 1.035792 2.255171 1.534519 914.69 989.55 1.000
r(A<->C){all} 0.072455 0.001157 0.004917 0.133179 0.070168 640.91 745.04 1.000
r(A<->G){all} 0.249989 0.002208 0.163143 0.347027 0.247219 676.06 817.13 1.001
r(A<->T){all} 0.166072 0.001216 0.106764 0.242086 0.163527 807.67 878.70 1.006
r(C<->G){all} 0.069358 0.000860 0.015276 0.128055 0.067342 711.69 715.39 1.004
r(C<->T){all} 0.391897 0.003159 0.289216 0.506545 0.389361 573.65 757.16 1.002
r(G<->T){all} 0.050229 0.000567 0.006093 0.096339 0.048682 721.36 792.31 1.000
pi(A){all} 0.232285 0.000248 0.200703 0.262167 0.231561 984.72 1004.81 1.001
pi(C){all} 0.207299 0.000207 0.178112 0.233535 0.207368 980.89 1018.14 1.000
pi(G){all} 0.267607 0.000278 0.234106 0.298766 0.267708 1064.10 1167.73 1.000
pi(T){all} 0.292809 0.000263 0.260784 0.324208 0.293287 1178.88 1232.60 1.000
alpha{1,2} 0.349619 0.009320 0.198967 0.524270 0.335241 1302.51 1333.99 1.000
alpha{3} 2.944915 1.684925 1.009183 5.618096 2.668002 1344.27 1360.88 1.002
pinvar{all} 0.093194 0.003813 0.000014 0.208211 0.084885 1323.45 1408.12 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
Model 1: NearlyNeutral -1783.919442
Model 2: PositiveSelection -1783.919442
Model 7: beta -1779.558196
Model 8: beta&w>1 -1779.558211
Model 2 vs 1 0
Model 8 vs 7 -.000030
-- Starting log on Wed Oct 26 00:49:06 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=175
C1 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDMPMQEALEVVKNELRKP
C2 MEGVPGPSKLRSMVTITLKWIDPNIMPSVTGWDMPMCEALEIVKDELRKP
C3 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDVSMQEALELVKAELRKP
C4 MEGVPDPPKLKSMVVTTLKWCDPFANPNVTGWDIPIEEALEYAKQQLRTP
*****.*.**:***. *:** ** *.*****:.: **** .* :**.*
C1 EPQLVFVPKYLCHTPLIGEDRIVVTDSTFRATNMGWVPIRELAFDENRIR
C2 EPDLVFVPKYLCHTPLIGRNRVVITDATYRTTVLGWIPIRELAYDESETR
C3 TPKLVFVPNYLCHTPLIGRDRIVITDSIYRATVMGWIPIRELAFDENNIR
C4 EPQLVFVPYYLSHAPGISGDRVVITDSIWYATNFGWQPIRELAMDKDGVR
*.***** **.*:* *. :*:*:**: : :* :** ****** *:. *
C1 FGRSGTFGVLLPMQDAKYIMGHIDIDMRKYGVGAGGDKDEPLLWDGYIDT
C2 YGRSGTYGVLLPMQDSKYIMGSIDIDMRKYGAGAGSDRPEPMLWDGFVDL
C3 CGRSGTFGVLLPEQDPKYVMGEVDIDMRKYGVGACSEKPVPLLWDGYIDT
C4 YGRGGTHGVLLPMQDPSFIMGDIDIQIRKYGIGANSPPDVLPLWDGFSDP
**.**.***** **..::** :**::**** ** . ****: *
C1 PYPEDDYLDFPDNSRPAKPKAKRGG
C2 PRSQKQYLDYPDNCRPTKPKAKRGG
C3 PYPEDDYLDFPDMCRPAKPKAKRGG
C4 GPDVGPYLDFPDNCCPTKPKAKRGG
***:** . *:********
-- Starting log on Wed Oct 26 00:49:48 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=994, Nseq=4, Len=175
C1 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDMPMQEALEVVKNELRKP
C2 MEGVPGPSKLRSMVTITLKWIDPNIMPSVTGWDMPMCEALEIVKDELRKP
C3 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDVSMQEALELVKAELRKP
C4 MEGVPDPPKLKSMVVTTLKWCDPFANPNVTGWDIPIEEALEYAKQQLRTP
*****.*.**:***. *:** ** *.*****:.: **** .* :**.*
C1 EPQLVFVPKYLCHTPLIGEDRIVVTDSTFRATNMGWVPIRELAFDENRIR
C2 EPDLVFVPKYLCHTPLIGRNRVVITDATYRTTVLGWIPIRELAYDESETR
C3 TPKLVFVPNYLCHTPLIGRDRIVITDSIYRATVMGWIPIRELAFDENNIR
C4 EPQLVFVPYYLSHAPGISGDRVVITDSIWYATNFGWQPIRELAMDKDGVR
*.***** **.*:* *. :*:*:**: : :* :** ****** *:. *
C1 FGRSGTFGVLLPMQDAKYIMGHIDIDMRKYGVGAGGDKDEPLLWDGYIDT
C2 YGRSGTYGVLLPMQDSKYIMGSIDIDMRKYGAGAGSDRPEPMLWDGFVDL
C3 CGRSGTFGVLLPEQDPKYVMGEVDIDMRKYGVGACSEKPVPLLWDGYIDT
C4 YGRGGTHGVLLPMQDPSFIMGDIDIQIRKYGIGANSPPDVLPLWDGFSDP
**.**.***** **..::** :**::**** ** . ****: *
C1 PYPEDDYLDFPDNSRPAKPKAKRGG
C2 PRSQKQYLDYPDNCRPTKPKAKRGG
C3 PYPEDDYLDFPDMCRPAKPKAKRGG
C4 GPDVGPYLDFPDNCCPTKPKAKRGG
***:** . *:********
-- Starting log on Wed Oct 26 01:32:57 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/gapped_alignment/codeml,BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 525 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666747979
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1835406644
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5564229852
Seed = 522946480
Swapseed = 1666747979
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.00 % Dirichlet(Revmat{all})
1.00 % Slider(Revmat{all})
1.00 % Dirichlet(Pi{all})
1.00 % Slider(Pi{all})
2.00 % Multiplier(Alpha{1,2})
2.00 % Multiplier(Alpha{3})
2.00 % Slider(Pinvar{all})
10.00 % ExtSPR(Tau{all},V{all})
10.00 % NNI(Tau{all},V{all})
10.00 % ParsSPR(Tau{all},V{all})
40.00 % Multiplier(V{all})
14.00 % Nodeslider(V{all})
6.00 % TLMultiplier(V{all})
Division 1 has 50 unique site patterns
Division 2 has 34 unique site patterns
Division 3 has 68 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2326.398784 -- 13.556448
Chain 2 -- -2296.311413 -- 13.556448
Chain 3 -- -2327.733514 -- 13.556448
Chain 4 -- -2327.733514 -- 13.556448
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2296.311413 -- 13.556448
Chain 2 -- -2296.311413 -- 13.556448
Chain 3 -- -2326.398784 -- 13.556448
Chain 4 -- -2296.311413 -- 13.556448
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2326.399] (-2296.311) (-2327.734) (-2327.734) * [-2296.311] (-2296.311) (-2326.399) (-2296.311)
1000 -- [-1904.047] (-1902.838) (-1908.316) (-1905.033) * (-1900.890) [-1890.195] (-1895.799) (-1926.528) -- 0:00:00
2000 -- [-1888.742] (-1900.591) (-1885.549) (-1900.207) * (-1896.977) [-1887.965] (-1891.615) (-1898.804) -- 0:00:00
3000 -- (-1888.669) (-1889.713) [-1887.459] (-1891.533) * (-1890.530) (-1890.717) [-1888.993] (-1896.091) -- 0:05:32
4000 -- (-1891.648) (-1881.630) (-1885.227) [-1887.616] * (-1883.761) [-1888.014] (-1889.367) (-1895.920) -- 0:04:09
5000 -- [-1886.565] (-1885.906) (-1885.359) (-1886.966) * (-1886.948) [-1884.591] (-1886.265) (-1885.286) -- 0:03:19
Average standard deviation of split frequencies: 0.078567
6000 -- [-1893.530] (-1885.944) (-1893.622) (-1886.468) * (-1884.183) (-1885.430) (-1883.432) [-1892.759] -- 0:02:45
7000 -- (-1884.959) [-1881.796] (-1883.703) (-1885.197) * (-1886.940) [-1885.830] (-1884.309) (-1884.332) -- 0:02:21
8000 -- [-1880.790] (-1886.383) (-1887.634) (-1886.604) * (-1887.874) (-1883.261) (-1888.071) [-1886.846] -- 0:04:08
9000 -- (-1887.792) (-1890.305) [-1887.544] (-1888.392) * (-1888.277) [-1880.908] (-1887.275) (-1883.350) -- 0:03:40
10000 -- [-1887.586] (-1888.454) (-1884.910) (-1885.385) * (-1889.554) (-1885.092) [-1891.057] (-1890.781) -- 0:03:18
Average standard deviation of split frequencies: 0.058926
11000 -- (-1891.721) [-1886.251] (-1883.531) (-1885.414) * (-1887.156) [-1887.919] (-1893.471) (-1882.921) -- 0:02:59
12000 -- (-1885.917) (-1882.375) [-1885.191] (-1893.651) * (-1889.289) [-1886.009] (-1890.546) (-1888.475) -- 0:04:07
13000 -- (-1882.463) (-1883.665) (-1885.093) [-1888.547] * (-1891.253) [-1883.978] (-1887.121) (-1882.372) -- 0:03:47
14000 -- (-1885.311) [-1893.716] (-1889.822) (-1888.552) * (-1883.641) (-1884.108) (-1887.892) [-1882.868] -- 0:03:31
15000 -- (-1890.648) (-1894.244) [-1891.782] (-1888.814) * (-1880.879) [-1880.882] (-1888.258) (-1883.563) -- 0:03:17
Average standard deviation of split frequencies: 0.058926
16000 -- (-1888.978) (-1891.873) [-1883.303] (-1896.400) * (-1889.978) [-1883.395] (-1897.359) (-1883.067) -- 0:03:04
17000 -- (-1891.578) (-1885.846) (-1884.639) [-1883.423] * (-1886.538) [-1882.766] (-1888.736) (-1884.109) -- 0:03:51
18000 -- (-1884.661) (-1890.522) (-1883.484) [-1885.326] * [-1889.568] (-1887.798) (-1889.546) (-1884.241) -- 0:03:38
19000 -- (-1885.610) (-1892.475) [-1888.054] (-1887.710) * (-1885.705) [-1881.413] (-1892.352) (-1885.931) -- 0:03:26
20000 -- [-1884.508] (-1889.391) (-1890.090) (-1888.054) * [-1889.254] (-1891.250) (-1890.083) (-1890.356) -- 0:03:16
Average standard deviation of split frequencies: 0.079835
21000 -- (-1885.577) [-1884.228] (-1887.317) (-1887.325) * (-1885.680) (-1889.641) [-1886.158] (-1890.821) -- 0:03:53
22000 -- (-1894.285) [-1884.653] (-1886.943) (-1885.922) * (-1886.721) (-1887.509) [-1883.933] (-1886.384) -- 0:03:42
23000 -- (-1887.977) [-1885.196] (-1885.536) (-1889.470) * [-1888.393] (-1886.921) (-1883.490) (-1884.471) -- 0:03:32
24000 -- (-1893.132) (-1886.968) [-1886.004] (-1887.009) * (-1895.111) (-1885.076) [-1882.752] (-1887.083) -- 0:03:23
25000 -- (-1886.653) [-1886.986] (-1882.351) (-1887.972) * (-1885.802) (-1888.392) (-1885.505) [-1880.409] -- 0:03:15
Average standard deviation of split frequencies: 0.108786
26000 -- (-1884.053) [-1891.283] (-1886.780) (-1884.286) * (-1884.019) [-1881.224] (-1886.406) (-1885.552) -- 0:03:44
27000 -- (-1885.778) (-1890.115) [-1883.181] (-1882.022) * (-1880.850) (-1883.019) [-1886.728] (-1886.298) -- 0:03:36
28000 -- (-1886.679) [-1892.954] (-1886.650) (-1884.182) * (-1889.050) (-1885.811) [-1889.033] (-1881.154) -- 0:03:28
29000 -- (-1888.694) (-1885.657) (-1883.353) [-1884.248] * (-1886.716) (-1885.320) [-1883.770] (-1883.843) -- 0:03:20
30000 -- (-1884.510) (-1888.207) [-1887.855] (-1891.525) * (-1882.941) (-1886.068) [-1887.883] (-1888.773) -- 0:03:46
Average standard deviation of split frequencies: 0.115289
31000 -- (-1885.100) (-1881.881) [-1882.569] (-1891.228) * (-1887.269) (-1882.388) [-1882.928] (-1883.960) -- 0:03:38
32000 -- (-1888.930) (-1890.353) [-1883.768] (-1885.741) * (-1883.122) [-1883.140] (-1888.841) (-1891.405) -- 0:03:31
33000 -- (-1889.398) (-1886.928) (-1881.424) [-1882.405] * (-1889.912) (-1885.015) [-1887.109] (-1884.298) -- 0:03:25
34000 -- [-1881.207] (-1884.736) (-1884.911) (-1886.458) * (-1892.687) [-1884.033] (-1890.263) (-1891.112) -- 0:03:18
35000 -- (-1884.150) (-1882.392) (-1887.076) [-1882.777] * (-1896.773) (-1882.658) [-1884.744] (-1888.834) -- 0:03:40
Average standard deviation of split frequencies: 0.026189
36000 -- (-1896.239) (-1882.015) [-1886.102] (-1887.664) * [-1890.743] (-1881.072) (-1888.257) (-1895.622) -- 0:03:34
37000 -- (-1885.673) (-1886.503) (-1885.671) [-1884.355] * (-1889.817) (-1886.761) (-1891.552) [-1889.367] -- 0:03:28
38000 -- [-1895.046] (-1883.426) (-1885.165) (-1884.910) * [-1879.712] (-1884.836) (-1892.251) (-1885.953) -- 0:03:22
39000 -- (-1886.935) (-1884.108) (-1883.133) [-1884.868] * (-1884.301) (-1891.624) (-1893.397) [-1890.923] -- 0:03:41
40000 -- (-1890.576) [-1880.429] (-1880.249) (-1883.342) * (-1885.994) (-1890.434) (-1891.906) [-1880.867] -- 0:03:36
Average standard deviation of split frequencies: 0.028980
41000 -- (-1888.915) (-1885.746) [-1888.414] (-1884.833) * (-1884.582) (-1891.647) (-1886.610) [-1890.087] -- 0:03:30
42000 -- (-1886.504) [-1885.864] (-1884.644) (-1893.629) * (-1888.211) [-1892.850] (-1887.675) (-1891.008) -- 0:03:25
43000 -- (-1892.157) (-1884.749) (-1890.638) [-1882.215] * (-1887.742) (-1889.405) (-1885.620) [-1889.620] -- 0:03:42
44000 -- (-1885.710) [-1888.241] (-1891.427) (-1886.340) * (-1887.990) [-1886.572] (-1887.482) (-1887.233) -- 0:03:37
45000 -- (-1884.887) [-1885.871] (-1890.365) (-1887.218) * (-1887.646) (-1889.034) [-1886.947] (-1887.026) -- 0:03:32
Average standard deviation of split frequencies: 0.010248
46000 -- (-1883.982) (-1888.339) (-1887.969) [-1885.558] * (-1886.744) (-1885.558) [-1885.812] (-1891.442) -- 0:03:27
47000 -- (-1885.974) (-1887.877) (-1885.750) [-1882.952] * (-1882.393) (-1885.091) [-1884.421] (-1887.500) -- 0:03:22
48000 -- [-1886.570] (-1884.314) (-1893.389) (-1888.072) * (-1885.711) (-1888.414) [-1882.429] (-1889.410) -- 0:03:38
49000 -- (-1889.131) (-1881.784) [-1885.636] (-1885.333) * (-1886.134) [-1883.571] (-1885.514) (-1888.605) -- 0:03:33
50000 -- (-1882.970) [-1881.937] (-1897.517) (-1883.098) * (-1883.783) [-1887.803] (-1882.511) (-1892.002) -- 0:03:29
Average standard deviation of split frequencies: 0.013956
51000 -- [-1884.452] (-1885.901) (-1892.116) (-1887.011) * (-1883.859) (-1888.252) (-1888.876) [-1888.906] -- 0:03:24
52000 -- (-1893.854) (-1893.118) (-1886.451) [-1885.087] * (-1883.280) [-1882.825] (-1886.350) (-1891.035) -- 0:03:20
53000 -- (-1881.544) (-1888.160) (-1880.822) [-1886.824] * [-1884.867] (-1887.343) (-1887.209) (-1880.272) -- 0:03:34
54000 -- (-1887.109) [-1884.003] (-1885.958) (-1881.723) * (-1881.210) (-1886.526) [-1884.894] (-1891.467) -- 0:03:30
55000 -- (-1884.628) (-1884.800) (-1881.917) [-1883.137] * [-1886.129] (-1885.537) (-1889.637) (-1885.733) -- 0:03:26
Average standard deviation of split frequencies: 0.012627
56000 -- (-1885.995) [-1885.037] (-1883.535) (-1885.035) * (-1884.248) (-1888.938) (-1890.333) [-1884.222] -- 0:03:22
57000 -- (-1884.253) [-1884.351] (-1883.647) (-1887.414) * (-1886.353) [-1882.204] (-1887.702) (-1884.227) -- 0:03:35
58000 -- (-1887.725) (-1890.528) (-1884.881) [-1888.677] * (-1887.113) [-1881.866] (-1886.707) (-1886.657) -- 0:03:31
59000 -- (-1889.886) [-1886.280] (-1888.638) (-1887.335) * [-1880.896] (-1884.506) (-1884.507) (-1878.502) -- 0:03:27
60000 -- (-1892.109) (-1883.948) [-1884.375] (-1884.510) * (-1880.591) (-1883.622) [-1888.423] (-1886.295) -- 0:03:23
Average standard deviation of split frequencies: 0.027196
61000 -- (-1884.586) (-1885.812) (-1884.446) [-1884.461] * (-1884.442) (-1887.276) [-1884.241] (-1892.294) -- 0:03:35
62000 -- (-1887.165) (-1882.363) (-1884.209) [-1887.224] * (-1885.158) (-1886.802) (-1886.933) [-1884.332] -- 0:03:31
63000 -- [-1885.487] (-1884.385) (-1889.223) (-1885.989) * (-1893.169) (-1886.670) (-1887.020) [-1887.850] -- 0:03:28
64000 -- (-1888.152) (-1884.748) (-1882.263) [-1883.955] * (-1887.377) (-1884.002) [-1881.493] (-1891.386) -- 0:03:24
65000 -- (-1886.066) (-1887.529) (-1887.478) [-1883.548] * (-1888.299) [-1883.772] (-1884.731) (-1888.636) -- 0:03:21
Average standard deviation of split frequencies: 0.046426
66000 -- (-1884.508) (-1882.082) (-1888.070) [-1885.024] * [-1883.625] (-1891.814) (-1885.622) (-1884.784) -- 0:03:32
67000 -- [-1885.615] (-1884.201) (-1888.595) (-1887.780) * [-1887.607] (-1889.245) (-1883.093) (-1894.972) -- 0:03:28
68000 -- (-1888.222) (-1884.308) (-1883.836) [-1882.555] * (-1884.804) (-1892.301) (-1881.753) [-1888.604] -- 0:03:25
69000 -- [-1888.249] (-1885.920) (-1886.408) (-1882.863) * (-1883.548) (-1889.136) [-1881.299] (-1896.452) -- 0:03:22
70000 -- (-1889.991) (-1887.518) (-1888.549) [-1883.439] * [-1885.491] (-1886.136) (-1882.870) (-1893.026) -- 0:03:32
Average standard deviation of split frequencies: 0.033354
71000 -- [-1884.529] (-1887.951) (-1883.120) (-1886.777) * (-1889.197) (-1883.374) (-1886.330) [-1890.091] -- 0:03:29
72000 -- [-1882.776] (-1896.128) (-1882.764) (-1886.043) * (-1891.086) (-1887.760) (-1884.875) [-1886.639] -- 0:03:26
73000 -- (-1884.612) (-1883.764) (-1886.900) [-1879.868] * (-1891.026) [-1889.883] (-1886.366) (-1885.463) -- 0:03:23
74000 -- (-1884.157) (-1885.129) [-1890.256] (-1883.732) * (-1889.748) [-1885.218] (-1885.270) (-1885.826) -- 0:03:20
75000 -- (-1887.329) (-1885.097) [-1885.326] (-1886.387) * (-1886.062) [-1888.805] (-1883.125) (-1890.727) -- 0:03:29
Average standard deviation of split frequencies: 0.015507
76000 -- [-1882.062] (-1886.867) (-1885.110) (-1887.036) * (-1889.814) [-1885.224] (-1882.990) (-1886.697) -- 0:03:26
77000 -- (-1887.370) (-1884.489) [-1885.020] (-1883.424) * (-1893.308) [-1883.532] (-1885.541) (-1886.012) -- 0:03:23
78000 -- [-1882.791] (-1885.268) (-1882.506) (-1891.888) * (-1885.865) [-1888.870] (-1884.697) (-1886.850) -- 0:03:20
79000 -- [-1885.077] (-1888.247) (-1890.833) (-1887.200) * (-1884.867) (-1889.357) (-1890.412) [-1881.333] -- 0:03:29
80000 -- [-1883.405] (-1889.774) (-1888.701) (-1886.465) * (-1888.283) (-1894.142) [-1883.134] (-1889.957) -- 0:03:27
Average standard deviation of split frequencies: 0.008766
81000 -- [-1884.547] (-1889.076) (-1884.700) (-1889.377) * (-1890.931) [-1889.337] (-1886.265) (-1883.063) -- 0:03:24
82000 -- (-1886.368) (-1885.764) (-1888.556) [-1887.755] * (-1884.184) (-1885.868) (-1881.555) [-1885.173] -- 0:03:21
83000 -- (-1887.247) (-1884.644) [-1888.303] (-1884.252) * (-1887.284) (-1889.302) (-1885.075) [-1884.716] -- 0:03:18
84000 -- (-1883.828) (-1886.477) (-1888.076) [-1883.359] * (-1888.850) (-1885.603) [-1882.796] (-1889.080) -- 0:03:27
85000 -- [-1882.462] (-1889.185) (-1882.927) (-1885.838) * [-1885.467] (-1889.829) (-1889.228) (-1889.202) -- 0:03:24
Average standard deviation of split frequencies: 0.010963
86000 -- [-1882.755] (-1884.435) (-1881.517) (-1884.167) * (-1891.398) (-1890.256) (-1885.771) [-1882.834] -- 0:03:21
87000 -- (-1885.896) (-1902.814) [-1887.164] (-1885.682) * (-1889.305) [-1886.023] (-1882.668) (-1887.413) -- 0:03:19
88000 -- (-1884.960) (-1886.753) [-1893.988] (-1886.746) * (-1882.672) (-1887.868) [-1886.190] (-1894.220) -- 0:03:27
89000 -- (-1884.913) [-1888.840] (-1886.311) (-1895.322) * [-1885.330] (-1883.210) (-1886.398) (-1886.167) -- 0:03:24
90000 -- (-1887.793) [-1884.594] (-1882.320) (-1888.295) * (-1892.992) [-1883.644] (-1885.434) (-1882.149) -- 0:03:22
Average standard deviation of split frequencies: 0.023397
91000 -- [-1889.375] (-1881.007) (-1885.455) (-1890.428) * [-1886.464] (-1884.144) (-1888.432) (-1901.760) -- 0:03:19
92000 -- (-1883.469) [-1882.418] (-1885.289) (-1887.378) * (-1886.378) [-1892.102] (-1883.439) (-1883.593) -- 0:03:17
93000 -- (-1890.981) (-1889.731) (-1886.587) [-1881.515] * [-1890.586] (-1890.744) (-1886.223) (-1884.923) -- 0:03:24
94000 -- (-1886.744) (-1892.673) [-1885.350] (-1888.167) * (-1887.817) (-1887.568) [-1885.761] (-1885.171) -- 0:03:22
95000 -- [-1885.726] (-1889.250) (-1884.300) (-1884.906) * (-1885.269) [-1885.734] (-1882.856) (-1884.002) -- 0:03:20
Average standard deviation of split frequencies: 0.014731
96000 -- (-1889.605) [-1889.055] (-1884.687) (-1886.606) * [-1883.653] (-1887.253) (-1893.069) (-1883.371) -- 0:03:17
97000 -- (-1897.336) [-1885.205] (-1884.022) (-1890.282) * (-1886.692) (-1890.141) [-1883.645] (-1882.575) -- 0:03:24
98000 -- (-1889.809) [-1886.051] (-1888.975) (-1885.074) * (-1888.359) (-1892.957) (-1888.225) [-1881.208] -- 0:03:22
99000 -- [-1885.362] (-1886.370) (-1889.853) (-1886.012) * (-1887.338) [-1889.074] (-1885.402) (-1885.151) -- 0:03:20
100000 -- [-1885.134] (-1888.847) (-1885.068) (-1882.317) * (-1889.719) (-1889.398) [-1883.011] (-1883.903) -- 0:03:18
Average standard deviation of split frequencies: 0.002341
101000 -- (-1886.840) (-1884.111) [-1887.006] (-1883.632) * (-1882.190) (-1890.436) [-1882.083] (-1884.992) -- 0:03:24
102000 -- (-1885.559) (-1886.670) [-1885.483] (-1888.172) * [-1883.128] (-1884.951) (-1884.434) (-1893.403) -- 0:03:22
103000 -- (-1885.764) (-1889.575) (-1890.917) [-1882.535] * (-1884.074) [-1884.225] (-1885.325) (-1885.913) -- 0:03:20
104000 -- (-1881.333) (-1887.491) [-1884.229] (-1883.657) * [-1887.220] (-1886.414) (-1888.456) (-1886.838) -- 0:03:18
105000 -- [-1884.654] (-1884.463) (-1887.492) (-1887.058) * [-1884.039] (-1891.362) (-1886.222) (-1884.550) -- 0:03:16
Average standard deviation of split frequencies: 0.011859
106000 -- (-1885.603) [-1882.822] (-1886.261) (-1892.243) * (-1886.293) (-1884.714) (-1886.460) [-1886.024] -- 0:03:22
107000 -- (-1892.857) (-1886.540) (-1886.457) [-1884.331] * (-1889.802) (-1890.406) [-1880.762] (-1883.853) -- 0:03:20
108000 -- (-1882.035) (-1891.585) (-1883.796) [-1885.251] * (-1891.566) (-1885.072) (-1886.316) [-1882.558] -- 0:03:18
109000 -- (-1884.923) (-1882.811) [-1885.831] (-1886.377) * (-1891.143) [-1887.024] (-1883.972) (-1889.192) -- 0:03:16
110000 -- [-1883.768] (-1883.546) (-1889.830) (-1895.424) * (-1886.570) (-1892.474) [-1883.425] (-1888.711) -- 0:03:22
Average standard deviation of split frequencies: 0.017039
111000 -- (-1886.756) [-1884.123] (-1881.930) (-1888.819) * (-1885.861) (-1890.332) (-1887.182) [-1883.684] -- 0:03:20
112000 -- (-1882.104) (-1885.260) [-1889.040] (-1888.781) * (-1884.609) [-1884.033] (-1894.309) (-1889.700) -- 0:03:18
113000 -- (-1887.738) (-1891.090) (-1889.319) [-1885.944] * (-1883.082) (-1890.498) (-1887.350) [-1886.175] -- 0:03:16
114000 -- (-1887.495) (-1889.929) (-1885.154) [-1885.314] * (-1887.270) (-1889.631) (-1885.427) [-1881.378] -- 0:03:14
115000 -- [-1881.823] (-1886.242) (-1885.127) (-1889.226) * (-1892.149) [-1880.465] (-1881.342) (-1885.022) -- 0:03:20
Average standard deviation of split frequencies: 0.024383
116000 -- [-1889.980] (-1885.217) (-1888.748) (-1887.380) * (-1886.966) (-1880.703) [-1886.094] (-1882.311) -- 0:03:18
117000 -- (-1884.331) (-1888.533) (-1884.623) [-1889.903] * (-1886.207) (-1889.533) [-1880.201] (-1884.892) -- 0:03:16
118000 -- (-1880.667) (-1883.128) (-1889.447) [-1887.584] * [-1886.871] (-1888.497) (-1883.102) (-1890.121) -- 0:03:14
119000 -- (-1883.933) (-1889.037) [-1885.194] (-1889.186) * [-1882.645] (-1888.484) (-1885.395) (-1886.652) -- 0:03:19
120000 -- [-1890.032] (-1898.099) (-1893.555) (-1887.906) * [-1881.358] (-1883.350) (-1887.286) (-1891.107) -- 0:03:18
Average standard deviation of split frequencies: 0.033207
121000 -- [-1887.063] (-1882.617) (-1887.095) (-1884.841) * (-1885.585) (-1886.683) [-1890.393] (-1887.187) -- 0:03:16
122000 -- (-1884.930) (-1882.728) [-1886.665] (-1889.321) * (-1882.931) (-1892.879) [-1882.638] (-1885.963) -- 0:03:14
123000 -- (-1881.558) [-1883.207] (-1891.934) (-1887.033) * (-1889.267) [-1885.609] (-1885.362) (-1887.592) -- 0:03:12
124000 -- (-1886.203) (-1889.424) (-1890.478) [-1885.447] * [-1882.490] (-1891.645) (-1888.081) (-1885.745) -- 0:03:17
125000 -- (-1889.318) [-1886.072] (-1884.580) (-1892.797) * [-1885.334] (-1882.194) (-1885.085) (-1884.637) -- 0:03:16
Average standard deviation of split frequencies: 0.031801
126000 -- [-1885.520] (-1888.416) (-1886.623) (-1885.195) * (-1880.701) (-1884.576) [-1890.311] (-1887.361) -- 0:03:14
127000 -- (-1887.979) [-1884.453] (-1886.580) (-1888.078) * (-1895.173) (-1884.095) [-1883.392] (-1888.500) -- 0:03:12
128000 -- (-1882.580) (-1888.782) [-1893.038] (-1882.202) * (-1886.245) [-1884.123] (-1890.883) (-1883.739) -- 0:03:10
129000 -- (-1881.840) (-1888.102) [-1884.226] (-1882.135) * (-1887.482) (-1884.312) [-1887.894] (-1887.739) -- 0:03:15
130000 -- (-1891.496) (-1889.121) [-1883.218] (-1883.792) * (-1886.616) (-1883.859) [-1884.904] (-1888.358) -- 0:03:14
Average standard deviation of split frequencies: 0.023450
131000 -- (-1887.741) [-1883.060] (-1883.666) (-1884.305) * (-1885.930) [-1884.598] (-1885.573) (-1882.279) -- 0:03:12
132000 -- (-1885.274) (-1895.780) (-1888.331) [-1891.752] * (-1892.307) (-1885.525) [-1889.196] (-1886.180) -- 0:03:10
133000 -- (-1890.617) [-1885.663] (-1887.810) (-1889.088) * [-1882.855] (-1890.328) (-1883.530) (-1890.305) -- 0:03:15
134000 -- (-1882.860) [-1887.711] (-1887.590) (-1881.275) * (-1885.514) (-1893.205) [-1881.156] (-1891.758) -- 0:03:13
135000 -- [-1888.530] (-1891.217) (-1886.783) (-1892.503) * (-1882.578) [-1889.424] (-1884.539) (-1887.093) -- 0:03:12
Average standard deviation of split frequencies: 0.017331
136000 -- [-1891.045] (-1881.292) (-1890.004) (-1888.894) * (-1883.411) (-1886.990) [-1886.015] (-1884.798) -- 0:03:10
137000 -- (-1888.367) [-1885.202] (-1884.303) (-1887.486) * (-1885.682) (-1889.212) [-1889.189] (-1889.422) -- 0:03:15
138000 -- (-1884.973) (-1885.103) [-1882.589] (-1887.641) * (-1883.368) (-1885.568) [-1887.148] (-1892.420) -- 0:03:13
139000 -- (-1891.214) [-1884.733] (-1884.725) (-1888.274) * (-1886.768) (-1885.374) [-1884.153] (-1881.190) -- 0:03:12
140000 -- [-1886.225] (-1896.302) (-1882.357) (-1886.968) * (-1889.392) (-1887.321) [-1890.286] (-1888.681) -- 0:03:10
Average standard deviation of split frequencies: 0.006702
141000 -- [-1887.989] (-1888.327) (-1890.348) (-1881.217) * [-1886.045] (-1894.427) (-1882.297) (-1886.224) -- 0:03:08
142000 -- (-1881.837) (-1885.989) [-1882.072] (-1889.522) * (-1893.582) (-1893.084) (-1888.375) [-1884.862] -- 0:03:13
143000 -- (-1885.443) [-1886.130] (-1887.740) (-1882.650) * [-1882.800] (-1891.815) (-1889.695) (-1890.598) -- 0:03:11
144000 -- (-1890.637) [-1888.897] (-1899.744) (-1884.741) * (-1885.158) (-1885.489) (-1885.745) [-1884.865] -- 0:03:10
145000 -- (-1888.422) (-1885.810) (-1887.562) [-1888.486] * (-1885.675) [-1890.574] (-1883.754) (-1888.887) -- 0:03:08
Average standard deviation of split frequencies: 0.004305
146000 -- [-1882.140] (-1884.373) (-1888.768) (-1893.431) * (-1888.197) (-1887.560) (-1891.771) [-1887.795] -- 0:03:13
147000 -- [-1884.827] (-1882.876) (-1884.956) (-1889.159) * (-1890.165) (-1883.820) [-1891.426] (-1883.100) -- 0:03:11
148000 -- (-1889.352) [-1882.393] (-1894.082) (-1884.736) * [-1893.299] (-1879.839) (-1891.164) (-1886.369) -- 0:03:09
149000 -- (-1887.999) (-1888.003) (-1890.613) [-1882.402] * (-1886.865) [-1883.224] (-1894.592) (-1884.566) -- 0:03:08
150000 -- (-1885.633) (-1885.940) [-1888.952] (-1886.073) * (-1882.820) [-1884.955] (-1889.192) (-1883.765) -- 0:03:07
Average standard deviation of split frequencies: 0.010429
151000 -- (-1891.984) (-1885.847) [-1886.586] (-1884.346) * [-1885.170] (-1887.643) (-1884.738) (-1885.682) -- 0:03:11
152000 -- (-1890.985) (-1883.778) (-1886.988) [-1885.051] * (-1882.135) [-1885.568] (-1882.152) (-1888.910) -- 0:03:09
153000 -- [-1890.913] (-1888.744) (-1882.234) (-1891.591) * [-1887.951] (-1889.896) (-1884.868) (-1889.043) -- 0:03:08
154000 -- [-1883.809] (-1883.651) (-1879.927) (-1886.625) * (-1887.644) (-1888.751) [-1880.556] (-1882.027) -- 0:03:06
155000 -- (-1886.209) [-1881.958] (-1882.207) (-1883.328) * [-1887.190] (-1891.588) (-1880.104) (-1882.890) -- 0:03:10
Average standard deviation of split frequencies: 0.016116
156000 -- (-1883.909) [-1888.004] (-1894.163) (-1882.995) * (-1882.886) (-1891.300) [-1881.595] (-1880.740) -- 0:03:09
157000 -- (-1888.813) [-1884.254] (-1883.577) (-1889.808) * [-1886.279] (-1885.205) (-1883.491) (-1881.801) -- 0:03:07
158000 -- (-1891.156) (-1886.742) (-1884.111) [-1885.042] * (-1884.178) (-1885.856) (-1893.696) [-1882.819] -- 0:03:06
159000 -- [-1887.205] (-1886.142) (-1884.840) (-1892.220) * (-1883.341) [-1885.424] (-1885.934) (-1881.963) -- 0:03:05
160000 -- (-1886.409) (-1890.160) (-1898.517) [-1885.494] * (-1886.805) [-1893.031] (-1893.749) (-1890.099) -- 0:03:09
Average standard deviation of split frequencies: 0.011736
161000 -- [-1881.745] (-1885.617) (-1888.553) (-1882.113) * [-1883.339] (-1886.162) (-1881.123) (-1892.064) -- 0:03:07
162000 -- (-1884.050) (-1884.163) [-1886.641] (-1885.083) * (-1886.311) (-1892.838) (-1889.283) [-1884.560] -- 0:03:06
163000 -- [-1882.258] (-1890.720) (-1884.419) (-1881.603) * [-1885.012] (-1886.310) (-1881.649) (-1883.610) -- 0:03:04
164000 -- (-1887.081) (-1885.780) (-1889.707) [-1882.402] * (-1887.803) (-1893.778) [-1893.152] (-1884.338) -- 0:03:08
165000 -- (-1897.025) [-1891.162] (-1883.884) (-1888.689) * (-1883.614) [-1879.070] (-1890.237) (-1887.994) -- 0:03:07
Average standard deviation of split frequencies: 0.013252
166000 -- (-1887.513) (-1886.627) (-1895.910) [-1887.129] * [-1887.627] (-1884.445) (-1886.794) (-1882.581) -- 0:03:05
167000 -- (-1890.853) [-1886.272] (-1890.055) (-1884.713) * (-1887.846) (-1885.103) [-1884.179] (-1890.243) -- 0:03:04
168000 -- (-1887.459) (-1884.240) [-1885.528] (-1886.660) * (-1887.493) (-1886.263) (-1888.133) [-1884.075] -- 0:03:08
169000 -- [-1891.889] (-1888.054) (-1881.594) (-1886.307) * (-1884.143) (-1882.612) [-1884.949] (-1886.448) -- 0:03:06
170000 -- (-1887.391) (-1889.887) [-1887.722] (-1886.627) * [-1885.582] (-1887.189) (-1887.142) (-1881.953) -- 0:03:05
Average standard deviation of split frequencies: 0.009207
171000 -- (-1885.030) (-1886.248) [-1884.321] (-1884.511) * (-1883.959) [-1885.870] (-1888.801) (-1883.389) -- 0:03:04
172000 -- [-1892.896] (-1885.786) (-1883.211) (-1886.950) * (-1892.506) (-1889.754) [-1882.777] (-1886.054) -- 0:03:02
173000 -- (-1883.869) (-1890.168) (-1887.384) [-1890.149] * [-1889.452] (-1895.246) (-1880.946) (-1883.549) -- 0:03:06
174000 -- (-1889.030) (-1897.938) [-1882.397] (-1884.048) * (-1883.362) (-1892.201) (-1884.329) [-1882.136] -- 0:03:05
175000 -- (-1891.488) (-1885.534) [-1885.211] (-1889.398) * (-1882.530) [-1885.184] (-1884.555) (-1893.164) -- 0:03:03
Average standard deviation of split frequencies: 0.007142
176000 -- (-1886.378) (-1886.297) [-1884.494] (-1888.835) * (-1889.989) (-1886.613) [-1884.428] (-1884.108) -- 0:03:02
177000 -- [-1884.245] (-1884.322) (-1886.956) (-1881.982) * (-1882.543) (-1886.708) [-1880.967] (-1886.762) -- 0:03:05
178000 -- (-1884.938) (-1887.095) [-1884.460] (-1890.418) * (-1883.481) (-1886.911) [-1887.776] (-1884.791) -- 0:03:04
179000 -- (-1888.766) [-1888.491] (-1884.364) (-1885.923) * (-1883.274) [-1889.640] (-1886.739) (-1891.347) -- 0:03:03
180000 -- (-1885.964) [-1886.027] (-1883.575) (-1891.901) * (-1882.595) (-1889.427) (-1887.233) [-1886.879] -- 0:03:02
Average standard deviation of split frequencies: 0.003479
181000 -- (-1883.946) [-1882.663] (-1886.811) (-1888.032) * (-1889.131) [-1887.750] (-1886.118) (-1901.611) -- 0:03:00
182000 -- (-1888.210) [-1888.854] (-1890.739) (-1886.942) * (-1881.038) (-1889.954) (-1883.212) [-1886.453] -- 0:03:04
183000 -- [-1886.788] (-1883.878) (-1884.563) (-1891.025) * (-1893.994) (-1888.618) (-1883.934) [-1886.961] -- 0:03:03
184000 -- [-1882.381] (-1882.712) (-1889.334) (-1901.898) * (-1889.524) (-1883.929) [-1885.400] (-1894.742) -- 0:03:01
185000 -- (-1889.958) (-1899.802) (-1885.869) [-1885.861] * [-1880.207] (-1884.579) (-1894.648) (-1883.663) -- 0:03:00
Average standard deviation of split frequencies: 0.005069
186000 -- (-1887.245) [-1882.464] (-1886.054) (-1883.384) * (-1885.511) (-1883.007) (-1883.225) [-1888.044] -- 0:03:03
187000 -- (-1887.547) (-1883.427) (-1885.739) [-1887.744] * [-1886.963] (-1883.417) (-1886.192) (-1890.404) -- 0:03:02
188000 -- (-1886.414) [-1886.261] (-1883.752) (-1889.221) * [-1884.327] (-1886.748) (-1886.995) (-1889.174) -- 0:03:01
189000 -- (-1891.752) (-1884.906) (-1887.760) [-1881.586] * (-1886.956) [-1883.898] (-1884.855) (-1885.697) -- 0:03:00
190000 -- (-1889.636) [-1882.227] (-1886.466) (-1883.684) * [-1886.118] (-1882.862) (-1890.158) (-1886.515) -- 0:02:59
Average standard deviation of split frequencies: 0.004945
191000 -- (-1884.867) [-1884.502] (-1886.571) (-1886.269) * (-1881.322) (-1886.914) [-1888.525] (-1886.335) -- 0:03:02
192000 -- (-1883.853) (-1885.173) (-1890.344) [-1887.141] * (-1885.934) (-1892.109) [-1888.396] (-1893.079) -- 0:03:00
193000 -- (-1885.032) [-1881.710] (-1885.475) (-1886.089) * (-1887.955) (-1885.888) (-1884.891) [-1885.372] -- 0:02:59
194000 -- (-1883.984) (-1888.284) [-1885.384] (-1886.637) * (-1890.517) (-1889.830) (-1884.178) [-1884.667] -- 0:02:58
195000 -- (-1887.407) [-1886.814] (-1883.838) (-1890.863) * (-1886.070) [-1890.613] (-1883.721) (-1890.416) -- 0:03:01
Average standard deviation of split frequencies: 0.004810
196000 -- (-1887.410) (-1885.945) [-1886.470] (-1883.633) * [-1884.725] (-1889.918) (-1886.880) (-1890.699) -- 0:03:00
197000 -- [-1882.669] (-1892.886) (-1885.248) (-1886.687) * [-1883.056] (-1883.917) (-1889.256) (-1891.456) -- 0:02:59
198000 -- [-1881.675] (-1884.336) (-1888.312) (-1892.329) * (-1889.322) (-1887.887) [-1888.278] (-1889.111) -- 0:02:58
199000 -- (-1889.000) [-1886.856] (-1884.595) (-1887.603) * (-1886.727) (-1885.319) (-1891.618) [-1881.056] -- 0:02:57
200000 -- (-1881.386) [-1886.925] (-1883.926) (-1886.155) * [-1882.357] (-1887.854) (-1885.717) (-1883.996) -- 0:03:00
Average standard deviation of split frequencies: 0.006265
201000 -- [-1884.092] (-1886.007) (-1883.790) (-1889.032) * [-1884.709] (-1887.748) (-1886.203) (-1882.583) -- 0:02:58
202000 -- [-1884.706] (-1886.374) (-1884.239) (-1886.519) * (-1885.732) (-1887.884) (-1892.528) [-1888.302] -- 0:02:57
203000 -- [-1883.929] (-1887.948) (-1883.414) (-1883.929) * (-1882.483) (-1886.470) [-1887.427] (-1887.471) -- 0:02:56
204000 -- (-1887.523) (-1888.853) (-1890.867) [-1887.400] * (-1887.125) (-1883.466) (-1888.667) [-1883.918] -- 0:02:59
205000 -- (-1884.536) (-1884.805) [-1888.662] (-1888.702) * (-1894.296) (-1883.251) (-1889.134) [-1884.077] -- 0:02:58
Average standard deviation of split frequencies: 0.007628
206000 -- (-1888.282) [-1888.948] (-1895.668) (-1885.471) * (-1889.611) (-1889.282) (-1885.325) [-1883.838] -- 0:02:57
207000 -- (-1882.353) [-1892.652] (-1894.066) (-1882.054) * (-1888.006) (-1890.748) (-1885.069) [-1882.666] -- 0:02:56
208000 -- (-1887.380) [-1885.923] (-1886.380) (-1895.546) * (-1888.447) [-1885.536] (-1891.000) (-1888.140) -- 0:02:55
209000 -- [-1885.559] (-1882.376) (-1892.226) (-1891.071) * [-1886.213] (-1881.902) (-1884.671) (-1888.304) -- 0:02:57
210000 -- [-1887.559] (-1881.489) (-1895.476) (-1889.667) * (-1891.214) (-1884.609) [-1888.505] (-1889.621) -- 0:02:56
Average standard deviation of split frequencies: 0.011934
211000 -- (-1884.907) [-1886.898] (-1887.437) (-1888.525) * (-1884.284) [-1885.911] (-1881.406) (-1885.532) -- 0:02:55
212000 -- (-1882.487) (-1885.040) (-1889.152) [-1884.977] * (-1891.911) (-1887.330) [-1884.807] (-1885.027) -- 0:02:54
213000 -- (-1883.283) (-1889.810) [-1884.398] (-1881.908) * [-1887.879] (-1892.480) (-1889.466) (-1888.385) -- 0:02:57
214000 -- (-1892.297) (-1891.234) [-1884.787] (-1885.269) * [-1886.497] (-1890.812) (-1888.583) (-1887.571) -- 0:02:56
215000 -- (-1885.458) [-1885.947] (-1885.344) (-1885.644) * (-1885.782) [-1889.015] (-1885.126) (-1885.057) -- 0:02:55
Average standard deviation of split frequencies: 0.008730
216000 -- (-1886.256) (-1886.547) (-1883.236) [-1888.686] * (-1885.793) (-1887.994) [-1886.061] (-1892.186) -- 0:02:54
217000 -- [-1883.154] (-1886.234) (-1890.630) (-1886.732) * [-1885.821] (-1884.697) (-1885.762) (-1884.346) -- 0:02:53
218000 -- (-1883.029) (-1891.565) [-1883.432] (-1887.891) * [-1885.264] (-1884.157) (-1883.527) (-1888.773) -- 0:02:55
219000 -- (-1883.264) (-1895.140) [-1883.099] (-1890.154) * [-1888.008] (-1882.064) (-1889.932) (-1886.570) -- 0:02:54
220000 -- (-1886.677) (-1886.759) [-1883.882] (-1884.773) * (-1890.817) [-1886.382] (-1888.226) (-1882.121) -- 0:02:53
Average standard deviation of split frequencies: 0.014242
221000 -- [-1889.402] (-1890.766) (-1885.519) (-1885.038) * (-1891.782) (-1881.452) (-1887.563) [-1881.834] -- 0:02:52
222000 -- [-1888.736] (-1885.778) (-1890.289) (-1885.627) * (-1884.260) (-1884.050) [-1887.318] (-1885.480) -- 0:02:55
223000 -- (-1888.419) [-1883.306] (-1885.427) (-1884.495) * (-1886.956) [-1884.338] (-1887.988) (-1882.119) -- 0:02:54
224000 -- [-1886.387] (-1883.893) (-1888.091) (-1889.593) * (-1883.517) [-1883.338] (-1889.456) (-1881.220) -- 0:02:53
225000 -- (-1882.246) [-1880.451] (-1887.630) (-1884.514) * [-1886.195] (-1885.471) (-1887.827) (-1887.868) -- 0:02:52
Average standard deviation of split frequencies: 0.008343
226000 -- (-1883.020) [-1881.390] (-1894.950) (-1886.233) * (-1887.350) [-1885.015] (-1881.470) (-1887.216) -- 0:02:51
227000 -- (-1884.349) [-1882.411] (-1888.017) (-1889.446) * (-1887.791) (-1890.173) [-1887.195] (-1888.141) -- 0:02:53
228000 -- [-1889.528] (-1885.124) (-1889.354) (-1891.734) * (-1886.584) (-1887.915) [-1883.593] (-1886.347) -- 0:02:52
229000 -- (-1891.026) (-1886.904) [-1889.771] (-1888.966) * [-1889.539] (-1885.844) (-1885.599) (-1886.391) -- 0:02:51
230000 -- (-1892.700) (-1883.960) (-1888.647) [-1884.779] * [-1889.207] (-1885.802) (-1883.967) (-1891.693) -- 0:02:50
Average standard deviation of split frequencies: 0.008175
231000 -- [-1882.730] (-1881.042) (-1889.940) (-1884.393) * [-1890.050] (-1886.918) (-1892.489) (-1893.250) -- 0:02:53
232000 -- [-1883.438] (-1886.827) (-1884.951) (-1882.169) * (-1883.693) [-1889.035] (-1882.211) (-1890.839) -- 0:02:52
233000 -- [-1884.684] (-1883.726) (-1883.893) (-1884.085) * (-1890.618) (-1890.965) [-1886.881] (-1893.430) -- 0:02:51
234000 -- [-1883.810] (-1886.028) (-1882.616) (-1884.810) * (-1883.797) [-1886.364] (-1884.999) (-1887.517) -- 0:02:50
235000 -- [-1885.876] (-1886.836) (-1887.939) (-1888.962) * [-1884.651] (-1883.228) (-1885.073) (-1885.740) -- 0:02:49
Average standard deviation of split frequencies: 0.017977
236000 -- [-1883.044] (-1888.332) (-1883.851) (-1881.422) * (-1886.879) [-1887.237] (-1888.394) (-1888.733) -- 0:02:51
237000 -- (-1889.303) (-1895.777) [-1883.473] (-1884.362) * [-1883.563] (-1891.848) (-1893.926) (-1886.895) -- 0:02:50
238000 -- (-1891.727) (-1890.585) [-1882.583] (-1886.754) * (-1883.375) (-1894.674) (-1885.147) [-1883.784] -- 0:02:49
239000 -- (-1887.350) (-1889.220) (-1887.017) [-1883.665] * [-1885.930] (-1886.904) (-1894.223) (-1885.779) -- 0:02:48
240000 -- (-1883.220) (-1888.563) [-1886.397] (-1891.755) * [-1889.106] (-1882.900) (-1890.661) (-1883.074) -- 0:02:51
Average standard deviation of split frequencies: 0.006856
241000 -- (-1890.728) (-1882.708) [-1885.282] (-1887.058) * (-1890.514) [-1882.320] (-1882.650) (-1886.112) -- 0:02:50
242000 -- [-1884.153] (-1888.432) (-1887.635) (-1888.951) * (-1886.601) [-1884.171] (-1889.423) (-1887.395) -- 0:02:49
243000 -- (-1885.421) (-1884.703) [-1889.051] (-1882.153) * [-1884.460] (-1889.597) (-1892.067) (-1884.918) -- 0:02:48
244000 -- (-1888.583) (-1883.555) [-1883.451] (-1884.172) * [-1885.582] (-1885.226) (-1883.339) (-1889.426) -- 0:02:50
245000 -- (-1886.698) (-1885.671) (-1887.123) [-1883.731] * (-1884.947) (-1883.700) (-1890.760) [-1883.010] -- 0:02:49
Average standard deviation of split frequencies: 0.000958
246000 -- [-1885.548] (-1881.549) (-1884.162) (-1888.888) * (-1883.505) (-1884.724) (-1889.193) [-1888.583] -- 0:02:48
247000 -- (-1887.026) (-1883.325) [-1882.777] (-1884.692) * (-1884.337) (-1890.519) (-1886.443) [-1883.593] -- 0:02:47
248000 -- (-1893.266) (-1885.827) (-1887.106) [-1885.648] * (-1887.326) [-1887.835] (-1892.316) (-1880.529) -- 0:02:46
249000 -- (-1891.421) (-1888.906) [-1884.785] (-1890.575) * (-1885.265) [-1887.935] (-1885.020) (-1881.612) -- 0:02:48
250000 -- [-1884.779] (-1886.632) (-1889.286) (-1886.239) * (-1887.736) (-1884.654) (-1887.430) [-1884.409] -- 0:02:48
Average standard deviation of split frequencies: 0.000000
251000 -- (-1894.718) [-1885.620] (-1886.648) (-1887.348) * (-1887.215) (-1888.563) [-1893.996] (-1888.647) -- 0:02:47
252000 -- (-1892.125) (-1883.321) [-1882.979] (-1886.285) * (-1894.103) (-1884.242) [-1886.326] (-1883.575) -- 0:02:46
253000 -- (-1888.639) (-1884.849) [-1884.587] (-1883.010) * [-1892.248] (-1884.078) (-1885.281) (-1883.269) -- 0:02:48
254000 -- [-1883.887] (-1881.532) (-1884.506) (-1883.932) * (-1884.096) (-1884.277) (-1883.655) [-1882.781] -- 0:02:47
255000 -- [-1890.782] (-1885.085) (-1891.312) (-1884.001) * (-1882.368) (-1890.444) (-1888.156) [-1887.416] -- 0:02:46
Average standard deviation of split frequencies: 0.002455
256000 -- (-1890.984) (-1886.214) (-1894.680) [-1888.169] * (-1886.836) (-1882.757) (-1897.510) [-1890.779] -- 0:02:45
257000 -- [-1890.664] (-1886.171) (-1890.277) (-1883.718) * (-1888.170) [-1883.504] (-1890.288) (-1886.770) -- 0:02:44
258000 -- (-1883.312) [-1886.933] (-1891.205) (-1891.771) * [-1890.892] (-1882.406) (-1892.893) (-1882.382) -- 0:02:46
259000 -- (-1888.148) (-1884.610) (-1884.174) [-1887.438] * (-1886.709) [-1883.729] (-1885.949) (-1885.987) -- 0:02:45
260000 -- [-1882.405] (-1883.484) (-1884.989) (-1883.403) * [-1884.628] (-1889.226) (-1886.829) (-1882.217) -- 0:02:45
Average standard deviation of split frequencies: 0.004521
261000 -- (-1887.833) (-1890.793) (-1887.149) [-1887.309] * (-1887.982) [-1886.252] (-1887.144) (-1882.089) -- 0:02:44
262000 -- (-1886.625) (-1888.865) [-1886.151] (-1885.915) * (-1887.951) [-1887.310] (-1884.811) (-1885.484) -- 0:02:43
263000 -- (-1885.742) (-1889.319) (-1892.346) [-1888.403] * (-1886.221) (-1891.943) [-1889.841] (-1896.610) -- 0:02:45
264000 -- (-1886.509) [-1886.397] (-1882.382) (-1883.359) * (-1886.010) [-1883.666] (-1893.766) (-1887.347) -- 0:02:44
265000 -- (-1887.641) (-1892.953) (-1882.272) [-1887.385] * (-1887.136) (-1889.412) [-1893.536] (-1890.248) -- 0:02:43
Average standard deviation of split frequencies: 0.000000
266000 -- [-1888.100] (-1886.399) (-1884.229) (-1882.987) * (-1883.104) [-1884.377] (-1885.612) (-1883.678) -- 0:02:42
267000 -- [-1885.410] (-1887.309) (-1887.141) (-1885.660) * (-1883.729) [-1885.652] (-1893.426) (-1884.915) -- 0:02:44
268000 -- [-1885.112] (-1883.120) (-1888.389) (-1887.847) * [-1881.932] (-1880.231) (-1884.977) (-1883.320) -- 0:02:43
269000 -- (-1892.637) (-1879.512) [-1885.974] (-1887.278) * (-1883.944) [-1888.998] (-1889.315) (-1882.202) -- 0:02:43
270000 -- (-1882.110) [-1883.142] (-1891.692) (-1884.494) * (-1881.230) [-1885.588] (-1887.644) (-1886.441) -- 0:02:42
Average standard deviation of split frequencies: 0.002612
271000 -- [-1886.092] (-1889.542) (-1883.186) (-1887.140) * (-1892.311) (-1882.623) (-1884.478) [-1884.337] -- 0:02:41
272000 -- (-1882.214) [-1890.698] (-1891.984) (-1884.146) * (-1887.178) [-1883.841] (-1888.150) (-1884.995) -- 0:02:43
273000 -- (-1886.237) (-1886.195) [-1887.587] (-1883.149) * (-1883.727) [-1884.733] (-1887.359) (-1885.086) -- 0:02:42
274000 -- [-1887.693] (-1884.809) (-1883.800) (-1888.525) * (-1884.770) [-1886.724] (-1881.537) (-1889.696) -- 0:02:41
275000 -- (-1890.031) (-1883.626) (-1887.335) [-1888.557] * (-1884.766) (-1886.468) [-1885.328] (-1887.720) -- 0:02:40
Average standard deviation of split frequencies: 0.001708
276000 -- (-1890.696) (-1889.403) (-1884.874) [-1888.749] * (-1890.363) [-1887.422] (-1881.438) (-1880.639) -- 0:02:42
277000 -- (-1883.767) (-1886.358) [-1886.596] (-1883.292) * [-1883.064] (-1883.945) (-1885.229) (-1886.980) -- 0:02:41
278000 -- [-1887.276] (-1882.683) (-1888.793) (-1882.471) * (-1892.985) [-1886.613] (-1885.633) (-1883.646) -- 0:02:41
279000 -- (-1885.876) (-1882.503) (-1886.407) [-1880.541] * (-1890.227) (-1886.757) [-1888.250] (-1885.163) -- 0:02:40
280000 -- (-1889.769) [-1884.602] (-1887.711) (-1884.769) * (-1890.493) [-1884.993] (-1882.806) (-1884.786) -- 0:02:42
Average standard deviation of split frequencies: 0.005039
281000 -- [-1885.985] (-1882.643) (-1881.973) (-1889.017) * (-1898.142) (-1885.097) (-1888.240) [-1891.165] -- 0:02:41
282000 -- (-1883.454) [-1883.377] (-1880.757) (-1886.750) * (-1887.691) (-1884.799) (-1886.191) [-1884.325] -- 0:02:40
283000 -- (-1880.624) (-1884.605) [-1880.812] (-1889.219) * (-1887.587) (-1888.108) (-1889.841) [-1883.189] -- 0:02:39
284000 -- (-1889.047) (-1884.217) (-1882.056) [-1881.112] * (-1887.770) (-1889.370) [-1886.164] (-1886.746) -- 0:02:38
285000 -- (-1882.553) [-1885.094] (-1882.059) (-1886.831) * (-1885.990) (-1884.166) (-1884.499) [-1887.108] -- 0:02:40
Average standard deviation of split frequencies: 0.001648
286000 -- (-1884.651) (-1885.398) [-1889.115] (-1885.162) * [-1881.762] (-1888.380) (-1889.171) (-1887.503) -- 0:02:39
287000 -- [-1884.315] (-1885.982) (-1887.208) (-1885.734) * [-1885.362] (-1886.031) (-1883.072) (-1887.516) -- 0:02:38
288000 -- [-1883.012] (-1885.485) (-1889.481) (-1887.220) * (-1886.254) (-1886.480) [-1882.598] (-1882.831) -- 0:02:38
289000 -- (-1882.846) (-1896.399) [-1883.267] (-1885.697) * (-1885.920) [-1880.700] (-1887.333) (-1888.977) -- 0:02:39
290000 -- (-1885.892) (-1888.904) (-1886.804) [-1886.536] * (-1889.753) (-1882.056) [-1882.451] (-1890.531) -- 0:02:39
Average standard deviation of split frequencies: 0.002162
291000 -- [-1884.455] (-1885.533) (-1893.236) (-1887.273) * [-1892.617] (-1884.322) (-1883.829) (-1887.377) -- 0:02:38
292000 -- (-1887.565) [-1886.675] (-1887.040) (-1893.812) * [-1890.070] (-1886.710) (-1887.544) (-1882.835) -- 0:02:37
293000 -- (-1890.395) [-1888.770] (-1889.727) (-1887.144) * (-1883.691) (-1889.302) (-1888.187) [-1885.865] -- 0:02:36
294000 -- [-1884.662] (-1890.191) (-1890.374) (-1886.126) * (-1888.119) (-1886.070) [-1882.242] (-1888.798) -- 0:02:38
295000 -- (-1886.684) [-1884.500] (-1881.699) (-1886.936) * [-1884.479] (-1883.689) (-1884.700) (-1885.060) -- 0:02:37
Average standard deviation of split frequencies: 0.007432
296000 -- (-1890.725) [-1884.716] (-1885.327) (-1889.067) * (-1888.096) (-1884.364) (-1882.244) [-1881.002] -- 0:02:36
297000 -- (-1887.941) (-1885.846) (-1885.559) [-1887.085] * (-1891.224) (-1883.795) (-1883.299) [-1883.964] -- 0:02:36
298000 -- (-1884.238) [-1889.129] (-1886.784) (-1889.078) * (-1891.165) (-1883.425) (-1883.371) [-1883.360] -- 0:02:37
299000 -- (-1885.146) [-1883.702] (-1887.802) (-1886.205) * (-1888.040) (-1884.829) (-1888.490) [-1886.016] -- 0:02:37
300000 -- (-1882.693) [-1888.390] (-1882.911) (-1889.619) * (-1883.714) [-1882.482] (-1890.400) (-1883.769) -- 0:02:36
Average standard deviation of split frequencies: 0.007317
301000 -- [-1880.845] (-1883.263) (-1883.251) (-1886.718) * [-1885.693] (-1884.721) (-1885.132) (-1888.027) -- 0:02:35
302000 -- (-1887.274) (-1887.374) [-1883.723] (-1889.097) * (-1886.666) (-1885.924) [-1889.363] (-1887.179) -- 0:02:34
303000 -- [-1885.775] (-1888.718) (-1884.968) (-1891.067) * (-1882.305) (-1882.045) [-1883.972] (-1886.437) -- 0:02:36
304000 -- (-1895.189) [-1887.033] (-1891.328) (-1887.591) * (-1883.773) [-1888.372] (-1887.572) (-1883.559) -- 0:02:35
305000 -- (-1884.792) [-1888.247] (-1889.969) (-1886.457) * (-1893.503) [-1883.497] (-1886.809) (-1888.086) -- 0:02:34
Average standard deviation of split frequencies: 0.008216
306000 -- (-1886.663) (-1884.021) [-1883.887] (-1888.170) * (-1885.029) (-1890.002) [-1887.602] (-1885.590) -- 0:02:34
307000 -- [-1882.579] (-1882.429) (-1891.030) (-1887.585) * (-1883.676) [-1884.905] (-1883.412) (-1885.986) -- 0:02:35
308000 -- (-1887.791) [-1888.656] (-1892.033) (-1883.464) * [-1888.751] (-1891.525) (-1885.032) (-1891.436) -- 0:02:35
309000 -- (-1886.600) [-1888.551] (-1886.944) (-1883.647) * (-1883.396) (-1890.503) [-1882.121] (-1888.246) -- 0:02:34
310000 -- (-1889.061) [-1892.107] (-1885.257) (-1883.473) * (-1882.922) (-1885.061) (-1887.764) [-1885.049] -- 0:02:33
Average standard deviation of split frequencies: 0.008093
311000 -- (-1884.977) (-1885.452) (-1891.499) [-1884.383] * (-1887.118) (-1888.326) [-1885.624] (-1887.437) -- 0:02:32
312000 -- (-1885.888) (-1887.011) [-1885.837] (-1883.886) * (-1885.822) [-1884.210] (-1886.142) (-1884.426) -- 0:02:34
313000 -- (-1885.947) [-1882.198] (-1892.352) (-1881.233) * (-1891.523) (-1885.943) (-1892.182) [-1886.858] -- 0:02:33
314000 -- (-1886.401) [-1888.573] (-1882.392) (-1883.927) * (-1888.377) (-1885.014) [-1886.742] (-1889.631) -- 0:02:32
315000 -- (-1885.412) (-1890.675) [-1888.979] (-1884.390) * (-1886.438) [-1885.866] (-1886.455) (-1889.342) -- 0:02:32
Average standard deviation of split frequencies: 0.008951
316000 -- (-1886.836) (-1889.190) [-1884.724] (-1890.544) * (-1885.894) [-1887.341] (-1890.737) (-1889.144) -- 0:02:33
317000 -- (-1884.996) [-1888.507] (-1884.638) (-1884.593) * (-1887.085) (-1883.971) [-1880.721] (-1887.288) -- 0:02:32
318000 -- (-1883.333) (-1890.323) (-1889.065) [-1881.421] * [-1884.513] (-1881.698) (-1885.775) (-1887.223) -- 0:02:32
319000 -- (-1883.990) (-1887.953) (-1893.872) [-1883.512] * [-1883.478] (-1881.792) (-1890.399) (-1888.976) -- 0:02:31
320000 -- (-1884.163) (-1884.147) (-1883.186) [-1884.891] * (-1890.176) (-1886.013) [-1881.666] (-1883.855) -- 0:02:30
Average standard deviation of split frequencies: 0.007840
321000 -- (-1889.817) (-1891.981) [-1884.513] (-1883.411) * [-1885.489] (-1890.223) (-1889.203) (-1892.643) -- 0:02:32
322000 -- (-1888.083) (-1894.238) [-1885.009] (-1885.923) * (-1889.769) [-1888.046] (-1890.341) (-1888.750) -- 0:02:31
323000 -- (-1886.463) (-1889.665) [-1888.885] (-1884.939) * [-1883.740] (-1892.234) (-1887.363) (-1887.688) -- 0:02:30
324000 -- (-1892.657) (-1885.057) (-1886.033) [-1885.197] * [-1881.508] (-1887.236) (-1888.452) (-1884.842) -- 0:02:30
325000 -- [-1883.287] (-1885.225) (-1887.033) (-1879.261) * [-1890.034] (-1885.325) (-1900.600) (-1889.923) -- 0:02:31
Average standard deviation of split frequencies: 0.008676
326000 -- [-1889.707] (-1888.896) (-1881.175) (-1883.147) * (-1888.687) (-1885.128) (-1885.621) [-1882.105] -- 0:02:30
327000 -- (-1886.900) [-1888.636] (-1889.778) (-1889.841) * (-1886.541) (-1888.723) [-1884.639] (-1886.416) -- 0:02:30
328000 -- (-1890.519) [-1883.919] (-1884.250) (-1890.131) * (-1884.157) (-1882.173) [-1883.026] (-1894.884) -- 0:02:29
329000 -- (-1889.406) (-1887.770) [-1885.051] (-1883.474) * (-1885.211) (-1886.619) [-1884.150] (-1885.646) -- 0:02:28
330000 -- (-1885.532) [-1888.761] (-1883.484) (-1889.533) * (-1887.378) [-1889.740] (-1889.219) (-1881.202) -- 0:02:30
Average standard deviation of split frequencies: 0.010455
331000 -- (-1880.950) (-1890.042) [-1885.876] (-1891.803) * [-1886.844] (-1886.510) (-1885.705) (-1889.741) -- 0:02:29
332000 -- (-1888.341) [-1887.005] (-1888.011) (-1887.068) * (-1888.766) [-1881.838] (-1885.790) (-1886.524) -- 0:02:28
333000 -- (-1883.545) (-1883.838) [-1885.321] (-1885.904) * (-1887.231) [-1884.620] (-1886.275) (-1887.622) -- 0:02:28
334000 -- (-1891.101) (-1887.192) [-1889.949] (-1889.568) * (-1891.537) [-1890.567] (-1885.139) (-1888.523) -- 0:02:29
335000 -- (-1887.090) [-1886.971] (-1886.034) (-1883.843) * (-1886.610) (-1886.030) (-1885.979) [-1888.334] -- 0:02:28
Average standard deviation of split frequencies: 0.009353
336000 -- (-1885.781) (-1884.502) [-1886.636] (-1885.639) * [-1888.063] (-1887.156) (-1880.732) (-1890.627) -- 0:02:28
337000 -- (-1882.269) [-1890.997] (-1887.396) (-1884.230) * (-1894.215) (-1884.270) (-1888.828) [-1881.685] -- 0:02:27
338000 -- [-1886.793] (-1890.537) (-1887.705) (-1887.896) * (-1883.678) [-1890.461] (-1881.695) (-1886.796) -- 0:02:26
339000 -- (-1886.768) (-1887.916) [-1882.216] (-1891.495) * (-1885.894) (-1887.871) (-1886.693) [-1881.806] -- 0:02:28
340000 -- (-1887.031) [-1883.779] (-1882.043) (-1885.125) * (-1889.025) [-1887.326] (-1882.500) (-1888.799) -- 0:02:27
Average standard deviation of split frequencies: 0.007380
341000 -- (-1882.527) (-1885.906) (-1883.929) [-1884.317] * (-1892.288) [-1886.721] (-1886.282) (-1886.794) -- 0:02:26
342000 -- (-1883.589) (-1885.456) [-1885.016] (-1884.495) * [-1881.127] (-1890.843) (-1885.620) (-1888.328) -- 0:02:26
343000 -- (-1890.410) (-1889.476) [-1886.211] (-1889.962) * (-1884.074) [-1881.715] (-1893.079) (-1887.508) -- 0:02:27
344000 -- (-1888.275) (-1888.835) (-1884.238) [-1887.138] * (-1887.816) (-1891.178) (-1886.685) [-1888.989] -- 0:02:26
345000 -- (-1887.993) [-1885.668] (-1885.179) (-1891.360) * (-1892.031) (-1883.036) [-1887.678] (-1885.189) -- 0:02:26
Average standard deviation of split frequencies: 0.009083
346000 -- (-1885.598) (-1894.380) (-1880.058) [-1884.322] * (-1888.393) (-1886.843) [-1885.844] (-1885.996) -- 0:02:25
347000 -- (-1888.950) (-1890.462) (-1893.985) [-1887.594] * [-1884.415] (-1890.200) (-1888.188) (-1889.173) -- 0:02:26
348000 -- (-1889.853) [-1885.016] (-1889.292) (-1890.668) * (-1887.140) [-1889.520] (-1887.200) (-1886.452) -- 0:02:26
349000 -- (-1886.520) (-1889.778) (-1889.744) [-1885.787] * [-1883.511] (-1888.648) (-1890.053) (-1892.040) -- 0:02:25
350000 -- [-1880.228] (-1892.972) (-1884.487) (-1885.043) * (-1886.670) [-1888.667] (-1892.322) (-1888.942) -- 0:02:24
Average standard deviation of split frequencies: 0.007170
351000 -- [-1882.762] (-1896.907) (-1886.753) (-1890.542) * [-1885.353] (-1884.674) (-1887.937) (-1892.365) -- 0:02:24
352000 -- [-1890.150] (-1890.116) (-1881.635) (-1886.025) * (-1888.241) [-1886.999] (-1887.770) (-1886.553) -- 0:02:25
353000 -- (-1885.762) (-1879.988) [-1891.357] (-1891.132) * (-1887.193) [-1886.653] (-1884.423) (-1888.524) -- 0:02:24
354000 -- [-1884.217] (-1885.987) (-1885.627) (-1886.772) * (-1888.486) [-1886.173] (-1883.992) (-1888.522) -- 0:02:24
355000 -- (-1886.501) [-1883.786] (-1887.603) (-1882.031) * (-1893.593) [-1885.348] (-1884.418) (-1886.924) -- 0:02:23
Average standard deviation of split frequencies: 0.007062
356000 -- (-1889.939) (-1885.971) [-1885.432] (-1888.093) * (-1888.897) (-1890.763) (-1886.692) [-1882.293] -- 0:02:24
357000 -- (-1884.128) (-1884.902) (-1886.533) [-1883.249] * [-1881.433] (-1888.585) (-1893.455) (-1884.474) -- 0:02:24
358000 -- [-1885.319] (-1882.970) (-1880.724) (-1884.334) * [-1885.571] (-1891.544) (-1885.582) (-1885.712) -- 0:02:23
359000 -- [-1887.535] (-1887.672) (-1881.559) (-1890.231) * (-1887.733) (-1887.064) [-1887.165] (-1886.359) -- 0:02:22
360000 -- [-1892.511] (-1892.782) (-1884.718) (-1890.565) * (-1885.045) (-1882.494) [-1886.626] (-1890.188) -- 0:02:22
Average standard deviation of split frequencies: 0.008714
361000 -- (-1887.319) [-1884.215] (-1888.817) (-1887.117) * (-1883.636) [-1882.774] (-1882.936) (-1890.564) -- 0:02:23
362000 -- (-1887.781) (-1887.956) (-1886.067) [-1883.036] * (-1890.678) (-1890.173) (-1888.715) [-1888.710] -- 0:02:22
363000 -- [-1882.676] (-1884.695) (-1883.026) (-1886.185) * (-1885.029) [-1885.629] (-1887.648) (-1891.070) -- 0:02:22
364000 -- (-1886.411) (-1891.800) (-1889.519) [-1886.451] * (-1885.774) (-1884.860) [-1889.143] (-1882.910) -- 0:02:21
365000 -- (-1885.241) (-1886.542) [-1882.407] (-1885.586) * (-1888.636) (-1885.375) (-1884.445) [-1892.103] -- 0:02:22
Average standard deviation of split frequencies: 0.008587
366000 -- [-1886.241] (-1886.175) (-1888.228) (-1884.520) * (-1887.257) (-1880.213) (-1883.729) [-1886.373] -- 0:02:22
367000 -- (-1886.509) (-1891.773) (-1885.648) [-1883.667] * (-1882.965) (-1887.650) (-1886.414) [-1883.320] -- 0:02:21
368000 -- (-1882.062) (-1884.518) [-1880.337] (-1881.220) * (-1887.682) [-1882.021] (-1886.629) (-1880.242) -- 0:02:20
369000 -- (-1884.623) (-1886.901) [-1888.214] (-1883.414) * [-1889.423] (-1885.791) (-1889.647) (-1888.571) -- 0:02:20
370000 -- [-1884.950] (-1884.403) (-1885.209) (-1885.918) * (-1885.335) [-1884.025] (-1890.068) (-1883.957) -- 0:02:21
Average standard deviation of split frequencies: 0.008902
371000 -- (-1889.929) (-1890.291) (-1884.026) [-1884.501] * (-1892.723) [-1882.307] (-1884.368) (-1883.375) -- 0:02:20
372000 -- (-1885.973) (-1893.775) (-1891.048) [-1881.568] * (-1886.220) (-1885.814) (-1890.600) [-1882.052] -- 0:02:20
373000 -- (-1887.592) (-1886.419) [-1889.234] (-1883.375) * (-1883.164) (-1886.056) (-1883.592) [-1882.295] -- 0:02:19
374000 -- (-1885.499) (-1885.083) (-1883.878) [-1880.471] * [-1884.296] (-1884.636) (-1892.357) (-1881.816) -- 0:02:20
375000 -- (-1886.002) (-1883.748) [-1884.889] (-1889.265) * (-1884.621) [-1882.364] (-1886.479) (-1889.050) -- 0:02:20
Average standard deviation of split frequencies: 0.006269
376000 -- (-1885.089) (-1884.415) [-1889.355] (-1884.012) * (-1884.361) (-1884.246) (-1883.009) [-1886.087] -- 0:02:19
377000 -- (-1881.859) [-1881.369] (-1888.944) (-1889.648) * (-1891.122) (-1885.239) [-1883.542] (-1894.744) -- 0:02:18
378000 -- [-1883.519] (-1888.437) (-1890.749) (-1893.210) * [-1886.144] (-1885.317) (-1889.274) (-1884.315) -- 0:02:18
379000 -- (-1890.235) (-1884.721) (-1895.084) [-1888.587] * (-1884.941) (-1896.162) [-1884.173] (-1886.824) -- 0:02:19
380000 -- (-1884.291) [-1888.176] (-1891.042) (-1881.473) * [-1884.875] (-1892.378) (-1884.491) (-1891.080) -- 0:02:18
Average standard deviation of split frequencies: 0.008669
381000 -- (-1883.624) (-1889.330) (-1891.064) [-1885.344] * (-1885.059) [-1884.428] (-1888.330) (-1884.392) -- 0:02:18
382000 -- (-1892.204) (-1897.789) (-1890.653) [-1888.038] * [-1887.313] (-1887.161) (-1889.189) (-1882.447) -- 0:02:17
383000 -- [-1885.532] (-1888.728) (-1893.514) (-1883.839) * (-1886.726) [-1889.118] (-1890.890) (-1882.620) -- 0:02:18
384000 -- [-1884.502] (-1888.565) (-1891.720) (-1888.056) * [-1886.722] (-1886.837) (-1886.214) (-1887.140) -- 0:02:17
385000 -- (-1885.287) (-1887.640) [-1884.951] (-1888.437) * (-1881.955) (-1887.428) [-1885.951] (-1888.638) -- 0:02:17
Average standard deviation of split frequencies: 0.005496
386000 -- (-1884.373) (-1886.331) [-1885.968] (-1890.125) * (-1891.485) (-1883.715) (-1886.932) [-1885.739] -- 0:02:16
387000 -- [-1889.991] (-1892.539) (-1888.164) (-1883.354) * [-1881.642] (-1881.804) (-1888.497) (-1888.460) -- 0:02:16
388000 -- (-1892.118) (-1892.332) (-1883.437) [-1885.214] * (-1885.170) (-1888.035) [-1884.554] (-1884.886) -- 0:02:17
389000 -- [-1891.894] (-1885.047) (-1886.712) (-1889.286) * [-1884.210] (-1889.047) (-1883.507) (-1885.462) -- 0:02:16
390000 -- (-1898.400) [-1884.533] (-1888.693) (-1888.127) * (-1884.327) (-1881.974) (-1886.443) [-1881.051] -- 0:02:16
Average standard deviation of split frequencies: 0.004223
391000 -- [-1883.590] (-1885.358) (-1889.509) (-1891.816) * [-1884.277] (-1893.586) (-1881.792) (-1882.888) -- 0:02:15
392000 -- (-1886.298) (-1890.927) (-1888.585) [-1884.026] * (-1885.285) (-1884.368) (-1889.966) [-1886.920] -- 0:02:16
393000 -- [-1884.784] (-1888.573) (-1879.776) (-1887.752) * (-1888.403) (-1884.533) (-1883.622) [-1889.183] -- 0:02:15
394000 -- (-1885.157) (-1882.970) [-1883.707] (-1891.643) * (-1891.957) [-1885.338] (-1883.882) (-1886.499) -- 0:02:15
395000 -- (-1887.913) (-1880.814) [-1883.494] (-1888.868) * (-1890.923) [-1884.075] (-1886.270) (-1890.197) -- 0:02:14
Average standard deviation of split frequencies: 0.004762
396000 -- [-1890.303] (-1888.675) (-1883.516) (-1894.433) * (-1886.726) (-1893.296) [-1892.757] (-1888.854) -- 0:02:14
397000 -- (-1888.150) (-1882.324) (-1892.924) [-1885.638] * (-1888.791) (-1890.616) [-1885.416] (-1889.861) -- 0:02:15
398000 -- (-1886.867) (-1890.864) (-1886.871) [-1884.244] * (-1894.329) [-1888.134] (-1887.669) (-1883.477) -- 0:02:14
399000 -- (-1887.805) [-1888.837] (-1884.746) (-1887.847) * (-1885.313) [-1886.433] (-1890.319) (-1885.266) -- 0:02:14
400000 -- (-1882.584) (-1889.599) (-1885.306) [-1888.704] * (-1891.491) (-1888.456) (-1884.599) [-1884.320] -- 0:02:13
Average standard deviation of split frequencies: 0.006471
401000 -- (-1886.440) [-1889.115] (-1883.605) (-1890.619) * (-1881.870) (-1885.683) (-1884.620) [-1885.247] -- 0:02:14
402000 -- (-1891.764) [-1886.291] (-1882.746) (-1884.699) * (-1885.388) (-1891.507) [-1882.183] (-1882.001) -- 0:02:13
403000 -- (-1882.582) (-1888.477) [-1885.411] (-1887.165) * (-1890.586) [-1884.893] (-1886.386) (-1885.478) -- 0:02:13
404000 -- (-1887.297) [-1885.452] (-1886.816) (-1888.820) * (-1886.341) [-1886.347] (-1887.755) (-1887.982) -- 0:02:12
405000 -- (-1885.213) (-1889.477) (-1897.886) [-1894.999] * (-1886.860) (-1883.787) (-1892.054) [-1880.922] -- 0:02:12
Average standard deviation of split frequencies: 0.008708
406000 -- (-1884.181) [-1883.943] (-1889.033) (-1893.057) * (-1885.604) (-1886.693) (-1886.476) [-1886.242] -- 0:02:13
407000 -- [-1884.557] (-1882.791) (-1884.713) (-1886.120) * (-1903.049) (-1886.755) [-1882.568] (-1882.926) -- 0:02:12
408000 -- (-1893.585) [-1881.284] (-1888.898) (-1890.979) * (-1888.590) (-1884.780) [-1885.426] (-1883.148) -- 0:02:12
409000 -- (-1887.602) [-1883.860] (-1881.270) (-1888.142) * (-1891.262) (-1884.789) (-1892.629) [-1885.141] -- 0:02:11
410000 -- (-1885.376) (-1884.997) (-1886.102) [-1887.703] * [-1883.030] (-1883.008) (-1886.514) (-1885.742) -- 0:02:12
Average standard deviation of split frequencies: 0.006887
411000 -- [-1885.789] (-1884.888) (-1882.886) (-1890.161) * (-1883.864) [-1883.499] (-1882.808) (-1891.339) -- 0:02:11
412000 -- [-1882.209] (-1890.731) (-1885.441) (-1888.036) * (-1890.828) [-1882.230] (-1884.840) (-1890.596) -- 0:02:11
413000 -- (-1881.625) (-1888.956) (-1887.853) [-1880.976] * [-1883.973] (-1884.553) (-1887.015) (-1893.340) -- 0:02:10
414000 -- [-1880.709] (-1884.169) (-1886.763) (-1885.255) * [-1883.040] (-1881.335) (-1886.256) (-1894.366) -- 0:02:10
415000 -- [-1885.339] (-1887.402) (-1880.964) (-1886.614) * (-1883.439) (-1884.967) [-1886.846] (-1883.454) -- 0:02:11
Average standard deviation of split frequencies: 0.008499
416000 -- (-1891.157) (-1888.367) [-1884.872] (-1882.513) * (-1882.405) (-1885.197) [-1882.560] (-1886.459) -- 0:02:10
417000 -- (-1885.522) (-1885.712) [-1881.340] (-1891.736) * (-1884.064) [-1882.867] (-1888.812) (-1889.068) -- 0:02:10
418000 -- [-1883.057] (-1882.090) (-1887.977) (-1883.585) * (-1883.675) [-1884.827] (-1885.498) (-1882.728) -- 0:02:09
419000 -- (-1888.477) [-1884.260] (-1892.763) (-1887.913) * [-1882.051] (-1883.249) (-1888.984) (-1884.443) -- 0:02:10
420000 -- [-1885.067] (-1886.019) (-1888.453) (-1884.605) * [-1885.192] (-1888.985) (-1885.737) (-1884.813) -- 0:02:09
Average standard deviation of split frequencies: 0.009525
421000 -- (-1886.851) (-1887.674) (-1891.666) [-1888.403] * (-1889.024) [-1882.757] (-1883.388) (-1880.594) -- 0:02:09
422000 -- (-1888.803) (-1895.456) (-1886.452) [-1888.130] * (-1896.701) [-1883.633] (-1886.367) (-1883.061) -- 0:02:08
423000 -- (-1889.469) (-1888.235) (-1891.759) [-1884.581] * (-1887.842) (-1883.694) (-1883.888) [-1881.389] -- 0:02:08
424000 -- (-1885.689) [-1889.814] (-1883.876) (-1883.525) * (-1891.633) (-1891.057) [-1886.365] (-1888.572) -- 0:02:09
425000 -- [-1882.542] (-1889.541) (-1887.456) (-1884.330) * (-1889.473) (-1886.544) (-1883.943) [-1883.577] -- 0:02:08
Average standard deviation of split frequencies: 0.008853
426000 -- (-1886.224) (-1883.373) [-1888.267] (-1886.153) * (-1892.190) (-1885.486) (-1886.505) [-1886.121] -- 0:02:08
427000 -- (-1890.303) (-1885.670) (-1890.924) [-1882.883] * [-1881.872] (-1891.197) (-1888.724) (-1889.849) -- 0:02:07
428000 -- (-1887.993) (-1886.539) (-1887.486) [-1881.552] * [-1882.158] (-1881.608) (-1890.853) (-1888.781) -- 0:02:08
429000 -- (-1886.926) (-1884.667) [-1888.035] (-1895.265) * (-1886.852) (-1891.094) [-1883.669] (-1890.470) -- 0:02:07
430000 -- (-1881.796) [-1885.394] (-1885.282) (-1894.551) * [-1883.871] (-1884.940) (-1887.125) (-1890.789) -- 0:02:07
Average standard deviation of split frequencies: 0.006020
431000 -- (-1892.423) (-1888.139) [-1881.404] (-1893.727) * (-1891.631) [-1882.609] (-1886.007) (-1887.979) -- 0:02:06
432000 -- (-1890.073) (-1891.021) [-1884.376] (-1889.095) * (-1888.010) (-1888.301) [-1890.544] (-1886.888) -- 0:02:07
433000 -- (-1883.891) [-1883.384] (-1887.001) (-1886.062) * [-1889.816] (-1887.082) (-1888.252) (-1888.631) -- 0:02:07
434000 -- (-1879.676) (-1888.411) (-1887.289) [-1886.097] * (-1884.987) (-1883.065) [-1888.454] (-1888.197) -- 0:02:06
435000 -- [-1885.720] (-1883.382) (-1896.207) (-1886.020) * (-1895.333) (-1883.464) [-1886.964] (-1882.112) -- 0:02:05
Average standard deviation of split frequencies: 0.004865
436000 -- (-1891.727) (-1884.802) (-1890.475) [-1883.914] * [-1882.903] (-1882.298) (-1891.217) (-1884.625) -- 0:02:05
437000 -- (-1881.373) (-1885.689) (-1881.878) [-1882.179] * (-1886.789) (-1888.978) (-1889.135) [-1885.477] -- 0:02:06
438000 -- (-1882.627) [-1888.957] (-1882.741) (-1883.290) * (-1886.276) (-1885.405) [-1884.017] (-1885.172) -- 0:02:05
439000 -- (-1883.699) (-1884.707) [-1882.454] (-1887.210) * (-1890.095) (-1887.349) (-1883.828) [-1887.608] -- 0:02:05
440000 -- (-1880.836) (-1895.062) (-1890.863) [-1893.715] * (-1891.127) (-1884.809) (-1890.435) [-1888.727] -- 0:02:04
Average standard deviation of split frequencies: 0.004279
441000 -- [-1885.222] (-1884.657) (-1882.071) (-1893.200) * (-1884.050) (-1885.402) [-1885.225] (-1890.664) -- 0:02:05
442000 -- (-1893.164) [-1885.033] (-1882.876) (-1886.558) * (-1887.952) (-1884.010) [-1886.536] (-1889.058) -- 0:02:04
443000 -- (-1887.989) (-1886.937) (-1888.809) [-1891.054] * (-1885.293) [-1882.942] (-1889.444) (-1888.536) -- 0:02:04
444000 -- (-1897.678) (-1889.070) [-1880.796] (-1891.249) * (-1884.670) (-1894.065) (-1886.836) [-1889.790] -- 0:02:03
445000 -- (-1886.813) (-1894.867) (-1883.395) [-1882.716] * (-1897.148) (-1885.673) [-1885.525] (-1884.743) -- 0:02:03
Average standard deviation of split frequencies: 0.004756
446000 -- (-1889.178) (-1898.315) (-1884.884) [-1883.809] * [-1883.518] (-1885.009) (-1883.101) (-1886.620) -- 0:02:04
447000 -- [-1884.741] (-1896.413) (-1885.582) (-1884.020) * (-1887.876) (-1882.239) (-1878.784) [-1883.625] -- 0:02:03
448000 -- (-1886.750) [-1886.866] (-1886.421) (-1886.102) * (-1887.441) (-1888.482) (-1885.500) [-1882.838] -- 0:02:03
449000 -- (-1889.491) (-1890.809) [-1890.343] (-1885.661) * (-1882.961) [-1887.118] (-1890.226) (-1890.465) -- 0:02:02
450000 -- (-1882.822) (-1894.912) [-1890.060] (-1891.117) * (-1885.089) (-1889.609) (-1885.889) [-1893.151] -- 0:02:03
Average standard deviation of split frequencies: 0.005230
451000 -- (-1891.462) (-1882.831) (-1887.461) [-1888.135] * [-1883.990] (-1882.453) (-1883.178) (-1883.602) -- 0:02:02
452000 -- (-1887.363) (-1890.875) (-1890.309) [-1881.273] * (-1888.211) (-1889.365) [-1883.068] (-1887.360) -- 0:02:02
453000 -- (-1886.005) [-1889.739] (-1889.241) (-1885.357) * (-1890.109) (-1885.014) [-1883.232] (-1889.990) -- 0:02:01
454000 -- [-1886.216] (-1889.559) (-1893.254) (-1884.480) * [-1884.012] (-1888.294) (-1884.542) (-1890.515) -- 0:02:01
455000 -- (-1889.207) [-1884.658] (-1899.455) (-1885.701) * (-1886.149) (-1885.049) [-1882.118] (-1889.343) -- 0:02:02
Average standard deviation of split frequencies: 0.005686
456000 -- (-1883.993) (-1883.200) [-1897.150] (-1893.542) * [-1894.384] (-1888.340) (-1885.152) (-1881.592) -- 0:02:01
457000 -- (-1891.833) (-1886.132) (-1895.931) [-1883.071] * (-1887.725) [-1884.378] (-1884.059) (-1890.498) -- 0:02:01
458000 -- (-1888.320) (-1887.539) [-1886.714] (-1889.806) * (-1884.081) [-1884.836] (-1880.168) (-1885.867) -- 0:02:00
459000 -- [-1890.472] (-1887.084) (-1887.224) (-1886.802) * (-1883.952) (-1894.469) (-1886.484) [-1882.059] -- 0:02:01
460000 -- (-1891.047) [-1883.947] (-1889.665) (-1885.232) * (-1887.165) [-1884.726] (-1881.472) (-1884.020) -- 0:02:00
Average standard deviation of split frequencies: 0.006140
461000 -- [-1887.926] (-1890.792) (-1883.185) (-1888.490) * (-1883.379) (-1888.627) [-1881.176] (-1887.426) -- 0:02:00
462000 -- (-1890.547) [-1883.993] (-1888.296) (-1888.599) * [-1881.838] (-1888.857) (-1888.114) (-1887.365) -- 0:01:59
463000 -- (-1891.605) (-1883.145) [-1884.785] (-1888.179) * (-1883.231) (-1886.204) (-1887.821) [-1885.001] -- 0:01:59
464000 -- (-1887.871) (-1887.246) (-1888.553) [-1881.976] * [-1884.643] (-1881.810) (-1884.466) (-1888.817) -- 0:02:00
465000 -- (-1894.429) (-1888.627) [-1884.701] (-1884.204) * (-1884.293) [-1883.957] (-1890.542) (-1889.238) -- 0:01:59
Average standard deviation of split frequencies: 0.006070
466000 -- (-1894.015) (-1887.925) (-1884.200) [-1884.942] * [-1885.370] (-1883.751) (-1885.747) (-1889.740) -- 0:01:59
467000 -- [-1883.701] (-1889.820) (-1880.701) (-1883.432) * (-1883.584) (-1883.018) [-1885.419] (-1889.069) -- 0:01:58
468000 -- [-1886.876] (-1884.881) (-1883.644) (-1889.939) * [-1884.474] (-1888.407) (-1884.388) (-1892.905) -- 0:01:59
469000 -- [-1888.907] (-1883.777) (-1884.672) (-1890.287) * (-1887.135) [-1882.057] (-1886.156) (-1885.689) -- 0:01:58
470000 -- (-1890.101) [-1882.553] (-1887.077) (-1886.842) * (-1886.379) (-1884.459) [-1884.317] (-1891.772) -- 0:01:58
Average standard deviation of split frequencies: 0.007011
471000 -- (-1887.624) (-1892.467) [-1886.391] (-1888.898) * (-1887.508) (-1893.438) (-1892.145) [-1884.742] -- 0:01:57
472000 -- (-1884.329) (-1885.127) (-1890.290) [-1888.946] * [-1886.922] (-1883.472) (-1890.828) (-1889.387) -- 0:01:58
473000 -- [-1884.442] (-1887.595) (-1886.824) (-1889.915) * (-1887.396) [-1892.020] (-1889.414) (-1886.576) -- 0:01:58
474000 -- [-1888.706] (-1886.090) (-1882.612) (-1889.016) * [-1883.892] (-1891.401) (-1895.663) (-1885.519) -- 0:01:57
475000 -- (-1890.086) [-1886.700] (-1885.523) (-1887.954) * [-1880.432] (-1892.401) (-1883.599) (-1884.158) -- 0:01:57
Average standard deviation of split frequencies: 0.008418
476000 -- [-1884.760] (-1891.998) (-1888.213) (-1890.346) * (-1885.273) (-1887.278) (-1883.366) [-1886.947] -- 0:01:56
477000 -- (-1888.366) [-1888.117] (-1885.334) (-1883.594) * (-1884.689) (-1885.993) [-1883.636] (-1887.783) -- 0:01:57
478000 -- (-1898.646) [-1890.178] (-1886.728) (-1885.125) * (-1889.086) [-1884.257] (-1885.801) (-1880.830) -- 0:01:56
479000 -- (-1888.248) [-1891.288] (-1894.452) (-1884.356) * [-1887.216] (-1881.725) (-1891.428) (-1887.720) -- 0:01:56
480000 -- (-1889.019) (-1883.240) (-1889.698) [-1885.425] * (-1891.536) [-1885.639] (-1891.848) (-1886.205) -- 0:01:55
Average standard deviation of split frequencies: 0.008336
481000 -- [-1881.747] (-1883.743) (-1890.014) (-1886.905) * [-1886.832] (-1886.274) (-1885.249) (-1884.488) -- 0:01:56
482000 -- [-1882.829] (-1885.281) (-1890.625) (-1884.268) * [-1886.507] (-1884.374) (-1888.816) (-1882.282) -- 0:01:56
483000 -- (-1881.945) (-1888.515) (-1887.025) [-1882.371] * (-1885.759) (-1890.312) (-1883.469) [-1886.965] -- 0:01:55
484000 -- [-1885.813] (-1884.245) (-1893.716) (-1885.791) * (-1883.764) (-1894.592) (-1883.826) [-1882.404] -- 0:01:55
485000 -- (-1885.029) [-1883.879] (-1887.405) (-1887.914) * [-1886.304] (-1886.154) (-1886.697) (-1886.071) -- 0:01:54
Average standard deviation of split frequencies: 0.009215
486000 -- [-1884.364] (-1883.408) (-1887.776) (-1885.472) * (-1888.665) [-1882.679] (-1883.220) (-1884.149) -- 0:01:55
487000 -- (-1883.416) (-1886.777) [-1886.570] (-1887.924) * (-1882.461) (-1886.783) [-1884.867] (-1888.174) -- 0:01:54
488000 -- (-1880.317) (-1889.370) [-1883.473] (-1886.025) * (-1881.265) (-1883.010) [-1883.008] (-1889.268) -- 0:01:54
489000 -- (-1884.400) (-1891.728) (-1894.392) [-1883.887] * [-1882.624] (-1882.390) (-1886.594) (-1886.176) -- 0:01:53
490000 -- (-1890.648) (-1887.190) [-1879.974] (-1886.652) * [-1888.583] (-1881.818) (-1886.240) (-1888.344) -- 0:01:54
Average standard deviation of split frequencies: 0.010568
491000 -- (-1887.198) [-1884.772] (-1885.895) (-1887.635) * [-1883.509] (-1887.734) (-1886.353) (-1888.992) -- 0:01:54
492000 -- (-1890.247) (-1883.109) (-1886.718) [-1884.894] * (-1888.909) [-1892.091] (-1885.174) (-1891.041) -- 0:01:53
493000 -- (-1886.276) (-1887.224) [-1892.394] (-1889.473) * [-1887.619] (-1884.544) (-1886.690) (-1888.065) -- 0:01:53
494000 -- (-1887.834) [-1883.539] (-1887.578) (-1885.736) * (-1883.753) (-1879.015) [-1885.777] (-1885.092) -- 0:01:52
495000 -- (-1884.275) (-1883.363) [-1884.103] (-1884.303) * (-1887.991) [-1880.075] (-1892.357) (-1893.614) -- 0:01:53
Average standard deviation of split frequencies: 0.008079
496000 -- (-1889.519) (-1893.425) [-1885.550] (-1886.538) * (-1885.225) [-1884.108] (-1885.840) (-1888.285) -- 0:01:52
497000 -- (-1884.586) [-1882.329] (-1885.250) (-1886.654) * (-1894.155) (-1882.485) [-1885.593] (-1890.072) -- 0:01:52
498000 -- (-1883.815) (-1886.427) (-1884.459) [-1884.840] * (-1892.715) [-1882.193] (-1883.699) (-1884.845) -- 0:01:51
499000 -- (-1882.587) [-1892.337] (-1886.668) (-1889.628) * (-1894.480) (-1884.350) (-1885.606) [-1883.010] -- 0:01:52
500000 -- [-1887.529] (-1885.794) (-1892.907) (-1887.498) * (-1891.823) [-1893.066] (-1893.706) (-1884.163) -- 0:01:52
Average standard deviation of split frequencies: 0.007062
501000 -- (-1892.924) (-1886.828) [-1888.537] (-1883.547) * [-1883.496] (-1885.249) (-1890.866) (-1885.036) -- 0:01:51
502000 -- (-1883.176) (-1881.934) [-1886.731] (-1883.880) * [-1885.770] (-1886.384) (-1886.927) (-1885.751) -- 0:01:51
503000 -- (-1893.742) [-1882.436] (-1891.506) (-1884.602) * [-1885.134] (-1884.683) (-1895.593) (-1888.535) -- 0:01:50
504000 -- (-1882.084) (-1884.510) (-1893.011) [-1882.812] * [-1883.399] (-1882.930) (-1890.588) (-1886.088) -- 0:01:51
505000 -- (-1887.653) [-1887.091] (-1881.770) (-1882.771) * (-1887.698) (-1890.993) [-1889.352] (-1887.321) -- 0:01:50
Average standard deviation of split frequencies: 0.007453
506000 -- (-1888.712) (-1886.504) [-1885.976] (-1886.282) * (-1889.749) (-1890.391) (-1881.476) [-1884.276] -- 0:01:50
507000 -- (-1883.450) (-1889.523) [-1891.952] (-1881.019) * (-1888.410) (-1882.309) [-1886.187] (-1885.839) -- 0:01:49
508000 -- [-1891.024] (-1887.287) (-1884.474) (-1882.875) * (-1880.803) (-1884.068) [-1885.229] (-1884.965) -- 0:01:50
509000 -- [-1888.756] (-1887.017) (-1885.041) (-1883.430) * [-1885.944] (-1885.420) (-1889.055) (-1882.483) -- 0:01:49
510000 -- (-1884.369) (-1887.224) [-1882.459] (-1881.428) * [-1885.849] (-1892.280) (-1893.471) (-1888.261) -- 0:01:49
Average standard deviation of split frequencies: 0.007846
511000 -- [-1885.589] (-1890.925) (-1884.656) (-1886.156) * (-1889.159) (-1884.462) (-1891.359) [-1881.574] -- 0:01:49
512000 -- (-1888.791) (-1884.598) [-1882.456] (-1889.170) * [-1887.024] (-1886.176) (-1890.281) (-1882.183) -- 0:01:49
513000 -- [-1884.473] (-1882.507) (-1887.525) (-1885.642) * (-1887.028) (-1899.602) [-1887.623] (-1890.125) -- 0:01:49
514000 -- (-1886.202) [-1889.513] (-1886.981) (-1883.491) * (-1884.259) (-1886.928) [-1887.744] (-1886.268) -- 0:01:48
515000 -- (-1886.495) (-1884.967) [-1887.221] (-1883.810) * [-1883.127] (-1889.074) (-1888.052) (-1892.062) -- 0:01:48
Average standard deviation of split frequencies: 0.006395
516000 -- (-1887.251) (-1884.451) (-1888.759) [-1886.009] * [-1882.060] (-1887.987) (-1891.455) (-1884.363) -- 0:01:47
517000 -- [-1890.596] (-1887.546) (-1881.505) (-1888.572) * (-1892.927) (-1889.339) [-1888.288] (-1891.802) -- 0:01:48
518000 -- (-1889.601) (-1888.544) (-1888.365) [-1885.393] * (-1888.597) [-1885.090] (-1884.448) (-1891.966) -- 0:01:47
519000 -- (-1886.500) [-1885.745] (-1896.014) (-1883.866) * (-1885.989) (-1888.031) [-1890.350] (-1888.416) -- 0:01:47
520000 -- [-1887.219] (-1880.651) (-1890.158) (-1885.625) * (-1889.387) [-1883.736] (-1884.933) (-1884.005) -- 0:01:47
Average standard deviation of split frequencies: 0.006790
521000 -- (-1883.367) [-1887.938] (-1888.902) (-1886.749) * (-1891.075) (-1885.740) (-1884.569) [-1886.478] -- 0:01:47
522000 -- [-1884.860] (-1884.886) (-1888.271) (-1882.566) * [-1888.427] (-1896.219) (-1887.415) (-1889.261) -- 0:01:47
523000 -- (-1884.800) (-1888.871) (-1890.891) [-1886.517] * (-1892.099) (-1887.337) [-1886.892] (-1882.620) -- 0:01:46
524000 -- (-1881.511) (-1883.378) [-1886.613] (-1884.429) * (-1887.825) [-1885.516] (-1889.414) (-1884.518) -- 0:01:46
525000 -- [-1885.846] (-1888.162) (-1891.185) (-1885.434) * [-1888.402] (-1890.081) (-1897.344) (-1894.548) -- 0:01:45
Average standard deviation of split frequencies: 0.007170
526000 -- (-1883.636) [-1888.422] (-1885.004) (-1891.002) * (-1887.264) [-1881.894] (-1893.183) (-1887.919) -- 0:01:46
527000 -- (-1887.878) [-1883.355] (-1890.593) (-1881.783) * (-1892.226) (-1884.678) [-1887.510] (-1890.391) -- 0:01:45
528000 -- (-1888.575) (-1885.922) [-1887.200] (-1885.749) * (-1885.831) (-1888.066) (-1888.404) [-1885.970] -- 0:01:45
529000 -- [-1885.571] (-1884.342) (-1888.183) (-1888.074) * (-1883.776) [-1887.517] (-1894.849) (-1887.635) -- 0:01:45
530000 -- (-1885.875) [-1883.607] (-1891.823) (-1882.646) * (-1886.938) [-1880.540] (-1886.837) (-1881.817) -- 0:01:45
Average standard deviation of split frequencies: 0.006218
531000 -- [-1891.116] (-1886.554) (-1889.365) (-1886.274) * (-1884.725) (-1887.460) [-1883.094] (-1883.659) -- 0:01:45
532000 -- (-1887.570) (-1883.924) [-1886.459] (-1887.858) * (-1888.203) (-1886.036) [-1886.881] (-1884.379) -- 0:01:44
533000 -- (-1888.794) [-1883.017] (-1888.537) (-1882.663) * (-1884.394) [-1888.282] (-1892.111) (-1883.461) -- 0:01:44
534000 -- (-1892.799) [-1892.102] (-1883.563) (-1885.583) * (-1881.671) (-1888.256) [-1885.589] (-1885.713) -- 0:01:43
535000 -- (-1885.193) (-1885.566) (-1890.061) [-1884.540] * (-1884.497) (-1881.558) [-1886.443] (-1880.800) -- 0:01:44
Average standard deviation of split frequencies: 0.007476
536000 -- [-1883.723] (-1884.264) (-1890.469) (-1882.593) * (-1884.888) (-1888.167) (-1892.294) [-1888.681] -- 0:01:43
537000 -- (-1884.938) (-1888.868) (-1888.171) [-1881.828] * (-1890.990) (-1886.729) [-1887.509] (-1883.317) -- 0:01:43
538000 -- (-1882.127) [-1888.101] (-1886.738) (-1890.030) * (-1885.526) (-1886.473) [-1888.474] (-1883.214) -- 0:01:43
539000 -- (-1883.863) (-1883.921) [-1884.453] (-1892.124) * (-1887.198) (-1884.812) [-1883.497] (-1883.989) -- 0:01:43
540000 -- (-1885.229) (-1892.850) (-1885.825) [-1885.199] * (-1885.401) (-1890.633) (-1883.630) [-1893.869] -- 0:01:43
Average standard deviation of split frequencies: 0.004795
541000 -- (-1886.890) (-1884.791) [-1882.185] (-1888.587) * (-1886.746) [-1884.159] (-1884.324) (-1884.765) -- 0:01:42
542000 -- (-1895.303) [-1887.821] (-1883.541) (-1889.648) * (-1884.911) (-1892.409) [-1883.889] (-1889.277) -- 0:01:42
543000 -- [-1880.953] (-1887.328) (-1886.925) (-1883.928) * (-1885.292) (-1880.908) [-1883.649] (-1892.225) -- 0:01:41
544000 -- (-1889.703) (-1893.949) [-1886.239] (-1882.747) * (-1882.036) [-1886.145] (-1894.690) (-1897.465) -- 0:01:42
545000 -- [-1883.115] (-1894.294) (-1889.787) (-1889.926) * (-1882.451) (-1891.077) [-1884.060] (-1895.535) -- 0:01:41
Average standard deviation of split frequencies: 0.007770
546000 -- (-1886.987) (-1885.285) [-1883.935] (-1888.528) * [-1882.089] (-1887.730) (-1889.841) (-1889.138) -- 0:01:41
547000 -- [-1883.082] (-1888.870) (-1886.000) (-1883.274) * [-1880.570] (-1884.518) (-1884.321) (-1893.406) -- 0:01:41
548000 -- [-1881.615] (-1892.935) (-1891.695) (-1887.633) * (-1884.146) [-1886.296] (-1882.857) (-1889.042) -- 0:01:41
549000 -- [-1885.294] (-1890.501) (-1884.241) (-1884.529) * [-1880.568] (-1887.213) (-1886.428) (-1888.155) -- 0:01:41
550000 -- (-1890.408) (-1884.288) (-1886.332) [-1886.891] * (-1882.296) [-1883.305] (-1889.698) (-1890.129) -- 0:01:40
Average standard deviation of split frequencies: 0.005136
551000 -- [-1888.099] (-1890.969) (-1883.514) (-1883.379) * (-1886.289) (-1886.343) [-1883.616] (-1883.950) -- 0:01:40
552000 -- [-1886.142] (-1886.970) (-1887.781) (-1885.938) * (-1886.463) (-1886.959) [-1885.772] (-1885.524) -- 0:01:39
553000 -- (-1885.637) (-1887.562) [-1882.025] (-1882.719) * (-1885.802) (-1884.545) [-1888.130] (-1891.156) -- 0:01:40
554000 -- (-1887.122) (-1885.725) (-1886.378) [-1883.708] * (-1894.899) [-1885.379] (-1891.507) (-1885.298) -- 0:01:39
555000 -- [-1887.461] (-1882.844) (-1885.946) (-1885.302) * (-1880.586) (-1888.662) (-1882.728) [-1880.950] -- 0:01:39
Average standard deviation of split frequencies: 0.006783
556000 -- (-1886.548) (-1888.565) (-1886.022) [-1886.324] * (-1889.026) [-1883.290] (-1882.441) (-1891.928) -- 0:01:39
557000 -- (-1888.573) [-1882.662] (-1882.895) (-1887.617) * (-1887.633) [-1888.029] (-1884.994) (-1879.763) -- 0:01:39
558000 -- [-1883.086] (-1883.837) (-1885.065) (-1890.839) * [-1886.283] (-1885.802) (-1884.302) (-1889.452) -- 0:01:39
559000 -- [-1885.584] (-1890.578) (-1885.441) (-1892.557) * (-1884.934) (-1884.513) (-1887.638) [-1885.601] -- 0:01:38
560000 -- (-1883.793) [-1884.584] (-1892.123) (-1883.395) * (-1889.188) [-1882.608] (-1886.187) (-1885.929) -- 0:01:38
Average standard deviation of split frequencies: 0.007988
561000 -- (-1889.207) [-1885.121] (-1887.678) (-1887.913) * (-1890.454) (-1884.201) (-1886.045) [-1885.853] -- 0:01:37
562000 -- [-1888.215] (-1884.060) (-1888.803) (-1887.350) * (-1892.415) (-1885.203) (-1884.536) [-1885.870] -- 0:01:38
563000 -- (-1888.661) (-1891.032) [-1886.783] (-1884.785) * (-1883.472) (-1888.161) [-1890.863] (-1888.672) -- 0:01:37
564000 -- [-1882.027] (-1883.465) (-1887.244) (-1887.498) * (-1888.419) [-1881.210] (-1885.151) (-1890.193) -- 0:01:37
565000 -- [-1888.645] (-1885.817) (-1882.504) (-1886.604) * (-1887.822) [-1883.487] (-1886.300) (-1887.087) -- 0:01:37
Average standard deviation of split frequencies: 0.005830
566000 -- (-1885.649) (-1885.287) [-1883.241] (-1884.418) * (-1887.696) (-1882.116) (-1890.271) [-1885.903] -- 0:01:37
567000 -- (-1887.770) (-1883.308) [-1881.398] (-1887.786) * (-1890.685) [-1885.234] (-1885.716) (-1890.621) -- 0:01:36
568000 -- (-1883.080) [-1887.328] (-1881.269) (-1886.690) * [-1886.443] (-1881.627) (-1886.413) (-1888.295) -- 0:01:36
569000 -- (-1890.701) [-1889.054] (-1883.195) (-1886.834) * (-1883.918) [-1886.001] (-1891.003) (-1887.402) -- 0:01:36
570000 -- (-1888.395) [-1888.333] (-1882.405) (-1890.415) * (-1881.432) (-1889.264) (-1884.212) [-1884.576] -- 0:01:35
Average standard deviation of split frequencies: 0.003717
571000 -- (-1885.585) (-1883.730) [-1886.431] (-1889.311) * (-1885.950) [-1886.639] (-1885.788) (-1882.202) -- 0:01:36
572000 -- (-1882.788) (-1890.229) (-1888.453) [-1885.509] * (-1887.643) (-1895.781) [-1881.690] (-1889.659) -- 0:01:35
573000 -- [-1883.290] (-1884.139) (-1884.446) (-1880.205) * [-1881.012] (-1889.462) (-1884.155) (-1888.738) -- 0:01:35
574000 -- (-1886.533) (-1885.028) (-1884.894) [-1886.552] * (-1885.973) (-1890.376) [-1884.511] (-1893.865) -- 0:01:34
575000 -- (-1885.849) (-1888.706) (-1886.284) [-1888.811] * (-1887.247) (-1884.405) (-1887.990) [-1888.571] -- 0:01:35
Average standard deviation of split frequencies: 0.006956
576000 -- (-1889.050) (-1886.499) [-1886.825] (-1888.621) * [-1887.939] (-1890.332) (-1887.084) (-1890.955) -- 0:01:34
577000 -- (-1895.449) (-1890.142) [-1884.349] (-1890.909) * (-1884.822) [-1884.050] (-1884.871) (-1887.475) -- 0:01:34
578000 -- [-1894.852] (-1884.048) (-1889.284) (-1887.582) * (-1888.004) [-1887.241] (-1888.535) (-1886.400) -- 0:01:34
579000 -- (-1885.183) [-1889.393] (-1883.530) (-1886.293) * (-1896.969) [-1881.195] (-1883.678) (-1882.757) -- 0:01:33
580000 -- [-1887.080] (-1889.273) (-1893.048) (-1884.700) * (-1886.300) (-1882.849) [-1888.068] (-1885.738) -- 0:01:34
Average standard deviation of split frequencies: 0.008118
581000 -- (-1884.255) [-1889.431] (-1889.433) (-1886.631) * (-1888.394) (-1885.033) [-1885.940] (-1881.862) -- 0:01:33
582000 -- [-1888.579] (-1883.690) (-1901.148) (-1887.494) * [-1885.576] (-1883.846) (-1880.879) (-1881.482) -- 0:01:33
583000 -- (-1886.398) (-1886.769) (-1894.700) [-1885.384] * (-1887.332) [-1882.987] (-1890.583) (-1880.626) -- 0:01:32
584000 -- [-1880.433] (-1886.144) (-1893.489) (-1895.716) * (-1880.832) (-1886.729) (-1895.360) [-1888.624] -- 0:01:33
585000 -- (-1886.624) (-1883.763) (-1888.115) [-1886.816] * [-1883.940] (-1888.945) (-1893.469) (-1885.241) -- 0:01:32
Average standard deviation of split frequencies: 0.009653
586000 -- [-1882.818] (-1886.130) (-1889.421) (-1882.353) * (-1888.184) (-1886.918) (-1887.007) [-1883.827] -- 0:01:32
587000 -- (-1885.712) [-1886.926] (-1887.481) (-1888.563) * (-1885.861) [-1883.546] (-1892.773) (-1886.242) -- 0:01:32
588000 -- (-1889.461) (-1886.281) (-1882.470) [-1884.193] * [-1882.722] (-1888.448) (-1884.736) (-1891.224) -- 0:01:32
589000 -- (-1898.054) (-1891.301) [-1881.856] (-1887.495) * [-1880.163] (-1888.666) (-1889.254) (-1887.231) -- 0:01:32
590000 -- (-1886.111) [-1889.766] (-1885.869) (-1887.534) * (-1886.848) (-1886.437) (-1896.419) [-1885.539] -- 0:01:31
Average standard deviation of split frequencies: 0.009577
591000 -- [-1883.633] (-1889.461) (-1889.379) (-1883.228) * (-1890.999) (-1883.444) (-1886.686) [-1881.772] -- 0:01:31
592000 -- [-1882.846] (-1896.324) (-1884.480) (-1881.308) * (-1885.337) [-1887.958] (-1893.407) (-1883.011) -- 0:01:30
593000 -- (-1888.419) [-1887.670] (-1891.713) (-1882.412) * (-1882.452) [-1884.408] (-1885.490) (-1890.154) -- 0:01:31
594000 -- (-1888.412) (-1882.814) [-1883.155] (-1881.652) * (-1891.605) [-1883.934] (-1886.042) (-1885.323) -- 0:01:30
595000 -- (-1884.378) [-1884.716] (-1882.127) (-1885.065) * [-1880.115] (-1883.864) (-1895.534) (-1886.187) -- 0:01:30
Average standard deviation of split frequencies: 0.008700
596000 -- (-1882.276) (-1881.514) (-1897.015) [-1889.492] * (-1884.142) (-1885.067) [-1881.632] (-1888.469) -- 0:01:30
597000 -- (-1885.914) [-1887.188] (-1885.444) (-1885.937) * (-1883.080) (-1889.913) [-1882.396] (-1890.101) -- 0:01:30
598000 -- [-1886.678] (-1886.022) (-1886.754) (-1887.023) * (-1883.487) (-1890.560) [-1885.872] (-1891.024) -- 0:01:30
599000 -- [-1887.355] (-1889.014) (-1887.347) (-1888.341) * (-1880.981) (-1892.322) [-1883.932] (-1882.999) -- 0:01:29
600000 -- (-1889.955) (-1884.825) [-1887.191] (-1882.029) * (-1885.569) (-1884.417) (-1886.681) [-1887.553] -- 0:01:29
Average standard deviation of split frequencies: 0.010202
601000 -- [-1890.156] (-1888.590) (-1889.227) (-1890.248) * (-1888.516) (-1896.925) [-1885.315] (-1892.906) -- 0:01:28
602000 -- [-1884.345] (-1890.359) (-1888.672) (-1894.317) * (-1885.033) [-1901.448] (-1886.216) (-1895.111) -- 0:01:29
603000 -- (-1886.972) [-1887.152] (-1884.730) (-1887.865) * [-1881.147] (-1901.594) (-1890.153) (-1882.925) -- 0:01:28
604000 -- (-1883.050) (-1889.587) (-1885.093) [-1881.431] * (-1881.321) (-1888.844) (-1889.884) [-1881.682] -- 0:01:28
605000 -- (-1883.788) (-1885.337) (-1891.386) [-1888.578] * (-1884.969) (-1893.005) (-1885.918) [-1884.963] -- 0:01:28
Average standard deviation of split frequencies: 0.014002
606000 -- (-1882.102) (-1885.626) [-1885.047] (-1885.194) * (-1890.393) (-1889.703) (-1886.059) [-1881.725] -- 0:01:28
607000 -- (-1886.569) (-1884.003) [-1885.444] (-1885.623) * (-1888.008) (-1887.908) [-1886.453] (-1885.977) -- 0:01:28
608000 -- [-1885.432] (-1893.390) (-1880.797) (-1886.097) * (-1886.842) (-1888.472) (-1889.491) [-1882.195] -- 0:01:27
609000 -- (-1884.090) (-1884.754) (-1886.548) [-1883.563] * (-1889.431) [-1891.068] (-1890.169) (-1886.847) -- 0:01:27
610000 -- (-1886.827) (-1881.756) [-1885.582] (-1886.264) * (-1884.922) [-1884.784] (-1895.280) (-1880.422) -- 0:01:26
Average standard deviation of split frequencies: 0.014281
611000 -- (-1884.222) (-1888.764) (-1892.749) [-1884.005] * (-1886.852) (-1889.282) (-1896.654) [-1886.547] -- 0:01:27
612000 -- (-1890.317) (-1890.678) (-1884.647) [-1888.037] * (-1890.656) (-1885.604) (-1885.225) [-1881.719] -- 0:01:26
613000 -- (-1888.296) (-1887.857) [-1883.320] (-1885.783) * (-1885.876) [-1886.830] (-1882.756) (-1886.581) -- 0:01:26
614000 -- [-1884.528] (-1884.496) (-1889.420) (-1883.912) * (-1885.325) [-1888.540] (-1885.659) (-1886.828) -- 0:01:26
615000 -- [-1890.554] (-1890.805) (-1887.434) (-1887.455) * (-1885.015) (-1888.223) (-1884.586) [-1881.991] -- 0:01:26
Average standard deviation of split frequencies: 0.015305
616000 -- [-1884.737] (-1893.651) (-1880.405) (-1881.593) * (-1885.498) (-1888.304) (-1884.364) [-1886.413] -- 0:01:26
617000 -- (-1886.626) (-1884.682) [-1880.513] (-1885.968) * (-1886.730) [-1883.356] (-1886.536) (-1883.015) -- 0:01:25
618000 -- [-1883.411] (-1883.462) (-1884.303) (-1887.754) * (-1884.640) (-1886.255) [-1883.462] (-1886.325) -- 0:01:25
619000 -- (-1884.858) [-1884.686] (-1886.597) (-1886.024) * [-1884.866] (-1888.892) (-1886.942) (-1885.276) -- 0:01:24
620000 -- (-1887.533) [-1890.902] (-1889.976) (-1882.156) * (-1886.265) [-1883.790] (-1887.811) (-1885.065) -- 0:01:25
Average standard deviation of split frequencies: 0.012152
621000 -- (-1881.270) (-1885.261) (-1886.226) [-1881.616] * (-1891.701) (-1886.034) [-1881.467] (-1883.253) -- 0:01:24
622000 -- (-1883.611) (-1883.397) [-1882.176] (-1884.949) * (-1884.910) (-1882.986) [-1882.219] (-1882.312) -- 0:01:24
623000 -- (-1891.174) (-1889.820) (-1889.147) [-1887.512] * [-1885.901] (-1888.072) (-1881.830) (-1891.575) -- 0:01:24
624000 -- (-1889.624) (-1883.621) (-1895.456) [-1882.748] * [-1880.892] (-1888.521) (-1885.039) (-1891.681) -- 0:01:24
625000 -- (-1885.249) [-1884.718] (-1887.478) (-1886.556) * (-1884.672) (-1884.599) [-1885.544] (-1884.251) -- 0:01:24
Average standard deviation of split frequencies: 0.015061
626000 -- (-1886.377) [-1887.298] (-1891.392) (-1891.008) * (-1889.356) (-1882.093) [-1885.360] (-1886.571) -- 0:01:23
627000 -- [-1882.981] (-1888.610) (-1891.675) (-1886.582) * (-1892.844) [-1881.888] (-1884.957) (-1887.809) -- 0:01:23
628000 -- [-1884.232] (-1888.413) (-1891.792) (-1887.604) * (-1892.423) (-1889.493) [-1892.233] (-1884.956) -- 0:01:22
629000 -- (-1885.037) [-1881.401] (-1884.410) (-1888.173) * [-1884.809] (-1888.400) (-1893.939) (-1884.892) -- 0:01:23
630000 -- (-1889.564) (-1883.187) [-1888.119] (-1889.312) * (-1888.399) (-1884.698) (-1885.246) [-1886.745] -- 0:01:22
Average standard deviation of split frequencies: 0.014576
631000 -- (-1890.103) [-1884.794] (-1886.699) (-1892.089) * (-1885.736) (-1887.513) [-1887.100] (-1888.324) -- 0:01:22
632000 -- (-1886.793) (-1881.948) (-1883.894) [-1888.170] * (-1884.009) (-1885.523) [-1885.595] (-1884.459) -- 0:01:22
633000 -- (-1882.479) (-1886.684) (-1883.124) [-1886.231] * [-1889.087] (-1885.675) (-1888.792) (-1885.158) -- 0:01:22
634000 -- (-1886.211) [-1879.358] (-1887.139) (-1886.155) * [-1886.961] (-1883.686) (-1887.360) (-1884.618) -- 0:01:21
635000 -- (-1881.920) (-1881.984) (-1890.450) [-1885.018] * [-1883.453] (-1887.179) (-1892.173) (-1886.242) -- 0:01:21
Average standard deviation of split frequencies: 0.014083
636000 -- (-1884.121) (-1888.689) [-1884.218] (-1882.519) * [-1887.588] (-1886.636) (-1887.612) (-1884.588) -- 0:01:21
637000 -- [-1885.661] (-1889.881) (-1888.467) (-1887.155) * (-1888.283) (-1888.006) (-1888.615) [-1883.224] -- 0:01:20
638000 -- (-1882.219) (-1885.592) (-1884.851) [-1887.017] * (-1883.778) [-1881.516] (-1893.401) (-1896.315) -- 0:01:21
639000 -- [-1886.218] (-1888.784) (-1886.548) (-1890.629) * (-1886.765) [-1894.525] (-1882.172) (-1886.345) -- 0:01:20
640000 -- (-1883.870) (-1897.310) (-1890.329) [-1882.821] * (-1889.042) (-1884.164) (-1885.933) [-1887.109] -- 0:01:20
Average standard deviation of split frequencies: 0.012877
641000 -- [-1883.639] (-1898.592) (-1891.575) (-1886.746) * [-1884.090] (-1889.143) (-1884.477) (-1883.735) -- 0:01:20
642000 -- (-1881.293) [-1892.815] (-1882.180) (-1892.265) * (-1885.771) [-1884.568] (-1888.008) (-1887.250) -- 0:01:20
643000 -- (-1887.558) (-1889.415) (-1887.351) [-1885.376] * (-1887.935) (-1887.816) (-1883.456) [-1886.643] -- 0:01:19
644000 -- (-1882.647) (-1890.793) [-1882.021] (-1883.769) * (-1886.377) (-1885.828) (-1885.467) [-1883.035] -- 0:01:19
645000 -- (-1887.876) (-1884.868) (-1886.412) [-1885.519] * [-1888.073] (-1886.258) (-1883.769) (-1879.312) -- 0:01:19
Average standard deviation of split frequencies: 0.015324
646000 -- (-1884.705) [-1885.713] (-1886.471) (-1884.621) * [-1885.422] (-1883.408) (-1887.520) (-1883.070) -- 0:01:18
647000 -- (-1882.693) (-1881.091) (-1887.944) [-1888.019] * (-1889.358) (-1886.836) (-1889.493) [-1887.220] -- 0:01:19
648000 -- (-1886.360) (-1886.448) [-1885.461] (-1885.617) * (-1884.520) (-1884.806) (-1888.149) [-1887.805] -- 0:01:18
649000 -- (-1888.477) (-1882.836) (-1882.938) [-1890.769] * [-1889.165] (-1887.770) (-1886.254) (-1884.004) -- 0:01:18
650000 -- (-1886.959) [-1886.349] (-1886.268) (-1884.641) * [-1883.307] (-1887.819) (-1881.365) (-1891.395) -- 0:01:18
Average standard deviation of split frequencies: 0.016301
651000 -- [-1888.869] (-1887.048) (-1886.871) (-1885.681) * (-1887.721) (-1889.208) [-1882.447] (-1890.772) -- 0:01:18
652000 -- (-1886.429) (-1896.707) [-1884.939] (-1884.963) * (-1882.113) (-1892.396) [-1889.244] (-1888.596) -- 0:01:17
653000 -- [-1885.391] (-1886.934) (-1886.306) (-1888.026) * [-1884.527] (-1886.480) (-1886.770) (-1889.199) -- 0:01:17
654000 -- (-1890.871) (-1885.559) [-1880.258] (-1885.289) * (-1886.382) (-1891.820) [-1884.218] (-1887.422) -- 0:01:17
655000 -- (-1895.920) [-1887.708] (-1884.091) (-1886.750) * (-1886.421) (-1887.864) (-1886.339) [-1885.997] -- 0:01:16
Average standard deviation of split frequencies: 0.016169
656000 -- (-1888.159) (-1887.828) [-1888.367] (-1888.976) * (-1884.954) [-1882.792] (-1887.766) (-1884.458) -- 0:01:17
657000 -- (-1892.298) [-1884.183] (-1883.740) (-1886.151) * [-1886.592] (-1883.813) (-1884.476) (-1896.253) -- 0:01:16
658000 -- [-1888.514] (-1893.967) (-1884.876) (-1884.356) * (-1884.873) (-1889.421) (-1885.112) [-1886.094] -- 0:01:16
659000 -- (-1887.968) [-1886.702] (-1882.267) (-1903.482) * (-1887.923) (-1881.964) [-1894.517] (-1884.540) -- 0:01:16
660000 -- (-1897.037) [-1885.811] (-1887.891) (-1885.115) * (-1886.254) (-1883.640) (-1896.686) [-1887.262] -- 0:01:16
Average standard deviation of split frequencies: 0.017838
661000 -- (-1888.901) (-1886.226) (-1886.873) [-1884.752] * (-1882.660) [-1888.462] (-1885.287) (-1889.020) -- 0:01:15
662000 -- [-1884.055] (-1886.027) (-1883.925) (-1883.784) * (-1888.460) (-1888.652) [-1889.698] (-1882.717) -- 0:01:15
663000 -- [-1884.748] (-1893.866) (-1886.273) (-1884.224) * (-1887.505) (-1886.113) [-1883.485] (-1883.099) -- 0:01:15
664000 -- (-1887.790) (-1886.317) [-1885.347] (-1882.740) * [-1889.499] (-1889.860) (-1882.437) (-1887.857) -- 0:01:14
665000 -- (-1884.641) (-1883.618) (-1886.752) [-1881.877] * [-1888.550] (-1890.264) (-1889.273) (-1883.485) -- 0:01:15
Average standard deviation of split frequencies: 0.014156
666000 -- (-1883.610) [-1884.496] (-1885.115) (-1885.259) * (-1889.144) [-1891.412] (-1895.684) (-1881.901) -- 0:01:14
667000 -- (-1884.095) (-1885.726) (-1884.488) [-1885.963] * (-1885.522) (-1890.125) [-1881.940] (-1887.646) -- 0:01:14
668000 -- (-1882.934) [-1881.546] (-1887.557) (-1884.720) * (-1882.525) (-1888.193) [-1888.755] (-1883.960) -- 0:01:14
669000 -- (-1886.440) [-1882.711] (-1883.407) (-1884.831) * (-1885.135) (-1884.363) (-1881.385) [-1885.607] -- 0:01:14
670000 -- (-1886.276) (-1882.940) [-1885.424] (-1886.613) * [-1881.813] (-1887.685) (-1883.084) (-1890.982) -- 0:01:13
Average standard deviation of split frequencies: 0.015112
671000 -- (-1892.284) (-1887.207) (-1882.878) [-1884.898] * [-1888.360] (-1889.173) (-1889.164) (-1882.169) -- 0:01:13
672000 -- (-1884.170) [-1880.437] (-1884.580) (-1885.366) * (-1894.877) (-1893.757) (-1884.413) [-1885.702] -- 0:01:13
673000 -- (-1885.987) (-1887.397) [-1884.196] (-1886.873) * (-1888.340) [-1891.923] (-1890.014) (-1887.002) -- 0:01:12
674000 -- [-1884.823] (-1889.107) (-1882.596) (-1882.313) * (-1888.552) [-1886.169] (-1892.200) (-1891.147) -- 0:01:13
675000 -- (-1885.438) [-1883.426] (-1886.685) (-1885.894) * [-1884.614] (-1886.289) (-1882.965) (-1880.502) -- 0:01:12
Average standard deviation of split frequencies: 0.017085
676000 -- (-1891.023) [-1884.028] (-1881.724) (-1883.633) * (-1887.586) (-1888.734) [-1881.453] (-1891.710) -- 0:01:12
677000 -- (-1889.688) (-1883.611) [-1888.128] (-1889.597) * (-1887.429) [-1887.151] (-1887.102) (-1887.054) -- 0:01:12
678000 -- (-1892.067) (-1888.510) [-1882.621] (-1895.129) * (-1892.283) (-1882.409) (-1890.888) [-1887.442] -- 0:01:12
679000 -- (-1889.865) (-1880.964) [-1883.014] (-1887.098) * (-1895.044) (-1888.500) (-1884.120) [-1885.646] -- 0:01:11
680000 -- (-1884.716) [-1881.879] (-1882.980) (-1892.802) * (-1886.831) (-1890.218) (-1888.050) [-1886.400] -- 0:01:11
Average standard deviation of split frequencies: 0.015236
681000 -- (-1886.025) (-1889.450) (-1883.499) [-1885.455] * (-1884.601) (-1881.409) [-1884.163] (-1883.007) -- 0:01:11
682000 -- (-1887.005) (-1885.497) [-1883.083] (-1890.581) * (-1882.070) (-1892.000) (-1896.306) [-1882.573] -- 0:01:10
683000 -- (-1885.920) [-1891.211] (-1890.793) (-1886.176) * (-1888.376) (-1894.784) [-1886.847] (-1887.585) -- 0:01:11
684000 -- (-1892.433) (-1883.231) [-1885.786] (-1888.715) * (-1886.892) (-1885.799) [-1885.172] (-1884.895) -- 0:01:10
685000 -- [-1884.126] (-1887.589) (-1884.061) (-1884.561) * (-1884.053) (-1889.596) (-1886.241) [-1883.899] -- 0:01:10
Average standard deviation of split frequencies: 0.014774
686000 -- (-1886.653) (-1884.876) [-1886.118] (-1881.301) * (-1884.477) [-1888.382] (-1891.521) (-1884.099) -- 0:01:10
687000 -- (-1883.449) [-1883.701] (-1884.616) (-1883.917) * (-1883.840) (-1888.890) (-1894.401) [-1882.962] -- 0:01:10
688000 -- (-1882.683) [-1885.546] (-1884.066) (-1881.670) * [-1883.026] (-1889.791) (-1888.586) (-1884.052) -- 0:01:09
689000 -- (-1884.466) (-1880.225) (-1889.071) [-1884.835] * [-1887.864] (-1889.634) (-1889.672) (-1889.399) -- 0:01:09
690000 -- (-1893.090) [-1885.568] (-1884.915) (-1883.534) * (-1889.039) [-1888.867] (-1890.074) (-1892.929) -- 0:01:09
Average standard deviation of split frequencies: 0.016381
691000 -- (-1882.914) (-1892.321) [-1881.483] (-1884.997) * (-1882.202) (-1883.594) [-1891.993] (-1884.006) -- 0:01:09
692000 -- [-1886.577] (-1890.292) (-1886.608) (-1889.161) * (-1885.274) (-1889.263) [-1881.264] (-1887.209) -- 0:01:08
693000 -- (-1887.799) (-1887.975) (-1889.249) [-1885.590] * (-1887.782) [-1885.980] (-1881.795) (-1889.611) -- 0:01:08
694000 -- (-1892.502) (-1887.456) (-1886.406) [-1882.340] * [-1884.322] (-1882.794) (-1897.521) (-1884.774) -- 0:01:08
695000 -- (-1888.826) [-1883.655] (-1891.930) (-1881.291) * (-1887.111) (-1884.842) [-1887.131] (-1887.687) -- 0:01:08
Average standard deviation of split frequencies: 0.015578
696000 -- (-1885.338) [-1889.130] (-1886.558) (-1887.069) * (-1885.036) (-1889.944) (-1886.836) [-1888.656] -- 0:01:08
697000 -- (-1889.554) [-1886.757] (-1895.028) (-1882.892) * [-1885.735] (-1892.626) (-1886.030) (-1886.272) -- 0:01:07
698000 -- (-1884.649) (-1886.184) (-1882.460) [-1881.497] * (-1887.605) (-1889.399) (-1883.903) [-1884.852] -- 0:01:07
699000 -- (-1885.670) [-1886.496] (-1882.987) (-1882.943) * (-1889.762) (-1888.675) [-1883.038] (-1885.198) -- 0:01:07
700000 -- (-1890.827) (-1884.777) (-1883.940) [-1887.009] * (-1882.586) [-1883.434] (-1883.654) (-1895.830) -- 0:01:07
Average standard deviation of split frequencies: 0.016820
701000 -- [-1887.844] (-1885.562) (-1887.093) (-1880.936) * (-1888.408) (-1890.347) [-1886.748] (-1894.997) -- 0:01:06
702000 -- (-1883.009) (-1881.108) (-1882.674) [-1881.921] * (-1886.159) (-1888.750) (-1887.205) [-1886.293] -- 0:01:06
703000 -- (-1889.479) (-1889.595) [-1887.417] (-1887.458) * (-1885.720) [-1883.242] (-1889.041) (-1885.522) -- 0:01:06
704000 -- (-1883.743) [-1882.311] (-1887.339) (-1888.227) * (-1882.225) (-1889.744) (-1885.632) [-1883.745] -- 0:01:06
705000 -- (-1886.184) [-1888.323] (-1892.377) (-1885.942) * [-1885.214] (-1883.239) (-1892.069) (-1884.000) -- 0:01:06
Average standard deviation of split frequencies: 0.017694
706000 -- (-1889.444) [-1892.477] (-1894.507) (-1884.808) * (-1886.328) (-1886.898) (-1890.018) [-1883.235] -- 0:01:05
707000 -- (-1884.535) [-1890.931] (-1885.553) (-1885.784) * (-1884.384) (-1883.058) [-1888.433] (-1890.670) -- 0:01:05
708000 -- (-1891.513) (-1891.870) (-1883.716) [-1885.870] * (-1890.094) (-1892.188) [-1887.499] (-1891.395) -- 0:01:05
709000 -- (-1886.169) (-1885.078) [-1887.088] (-1887.637) * (-1883.959) (-1888.068) [-1887.784] (-1886.127) -- 0:01:05
710000 -- [-1884.643] (-1888.412) (-1886.409) (-1884.638) * (-1886.063) (-1884.061) (-1892.395) [-1885.380] -- 0:01:04
Average standard deviation of split frequencies: 0.017578
711000 -- (-1886.882) (-1885.669) (-1885.818) [-1886.196] * (-1886.382) (-1887.061) [-1887.690] (-1884.044) -- 0:01:04
712000 -- (-1893.126) [-1885.589] (-1887.261) (-1885.519) * (-1890.243) [-1886.706] (-1885.437) (-1890.706) -- 0:01:04
713000 -- (-1886.817) (-1889.488) [-1881.793] (-1885.051) * (-1896.236) (-1893.345) [-1889.035] (-1883.766) -- 0:01:04
714000 -- [-1886.311] (-1888.123) (-1883.799) (-1891.184) * (-1894.097) [-1882.992] (-1889.898) (-1886.046) -- 0:01:04
715000 -- (-1884.505) (-1887.583) (-1886.186) [-1889.060] * [-1883.875] (-1883.696) (-1889.325) (-1887.042) -- 0:01:03
Average standard deviation of split frequencies: 0.016789
716000 -- (-1888.800) (-1890.683) [-1885.781] (-1891.189) * (-1886.263) (-1885.693) [-1883.153] (-1889.080) -- 0:01:03
717000 -- (-1881.605) (-1887.277) [-1889.122] (-1893.207) * (-1881.230) [-1881.344] (-1886.893) (-1888.995) -- 0:01:03
718000 -- (-1888.638) [-1885.204] (-1889.045) (-1888.372) * (-1889.661) (-1882.728) [-1886.266] (-1889.162) -- 0:01:03
719000 -- (-1888.957) (-1884.482) [-1883.773] (-1887.560) * (-1890.522) (-1890.103) [-1881.945] (-1889.278) -- 0:01:02
720000 -- [-1881.389] (-1885.663) (-1889.089) (-1888.263) * (-1892.142) (-1889.076) [-1886.440] (-1891.828) -- 0:01:02
Average standard deviation of split frequencies: 0.013410
721000 -- (-1887.674) (-1888.291) [-1885.070] (-1887.891) * [-1889.310] (-1885.310) (-1884.581) (-1887.140) -- 0:01:02
722000 -- (-1884.015) [-1884.914] (-1886.873) (-1884.725) * (-1891.154) [-1884.424] (-1892.735) (-1884.261) -- 0:01:01
723000 -- (-1886.371) (-1886.752) (-1892.925) [-1882.512] * (-1894.159) (-1886.148) [-1885.805] (-1885.074) -- 0:01:02
724000 -- [-1883.189] (-1887.540) (-1889.188) (-1889.623) * (-1888.902) (-1884.272) (-1883.459) [-1888.673] -- 0:01:01
725000 -- (-1880.373) (-1893.961) (-1884.192) [-1882.835] * (-1884.648) [-1889.677] (-1885.876) (-1883.769) -- 0:01:01
Average standard deviation of split frequencies: 0.012337
726000 -- (-1884.618) [-1882.912] (-1889.313) (-1884.891) * [-1887.807] (-1885.796) (-1884.817) (-1884.839) -- 0:01:01
727000 -- (-1881.711) [-1883.069] (-1884.817) (-1891.014) * (-1883.888) [-1883.946] (-1886.120) (-1886.008) -- 0:01:01
728000 -- (-1883.055) (-1882.580) [-1886.111] (-1886.610) * [-1887.413] (-1884.932) (-1887.203) (-1884.314) -- 0:01:00
729000 -- [-1883.015] (-1883.430) (-1886.135) (-1882.723) * (-1888.363) (-1887.925) (-1890.858) [-1884.600] -- 0:01:00
730000 -- (-1885.935) (-1884.888) [-1889.079] (-1885.911) * (-1886.903) [-1886.281] (-1888.911) (-1888.305) -- 0:01:00
Average standard deviation of split frequencies: 0.014516
731000 -- [-1880.659] (-1893.147) (-1886.029) (-1886.255) * (-1886.141) (-1887.129) (-1890.228) [-1888.361] -- 0:00:59
732000 -- [-1882.952] (-1891.596) (-1883.470) (-1887.135) * (-1890.306) (-1883.008) (-1888.032) [-1891.203] -- 0:01:00
733000 -- (-1884.984) (-1884.172) [-1885.753] (-1887.391) * (-1889.670) (-1890.823) [-1885.828] (-1889.099) -- 0:00:59
734000 -- (-1885.555) (-1881.079) [-1889.238] (-1893.459) * (-1885.471) [-1889.505] (-1893.481) (-1889.409) -- 0:00:59
735000 -- (-1892.982) (-1887.107) [-1891.538] (-1889.007) * (-1883.143) [-1883.393] (-1887.005) (-1889.167) -- 0:00:59
Average standard deviation of split frequencies: 0.017614
736000 -- (-1886.521) (-1888.526) (-1886.299) [-1885.943] * (-1892.201) (-1882.865) [-1885.203] (-1883.675) -- 0:00:58
737000 -- (-1886.905) (-1886.809) (-1886.709) [-1888.637] * (-1883.960) (-1882.985) (-1884.302) [-1884.111] -- 0:00:58
738000 -- (-1886.255) [-1886.586] (-1885.062) (-1894.031) * (-1883.390) (-1886.281) [-1884.204] (-1884.986) -- 0:00:58
739000 -- [-1884.765] (-1882.433) (-1887.234) (-1890.334) * (-1889.976) [-1883.036] (-1883.718) (-1884.904) -- 0:00:58
740000 -- (-1902.891) [-1888.942] (-1891.282) (-1892.204) * [-1883.450] (-1892.404) (-1886.015) (-1885.159) -- 0:00:57
Average standard deviation of split frequencies: 0.018139
741000 -- (-1881.359) (-1886.271) [-1885.955] (-1889.753) * (-1882.816) (-1895.348) [-1880.988] (-1891.303) -- 0:00:58
742000 -- [-1887.526] (-1884.258) (-1881.991) (-1885.871) * (-1883.761) [-1887.491] (-1892.885) (-1887.121) -- 0:00:57
743000 -- (-1884.888) (-1884.223) (-1881.600) [-1885.389] * (-1888.010) [-1884.891] (-1887.944) (-1884.950) -- 0:00:57
744000 -- [-1882.023] (-1888.993) (-1886.363) (-1881.725) * (-1886.082) (-1887.298) [-1884.431] (-1888.186) -- 0:00:57
745000 -- (-1887.445) [-1886.183] (-1889.204) (-1891.827) * (-1885.481) [-1884.262] (-1882.463) (-1888.598) -- 0:00:57
Average standard deviation of split frequencies: 0.018957
746000 -- [-1884.251] (-1882.701) (-1892.296) (-1895.390) * [-1885.704] (-1883.568) (-1891.443) (-1888.636) -- 0:00:56
747000 -- (-1884.909) (-1883.798) (-1894.683) [-1889.615] * [-1886.675] (-1886.987) (-1891.073) (-1889.818) -- 0:00:56
748000 -- (-1884.776) (-1893.127) (-1883.764) [-1889.782] * (-1885.353) [-1889.687] (-1886.185) (-1884.658) -- 0:00:56
749000 -- (-1890.599) [-1887.508] (-1883.344) (-1888.919) * (-1888.134) [-1887.176] (-1887.357) (-1883.403) -- 0:00:55
750000 -- [-1879.731] (-1882.756) (-1885.362) (-1885.058) * (-1887.230) (-1889.395) (-1887.276) [-1881.005] -- 0:00:56
Average standard deviation of split frequencies: 0.018525
751000 -- (-1885.328) (-1883.705) (-1883.650) [-1886.272] * (-1892.698) (-1885.656) [-1881.813] (-1884.612) -- 0:00:55
752000 -- (-1885.466) (-1884.358) (-1884.978) [-1886.345] * (-1887.358) (-1887.566) (-1884.220) [-1885.301] -- 0:00:55
753000 -- (-1887.200) (-1885.770) (-1886.639) [-1887.703] * (-1888.322) (-1885.813) [-1890.000] (-1884.829) -- 0:00:55
754000 -- [-1892.143] (-1882.236) (-1889.649) (-1886.595) * (-1885.024) [-1883.115] (-1883.807) (-1883.305) -- 0:00:55
755000 -- (-1890.916) (-1884.811) (-1886.185) [-1885.806] * (-1889.625) (-1887.613) [-1880.590] (-1890.766) -- 0:00:54
Average standard deviation of split frequencies: 0.021824
756000 -- [-1885.805] (-1886.883) (-1887.443) (-1882.523) * (-1888.814) [-1889.431] (-1882.744) (-1886.629) -- 0:00:54
757000 -- (-1884.686) (-1882.857) [-1889.296] (-1886.330) * (-1890.163) [-1885.797] (-1885.008) (-1884.059) -- 0:00:54
758000 -- (-1882.525) (-1882.480) (-1887.173) [-1887.311] * (-1893.619) [-1887.570] (-1901.385) (-1886.266) -- 0:00:53
759000 -- (-1881.176) (-1886.156) [-1885.556] (-1890.174) * [-1886.106] (-1890.138) (-1884.422) (-1886.401) -- 0:00:53
760000 -- [-1886.802] (-1889.172) (-1884.341) (-1885.247) * (-1884.295) [-1886.993] (-1891.861) (-1885.732) -- 0:00:53
Average standard deviation of split frequencies: 0.021381
761000 -- (-1886.819) (-1891.911) [-1882.173] (-1889.385) * (-1894.279) (-1890.137) (-1892.520) [-1886.261] -- 0:00:53
762000 -- [-1885.154] (-1887.576) (-1886.663) (-1886.319) * (-1883.262) (-1886.875) [-1887.457] (-1891.476) -- 0:00:53
763000 -- (-1886.849) (-1888.317) (-1891.536) [-1881.804] * (-1885.465) (-1887.390) [-1881.616] (-1888.123) -- 0:00:53
764000 -- [-1885.267] (-1891.629) (-1893.688) (-1886.421) * (-1883.931) (-1885.011) [-1885.905] (-1894.267) -- 0:00:52
765000 -- (-1883.127) (-1892.086) [-1886.514] (-1891.846) * (-1886.835) [-1881.607] (-1883.236) (-1890.711) -- 0:00:52
Average standard deviation of split frequencies: 0.019385
766000 -- (-1891.500) (-1892.666) (-1882.140) [-1888.663] * (-1884.995) [-1886.709] (-1888.866) (-1884.026) -- 0:00:52
767000 -- (-1885.300) [-1885.827] (-1894.419) (-1887.900) * (-1882.652) (-1887.432) [-1886.612] (-1886.396) -- 0:00:51
768000 -- (-1887.448) (-1889.311) [-1888.619] (-1883.124) * [-1883.617] (-1882.955) (-1888.711) (-1887.957) -- 0:00:51
769000 -- [-1888.901] (-1889.474) (-1890.130) (-1885.157) * (-1886.773) [-1882.327] (-1885.040) (-1887.116) -- 0:00:51
770000 -- [-1887.885] (-1886.200) (-1885.361) (-1884.891) * [-1885.937] (-1886.678) (-1881.829) (-1890.548) -- 0:00:51
Average standard deviation of split frequencies: 0.018656
771000 -- (-1889.777) (-1887.474) [-1890.173] (-1886.843) * [-1884.074] (-1888.895) (-1881.464) (-1891.543) -- 0:00:51
772000 -- (-1885.151) (-1882.981) (-1883.567) [-1884.400] * (-1890.720) [-1884.339] (-1888.288) (-1885.368) -- 0:00:51
773000 -- (-1884.294) (-1883.113) [-1884.303] (-1888.795) * (-1885.071) (-1895.612) (-1884.637) [-1892.630] -- 0:00:50
774000 -- (-1888.652) (-1885.490) [-1884.805] (-1883.947) * (-1884.702) [-1889.823] (-1887.852) (-1888.795) -- 0:00:50
775000 -- [-1887.072] (-1885.795) (-1885.926) (-1889.918) * (-1894.513) (-1883.499) (-1888.593) [-1886.065] -- 0:00:50
Average standard deviation of split frequencies: 0.016706
776000 -- (-1885.199) (-1881.481) (-1885.056) [-1890.116] * [-1883.477] (-1883.066) (-1887.324) (-1883.391) -- 0:00:49
777000 -- [-1883.471] (-1884.185) (-1888.796) (-1885.410) * [-1889.004] (-1886.539) (-1884.373) (-1886.008) -- 0:00:49
778000 -- (-1890.630) (-1883.900) [-1887.032] (-1886.435) * (-1885.193) [-1881.368] (-1891.505) (-1882.776) -- 0:00:49
779000 -- (-1886.515) [-1883.378] (-1882.083) (-1893.150) * (-1890.714) [-1888.040] (-1887.032) (-1882.942) -- 0:00:49
780000 -- (-1891.955) (-1882.513) (-1881.852) [-1882.666] * [-1884.558] (-1891.006) (-1886.043) (-1884.978) -- 0:00:49
Average standard deviation of split frequencies: 0.014492
781000 -- (-1883.819) [-1883.468] (-1887.300) (-1885.146) * (-1885.317) (-1887.326) [-1886.280] (-1885.078) -- 0:00:49
782000 -- (-1890.783) [-1884.790] (-1890.679) (-1886.276) * (-1898.492) [-1887.013] (-1885.151) (-1888.229) -- 0:00:48
783000 -- (-1891.801) [-1884.246] (-1888.962) (-1886.797) * (-1888.843) (-1883.947) (-1898.887) [-1894.380] -- 0:00:48
784000 -- [-1888.982] (-1890.077) (-1886.712) (-1883.054) * (-1889.601) [-1887.712] (-1893.848) (-1897.539) -- 0:00:48
785000 -- (-1893.820) (-1889.205) (-1882.712) [-1885.911] * [-1889.103] (-1887.753) (-1884.458) (-1887.237) -- 0:00:47
Average standard deviation of split frequencies: 0.014994
786000 -- (-1886.419) (-1887.307) (-1885.656) [-1888.070] * (-1884.722) (-1885.606) [-1886.415] (-1881.442) -- 0:00:47
787000 -- (-1889.707) (-1895.765) [-1883.810] (-1886.573) * (-1888.700) [-1883.748] (-1882.081) (-1882.772) -- 0:00:47
788000 -- (-1887.942) (-1886.781) [-1887.095] (-1887.743) * (-1895.682) [-1886.624] (-1885.557) (-1884.440) -- 0:00:47
789000 -- (-1889.143) [-1885.525] (-1892.248) (-1886.123) * (-1892.429) (-1888.892) [-1888.187] (-1887.119) -- 0:00:47
790000 -- (-1886.567) (-1881.283) (-1889.196) [-1883.291] * (-1892.473) (-1887.732) [-1885.478] (-1887.769) -- 0:00:47
Average standard deviation of split frequencies: 0.013117
791000 -- (-1888.605) (-1882.454) (-1881.532) [-1882.288] * (-1883.556) (-1891.484) (-1889.099) [-1883.979] -- 0:00:46
792000 -- (-1884.636) (-1883.422) (-1888.716) [-1883.756] * [-1886.215] (-1889.307) (-1888.129) (-1896.883) -- 0:00:46
793000 -- [-1881.643] (-1884.996) (-1882.427) (-1884.725) * (-1883.636) [-1888.082] (-1882.241) (-1880.691) -- 0:00:46
794000 -- [-1884.281] (-1884.416) (-1896.725) (-1888.930) * (-1887.673) [-1884.085] (-1884.915) (-1881.713) -- 0:00:45
795000 -- (-1885.363) [-1885.224] (-1888.857) (-1890.388) * (-1886.575) (-1885.378) (-1884.296) [-1888.917] -- 0:00:45
Average standard deviation of split frequencies: 0.009475
796000 -- (-1892.774) (-1889.996) (-1889.429) [-1883.370] * (-1884.099) (-1886.863) [-1885.646] (-1885.134) -- 0:00:45
797000 -- [-1889.612] (-1883.112) (-1884.342) (-1888.774) * (-1887.872) (-1890.015) (-1883.136) [-1880.740] -- 0:00:45
798000 -- (-1884.005) (-1888.968) (-1887.445) [-1886.963] * [-1885.438] (-1886.892) (-1893.676) (-1881.813) -- 0:00:45
799000 -- (-1883.551) (-1884.959) [-1883.300] (-1890.813) * [-1880.404] (-1891.479) (-1884.671) (-1883.726) -- 0:00:45
800000 -- (-1891.644) (-1890.231) [-1881.037] (-1892.016) * (-1887.393) [-1887.069] (-1888.831) (-1888.140) -- 0:00:44
Average standard deviation of split frequencies: 0.007654
801000 -- [-1884.760] (-1884.728) (-1884.935) (-1892.505) * (-1890.280) [-1882.155] (-1883.068) (-1888.099) -- 0:00:44
802000 -- (-1882.564) [-1886.176] (-1883.975) (-1885.209) * (-1885.470) (-1885.561) (-1883.185) [-1886.654] -- 0:00:44
803000 -- (-1883.667) [-1881.797] (-1882.276) (-1885.106) * (-1889.584) (-1890.177) (-1894.781) [-1885.089] -- 0:00:43
804000 -- (-1890.435) (-1889.404) [-1883.436] (-1886.321) * [-1885.038] (-1885.361) (-1891.299) (-1892.507) -- 0:00:43
805000 -- (-1885.520) (-1887.481) [-1880.853] (-1889.975) * (-1883.637) (-1887.351) [-1887.783] (-1891.438) -- 0:00:43
Average standard deviation of split frequencies: 0.007018
806000 -- [-1882.292] (-1881.366) (-1882.202) (-1884.085) * (-1897.163) [-1886.641] (-1888.753) (-1891.933) -- 0:00:43
807000 -- [-1886.272] (-1888.028) (-1884.282) (-1884.052) * (-1882.756) [-1886.858] (-1892.292) (-1886.906) -- 0:00:43
808000 -- [-1884.443] (-1885.187) (-1885.800) (-1883.109) * (-1887.051) (-1888.770) [-1889.063] (-1884.632) -- 0:00:43
809000 -- [-1889.196] (-1892.805) (-1890.275) (-1888.709) * [-1881.656] (-1894.184) (-1884.452) (-1886.633) -- 0:00:42
810000 -- (-1890.174) (-1887.064) (-1886.508) [-1879.805] * (-1883.008) [-1890.753] (-1887.444) (-1889.721) -- 0:00:42
Average standard deviation of split frequencies: 0.004943
811000 -- (-1885.023) [-1882.304] (-1887.943) (-1889.161) * [-1883.739] (-1891.967) (-1889.942) (-1889.705) -- 0:00:42
812000 -- (-1885.339) [-1884.435] (-1886.395) (-1884.145) * (-1890.993) (-1889.274) (-1885.453) [-1884.918] -- 0:00:41
813000 -- (-1888.426) (-1890.417) (-1883.943) [-1882.947] * (-1882.870) (-1886.288) (-1883.741) [-1885.567] -- 0:00:41
814000 -- (-1892.557) (-1886.801) (-1885.696) [-1886.830] * (-1885.592) (-1882.594) (-1887.281) [-1885.856] -- 0:00:41
815000 -- (-1886.196) (-1887.415) [-1884.949] (-1884.297) * (-1882.851) (-1884.223) [-1884.965] (-1884.879) -- 0:00:41
Average standard deviation of split frequencies: 0.005488
816000 -- (-1882.437) [-1880.930] (-1896.869) (-1884.969) * (-1885.476) (-1882.506) (-1888.113) [-1885.646] -- 0:00:41
817000 -- [-1890.294] (-1883.949) (-1883.279) (-1886.678) * (-1889.632) (-1887.814) (-1881.643) [-1883.191] -- 0:00:40
818000 -- (-1883.701) (-1886.359) [-1883.390] (-1883.966) * (-1885.914) (-1884.310) [-1884.545] (-1885.787) -- 0:00:40
819000 -- (-1885.158) (-1883.280) [-1885.153] (-1889.173) * [-1883.065] (-1885.373) (-1882.132) (-1883.537) -- 0:00:40
820000 -- [-1883.054] (-1888.428) (-1890.125) (-1884.872) * [-1884.932] (-1888.289) (-1887.578) (-1887.211) -- 0:00:40
Average standard deviation of split frequencies: 0.004883
821000 -- [-1882.584] (-1883.080) (-1884.270) (-1883.178) * (-1900.642) [-1882.086] (-1889.010) (-1885.838) -- 0:00:39
822000 -- [-1884.149] (-1890.195) (-1886.203) (-1884.805) * (-1883.940) [-1886.956] (-1887.602) (-1893.983) -- 0:00:39
823000 -- (-1883.081) (-1885.657) [-1883.611] (-1886.138) * (-1889.347) (-1884.498) (-1890.169) [-1892.528] -- 0:00:39
824000 -- (-1887.973) [-1882.777] (-1884.588) (-1888.966) * (-1888.631) (-1887.068) (-1896.438) [-1886.275] -- 0:00:39
825000 -- [-1882.098] (-1885.366) (-1883.281) (-1891.862) * (-1886.001) (-1884.131) [-1883.565] (-1884.988) -- 0:00:39
Average standard deviation of split frequencies: 0.005136
826000 -- (-1885.551) (-1882.589) [-1885.623] (-1888.018) * (-1891.720) [-1884.147] (-1886.708) (-1887.356) -- 0:00:38
827000 -- (-1886.294) [-1886.333] (-1884.513) (-1888.313) * (-1888.657) (-1886.335) (-1889.760) [-1881.118] -- 0:00:38
828000 -- [-1886.517] (-1886.851) (-1882.226) (-1889.212) * (-1886.489) [-1888.006] (-1884.336) (-1885.133) -- 0:00:38
829000 -- (-1887.832) (-1884.005) (-1883.618) [-1884.818] * (-1887.723) (-1885.218) [-1889.580] (-1883.634) -- 0:00:38
830000 -- (-1884.713) (-1890.211) (-1882.900) [-1882.517] * (-1886.452) [-1881.895] (-1885.917) (-1883.319) -- 0:00:37
Average standard deviation of split frequencies: 0.003405
831000 -- (-1895.252) (-1881.641) (-1885.627) [-1886.313] * (-1890.495) (-1887.623) (-1885.525) [-1881.880] -- 0:00:37
832000 -- (-1885.205) (-1879.119) (-1882.962) [-1885.365] * (-1887.350) (-1884.660) (-1889.150) [-1883.093] -- 0:00:37
833000 -- [-1885.270] (-1886.288) (-1884.883) (-1890.632) * [-1891.157] (-1888.252) (-1886.372) (-1886.041) -- 0:00:37
834000 -- [-1886.042] (-1884.164) (-1882.253) (-1888.696) * (-1885.286) [-1890.859] (-1884.056) (-1890.823) -- 0:00:37
835000 -- (-1882.567) (-1886.410) (-1885.931) [-1887.016] * (-1892.543) (-1888.429) [-1884.678] (-1889.717) -- 0:00:36
Average standard deviation of split frequencies: 0.004511
836000 -- [-1890.645] (-1885.374) (-1889.719) (-1883.471) * (-1890.699) [-1890.136] (-1881.924) (-1891.678) -- 0:00:36
837000 -- [-1886.683] (-1884.501) (-1886.299) (-1889.720) * [-1892.504] (-1885.554) (-1885.116) (-1891.370) -- 0:00:36
838000 -- (-1883.116) [-1887.600] (-1884.927) (-1888.282) * (-1888.226) [-1886.390] (-1884.435) (-1883.025) -- 0:00:36
839000 -- (-1885.308) (-1880.743) [-1882.700] (-1893.403) * (-1889.159) [-1883.316] (-1880.816) (-1887.376) -- 0:00:35
840000 -- [-1886.713] (-1883.947) (-1888.330) (-1884.937) * (-1887.948) (-1889.164) (-1883.081) [-1887.573] -- 0:00:35
Average standard deviation of split frequencies: 0.006449
841000 -- (-1883.606) (-1881.538) (-1882.989) [-1884.504] * (-1887.892) [-1886.801] (-1892.205) (-1887.963) -- 0:00:35
842000 -- [-1883.349] (-1889.256) (-1886.517) (-1887.712) * [-1881.260] (-1883.067) (-1886.004) (-1883.616) -- 0:00:35
843000 -- [-1882.371] (-1890.273) (-1890.414) (-1891.197) * (-1891.675) (-1886.355) [-1885.439] (-1885.342) -- 0:00:35
844000 -- [-1887.094] (-1883.924) (-1886.863) (-1884.176) * [-1885.955] (-1892.066) (-1884.269) (-1885.248) -- 0:00:34
845000 -- (-1889.227) (-1885.938) (-1887.017) [-1881.610] * [-1884.203] (-1884.721) (-1883.231) (-1881.957) -- 0:00:34
Average standard deviation of split frequencies: 0.004736
846000 -- (-1893.668) (-1890.879) (-1884.430) [-1889.787] * (-1883.296) [-1884.971] (-1887.510) (-1883.735) -- 0:00:34
847000 -- (-1885.419) (-1885.841) (-1884.732) [-1883.308] * (-1883.826) (-1887.549) [-1884.349] (-1892.531) -- 0:00:34
848000 -- [-1887.527] (-1883.584) (-1891.300) (-1885.999) * (-1887.527) [-1891.365] (-1890.711) (-1890.940) -- 0:00:33
849000 -- (-1884.364) (-1880.062) (-1885.112) [-1883.017] * [-1887.113] (-1889.200) (-1885.791) (-1897.320) -- 0:00:33
850000 -- [-1886.186] (-1885.192) (-1883.945) (-1881.945) * (-1887.101) (-1884.641) [-1886.724] (-1889.779) -- 0:00:33
Average standard deviation of split frequencies: 0.003879
851000 -- (-1889.312) (-1887.104) [-1884.657] (-1887.009) * [-1884.503] (-1896.542) (-1889.218) (-1891.931) -- 0:00:33
852000 -- [-1887.271] (-1888.975) (-1887.207) (-1883.447) * (-1891.051) [-1888.445] (-1883.571) (-1885.093) -- 0:00:33
853000 -- [-1881.725] (-1884.016) (-1887.039) (-1889.895) * (-1884.537) (-1880.507) [-1888.873] (-1885.013) -- 0:00:32
854000 -- [-1881.864] (-1884.005) (-1888.660) (-1880.507) * (-1884.978) (-1885.051) (-1882.386) [-1884.090] -- 0:00:32
855000 -- (-1891.987) (-1883.048) [-1883.166] (-1883.408) * (-1883.158) [-1884.166] (-1886.845) (-1887.255) -- 0:00:32
Average standard deviation of split frequencies: 0.003304
856000 -- (-1880.692) (-1885.862) [-1884.782] (-1890.807) * (-1884.988) [-1887.709] (-1886.442) (-1886.996) -- 0:00:32
857000 -- (-1890.030) (-1892.415) (-1888.072) [-1882.824] * (-1886.764) (-1881.423) (-1887.538) [-1885.143] -- 0:00:32
858000 -- (-1888.092) (-1888.599) (-1884.380) [-1886.263] * (-1891.564) [-1882.925] (-1900.098) (-1880.969) -- 0:00:31
859000 -- [-1882.212] (-1888.360) (-1883.838) (-1892.423) * (-1887.158) (-1890.135) (-1885.991) [-1882.571] -- 0:00:31
860000 -- (-1889.315) (-1890.893) [-1887.483] (-1887.658) * (-1882.180) (-1884.474) (-1883.420) [-1885.074] -- 0:00:31
Average standard deviation of split frequencies: 0.002465
861000 -- (-1884.552) (-1887.251) (-1890.228) [-1881.847] * (-1885.547) [-1882.749] (-1890.964) (-1890.812) -- 0:00:30
862000 -- (-1888.180) (-1884.999) [-1884.293] (-1886.120) * (-1884.275) (-1881.476) [-1884.800] (-1882.027) -- 0:00:30
863000 -- (-1881.779) (-1890.035) (-1898.295) [-1887.695] * (-1881.050) (-1891.242) (-1884.981) [-1886.468] -- 0:00:30
864000 -- (-1882.853) [-1887.037] (-1900.441) (-1879.996) * (-1889.868) (-1883.634) [-1887.552] (-1889.436) -- 0:00:30
865000 -- [-1882.099] (-1896.270) (-1901.397) (-1888.211) * [-1892.309] (-1885.705) (-1881.853) (-1887.848) -- 0:00:30
Average standard deviation of split frequencies: 0.002450
866000 -- (-1882.900) [-1883.341] (-1885.338) (-1886.419) * (-1884.033) [-1889.419] (-1884.780) (-1891.812) -- 0:00:30
867000 -- (-1887.996) (-1888.686) [-1883.274] (-1885.669) * [-1887.686] (-1886.480) (-1887.371) (-1892.505) -- 0:00:29
868000 -- [-1886.437] (-1885.116) (-1883.772) (-1889.327) * (-1895.654) [-1881.934] (-1893.526) (-1887.063) -- 0:00:29
869000 -- [-1883.285] (-1886.066) (-1885.924) (-1888.811) * (-1882.746) (-1887.269) (-1894.814) [-1885.094] -- 0:00:29
870000 -- (-1886.593) (-1899.300) (-1886.476) [-1883.049] * [-1882.112] (-1890.715) (-1885.497) (-1885.812) -- 0:00:28
Average standard deviation of split frequencies: 0.000812
871000 -- (-1893.510) (-1887.802) [-1892.589] (-1887.214) * (-1883.510) (-1883.608) [-1885.361] (-1887.159) -- 0:00:28
872000 -- [-1887.334] (-1886.430) (-1888.893) (-1889.820) * (-1882.335) [-1888.444] (-1886.402) (-1892.581) -- 0:00:28
873000 -- (-1892.315) [-1888.363] (-1891.729) (-1886.711) * (-1885.494) (-1884.559) (-1888.950) [-1886.239] -- 0:00:28
874000 -- [-1890.590] (-1892.662) (-1886.584) (-1886.179) * (-1895.930) (-1885.149) (-1892.981) [-1881.528] -- 0:00:28
875000 -- [-1892.621] (-1888.519) (-1886.246) (-1884.058) * [-1886.472] (-1893.906) (-1887.109) (-1883.694) -- 0:00:28
Average standard deviation of split frequencies: 0.001076
876000 -- [-1885.104] (-1887.138) (-1887.932) (-1886.038) * (-1885.710) (-1889.443) (-1882.137) [-1890.138] -- 0:00:27
877000 -- (-1885.667) [-1889.058] (-1886.087) (-1884.250) * (-1882.128) (-1889.319) [-1883.275] (-1893.134) -- 0:00:27
878000 -- [-1885.265] (-1888.508) (-1887.709) (-1883.604) * (-1889.912) (-1890.966) (-1889.015) [-1892.171] -- 0:00:27
879000 -- [-1886.628] (-1886.223) (-1886.258) (-1882.374) * [-1883.738] (-1885.069) (-1887.988) (-1893.666) -- 0:00:26
880000 -- (-1891.789) (-1889.143) (-1885.368) [-1882.731] * [-1881.118] (-1888.798) (-1893.402) (-1885.460) -- 0:00:26
Average standard deviation of split frequencies: 0.000803
881000 -- (-1885.487) [-1884.944] (-1882.545) (-1889.938) * (-1886.995) [-1893.024] (-1885.179) (-1890.667) -- 0:00:26
882000 -- (-1882.981) (-1883.903) [-1884.879] (-1885.437) * [-1881.474] (-1892.090) (-1885.679) (-1886.077) -- 0:00:26
883000 -- [-1888.722] (-1886.280) (-1889.911) (-1887.736) * (-1885.307) (-1893.397) (-1885.071) [-1882.245] -- 0:00:26
884000 -- (-1885.925) (-1885.023) [-1881.727] (-1883.493) * (-1888.342) [-1888.292] (-1885.221) (-1885.971) -- 0:00:25
885000 -- (-1885.568) (-1887.195) (-1884.358) [-1889.246] * (-1883.255) [-1884.792] (-1887.099) (-1886.089) -- 0:00:25
Average standard deviation of split frequencies: 0.001330
886000 -- (-1886.714) (-1886.821) [-1883.162] (-1890.963) * (-1887.121) [-1886.904] (-1885.578) (-1884.761) -- 0:00:25
887000 -- (-1885.635) (-1887.627) (-1887.233) [-1882.841] * (-1887.278) [-1886.068] (-1886.746) (-1889.000) -- 0:00:25
888000 -- (-1882.569) (-1884.325) [-1889.504] (-1879.967) * (-1887.292) (-1885.426) [-1888.401] (-1888.050) -- 0:00:24
889000 -- (-1892.340) (-1887.187) (-1883.194) [-1885.397] * [-1888.753] (-1882.264) (-1884.043) (-1886.042) -- 0:00:24
890000 -- (-1885.352) [-1883.957] (-1886.833) (-1887.362) * (-1884.987) (-1884.510) (-1888.188) [-1884.508] -- 0:00:24
Average standard deviation of split frequencies: 0.001323
891000 -- (-1889.362) (-1883.775) (-1890.364) [-1885.189] * (-1892.875) (-1891.646) (-1883.991) [-1882.960] -- 0:00:24
892000 -- (-1885.187) [-1883.416] (-1883.079) (-1888.234) * (-1888.271) (-1888.589) [-1884.121] (-1882.621) -- 0:00:24
893000 -- (-1885.077) (-1882.343) (-1890.149) [-1894.434] * [-1886.179] (-1886.822) (-1890.846) (-1884.948) -- 0:00:23
894000 -- [-1881.972] (-1893.789) (-1890.699) (-1884.165) * [-1886.515] (-1891.705) (-1889.300) (-1886.522) -- 0:00:23
895000 -- [-1883.245] (-1886.792) (-1882.649) (-1890.994) * (-1884.683) [-1883.181] (-1885.704) (-1889.467) -- 0:00:23
Average standard deviation of split frequencies: 0.001315
896000 -- (-1892.211) (-1886.762) (-1885.500) [-1885.515] * (-1888.060) [-1881.076] (-1888.797) (-1885.656) -- 0:00:23
897000 -- (-1888.175) (-1888.900) [-1884.679] (-1889.373) * (-1891.757) [-1882.444] (-1891.361) (-1888.110) -- 0:00:23
898000 -- (-1884.660) (-1884.051) [-1885.739] (-1888.757) * (-1886.969) (-1882.410) (-1885.418) [-1884.087] -- 0:00:22
899000 -- (-1881.329) [-1882.540] (-1886.237) (-1887.854) * (-1886.224) [-1884.389] (-1888.379) (-1886.129) -- 0:00:22
900000 -- (-1883.235) [-1884.803] (-1884.879) (-1884.989) * [-1892.382] (-1888.176) (-1889.674) (-1893.685) -- 0:00:22
Average standard deviation of split frequencies: 0.001570
901000 -- (-1884.948) (-1888.491) [-1888.911] (-1885.822) * (-1882.823) (-1890.744) (-1887.417) [-1887.990] -- 0:00:22
902000 -- (-1884.367) (-1886.336) [-1892.183] (-1888.433) * [-1886.462] (-1887.005) (-1890.555) (-1880.066) -- 0:00:21
903000 -- (-1885.031) [-1886.015] (-1891.000) (-1883.597) * (-1882.277) [-1887.631] (-1884.500) (-1885.188) -- 0:00:21
904000 -- (-1883.856) [-1883.712] (-1889.586) (-1894.514) * (-1890.894) (-1891.431) [-1883.246] (-1882.402) -- 0:00:21
905000 -- [-1882.107] (-1889.933) (-1887.180) (-1891.893) * (-1882.646) [-1882.265] (-1888.732) (-1890.776) -- 0:00:21
Average standard deviation of split frequencies: 0.001301
906000 -- (-1893.747) (-1888.003) (-1887.291) [-1886.202] * (-1888.561) (-1885.203) (-1887.549) [-1885.637] -- 0:00:21
907000 -- (-1883.444) (-1890.751) (-1886.205) [-1883.466] * (-1895.223) (-1887.219) (-1888.376) [-1881.783] -- 0:00:20
908000 -- (-1893.926) (-1890.641) (-1887.145) [-1881.742] * (-1885.981) (-1885.386) (-1892.159) [-1882.760] -- 0:00:20
909000 -- (-1886.147) (-1890.623) (-1881.325) [-1879.154] * [-1882.962] (-1885.959) (-1884.424) (-1888.793) -- 0:00:20
910000 -- (-1887.500) (-1889.004) [-1885.286] (-1881.653) * (-1888.226) [-1883.878] (-1886.792) (-1888.708) -- 0:00:20
Average standard deviation of split frequencies: 0.001294
911000 -- (-1886.708) [-1886.513] (-1887.495) (-1888.126) * [-1884.380] (-1884.621) (-1897.278) (-1891.267) -- 0:00:19
912000 -- (-1885.055) [-1883.990] (-1881.318) (-1882.216) * (-1887.857) (-1885.681) [-1884.978] (-1889.176) -- 0:00:19
913000 -- (-1887.998) (-1890.205) (-1888.906) [-1886.572] * (-1882.065) [-1891.573] (-1888.708) (-1892.339) -- 0:00:19
914000 -- (-1885.370) [-1883.832] (-1895.506) (-1885.878) * (-1886.587) [-1887.391] (-1881.315) (-1888.905) -- 0:00:19
915000 -- (-1885.215) (-1882.604) [-1881.803] (-1882.243) * [-1884.296] (-1888.838) (-1890.871) (-1887.048) -- 0:00:19
Average standard deviation of split frequencies: 0.001544
916000 -- (-1891.227) [-1884.069] (-1880.633) (-1883.986) * (-1885.580) [-1885.506] (-1886.514) (-1884.248) -- 0:00:18
917000 -- (-1888.262) [-1883.820] (-1888.938) (-1886.400) * (-1882.117) [-1883.247] (-1890.866) (-1888.469) -- 0:00:18
918000 -- (-1888.311) (-1899.778) (-1889.394) [-1884.594] * [-1890.384] (-1883.758) (-1892.507) (-1883.402) -- 0:00:18
919000 -- (-1888.131) (-1892.713) [-1882.786] (-1885.205) * (-1883.640) (-1884.640) (-1895.415) [-1887.618] -- 0:00:18
920000 -- (-1890.589) (-1883.096) (-1885.465) [-1887.618] * (-1885.675) (-1892.017) [-1887.725] (-1885.253) -- 0:00:17
Average standard deviation of split frequencies: 0.001280
921000 -- [-1891.549] (-1890.205) (-1881.192) (-1886.023) * [-1882.510] (-1888.352) (-1885.380) (-1885.973) -- 0:00:17
922000 -- [-1880.830] (-1886.269) (-1890.624) (-1894.510) * (-1886.144) (-1888.548) [-1887.925] (-1884.927) -- 0:00:17
923000 -- (-1884.706) (-1886.061) [-1885.237] (-1887.118) * (-1885.673) (-1880.742) (-1887.156) [-1885.950] -- 0:00:17
924000 -- (-1887.039) (-1887.370) (-1885.947) [-1883.823] * [-1885.282] (-1880.849) (-1887.081) (-1882.723) -- 0:00:17
925000 -- (-1884.390) (-1888.075) (-1892.338) [-1885.120] * (-1884.839) (-1886.897) (-1886.724) [-1883.734] -- 0:00:16
Average standard deviation of split frequencies: 0.001782
926000 -- (-1891.908) (-1882.721) (-1885.263) [-1886.362] * (-1887.192) (-1891.147) (-1883.186) [-1883.565] -- 0:00:16
927000 -- (-1901.279) [-1887.113] (-1888.561) (-1886.186) * [-1883.427] (-1890.052) (-1892.977) (-1882.332) -- 0:00:16
928000 -- (-1888.940) [-1884.441] (-1887.207) (-1893.302) * (-1887.626) (-1885.112) [-1887.647] (-1886.893) -- 0:00:16
929000 -- (-1884.297) [-1891.362] (-1890.919) (-1885.654) * (-1886.463) (-1890.173) (-1883.367) [-1885.362] -- 0:00:15
930000 -- (-1884.203) (-1883.337) (-1893.679) [-1884.943] * [-1883.683] (-1887.738) (-1885.347) (-1884.999) -- 0:00:15
Average standard deviation of split frequencies: 0.001266
931000 -- (-1884.271) [-1881.752] (-1889.501) (-1888.500) * (-1885.903) (-1882.927) [-1885.867] (-1891.399) -- 0:00:15
932000 -- (-1891.486) (-1883.526) (-1890.118) [-1887.590] * (-1886.095) (-1884.938) [-1884.787] (-1897.866) -- 0:00:15
933000 -- (-1886.058) (-1884.737) (-1880.497) [-1888.687] * (-1895.529) [-1887.850] (-1881.696) (-1886.206) -- 0:00:15
934000 -- (-1883.707) (-1882.712) (-1883.917) [-1884.122] * (-1882.878) [-1888.621] (-1888.144) (-1885.607) -- 0:00:14
935000 -- (-1890.538) (-1885.387) (-1882.833) [-1885.126] * [-1888.961] (-1883.474) (-1885.165) (-1884.737) -- 0:00:14
Average standard deviation of split frequencies: 0.001007
936000 -- [-1885.326] (-1884.377) (-1884.708) (-1884.995) * [-1884.972] (-1888.170) (-1884.544) (-1883.688) -- 0:00:14
937000 -- [-1882.509] (-1884.617) (-1886.187) (-1890.908) * (-1880.652) (-1887.580) [-1885.198] (-1888.516) -- 0:00:14
938000 -- (-1890.713) [-1887.102] (-1886.371) (-1888.265) * (-1883.589) (-1886.268) (-1888.104) [-1884.162] -- 0:00:13
939000 -- (-1895.444) (-1891.923) (-1884.537) [-1888.062] * (-1883.186) (-1890.869) (-1884.517) [-1882.056] -- 0:00:13
940000 -- (-1889.114) (-1884.821) [-1882.510] (-1888.993) * (-1885.578) (-1888.390) (-1886.070) [-1887.005] -- 0:00:13
Average standard deviation of split frequencies: 0.001754
941000 -- (-1888.161) (-1884.460) [-1884.876] (-1882.826) * (-1880.774) [-1883.982] (-1885.507) (-1895.742) -- 0:00:13
942000 -- (-1890.888) (-1885.482) [-1882.298] (-1884.401) * (-1885.838) [-1881.115] (-1886.140) (-1881.280) -- 0:00:12
943000 -- (-1887.630) (-1892.050) (-1884.359) [-1881.546] * (-1886.303) [-1882.789] (-1891.382) (-1888.456) -- 0:00:12
944000 -- (-1884.070) [-1887.227] (-1888.951) (-1884.828) * (-1887.596) [-1887.566] (-1882.136) (-1885.911) -- 0:00:12
945000 -- (-1883.450) (-1886.217) (-1883.869) [-1892.288] * (-1887.363) (-1883.596) [-1885.399] (-1883.960) -- 0:00:12
Average standard deviation of split frequencies: 0.002242
946000 -- [-1885.903] (-1886.259) (-1886.298) (-1893.741) * (-1884.565) [-1883.200] (-1889.622) (-1886.958) -- 0:00:12
947000 -- (-1887.444) (-1890.637) [-1883.459] (-1883.335) * (-1887.689) [-1886.969] (-1890.622) (-1892.650) -- 0:00:11
948000 -- (-1891.894) (-1888.161) [-1883.690] (-1886.761) * (-1885.203) (-1890.018) (-1887.114) [-1883.752] -- 0:00:11
949000 -- (-1885.664) (-1884.110) (-1886.872) [-1893.041] * (-1884.018) (-1885.146) (-1888.390) [-1885.784] -- 0:00:11
950000 -- [-1884.245] (-1888.070) (-1887.495) (-1893.247) * (-1883.924) [-1884.071] (-1886.380) (-1886.640) -- 0:00:11
Average standard deviation of split frequencies: 0.001983
951000 -- (-1888.778) (-1886.366) [-1886.033] (-1888.480) * (-1890.276) (-1892.611) [-1885.410] (-1883.764) -- 0:00:10
952000 -- (-1886.664) (-1893.938) (-1894.039) [-1888.334] * (-1886.150) (-1882.246) [-1888.401] (-1888.428) -- 0:00:10
953000 -- (-1887.740) (-1891.169) [-1888.205] (-1889.393) * [-1884.564] (-1883.230) (-1889.676) (-1882.074) -- 0:00:10
954000 -- (-1890.044) (-1884.458) (-1885.163) [-1880.979] * [-1885.667] (-1884.257) (-1892.367) (-1886.063) -- 0:00:10
955000 -- (-1889.923) (-1885.384) [-1881.179] (-1886.897) * (-1883.653) (-1882.187) [-1883.453] (-1884.581) -- 0:00:10
Average standard deviation of split frequencies: 0.001972
956000 -- [-1883.388] (-1892.074) (-1888.109) (-1886.702) * (-1884.977) (-1886.186) (-1884.105) [-1884.573] -- 0:00:09
957000 -- (-1886.911) (-1895.738) [-1883.686] (-1883.942) * [-1893.325] (-1885.709) (-1887.847) (-1884.876) -- 0:00:09
958000 -- (-1885.472) (-1880.473) [-1883.239] (-1888.552) * (-1886.730) [-1882.498] (-1887.839) (-1882.448) -- 0:00:09
959000 -- [-1883.524] (-1888.818) (-1882.762) (-1884.244) * (-1890.221) [-1885.890] (-1884.128) (-1881.846) -- 0:00:09
960000 -- [-1888.685] (-1884.198) (-1883.817) (-1892.122) * (-1889.272) (-1887.357) [-1881.949] (-1887.099) -- 0:00:08
Average standard deviation of split frequencies: 0.003680
961000 -- [-1886.735] (-1887.944) (-1885.155) (-1891.959) * (-1887.688) (-1888.478) [-1881.997] (-1885.426) -- 0:00:08
962000 -- (-1889.835) [-1885.159] (-1885.302) (-1892.730) * (-1885.874) (-1888.631) [-1884.563] (-1885.086) -- 0:00:08
963000 -- [-1883.486] (-1890.438) (-1882.208) (-1883.881) * [-1881.621] (-1887.281) (-1888.822) (-1886.558) -- 0:00:08
964000 -- (-1880.489) (-1889.811) [-1881.424] (-1887.111) * [-1881.029] (-1889.001) (-1882.818) (-1890.158) -- 0:00:08
965000 -- [-1885.138] (-1884.425) (-1889.645) (-1884.860) * (-1886.882) (-1886.932) [-1881.462] (-1885.655) -- 0:00:07
Average standard deviation of split frequencies: 0.004148
966000 -- [-1889.915] (-1884.682) (-1890.820) (-1884.716) * [-1885.451] (-1890.213) (-1885.983) (-1884.704) -- 0:00:07
967000 -- (-1885.782) (-1884.912) (-1888.727) [-1892.391] * (-1883.525) [-1890.958] (-1886.313) (-1894.213) -- 0:00:07
968000 -- (-1885.417) (-1888.015) (-1889.612) [-1887.009] * (-1887.554) (-1882.895) [-1886.056] (-1887.811) -- 0:00:07
969000 -- (-1883.412) (-1886.233) [-1885.743] (-1888.490) * (-1887.625) [-1882.034] (-1884.303) (-1884.850) -- 0:00:06
970000 -- (-1884.250) (-1885.235) (-1889.447) [-1885.173] * (-1889.283) [-1886.839] (-1891.687) (-1884.367) -- 0:00:06
Average standard deviation of split frequencies: 0.004128
971000 -- [-1887.376] (-1890.144) (-1886.410) (-1889.303) * (-1884.260) [-1883.734] (-1896.434) (-1885.382) -- 0:00:06
972000 -- (-1888.045) (-1887.709) (-1888.590) [-1888.319] * [-1882.830] (-1883.097) (-1888.571) (-1889.695) -- 0:00:06
973000 -- (-1892.174) (-1884.320) [-1886.628] (-1884.461) * (-1885.094) (-1885.519) (-1883.954) [-1894.114] -- 0:00:06
974000 -- (-1884.533) [-1881.284] (-1888.052) (-1894.188) * [-1887.018] (-1882.757) (-1884.417) (-1890.168) -- 0:00:05
975000 -- (-1885.531) (-1886.947) (-1885.088) [-1887.482] * (-1887.804) (-1883.143) (-1891.029) [-1884.485] -- 0:00:05
Average standard deviation of split frequencies: 0.005313
976000 -- [-1887.492] (-1887.530) (-1890.887) (-1893.186) * (-1881.055) (-1887.124) (-1888.004) [-1889.513] -- 0:00:05
977000 -- (-1888.898) (-1881.953) (-1880.740) [-1885.460] * (-1885.637) (-1894.155) [-1889.545] (-1887.046) -- 0:00:05
978000 -- (-1892.705) (-1880.117) (-1883.997) [-1886.250] * (-1889.231) (-1888.108) [-1887.828] (-1889.305) -- 0:00:04
979000 -- (-1886.457) [-1887.281] (-1883.602) (-1882.572) * (-1889.746) (-1882.865) [-1885.297] (-1890.037) -- 0:00:04
980000 -- [-1885.459] (-1891.950) (-1890.479) (-1888.911) * [-1888.049] (-1890.063) (-1883.924) (-1888.654) -- 0:00:04
Average standard deviation of split frequencies: 0.004086
981000 -- [-1889.997] (-1888.338) (-1885.973) (-1891.938) * (-1895.676) (-1889.453) [-1883.217] (-1886.659) -- 0:00:04
982000 -- (-1887.718) (-1890.328) [-1882.678] (-1890.308) * (-1885.113) [-1888.027] (-1886.011) (-1895.305) -- 0:00:04
983000 -- (-1888.807) (-1888.446) (-1887.734) [-1887.509] * (-1895.479) [-1887.295] (-1881.150) (-1892.014) -- 0:00:03
984000 -- (-1889.536) (-1883.150) [-1889.705] (-1889.945) * [-1888.727] (-1885.807) (-1891.220) (-1882.593) -- 0:00:03
985000 -- (-1888.202) (-1891.378) [-1885.850] (-1883.260) * [-1889.738] (-1887.261) (-1889.558) (-1883.451) -- 0:00:03
Average standard deviation of split frequencies: 0.002869
986000 -- [-1882.251] (-1886.615) (-1884.310) (-1890.383) * (-1892.404) (-1886.506) [-1886.098] (-1884.989) -- 0:00:03
987000 -- [-1883.703] (-1886.231) (-1885.754) (-1886.764) * (-1888.423) [-1885.984] (-1883.723) (-1884.886) -- 0:00:02
988000 -- (-1883.916) (-1881.446) [-1882.236] (-1888.864) * (-1883.776) (-1890.437) [-1887.957] (-1881.551) -- 0:00:02
989000 -- (-1886.162) (-1889.380) (-1883.246) [-1880.870] * [-1882.026] (-1893.276) (-1888.934) (-1881.290) -- 0:00:02
990000 -- (-1887.475) [-1887.868] (-1891.304) (-1889.078) * (-1893.358) [-1892.059] (-1891.080) (-1887.904) -- 0:00:02
Average standard deviation of split frequencies: 0.002141
991000 -- (-1885.420) (-1882.371) (-1880.284) [-1883.105] * (-1890.507) (-1891.580) [-1890.241] (-1892.113) -- 0:00:02
992000 -- (-1883.527) (-1887.994) (-1882.102) [-1885.525] * (-1886.536) (-1891.765) (-1888.430) [-1885.347] -- 0:00:01
993000 -- (-1888.991) (-1881.812) (-1885.940) [-1884.987] * (-1885.827) (-1886.463) (-1893.334) [-1881.614] -- 0:00:01
994000 -- (-1882.109) (-1888.495) (-1885.273) [-1884.275] * [-1890.720] (-1886.761) (-1897.633) (-1885.267) -- 0:00:01
995000 -- (-1886.414) [-1885.027] (-1891.144) (-1883.806) * (-1888.501) (-1892.775) (-1886.084) [-1883.201] -- 0:00:01
Average standard deviation of split frequencies: 0.003550
996000 -- (-1889.851) (-1882.563) (-1886.345) [-1884.000] * (-1886.869) (-1889.491) (-1884.742) [-1891.529] -- 0:00:00
997000 -- (-1884.901) [-1883.127] (-1880.510) (-1886.849) * (-1887.815) [-1884.715] (-1884.740) (-1883.835) -- 0:00:00
998000 -- [-1879.543] (-1880.255) (-1884.786) (-1889.970) * (-1891.279) [-1889.022] (-1890.517) (-1890.041) -- 0:00:00
999000 -- (-1883.971) (-1890.178) [-1886.018] (-1888.529) * (-1888.284) (-1885.557) (-1888.617) [-1881.524] -- 0:00:00
1000000 -- [-1883.385] (-1889.383) (-1884.780) (-1887.157) * (-1889.447) (-1885.702) [-1884.972] (-1883.565) -- 0:00:00
Average standard deviation of split frequencies: 0.002120
Analysis completed in 3 mins 43 seconds
Analysis used 223.46 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1878.03
Likelihood of best state for "cold" chain of run 2 was -1878.03
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
52.5 % ( 40 %) Dirichlet(Revmat{all})
68.8 % ( 50 %) Slider(Revmat{all})
26.5 % ( 29 %) Dirichlet(Pi{all})
28.2 % ( 29 %) Slider(Pi{all})
33.3 % ( 24 %) Multiplier(Alpha{1,2})
50.8 % ( 18 %) Multiplier(Alpha{3})
62.2 % ( 40 %) Slider(Pinvar{all})
33.4 % ( 39 %) ExtSPR(Tau{all},V{all})
33.7 % ( 29 %) NNI(Tau{all},V{all})
28.3 % ( 33 %) ParsSPR(Tau{all},V{all})
25.8 % ( 29 %) Multiplier(V{all})
26.6 % ( 19 %) Nodeslider(V{all})
25.3 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
53.1 % ( 41 %) Dirichlet(Revmat{all})
68.7 % ( 48 %) Slider(Revmat{all})
27.0 % ( 23 %) Dirichlet(Pi{all})
28.5 % ( 27 %) Slider(Pi{all})
32.9 % ( 29 %) Multiplier(Alpha{1,2})
50.8 % ( 20 %) Multiplier(Alpha{3})
62.3 % ( 34 %) Slider(Pinvar{all})
33.7 % ( 22 %) ExtSPR(Tau{all},V{all})
34.0 % ( 22 %) NNI(Tau{all},V{all})
28.6 % ( 32 %) ParsSPR(Tau{all},V{all})
25.9 % ( 28 %) Multiplier(V{all})
26.5 % ( 24 %) Nodeslider(V{all})
25.4 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 167097 0.85 0.72
3 | 166297 166762 0.87
4 | 166489 166817 166538
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.69 0.58
2 | 166371 0.85 0.72
3 | 166619 166438 0.86
4 | 167397 166620 166555
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1884.04
| 2 |
| 1 1|
| 1 1 2 1 1 2 |
| 2 |
| 2 2 1 2 2 1 |
| 12 2 1112 1 1 2 1 *2 |
| 1 2 2 2 2 111 1 12 1 1* 1 |
| * 2 2 2 112 |
| 2 * 1 1* * 2 2 222 2 * 2 2 |
|1 2 2 111 1 2 2 12 1 1 |
| 2 1 1 2 2 1 |
|21 2 * 1 12 2 11 21 |
| 1 1 2 1 1 2 22|
| 1 1 1 2 |
| 2 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1886.94
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1882.95 -1890.84
2 -1883.10 -1894.20
--------------------------------------
TOTAL -1883.02 -1893.54
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.593403 0.119181 1.035792 2.255171 1.534519 914.69 989.55 1.000
r(A<->C){all} 0.072455 0.001157 0.004917 0.133179 0.070168 640.91 745.04 1.000
r(A<->G){all} 0.249989 0.002208 0.163143 0.347027 0.247219 676.06 817.13 1.001
r(A<->T){all} 0.166072 0.001216 0.106764 0.242086 0.163527 807.67 878.70 1.006
r(C<->G){all} 0.069358 0.000860 0.015276 0.128055 0.067342 711.69 715.39 1.004
r(C<->T){all} 0.391897 0.003159 0.289216 0.506545 0.389361 573.65 757.16 1.002
r(G<->T){all} 0.050229 0.000567 0.006093 0.096339 0.048682 721.36 792.31 1.000
pi(A){all} 0.232285 0.000248 0.200703 0.262167 0.231561 984.72 1004.81 1.001
pi(C){all} 0.207299 0.000207 0.178112 0.233535 0.207368 980.89 1018.14 1.000
pi(G){all} 0.267607 0.000278 0.234106 0.298766 0.267708 1064.10 1167.73 1.000
pi(T){all} 0.292809 0.000263 0.260784 0.324208 0.293287 1178.88 1232.60 1.000
alpha{1,2} 0.349619 0.009320 0.198967 0.524270 0.335241 1302.51 1333.99 1.000
alpha{3} 2.944915 1.684925 1.009183 5.618096 2.668002 1344.27 1360.88 1.002
pinvar{all} 0.093194 0.003813 0.000014 0.208211 0.084885 1323.45 1408.12 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .*.*
6 -- ..**
----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 1377 0.458694 0.003298 0.456362 0.461026 2
6 1370 0.456362 0.000942 0.455696 0.457029 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.192750 0.002028 0.106396 0.277999 0.187032 1.000 2
length{all}[2] 0.228418 0.004054 0.103185 0.350728 0.226792 1.000 2
length{all}[3] 0.149338 0.002426 0.050460 0.242837 0.148257 1.000 2
length{all}[4] 0.961302 0.072906 0.539235 1.478370 0.910622 1.000 2
length{all}[5] 0.066965 0.002007 0.000063 0.146988 0.061509 1.001 2
length{all}[6] 0.062226 0.001614 0.000105 0.135234 0.058010 0.999 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.002120
Maximum standard deviation of split frequencies = 0.003298
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\------------------------------------------------------------------------ C4 (4)
Phylogram (based on average branch lengths):
/--------------- C1 (1)
|
|------------------ C2 (2)
+
|------------ C3 (3)
|
\------------------------------------------------------------------------ C4 (4)
|--------------| 0.200 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 2 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Wed Oct 26 00:49:06 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=175
C1 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDMPMQEALEVVKNELRKP
C2 MEGVPGPSKLRSMVTITLKWIDPNIMPSVTGWDMPMCEALEIVKDELRKP
C3 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDVSMQEALELVKAELRKP
C4 MEGVPDPPKLKSMVVTTLKWCDPFANPNVTGWDIPIEEALEYAKQQLRTP
*****.*.**:***. *:** ** *.*****:.: **** .* :**.*
C1 EPQLVFVPKYLCHTPLIGEDRIVVTDSTFRATNMGWVPIRELAFDENRIR
C2 EPDLVFVPKYLCHTPLIGRNRVVITDATYRTTVLGWIPIRELAYDESETR
C3 TPKLVFVPNYLCHTPLIGRDRIVITDSIYRATVMGWIPIRELAFDENNIR
C4 EPQLVFVPYYLSHAPGISGDRVVITDSIWYATNFGWQPIRELAMDKDGVR
*.***** **.*:* *. :*:*:**: : :* :** ****** *:. *
C1 FGRSGTFGVLLPMQDAKYIMGHIDIDMRKYGVGAGGDKDEPLLWDGYIDT
C2 YGRSGTYGVLLPMQDSKYIMGSIDIDMRKYGAGAGSDRPEPMLWDGFVDL
C3 CGRSGTFGVLLPEQDPKYVMGEVDIDMRKYGVGACSEKPVPLLWDGYIDT
C4 YGRGGTHGVLLPMQDPSFIMGDIDIQIRKYGIGANSPPDVLPLWDGFSDP
**.**.***** **..::** :**::**** ** . ****: *
C1 PYPEDDYLDFPDNSRPAKPKAKRGG
C2 PRSQKQYLDYPDNCRPTKPKAKRGG
C3 PYPEDDYLDFPDMCRPAKPKAKRGG
C4 GPDVGPYLDFPDNCCPTKPKAKRGG
***:** . *:********
-- Starting log on Wed Oct 26 02:11:10 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/codeml,BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C1 525 sites
reading seq# 2 C2 525 sites
reading seq# 3 C3 525 sites
reading seq# 4 C4 525 sitesns = 4 ls = 525
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Sequences read..
Counting site patterns.. 0:00
Compressing, 153 patterns at 175 / 175 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 153 patterns at 175 / 175 sites (100.0%), 0:00
Counting codons..
48 bytes for distance
149328 bytes for conP
13464 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4); MP score: 241
0.062806 0.081373 0.051337 0.049090 0.300000 0.816637 0.347418
ntime & nrate & np: 4 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 14.022938
np = 7
lnL0 = -2435.222087
Iterating by ming2
Initial: fx= 2435.222087
x= 0.06281 0.08137 0.05134 0.04909 0.30000 0.81664 0.34742
1 h-m-p 0.0000 0.0014 3068.8518 +++CYCYCCC 1851.590877 6 0.0012 26 | 0/7
2 h-m-p 0.0001 0.0003 236.2458 CCCCC 1849.378260 4 0.0001 44 | 0/7
3 h-m-p 0.0001 0.0051 184.8535 ++YYYCC 1833.028123 4 0.0014 61 | 0/7
4 h-m-p 0.0052 0.0467 51.7823 +CYCCCC 1797.142722 5 0.0273 81 | 0/7
5 h-m-p 0.1360 0.6799 5.1688 YCCC 1796.800107 3 0.0219 96 | 0/7
6 h-m-p 0.0615 1.6915 1.8413 CYC 1796.421341 2 0.0672 109 | 0/7
7 h-m-p 0.0961 0.8369 1.2876 +YCCC 1791.738237 3 0.2671 125 | 0/7
8 h-m-p 0.0169 0.0846 13.3776 YYYC 1789.771992 3 0.0158 138 | 0/7
9 h-m-p 1.0943 5.4716 0.1492 YCCCC 1786.580984 4 2.1499 155 | 0/7
10 h-m-p 1.6000 8.0000 0.0414 YC 1786.487211 1 0.8152 173 | 0/7
11 h-m-p 1.1602 8.0000 0.0291 YC 1786.457280 1 2.0436 191 | 0/7
12 h-m-p 1.6000 8.0000 0.0324 +YC 1786.342059 1 5.1285 210 | 0/7
13 h-m-p 1.6000 8.0000 0.0567 +YC 1786.014760 1 4.4010 229 | 0/7
14 h-m-p 1.6000 8.0000 0.1402 +CYC 1784.171575 2 6.7691 250 | 0/7
15 h-m-p 1.6000 8.0000 0.3242 CCC 1783.974809 2 0.6004 271 | 0/7
16 h-m-p 1.6000 8.0000 0.0274 CYC 1783.924404 2 1.3823 291 | 0/7
17 h-m-p 1.6000 8.0000 0.0171 YC 1783.919560 1 0.8726 309 | 0/7
18 h-m-p 1.6000 8.0000 0.0067 Y 1783.919449 0 0.6620 326 | 0/7
19 h-m-p 1.6000 8.0000 0.0014 Y 1783.919442 0 0.6489 343 | 0/7
20 h-m-p 1.6000 8.0000 0.0001 Y 1783.919442 0 0.8213 360 | 0/7
21 h-m-p 1.6000 8.0000 0.0000 Y 1783.919442 0 0.8964 377 | 0/7
22 h-m-p 1.6000 8.0000 0.0000 C 1783.919442 0 1.3824 394 | 0/7
23 h-m-p 1.6000 8.0000 0.0000 C 1783.919442 0 1.6000 411 | 0/7
24 h-m-p 1.6000 8.0000 0.0000 +Y 1783.919442 0 6.4000 429 | 0/7
25 h-m-p 1.1851 8.0000 0.0000 ----------------.. | 0/7
26 h-m-p 0.0160 8.0000 0.0002 ------------- | 0/7
27 h-m-p 0.0160 8.0000 0.0002 -------------
Out..
lnL = -1783.919442
517 lfun, 1551 eigenQcodon, 4136 P(t)
end of tree file.
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4); MP score: 241
0.093943 0.036478 0.093542 0.061655 2.380715 1.361560 0.301839 0.334661 1.413171
ntime & nrate & np: 4 3 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.583538
np = 9
lnL0 = -2297.126136
Iterating by ming2
Initial: fx= 2297.126136
x= 0.09394 0.03648 0.09354 0.06165 2.38071 1.36156 0.30184 0.33466 1.41317
1 h-m-p 0.0000 0.0022 2675.6418 +++YYYYCCC 1828.440516 6 0.0007 34 | 0/9
2 h-m-p 0.0002 0.0011 214.1104 +YYYYCCC 1798.602141 6 0.0009 64 | 0/9
3 h-m-p 0.0057 0.0447 31.7209 +YYCCC 1787.222308 4 0.0197 92 | 0/9
4 h-m-p 0.0065 0.0324 17.0319 CC 1786.129659 1 0.0095 115 | 0/9
5 h-m-p 0.0039 0.0193 12.9948 ++ 1784.739612 m 0.0193 136 | 1/9
6 h-m-p 0.0421 1.8415 3.0667 CCC 1784.697994 2 0.0101 161 | 1/9
7 h-m-p 0.0433 5.6193 0.7154 CYC 1784.654895 2 0.0473 184 | 1/9
8 h-m-p 0.0481 5.2685 0.7025 +CCC 1784.531403 2 0.2599 209 | 1/9
9 h-m-p 0.2428 8.0000 0.7519 YCC 1784.461022 2 0.1776 232 | 1/9
10 h-m-p 1.6000 8.0000 0.0234 CC 1784.440700 1 1.5280 254 | 1/9
11 h-m-p 1.6000 8.0000 0.0194 ++ 1784.328226 m 8.0000 274 | 1/9
12 h-m-p 1.2694 8.0000 0.1222 +YC 1783.980777 1 3.5359 296 | 1/9
13 h-m-p 1.6000 8.0000 0.1247 CYC 1783.922729 2 1.4203 319 | 1/9
14 h-m-p 1.6000 8.0000 0.0120 C 1783.919590 0 1.5772 339 | 1/9
15 h-m-p 1.4995 8.0000 0.0126 YC 1783.919442 1 1.0594 360 | 1/9
16 h-m-p 1.6000 8.0000 0.0003 Y 1783.919442 0 1.0457 380 | 1/9
17 h-m-p 1.6000 8.0000 0.0000 Y 1783.919442 0 1.0270 400 | 1/9
18 h-m-p 1.6000 8.0000 0.0000 Y 1783.919442 0 0.9630 420 | 1/9
19 h-m-p 1.6000 8.0000 0.0000 Y 1783.919442 0 1.6000 440 | 1/9
20 h-m-p 1.6000 8.0000 0.0000 -Y 1783.919442 0 0.1000 461
Out..
lnL = -1783.919442
462 lfun, 1848 eigenQcodon, 5544 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1792.687996 S = -1654.654564 -130.817301
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 153 patterns 0:04
did 20 / 153 patterns 0:05
did 30 / 153 patterns 0:05
did 40 / 153 patterns 0:05
did 50 / 153 patterns 0:05
did 60 / 153 patterns 0:05
did 70 / 153 patterns 0:05
did 80 / 153 patterns 0:05
did 90 / 153 patterns 0:05
did 100 / 153 patterns 0:05
did 110 / 153 patterns 0:05
did 120 / 153 patterns 0:05
did 130 / 153 patterns 0:05
did 140 / 153 patterns 0:05
did 150 / 153 patterns 0:05
did 153 / 153 patterns 0:05end of tree file.
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4); MP score: 241
0.099713 0.016266 0.088150 0.028466 2.380715 0.632031 1.983105
ntime & nrate & np: 4 1 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 9.878252
np = 7
lnL0 = -2404.801745
Iterating by ming2
Initial: fx= 2404.801745
x= 0.09971 0.01627 0.08815 0.02847 2.38071 0.63203 1.98311
1 h-m-p 0.0000 0.0110 5730.6407 +++CCYCCCC 1806.144994 6 0.0003 33 | 0/7
2 h-m-p 0.0036 0.0181 76.1253 CCCC 1794.005984 3 0.0050 56 | 0/7
3 h-m-p 0.0087 0.0436 32.9641 CYCCCC 1787.062530 5 0.0132 82 | 0/7
4 h-m-p 0.0029 0.0145 66.4233 CCCCC 1784.536297 4 0.0032 107 | 0/7
5 h-m-p 0.0303 0.1733 7.0325 YC 1784.206128 1 0.0143 125 | 0/7
6 h-m-p 0.0122 0.2734 8.2349 +YCYCCC 1782.004872 5 0.1019 151 | 0/7
7 h-m-p 0.0403 0.2017 5.9843 CYCYCCC 1781.158854 6 0.0677 178 | 0/7
8 h-m-p 1.2497 6.2485 0.3126 CYC 1779.847725 2 1.1306 198 | 0/7
9 h-m-p 1.6000 8.0000 0.0568 YC 1779.786167 1 0.8027 216 | 0/7
10 h-m-p 0.7150 8.0000 0.0638 YC 1779.777150 1 0.5376 234 | 0/7
11 h-m-p 1.6000 8.0000 0.0098 YC 1779.774853 1 0.7945 252 | 0/7
12 h-m-p 1.1364 8.0000 0.0069 ++ 1779.762425 m 8.0000 269 | 0/7
13 h-m-p 1.6000 8.0000 0.0182 ++ 1779.660987 m 8.0000 286 | 0/7
14 h-m-p 1.6000 8.0000 0.0544 CCC 1779.560906 2 2.2346 307 | 0/7
15 h-m-p 1.6000 8.0000 0.0147 YC 1779.558228 1 1.0390 325 | 0/7
16 h-m-p 1.6000 8.0000 0.0021 Y 1779.558196 0 1.0884 342 | 0/7
17 h-m-p 1.6000 8.0000 0.0002 Y 1779.558196 0 1.0778 359 | 0/7
18 h-m-p 1.6000 8.0000 0.0000 Y 1779.558196 0 0.9991 376 | 0/7
19 h-m-p 1.6000 8.0000 0.0000 ---N 1779.558196 0 0.0031 396
Out..
lnL = -1779.558196
397 lfun, 4367 eigenQcodon, 15880 P(t)
end of tree file.
Time used: 0:12
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4); MP score: 241
0.018995 0.062243 0.101442 0.106835 2.199272 0.900000 0.990283 1.037140 1.300000
ntime & nrate & np: 4 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.386526
np = 9
lnL0 = -2269.952904
Iterating by ming2
Initial: fx= 2269.952904
x= 0.01899 0.06224 0.10144 0.10683 2.19927 0.90000 0.99028 1.03714 1.30000
1 h-m-p 0.0000 0.0020 3006.9719 +++YCYCCCCC 1873.309355 7 0.0005 38 | 0/9
2 h-m-p 0.0004 0.0018 118.5379 ++ 1850.546634 m 0.0018 59 | 1/9
3 h-m-p 0.0017 0.0085 111.1012 +YYCYCCC 1818.866479 6 0.0054 90 | 1/9
4 h-m-p 0.0057 0.0285 23.7358 YYCCCC 1817.187600 5 0.0059 118 | 0/9
5 h-m-p 0.0021 0.0159 65.7951 YCCC 1813.207417 3 0.0047 143 | 0/9
6 h-m-p 0.0043 0.0215 28.4129 +YCCC 1810.943782 3 0.0112 170 | 0/9
7 h-m-p 0.0023 0.0113 10.6879 ++ 1809.565885 m 0.0113 191 | 1/9
8 h-m-p 0.0022 0.0517 18.5095 +YC 1803.481294 1 0.0223 214 | 1/9
9 h-m-p 0.2369 1.1847 1.3312 CYCCC 1799.034044 4 0.4539 241 | 1/9
10 h-m-p 0.0643 0.3215 2.0098 +YCCC 1794.689840 3 0.2171 267 | 1/9
11 h-m-p 0.0870 0.4352 1.7632 ++ 1786.775363 m 0.4352 287 | 1/9
12 h-m-p 0.0000 0.0000 1.2137
h-m-p: 0.00000000e+00 0.00000000e+00 1.21369631e+00 1786.775363
.. | 1/9
13 h-m-p 0.0001 0.0324 96.1383 +YCCC 1784.589188 3 0.0005 330 | 1/9
14 h-m-p 0.0021 0.0105 23.2213 ++ 1781.410414 m 0.0105 350 | 2/9
15 h-m-p 0.0266 0.2008 9.1368 YCCC 1780.979300 3 0.0115 375 | 2/9
16 h-m-p 0.0109 0.3801 9.6453 +CYC 1779.836409 2 0.0450 398 | 2/9
17 h-m-p 0.0541 0.3916 8.0183 YCC 1779.676705 2 0.0092 420 | 2/9
18 h-m-p 0.0486 2.1353 1.5239 YC 1779.650027 1 0.0245 440 | 2/9
19 h-m-p 0.0141 1.2123 2.6383 +CYC 1779.574003 2 0.0519 463 | 2/9
20 h-m-p 0.3451 2.4824 0.3964 CC 1779.565538 1 0.0995 484 | 2/9
21 h-m-p 1.2153 8.0000 0.0324 YC 1779.558522 1 0.7159 504 | 2/9
22 h-m-p 1.6000 8.0000 0.0073 YC 1779.558216 1 0.9185 524 | 2/9
23 h-m-p 1.6000 8.0000 0.0002 Y 1779.558211 0 1.1516 543 | 2/9
24 h-m-p 1.6000 8.0000 0.0000 Y 1779.558211 0 0.9775 562 | 2/9
25 h-m-p 1.6000 8.0000 0.0000 Y 1779.558211 0 0.8189 581 | 2/9
26 h-m-p 1.6000 8.0000 0.0000 Y 1779.558211 0 0.4000 600 | 2/9
27 h-m-p 0.6530 8.0000 0.0000 C 1779.558211 0 0.6530 619 | 2/9
28 h-m-p 1.6000 8.0000 0.0000 --------------Y 1779.558211 0 0.0000 652
Out..
lnL = -1779.558211
653 lfun, 7836 eigenQcodon, 28732 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1792.839046 S = -1659.365544 -142.842624
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 153 patterns 0:24
did 20 / 153 patterns 0:24
did 30 / 153 patterns 0:24
did 40 / 153 patterns 0:24
did 50 / 153 patterns 0:24
did 60 / 153 patterns 0:25
did 70 / 153 patterns 0:25
did 80 / 153 patterns 0:25
did 90 / 153 patterns 0:25
did 100 / 153 patterns 0:25
did 110 / 153 patterns 0:26
did 120 / 153 patterns 0:26
did 130 / 153 patterns 0:26
did 140 / 153 patterns 0:26
did 150 / 153 patterns 0:26
did 153 / 153 patterns 0:26end of tree file.
Time used: 0:26
The loglikelihoods for models M1, M2, M7 and M8 are -1783.919442 -1783.919442 -1779.558196 -1779.558211 respectively
CLUSTAL W (1.8) multiple sequence alignment (ALTER 1.3.3)
BF_141I_orf1ab_VIPR_P_124389505_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDMPMQEALEVVKNELRKPEPQLVFVPKY
BF_493I_orf1ab_VIPR_P_124389496_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MEGVPGPSKLRSMVTITLKWIDPNIMPSVTGWDMPMCEALEIVKDELRKPEPDLVFVPKY
BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDVSMQEALELVKAELRKPTPKLVFVPNY
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MEGVPDPPKLKSMVVTTLKWCDPFANPNVTGWDIPIEEALEYAKQQLRTPEPQLVFVPYY
*****.*.**:***. *:** ** *.*****:.: **** .* :**.* *.***** *
BF_141I_orf1ab_VIPR_P_124389505_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 LCHTPLIGEDRIVVTDSTFRATNMGWVPIRELAFDENRIRFGRSGTFGVLLPMQDAKYIM
BF_493I_orf1ab_VIPR_P_124389496_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 LCHTPLIGRNRVVITDATYRTTVLGWIPIRELAYDESETRYGRSGTYGVLLPMQDSKYIM
BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 LCHTPLIGRDRIVITDSIYRATVMGWIPIRELAFDENNIRCGRSGTFGVLLPEQDPKYVM
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 LSHAPGISGDRVVITDSIWYATNFGWQPIRELAMDKDGVRYGRGGTHGVLLPMQDPSFIM
*.*:* *. :*:*:**: : :* :** ****** *:. * **.**.***** **..::*
BF_141I_orf1ab_VIPR_P_124389505_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 GHIDIDMRKYGVGAGGDKDEPLLWDGYIDTPYPEDDYLDFPDNSRPAKPKAKRGG
BF_493I_orf1ab_VIPR_P_124389496_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 GSIDIDMRKYGAGAGSDRPEPMLWDGFVDLPRSQKQYLDYPDNCRPTKPKAKRGG
BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 GEVDIDMRKYGVGACSEKPVPLLWDGYIDTPYPEDDYLDFPDMCRPAKPKAKRGG
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 GDIDIQIRKYGIGANSPPDVLPLWDGFSDPGPDVGPYLDFPDNCCPTKPKAKRGG
* :**::**** ** . ****: * ***:** . *:********
>BF_141I_orf1ab_VIPR_P_124389505_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 ATGGAAGGTGTGCCTGACCCACCTAAGCTTAAAAGTATGGTGACTGTCACTTTTAAGTGGATAGATCCCAATATTATGCCCAGCGTCACTGGCTGGGATATGCCTATGCAAGAGGCTTTAGAGGTCGTTAAGAACGAGCTTCGTAAGCCTGAACCTCAATTGGTGTTTGTGCCTAAGTATTTGTGTCACACACCTTTAATTGGTGAGGACCGTATAGTAGTTACGGACTCTACCTTTAGGGCCACTAACATGGGTTGGGTTCCTATACGGGAGCTTGCCTTTGACGAAAACCGTATACGGTTTGGTCGTAGTGGCACTTTTGGCGTACTGCTACCTATGCAAGACGCCAAGTATATAATGGGTCACATTGACATTGACATGCGTAAATACGGTGTCGGTGCTGGTGGTGACAAGGATGAACCTTTACTCTGGGATGGTTACATTGATACACCATATCCGGAGGATGATTATCTGGATTTTCCTGACAATAGCCGTCCTGCAAAGCCTAAGGCTAAGCGTGGCGGT >BF_493I_orf1ab_VIPR_P_124389496_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 ATGGAGGGTGTGCCTGGTCCATCTAAGCTTAGAAGTATGGTGACTATCACTCTTAAGTGGATAGATCCCAATATTATGCCCAGTGTCACTGGCTGGGATATGCCTATGTGTGAGGCTTTGGAGATCGTTAAGGACGAGCTCCGTAAGCCTGAACCTGACTTGGTGTTTGTGCCCAAGTATTTGTGCCATACACCACTTATAGGTAGGAATCGCGTTGTTATAACCGATGCCACCTACCGTACCACTGTTCTCGGGTGGATCCCTATACGGGAGCTCGCCTATGATGAGAGTGAGACTAGATATGGTCGCAGTGGTACTTATGGTGTTCTGCTACCCATGCAGGATTCCAAGTATATTATGGGTTCTATTGACATCGACATGCGTAAGTACGGTGCCGGTGCTGGGTCTGATAGGCCTGAACCAATGTTGTGGGATGGATTTGTAGACCTCCCACGTTCCCAGAAGCAGTATCTGGATTATCCAGACAACTGCCGCCCCACAAAGCCTAAGGCTAAACGTGGTGGT >BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 ATGGAAGGTGTACCTGACCCACCTAAGCTTAAAAGTATGGTGACTGTCACTTTTAAGTGGATAGATCCCAACATTATGCCCAGCGTCACTGGCTGGGATGTTTCTATGCAAGAGGCTTTGGAGCTCGTTAAGGCTGAGCTCCGTAAGCCTACACCTAAATTGGTGTTTGTGCCCAATTATTTGTGCCATACACCACTTATAGGTAGAGATCGGATTGTTATAACCGACTCTATTTACCGTGCCACTGTCATGGGTTGGATTCCTATTAGGGAACTAGCCTTTGACGAAAATAATATTCGTTGTGGTCGCAGTGGTACGTTTGGTGTTTTGCTCCCTGAGCAGGACCCCAAGTATGTTATGGGCGAGGTCGACATTGACATGCGTAAGTATGGTGTCGGTGCCTGTTCTGAGAAACCTGTTCCATTGCTTTGGGATGGTTATATAGATACTCCATACCCAGAGGATGATTATTTGGATTTTCCTGACATGTGTCGCCCAGCGAAGCCTAAAGCTAAGCGAGGCGGC >HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 ATGGAGGGTGTGCCTGACCCACCTAAGCTTAAAAGTATGGTGGTTACCACTTTGAAGTGGTGCGATCCTTTTGCTAATCCCAACGTCACTGGTTGGGATATTCCTATTGAGGAGGCTCTGGAATATGCGAAACAGCAGTTGCGCACTCCGGAACCTCAGTTGGTGTTTGTGCCTTATTATTTGAGCCATGCACCTGGTATTAGTGGTGACCGCGTTGTCATAACTGATAGCATTTGGTACGCTACTAATTTTGGATGGCAGCCCATTAGGGAGCTTGCCATGGATAAGGATGGTGTTCGTTATGGTAGGGGAGGAACACATGGTGTTTTGCTTCCCATGCAGGACCCGTCCTTTATTATGGGTGATATTGATATCCAAATCCGTAAGTACGGTATTGGGGCCAACTCACCGCCTGATGTATTACCGCTCTGGGATGGGTTTTCAGACCCAGGTCCGGATGTGGGGCCTTATTTAGATTTCCCTGATAATTGCTGCCCTACAAAGCCTAAAGCGAAGAGGGGCGGC
>BF_141I_orf1ab_VIPR_P_124389505_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDMPMQEALEVVKNELRKPEPQLVFVPKYLCHTPLIGEDRIVVTDSTFRATNMGWVPIRELAFDENRIRFGRSGTFGVLLPMQDAKYIMGHIDIDMRKYGVGAGGDKDEPLLWDGYIDTPYPEDDYLDFPDNSRPAKPKAKRGG >BF_493I_orf1ab_VIPR_P_124389496_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MEGVPGPSKLRSMVTITLKWIDPNIMPSVTGWDMPMCEALEIVKDELRKPEPDLVFVPKYLCHTPLIGRNRVVITDATYRTTVLGWIPIRELAYDESETRYGRSGTYGVLLPMQDSKYIMGSIDIDMRKYGAGAGSDRPEPMLWDGFVDLPRSQKQYLDYPDNCRPTKPKAKRGG >BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MEGVPDPPKLKSMVTVTFKWIDPNIMPSVTGWDVSMQEALELVKAELRKPTPKLVFVPNYLCHTPLIGRDRIVITDSIYRATVMGWIPIRELAFDENNIRCGRSGTFGVLLPEQDPKYVMGEVDIDMRKYGVGACSEKPVPLLWDGYIDTPYPEDDYLDFPDMCRPAKPKAKRGG >HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9 MEGVPDPPKLKSMVVTTLKWCDPFANPNVTGWDIPIEEALEYAKQQLRTPEPQLVFVPYYLSHAPGISGDRVVITDSIWYATNFGWQPIRELAMDKDGVRYGRGGTHGVLLPMQDPSFIMGDIDIQIRKYGIGANSPPDVLPLWDGFSDPGPDVGPYLDFPDNCCPTKPKAKRGG
Reading sequence file /data//pss_subsets/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result/original_alignment/codeml/fasta/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1
Found 4 sequences of length 525
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 27.6%
Found 40 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 6
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 161 polymorphic sites
**p-Value(s)**
----------
NSS: 5.60e-02 (1000 permutations)
Max Chi^2: 3.82e-01 (1000 permutations)
PHI (Permutation): 6.42e-01 (1000 permutations)
PHI (Normal): 6.40e-01
#NEXUS
[ID: 5564229852]
begin taxa;
dimensions ntax=4;
taxlabels
BF_141I_orf1ab_VIPR_P_124389505_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
BF_493I_orf1ab_VIPR_P_124389496_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
;
end;
begin trees;
translate
1 BF_141I_orf1ab_VIPR_P_124389505_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9,
2 BF_493I_orf1ab_VIPR_P_124389496_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9,
3 BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9,
4 HKU9_1_BF_005I_ORF1ab_VIPR_ALG1_YP_001039970_1_229_753_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:1.870325e-01,2:2.267923e-01,3:1.482570e-01,4:9.106220e-01);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:1.870325e-01,2:2.267923e-01,3:1.482570e-01,4:9.106220e-01);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1882.95 -1890.84
2 -1883.10 -1894.20
--------------------------------------
TOTAL -1883.02 -1893.54
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.593403 0.119181 1.035792 2.255171 1.534519 914.69 989.55 1.000
r(A<->C){all} 0.072455 0.001157 0.004917 0.133179 0.070168 640.91 745.04 1.000
r(A<->G){all} 0.249989 0.002208 0.163143 0.347027 0.247219 676.06 817.13 1.001
r(A<->T){all} 0.166072 0.001216 0.106764 0.242086 0.163527 807.67 878.70 1.006
r(C<->G){all} 0.069358 0.000860 0.015276 0.128055 0.067342 711.69 715.39 1.004
r(C<->T){all} 0.391897 0.003159 0.289216 0.506545 0.389361 573.65 757.16 1.002
r(G<->T){all} 0.050229 0.000567 0.006093 0.096339 0.048682 721.36 792.31 1.000
pi(A){all} 0.232285 0.000248 0.200703 0.262167 0.231561 984.72 1004.81 1.001
pi(C){all} 0.207299 0.000207 0.178112 0.233535 0.207368 980.89 1018.14 1.000
pi(G){all} 0.267607 0.000278 0.234106 0.298766 0.267708 1064.10 1167.73 1.000
pi(T){all} 0.292809 0.000263 0.260784 0.324208 0.293287 1178.88 1232.60 1.000
alpha{1,2} 0.349619 0.009320 0.198967 0.524270 0.335241 1302.51 1333.99 1.000
alpha{3} 2.944915 1.684925 1.009183 5.618096 2.668002 1344.27 1360.88 1.002
pinvar{all} 0.093194 0.003813 0.000014 0.208211 0.084885 1323.45 1408.12 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/BF_017I_orf1ab_VIPR_P_124389487_228_752_1_NA_China_Bat_Rousettus_bat_coronavirus_HKU9.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 4 ls = 175
Codon usage in sequences
------------------------------------------------------------------------------------------------------
Phe TTT 7 2 5 5 | Ser TCT 1 3 3 0 | Tyr TAT 4 7 5 5 | Cys TGT 1 1 3 0
TTC 0 0 0 1 | TCC 0 2 0 1 | TAC 2 2 2 2 | TGC 0 2 1 3
Leu TTA 3 0 0 2 | TCA 0 0 0 2 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 2 4 6 5 | TCG 0 0 0 0 | TAG 0 0 0 0 | Trp TGG 4 4 4 5
------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 | Pro CCT 13 7 9 12 | His CAT 0 1 1 2 | Arg CGT 7 5 4 2
CTC 1 4 3 1 | CCC 2 5 4 3 | CAC 2 0 0 0 | CGC 0 3 2 2
CTA 1 1 1 0 | CCA 2 5 6 2 | Gln CAA 3 0 1 1 | CGA 0 0 1 0
CTG 2 2 0 1 | CCG 1 0 0 5 | CAG 0 3 1 5 | CGG 2 1 1 0
------------------------------------------------------------------------------------------------------
Ile ATT 5 3 7 8 | Thr ACT 5 6 5 5 | Asn AAT 2 2 3 3 | Ser AGT 2 4 2 2
ATC 0 4 0 2 | ACC 1 3 1 1 | AAC 3 1 1 2 | AGC 2 0 1 2
ATA 5 4 4 1 | ACA 2 2 2 2 | Lys AAA 2 1 4 3 | Arg AGA 0 2 1 0
Met ATG 9 9 8 5 | ACG 1 0 1 0 | AAG 10 10 8 6 | AGG 1 2 1 3
------------------------------------------------------------------------------------------------------
Val GTT 3 5 6 4 | Ala GCT 3 3 3 3 | Asp GAT 8 8 8 12 | Gly GGT 11 11 9 10
GTC 4 1 5 2 | GCC 3 3 3 2 | GAC 9 6 7 4 | GGC 4 1 4 2
GTA 2 1 1 1 | GCA 1 0 0 1 | Glu GAA 4 2 3 2 | GGA 0 1 0 3
GTG 4 4 3 5 | GCG 0 0 1 2 | GAG 6 7 7 4 | GGG 0 2 0 3
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C1
position 1: T:0.13714 C:0.22286 A:0.28571 G:0.35429
position 2: T:0.29143 C:0.20000 A:0.31429 G:0.19429
position 3: T:0.42857 C:0.18857 A:0.14286 G:0.24000
Average T:0.28571 C:0.20381 A:0.24762 G:0.26286
#2: C2
position 1: T:0.15429 C:0.22857 A:0.30286 G:0.31429
position 2: T:0.26857 C:0.22286 A:0.28571 G:0.22286
position 3: T:0.40571 C:0.21143 A:0.10857 G:0.27429
Average T:0.27619 C:0.22095 A:0.23238 G:0.27048
#3: C3
position 1: T:0.16571 C:0.21143 A:0.28000 G:0.34286
position 2: T:0.29714 C:0.21714 A:0.29143 G:0.19429
position 3: T:0.43429 C:0.19429 A:0.13714 G:0.23429
Average T:0.29905 C:0.20762 A:0.23619 G:0.25714
#4: C4
position 1: T:0.17714 C:0.22286 A:0.25714 G:0.34286
position 2: T:0.26286 C:0.23429 A:0.29143 G:0.21143
position 3: T:0.43429 C:0.17143 A:0.11429 G:0.28000
Average T:0.29143 C:0.20952 A:0.22095 G:0.27810
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 19 | Ser S TCT 7 | Tyr Y TAT 21 | Cys C TGT 5
TTC 1 | TCC 3 | TAC 8 | TGC 6
Leu L TTA 5 | TCA 2 | *** * TAA 0 | *** * TGA 0
TTG 17 | TCG 0 | TAG 0 | Trp W TGG 17
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 41 | His H CAT 4 | Arg R CGT 18
CTC 9 | CCC 14 | CAC 2 | CGC 7
CTA 3 | CCA 15 | Gln Q CAA 5 | CGA 1
CTG 5 | CCG 6 | CAG 9 | CGG 4
------------------------------------------------------------------------------
Ile I ATT 23 | Thr T ACT 21 | Asn N AAT 10 | Ser S AGT 10
ATC 6 | ACC 6 | AAC 7 | AGC 5
ATA 14 | ACA 8 | Lys K AAA 10 | Arg R AGA 3
Met M ATG 31 | ACG 2 | AAG 34 | AGG 7
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 12 | Asp D GAT 36 | Gly G GGT 41
GTC 12 | GCC 11 | GAC 26 | GGC 11
GTA 5 | GCA 2 | Glu E GAA 11 | GGA 4
GTG 16 | GCG 3 | GAG 24 | GGG 5
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15857 C:0.22143 A:0.28143 G:0.33857
position 2: T:0.28000 C:0.21857 A:0.29571 G:0.20571
position 3: T:0.42571 C:0.19143 A:0.12571 G:0.25714
Average T:0.28810 C:0.21048 A:0.23429 G:0.26714
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4); MP score: 241
check convergence..
lnL(ntime: 4 np: 7): -1783.919442 +0.000000
5..1 5..2 5..3 5..4
0.476986 0.615822 0.391636 2.204787 2.380715 0.681643 0.045570
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 3.689231
(1: 0.476986, 2: 0.615822, 3: 0.391636, 4: 2.204787);
(C1: 0.476986, C2: 0.615822, C3: 0.391636, C4: 2.204787);
Detailed output identifying parameters
kappa (ts/tv) = 2.38071
MLEs of dN/dS (w) for site classes (K=2)
p: 0.68164 0.31836
w: 0.04557 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.477 405.0 120.0 0.3494 0.1115 0.3192 45.2 38.3
5..2 0.616 405.0 120.0 0.3494 0.1440 0.4121 58.3 49.4
5..3 0.392 405.0 120.0 0.3494 0.0916 0.2621 37.1 31.4
5..4 2.205 405.0 120.0 0.3494 0.5155 1.4754 208.8 177.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4); MP score: 241
lnL(ntime: 4 np: 9): -1783.919442 +0.000000
5..1 5..2 5..3 5..4
0.476986 0.615822 0.391636 2.204787 2.380715 0.681643 0.146196 0.045570 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 3.689231
(1: 0.476986, 2: 0.615822, 3: 0.391636, 4: 2.204787);
(C1: 0.476986, C2: 0.615822, C3: 0.391636, C4: 2.204787);
Detailed output identifying parameters
kappa (ts/tv) = 2.38071
MLEs of dN/dS (w) for site classes (K=3)
p: 0.68164 0.14620 0.17216
w: 0.04557 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.477 405.0 120.0 0.3494 0.1115 0.3192 45.2 38.3
5..2 0.616 405.0 120.0 0.3494 0.1440 0.4121 58.3 49.4
5..3 0.392 405.0 120.0 0.3494 0.0916 0.2621 37.1 31.4
5..4 2.205 405.0 120.0 0.3494 0.5155 1.4754 208.8 177.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.533 0.134 0.070 0.049 0.041 0.037 0.035 0.034 0.034 0.034
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.374
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.016 0.183 0.362
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.014 0.018 0.022 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.001 0.001 0.000 0.000 0.000
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4); MP score: 241
lnL(ntime: 4 np: 7): -1779.558196 +0.000000
5..1 5..2 5..3 5..4
0.471056 0.624791 0.393679 2.236020 2.199272 0.214272 0.649227
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 3.725545
(1: 0.471056, 2: 0.624791, 3: 0.393679, 4: 2.236020);
(C1: 0.471056, C2: 0.624791, C3: 0.393679, C4: 2.236020);
Detailed output identifying parameters
kappa (ts/tv) = 2.19927
Parameters in M7 (beta):
p = 0.21427 q = 0.64923
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00028 0.00300 0.01439 0.04608 0.11510 0.24079 0.43588 0.68872 0.93415
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.471 406.3 118.7 0.2478 0.0931 0.3757 37.8 44.6
5..2 0.625 406.3 118.7 0.2478 0.1235 0.4984 50.2 59.2
5..3 0.394 406.3 118.7 0.2478 0.0778 0.3140 31.6 37.3
5..4 2.236 406.3 118.7 0.2478 0.4420 1.7836 179.6 211.7
Time used: 0:12
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4); MP score: 241
lnL(ntime: 4 np: 9): -1779.558211 +0.000000
5..1 5..2 5..3 5..4
0.471056 0.624791 0.393679 2.236021 2.199274 0.999990 0.214273 0.649253 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 3.725547
(1: 0.471056, 2: 0.624791, 3: 0.393679, 4: 2.236021);
(C1: 0.471056, C2: 0.624791, C3: 0.393679, C4: 2.236021);
Detailed output identifying parameters
kappa (ts/tv) = 2.19927
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.21427 q = 0.64925
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00028 0.00300 0.01439 0.04608 0.11509 0.24078 0.43586 0.68870 0.93414 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.471 406.3 118.7 0.2478 0.0931 0.3757 37.8 44.6
5..2 0.625 406.3 118.7 0.2478 0.1235 0.4984 50.2 59.2
5..3 0.394 406.3 118.7 0.2478 0.0778 0.3140 31.6 37.3
5..4 2.236 406.3 118.7 0.2478 0.4420 1.7836 179.6 211.7
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
122 H 0.605 2.021 +- 2.079
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.103 0.895
p : 0.727 0.268 0.004 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.319 0.314 0.053 0.031 0.060 0.081 0.067 0.045 0.031
ws: 0.676 0.123 0.050 0.031 0.024 0.021 0.020 0.019 0.019 0.019
Time used: 0:26
Model 1: NearlyNeutral -1783.919442 Model 2: PositiveSelection -1783.919442 Model 7: beta -1779.558196 Model 8: beta&w>1 -1779.558211 Model 2 vs 1 0 Model 8 vs 7 -.000030
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken. # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
