-- Starting log on Fri Oct 21 22:38:19 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_M_ABQ57219_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.08 sec, SCORE=1000, Nseq=8, Len=229
C1 -MTDSNNTVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C2 MSTDSNNTVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C3 MSSNSTESVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C4 MSTSSNETVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C5 MSTSSNETVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C6 MSTSSNETVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C7 MMTDSNNTVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C8 -MTDSNNTVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
:.*.::******************************************
C1 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C2 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C3 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C4 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C5 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C6 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C7 EVLIMWLLWLLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C8 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
::******* ****************************************
C1 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C2 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C3 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C4 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C5 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C6 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C7 NSFKLYRRTRTFWAFNPETDAIAVISVFGRFYSIPMPVAPTGITLTILSG
C8 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
****************************** *******************
C1 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C2 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C3 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C4 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C5 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C6 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C7 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C8 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
**************************************************
C1 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C2 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C3 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C4 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C5 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C6 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C7 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C8 YVRSKHGDYSALSNSSDNLTENDRLLHLV
*****************************
-- Starting log on Fri Oct 21 22:38:45 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_M_ABQ57219_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.08 sec, SCORE=996, Nseq=8, Len=229
C1 -MTDSNNTVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C2 MSTDSNNTVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C3 MSSNSTESVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C4 MSTSSNETVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C5 MSTSSNETVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C6 MSTSSNETVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C7 MMTDSNNTVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C8 -MTDSNNTVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
:.*.::******************************************
C1 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C2 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C3 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C4 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C5 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C6 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C7 EVLIMWLLWLLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C8 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
::******* ****************************************
C1 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C2 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C3 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C4 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C5 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C6 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C7 NSFKLYRRTRTFWAFNPETDAIAVISVFGRFYSIPMPVAPTGITLTILSG
C8 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
****************************** *******************
C1 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C2 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C3 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C4 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C5 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C6 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C7 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C8 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
**************************************************
C1 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C2 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C3 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C4 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C5 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C6 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C7 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C8 YVRSKHGDYSALSNSSDNLTENDRLLHLV
*****************************
-- Starting log on Fri Oct 21 22:48:02 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/HKU2_HK_46_2006_M_ABQ57219_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/gapped_alignment/codeml,HKU2_HK_46_2006_M_ABQ57219_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 8 taxa and 687 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666392494
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1428336728
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8832453689
Seed = 1006818880
Swapseed = 1666392494
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 11 unique site patterns
Division 2 has 9 unique site patterns
Division 3 has 16 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1357.844855 -- 29.153684
Chain 2 -- -1361.042260 -- 29.153684
Chain 3 -- -1368.463546 -- 29.153684
Chain 4 -- -1356.440093 -- 29.153684
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1452.438986 -- 29.153684
Chain 2 -- -1454.452597 -- 29.153684
Chain 3 -- -1411.567581 -- 29.153684
Chain 4 -- -1340.169547 -- 29.153684
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1357.845] (-1361.042) (-1368.464) (-1356.440) * [-1452.439] (-1454.453) (-1411.568) (-1340.170)
1000 -- (-1147.292) (-1148.998) [-1151.671] (-1153.187) * (-1145.971) (-1154.308) [-1148.920] (-1161.061) -- 0:00:00
2000 -- (-1149.207) (-1154.223) [-1153.166] (-1166.989) * [-1148.505] (-1146.352) (-1150.165) (-1150.327) -- 0:08:19
3000 -- (-1152.227) (-1156.620) (-1147.842) [-1154.512] * [-1144.578] (-1145.626) (-1146.988) (-1153.804) -- 0:05:32
4000 -- (-1147.424) (-1151.127) [-1151.743] (-1149.830) * (-1146.598) (-1142.650) (-1145.384) [-1148.390] -- 0:04:09
5000 -- (-1149.747) (-1156.873) (-1143.159) [-1145.688] * (-1144.119) [-1139.199] (-1143.430) (-1153.661) -- 0:03:19
Average standard deviation of split frequencies: 0.069838
6000 -- (-1150.692) (-1149.140) (-1143.981) [-1139.365] * (-1145.915) [-1145.196] (-1149.947) (-1147.909) -- 0:02:45
7000 -- (-1155.021) (-1149.411) [-1139.765] (-1141.751) * (-1146.333) (-1137.258) (-1158.977) [-1141.590] -- 0:04:43
8000 -- (-1151.433) (-1150.460) (-1144.715) [-1140.582] * [-1145.178] (-1143.689) (-1145.171) (-1139.030) -- 0:04:08
9000 -- (-1147.462) (-1158.549) (-1139.804) [-1141.585] * (-1142.530) [-1137.384] (-1141.002) (-1140.874) -- 0:03:40
10000 -- (-1151.250) (-1150.200) [-1140.964] (-1143.419) * [-1142.967] (-1148.480) (-1142.646) (-1145.900) -- 0:03:18
Average standard deviation of split frequencies: 0.039284
11000 -- (-1142.488) (-1143.604) [-1141.612] (-1138.669) * (-1146.086) (-1145.644) [-1142.309] (-1143.802) -- 0:02:59
12000 -- (-1139.490) (-1152.122) (-1145.778) [-1141.898] * [-1138.597] (-1146.805) (-1144.838) (-1138.280) -- 0:04:07
13000 -- [-1143.041] (-1142.420) (-1142.981) (-1146.014) * (-1148.085) (-1140.768) (-1146.411) [-1142.923] -- 0:03:47
14000 -- (-1142.207) (-1137.343) (-1142.532) [-1147.754] * (-1145.962) (-1142.067) (-1140.942) [-1142.308] -- 0:03:31
15000 -- [-1140.220] (-1149.947) (-1148.312) (-1141.675) * (-1144.277) (-1142.966) (-1148.504) [-1138.709] -- 0:03:17
Average standard deviation of split frequencies: 0.026189
16000 -- (-1144.376) [-1141.407] (-1148.065) (-1144.885) * (-1139.123) (-1139.173) [-1142.541] (-1144.600) -- 0:03:04
17000 -- (-1140.788) (-1142.645) [-1143.439] (-1140.265) * [-1141.168] (-1146.617) (-1144.930) (-1144.080) -- 0:03:51
18000 -- (-1146.693) [-1144.416] (-1144.609) (-1137.309) * [-1139.695] (-1138.188) (-1141.767) (-1144.362) -- 0:03:38
19000 -- [-1140.787] (-1153.678) (-1145.663) (-1141.056) * (-1142.062) [-1138.125] (-1146.080) (-1145.226) -- 0:03:26
20000 -- (-1143.844) [-1147.948] (-1142.939) (-1143.479) * (-1146.367) (-1138.437) (-1141.323) [-1140.729] -- 0:03:16
Average standard deviation of split frequencies: 0.045620
21000 -- (-1142.396) [-1144.777] (-1148.891) (-1149.653) * (-1146.730) (-1143.672) (-1141.300) [-1141.286] -- 0:03:06
22000 -- (-1144.796) [-1144.412] (-1140.987) (-1140.328) * (-1145.299) [-1141.293] (-1142.838) (-1149.459) -- 0:03:42
23000 -- [-1144.499] (-1139.554) (-1144.653) (-1146.277) * [-1139.453] (-1140.604) (-1157.560) (-1142.767) -- 0:03:32
24000 -- (-1148.293) (-1144.685) (-1145.284) [-1140.956] * (-1143.867) [-1142.110] (-1147.909) (-1143.672) -- 0:03:23
25000 -- (-1153.793) (-1142.099) (-1145.679) [-1142.264] * (-1143.523) (-1142.789) (-1147.436) [-1145.840] -- 0:03:15
Average standard deviation of split frequencies: 0.024175
26000 -- (-1155.304) [-1138.238] (-1142.742) (-1144.674) * (-1140.595) (-1144.021) (-1146.001) [-1143.112] -- 0:03:07
27000 -- (-1152.161) (-1146.625) [-1137.295] (-1141.926) * [-1138.252] (-1147.087) (-1145.223) (-1142.330) -- 0:03:36
28000 -- [-1149.077] (-1139.620) (-1141.231) (-1140.216) * (-1147.093) (-1143.664) (-1142.465) [-1140.647] -- 0:03:28
29000 -- (-1147.384) [-1144.366] (-1148.630) (-1142.399) * (-1145.709) [-1141.854] (-1146.133) (-1144.523) -- 0:03:20
30000 -- (-1152.692) [-1145.899] (-1140.451) (-1140.176) * [-1142.755] (-1142.758) (-1141.429) (-1150.169) -- 0:03:14
Average standard deviation of split frequencies: 0.020496
31000 -- [-1143.564] (-1149.194) (-1145.988) (-1143.849) * [-1138.038] (-1142.843) (-1139.312) (-1144.549) -- 0:03:07
32000 -- (-1145.030) (-1144.860) [-1146.049] (-1145.254) * (-1151.150) (-1140.420) [-1140.297] (-1147.359) -- 0:03:01
33000 -- (-1145.600) (-1146.051) [-1151.622] (-1145.533) * (-1148.134) (-1147.157) [-1144.198] (-1148.797) -- 0:03:25
34000 -- (-1149.387) [-1145.513] (-1145.143) (-1145.721) * [-1150.368] (-1148.728) (-1145.727) (-1142.627) -- 0:03:18
35000 -- (-1153.922) [-1141.790] (-1141.631) (-1147.949) * (-1143.900) (-1146.203) [-1137.003] (-1148.619) -- 0:03:13
Average standard deviation of split frequencies: 0.026189
36000 -- [-1146.959] (-1146.098) (-1141.565) (-1146.281) * (-1145.933) (-1144.700) [-1144.790] (-1141.179) -- 0:03:07
37000 -- (-1151.956) [-1138.611] (-1141.539) (-1150.659) * (-1141.673) (-1147.343) [-1144.764] (-1142.415) -- 0:03:02
38000 -- (-1154.685) [-1138.520] (-1146.681) (-1148.013) * (-1144.464) (-1143.642) (-1137.575) [-1143.053] -- 0:03:22
39000 -- (-1147.998) (-1137.868) [-1149.014] (-1143.536) * (-1144.961) (-1141.007) (-1138.516) [-1137.559] -- 0:03:17
40000 -- (-1144.789) (-1141.797) (-1147.562) [-1140.032] * (-1151.364) (-1141.036) [-1145.809] (-1146.921) -- 0:03:12
Average standard deviation of split frequencies: 0.025760
41000 -- (-1136.768) (-1142.530) [-1142.697] (-1140.251) * [-1141.678] (-1146.964) (-1143.301) (-1140.683) -- 0:03:07
42000 -- (-1144.439) (-1146.924) (-1149.599) [-1150.350] * [-1139.577] (-1156.891) (-1149.241) (-1146.132) -- 0:03:02
43000 -- (-1139.223) (-1148.571) [-1137.333] (-1139.707) * (-1145.599) (-1140.370) [-1142.855] (-1144.352) -- 0:03:20
44000 -- [-1141.290] (-1149.331) (-1146.942) (-1140.646) * (-1141.262) (-1143.634) [-1137.894] (-1145.929) -- 0:03:15
45000 -- (-1139.713) (-1149.298) (-1145.450) [-1140.911] * (-1145.366) (-1152.406) [-1138.435] (-1149.099) -- 0:03:11
Average standard deviation of split frequencies: 0.033021
46000 -- [-1140.811] (-1145.661) (-1147.848) (-1148.085) * [-1141.517] (-1146.378) (-1154.696) (-1150.194) -- 0:03:06
47000 -- (-1138.392) (-1146.058) (-1140.237) [-1139.588] * [-1145.159] (-1144.047) (-1148.372) (-1145.248) -- 0:03:22
48000 -- [-1142.912] (-1152.318) (-1140.102) (-1148.333) * (-1143.523) (-1150.434) (-1141.035) [-1139.160] -- 0:03:18
49000 -- [-1140.172] (-1147.550) (-1142.180) (-1143.869) * (-1143.342) (-1145.478) [-1143.867] (-1152.978) -- 0:03:14
50000 -- (-1136.506) [-1136.865] (-1148.217) (-1147.357) * (-1140.766) (-1146.812) [-1144.083] (-1148.744) -- 0:03:10
Average standard deviation of split frequencies: 0.025845
51000 -- (-1143.679) [-1139.350] (-1142.789) (-1145.122) * [-1140.615] (-1146.140) (-1148.219) (-1149.697) -- 0:03:06
52000 -- [-1144.169] (-1141.516) (-1148.865) (-1141.875) * (-1144.784) [-1143.937] (-1141.106) (-1147.546) -- 0:03:20
53000 -- (-1135.806) (-1142.434) [-1143.630] (-1144.349) * [-1144.430] (-1144.841) (-1146.007) (-1146.479) -- 0:03:16
54000 -- (-1145.845) [-1143.194] (-1140.819) (-1149.355) * (-1145.069) (-1150.685) [-1135.796] (-1139.567) -- 0:03:12
55000 -- [-1140.685] (-1140.659) (-1153.692) (-1143.039) * [-1144.952] (-1138.282) (-1138.646) (-1146.628) -- 0:03:09
Average standard deviation of split frequencies: 0.021513
56000 -- [-1141.143] (-1146.712) (-1153.434) (-1146.434) * (-1143.459) (-1142.772) [-1143.480] (-1152.912) -- 0:03:22
57000 -- (-1144.864) [-1138.925] (-1145.812) (-1146.008) * [-1144.934] (-1148.638) (-1145.688) (-1145.683) -- 0:03:18
58000 -- (-1141.945) (-1145.666) (-1146.616) [-1153.054] * (-1151.601) [-1142.826] (-1140.585) (-1145.411) -- 0:03:14
59000 -- [-1146.587] (-1146.257) (-1154.027) (-1152.675) * (-1143.988) [-1142.086] (-1146.636) (-1148.106) -- 0:03:11
60000 -- (-1152.807) (-1141.063) [-1139.169] (-1146.204) * (-1144.945) (-1144.539) (-1149.133) [-1139.894] -- 0:03:08
Average standard deviation of split frequencies: 0.009497
61000 -- [-1143.274] (-1140.671) (-1139.739) (-1148.007) * (-1151.766) (-1151.980) [-1137.654] (-1142.560) -- 0:03:20
62000 -- (-1143.063) (-1143.182) (-1149.958) [-1144.470] * [-1144.741] (-1140.844) (-1147.611) (-1141.159) -- 0:03:16
63000 -- (-1146.978) [-1138.449] (-1145.661) (-1142.789) * (-1143.965) (-1146.160) (-1140.611) [-1139.821] -- 0:03:13
64000 -- [-1141.744] (-1138.531) (-1144.246) (-1148.060) * [-1148.983] (-1145.337) (-1142.174) (-1144.697) -- 0:03:10
65000 -- (-1141.653) (-1141.349) (-1141.012) [-1144.026] * (-1144.106) (-1145.694) (-1143.152) [-1134.548] -- 0:03:07
Average standard deviation of split frequencies: 0.010317
66000 -- (-1140.141) [-1143.539] (-1142.937) (-1144.190) * (-1142.112) (-1147.871) [-1138.197] (-1144.156) -- 0:03:18
67000 -- [-1142.197] (-1146.475) (-1142.025) (-1141.188) * [-1143.861] (-1143.973) (-1142.532) (-1143.053) -- 0:03:14
68000 -- (-1158.816) (-1143.920) (-1144.951) [-1147.839] * (-1138.631) [-1145.351] (-1138.224) (-1144.361) -- 0:03:11
69000 -- [-1136.368] (-1148.343) (-1147.014) (-1147.068) * (-1144.115) [-1150.956] (-1140.906) (-1144.742) -- 0:03:08
70000 -- (-1151.806) [-1140.809] (-1156.067) (-1151.111) * (-1148.506) (-1151.219) [-1135.721] (-1138.261) -- 0:03:06
Average standard deviation of split frequencies: 0.014083
71000 -- (-1150.950) (-1154.179) [-1146.217] (-1145.955) * (-1142.080) (-1143.695) (-1143.504) [-1141.928] -- 0:03:16
72000 -- (-1143.080) (-1144.451) (-1140.029) [-1145.809] * (-1143.239) (-1143.686) (-1143.773) [-1140.999] -- 0:03:13
73000 -- (-1144.082) [-1143.696] (-1152.289) (-1137.566) * (-1138.217) (-1142.537) (-1139.939) [-1141.059] -- 0:03:10
74000 -- (-1148.480) (-1153.007) [-1140.383] (-1141.321) * (-1146.916) (-1141.710) [-1137.897] (-1144.831) -- 0:03:07
75000 -- (-1138.738) [-1142.291] (-1145.220) (-1148.738) * [-1142.986] (-1141.342) (-1141.929) (-1142.952) -- 0:03:05
Average standard deviation of split frequencies: 0.010338
76000 -- (-1152.885) [-1142.827] (-1143.037) (-1140.769) * (-1150.008) (-1142.181) [-1136.389] (-1145.851) -- 0:03:14
77000 -- (-1145.198) (-1144.406) [-1139.799] (-1149.879) * (-1146.676) (-1136.682) (-1139.854) [-1139.590] -- 0:03:11
78000 -- (-1141.972) (-1146.528) [-1144.790] (-1142.616) * (-1149.719) [-1137.972] (-1144.709) (-1140.273) -- 0:03:09
79000 -- [-1139.168] (-1142.290) (-1148.834) (-1143.317) * (-1148.972) (-1139.423) (-1144.605) [-1140.740] -- 0:03:06
80000 -- (-1145.571) (-1147.766) (-1150.237) [-1144.443] * (-1144.742) (-1153.175) (-1145.841) [-1146.395] -- 0:03:04
Average standard deviation of split frequencies: 0.016233
81000 -- [-1145.306] (-1149.267) (-1147.903) (-1143.638) * (-1147.346) (-1142.848) (-1144.276) [-1137.432] -- 0:03:12
82000 -- [-1148.471] (-1149.123) (-1146.125) (-1140.715) * (-1145.379) [-1146.460] (-1150.308) (-1144.384) -- 0:03:10
83000 -- (-1141.546) (-1157.200) (-1144.291) [-1141.900] * (-1149.216) (-1147.307) [-1139.231] (-1150.955) -- 0:03:07
84000 -- (-1142.038) [-1143.602] (-1144.437) (-1143.309) * (-1144.513) (-1151.324) [-1137.524] (-1143.943) -- 0:03:05
85000 -- (-1145.487) [-1142.182] (-1144.941) (-1143.658) * [-1138.589] (-1150.882) (-1138.270) (-1141.824) -- 0:03:03
Average standard deviation of split frequencies: 0.017662
86000 -- (-1143.935) (-1148.406) (-1155.358) [-1137.564] * (-1143.694) (-1136.033) (-1141.203) [-1140.796] -- 0:03:11
87000 -- [-1146.265] (-1147.628) (-1140.886) (-1141.187) * (-1145.882) (-1142.229) (-1141.527) [-1136.311] -- 0:03:08
88000 -- (-1143.452) (-1141.199) [-1145.668] (-1153.243) * (-1142.385) [-1138.339] (-1141.294) (-1145.225) -- 0:03:06
89000 -- (-1146.290) (-1150.627) [-1142.129] (-1142.477) * (-1149.382) (-1148.001) [-1141.621] (-1149.345) -- 0:03:04
90000 -- (-1141.163) [-1149.856] (-1146.751) (-1141.331) * [-1139.134] (-1142.222) (-1149.352) (-1145.614) -- 0:03:02
Average standard deviation of split frequencies: 0.020797
91000 -- (-1147.135) [-1143.991] (-1149.953) (-1142.947) * (-1152.829) [-1143.960] (-1144.670) (-1142.772) -- 0:03:09
92000 -- (-1146.187) (-1142.460) [-1149.905] (-1146.617) * [-1144.258] (-1145.413) (-1139.091) (-1145.343) -- 0:03:07
93000 -- (-1145.206) (-1146.813) [-1146.972] (-1144.808) * (-1147.278) (-1147.350) (-1140.577) [-1144.914] -- 0:03:05
94000 -- (-1145.455) [-1146.161] (-1146.506) (-1143.849) * (-1141.640) (-1149.370) (-1148.914) [-1144.998] -- 0:03:03
95000 -- (-1145.311) [-1147.249] (-1141.667) (-1143.193) * [-1140.253] (-1143.454) (-1144.703) (-1148.341) -- 0:03:01
Average standard deviation of split frequencies: 0.015277
96000 -- (-1143.579) (-1147.616) [-1144.304] (-1143.216) * [-1142.999] (-1147.511) (-1149.767) (-1140.302) -- 0:03:08
97000 -- (-1142.927) (-1154.465) [-1142.864] (-1137.909) * [-1143.261] (-1136.840) (-1140.399) (-1146.572) -- 0:03:06
98000 -- [-1140.374] (-1144.515) (-1142.480) (-1142.272) * (-1141.106) (-1138.296) [-1148.044] (-1145.702) -- 0:03:04
99000 -- (-1142.862) (-1141.394) [-1138.945] (-1139.614) * (-1151.912) (-1139.629) [-1140.915] (-1144.011) -- 0:03:02
100000 -- (-1152.744) (-1146.595) [-1142.863] (-1139.044) * (-1159.258) (-1138.388) (-1147.336) [-1149.450] -- 0:03:00
Average standard deviation of split frequencies: 0.012488
101000 -- (-1152.672) (-1144.606) [-1140.460] (-1143.264) * (-1149.790) (-1142.419) (-1143.692) [-1140.260] -- 0:03:06
102000 -- (-1144.358) (-1144.800) [-1142.079] (-1145.388) * (-1148.739) [-1142.805] (-1148.033) (-1144.713) -- 0:03:04
103000 -- (-1139.767) [-1142.313] (-1154.742) (-1144.155) * (-1143.939) (-1143.592) (-1146.456) [-1144.543] -- 0:03:02
104000 -- [-1143.393] (-1139.379) (-1144.041) (-1142.252) * (-1145.176) (-1153.038) (-1143.720) [-1141.401] -- 0:03:00
105000 -- (-1141.702) (-1146.902) (-1143.936) [-1141.844] * (-1147.993) (-1148.982) [-1139.399] (-1142.430) -- 0:02:59
Average standard deviation of split frequencies: 0.016306
106000 -- (-1147.251) (-1141.903) [-1145.087] (-1140.532) * (-1154.365) [-1143.572] (-1144.378) (-1141.117) -- 0:03:05
107000 -- (-1143.629) (-1143.001) (-1148.345) [-1138.830] * [-1148.513] (-1141.230) (-1150.353) (-1145.097) -- 0:03:03
108000 -- (-1143.253) (-1138.644) [-1149.341] (-1138.187) * (-1148.518) (-1138.953) [-1140.647] (-1145.155) -- 0:03:01
109000 -- (-1148.577) [-1137.539] (-1150.640) (-1141.323) * (-1142.245) (-1151.130) (-1137.645) [-1145.682] -- 0:02:59
110000 -- (-1142.854) (-1147.941) (-1142.844) [-1143.470] * (-1142.999) (-1147.296) (-1141.712) [-1140.261] -- 0:02:58
Average standard deviation of split frequencies: 0.017039
111000 -- (-1146.718) (-1137.913) (-1143.586) [-1142.459] * (-1153.337) (-1143.110) [-1137.688] (-1145.802) -- 0:03:04
112000 -- (-1147.855) (-1144.038) [-1139.824] (-1144.170) * (-1151.206) [-1144.841] (-1143.853) (-1143.750) -- 0:03:02
113000 -- (-1145.121) [-1142.435] (-1146.069) (-1150.804) * (-1154.078) (-1142.945) (-1147.611) [-1140.888] -- 0:03:00
114000 -- (-1150.436) [-1143.268] (-1140.561) (-1143.067) * (-1145.958) (-1145.194) (-1138.259) [-1144.246] -- 0:02:58
115000 -- (-1144.429) (-1148.734) (-1139.471) [-1145.005] * (-1148.077) (-1148.820) (-1141.831) [-1146.842] -- 0:02:57
Average standard deviation of split frequencies: 0.018965
116000 -- [-1143.794] (-1152.442) (-1142.225) (-1147.640) * [-1142.607] (-1147.686) (-1143.007) (-1148.657) -- 0:03:02
117000 -- (-1147.897) (-1143.549) [-1141.306] (-1142.024) * (-1146.898) (-1153.880) (-1139.805) [-1145.026] -- 0:03:01
118000 -- [-1141.192] (-1147.159) (-1140.779) (-1141.929) * (-1153.002) (-1148.765) [-1143.442] (-1144.779) -- 0:02:59
119000 -- (-1143.164) (-1141.047) (-1139.283) [-1145.293] * [-1150.866] (-1155.759) (-1139.228) (-1147.350) -- 0:02:57
120000 -- (-1141.851) (-1142.361) [-1140.165] (-1144.782) * (-1142.447) [-1148.634] (-1138.640) (-1149.331) -- 0:02:56
Average standard deviation of split frequencies: 0.018231
121000 -- (-1145.583) [-1137.017] (-1140.226) (-1150.418) * (-1152.267) (-1148.203) (-1138.908) [-1137.124] -- 0:03:01
122000 -- (-1142.065) (-1142.480) [-1146.457] (-1150.504) * (-1146.515) (-1152.402) [-1139.898] (-1144.235) -- 0:02:59
123000 -- (-1143.281) (-1151.143) [-1143.092] (-1144.528) * (-1148.979) (-1147.549) (-1144.471) [-1137.217] -- 0:02:58
124000 -- (-1145.785) (-1143.652) (-1139.237) [-1143.623] * (-1153.882) (-1153.551) [-1140.772] (-1151.337) -- 0:02:56
125000 -- [-1142.421] (-1143.451) (-1148.301) (-1151.213) * (-1147.342) (-1150.942) [-1140.649] (-1148.384) -- 0:02:55
Average standard deviation of split frequencies: 0.017459
126000 -- (-1158.301) (-1146.640) [-1142.441] (-1147.043) * (-1147.657) [-1148.537] (-1140.927) (-1137.361) -- 0:02:53
127000 -- (-1147.425) (-1144.913) (-1141.575) [-1138.280] * (-1146.012) (-1140.364) [-1136.443] (-1143.276) -- 0:02:58
128000 -- [-1139.938] (-1139.467) (-1147.438) (-1142.893) * [-1144.212] (-1141.944) (-1137.839) (-1148.312) -- 0:02:57
129000 -- (-1141.835) (-1148.831) (-1140.999) [-1147.677] * (-1155.354) (-1144.720) (-1141.006) [-1145.309] -- 0:02:55
130000 -- (-1146.516) [-1142.636] (-1147.552) (-1148.956) * (-1141.042) (-1147.124) (-1136.609) [-1141.283] -- 0:02:54
Average standard deviation of split frequencies: 0.016836
131000 -- [-1138.616] (-1143.306) (-1143.472) (-1147.769) * (-1138.970) (-1142.984) [-1139.948] (-1142.593) -- 0:02:59
132000 -- (-1140.153) [-1141.503] (-1146.241) (-1148.816) * (-1142.653) (-1154.952) (-1148.039) [-1143.797] -- 0:02:57
133000 -- (-1138.631) [-1138.682] (-1144.719) (-1142.316) * (-1142.973) (-1150.210) [-1139.964] (-1140.864) -- 0:02:56
134000 -- (-1144.960) (-1142.304) [-1141.525] (-1140.968) * (-1145.609) [-1144.017] (-1141.765) (-1143.563) -- 0:02:54
135000 -- (-1141.358) (-1139.310) [-1143.629] (-1145.077) * (-1152.220) (-1149.399) (-1142.055) [-1140.385] -- 0:02:53
Average standard deviation of split frequencies: 0.016176
136000 -- (-1141.250) (-1140.271) [-1146.519] (-1146.832) * (-1143.474) [-1138.947] (-1141.299) (-1148.620) -- 0:02:57
137000 -- [-1139.432] (-1150.895) (-1145.191) (-1143.779) * (-1144.126) (-1143.744) (-1143.755) [-1141.555] -- 0:02:56
138000 -- [-1146.762] (-1142.976) (-1139.726) (-1139.374) * [-1146.192] (-1137.261) (-1138.824) (-1138.792) -- 0:02:54
139000 -- (-1144.268) [-1143.470] (-1150.015) (-1141.573) * (-1155.395) [-1137.618] (-1141.207) (-1146.627) -- 0:02:53
140000 -- (-1145.023) (-1147.884) [-1146.264] (-1147.608) * (-1144.295) (-1152.828) (-1146.677) [-1139.694] -- 0:02:52
Average standard deviation of split frequencies: 0.009681
141000 -- (-1146.098) (-1152.280) (-1142.963) [-1139.380] * (-1144.449) [-1143.809] (-1146.878) (-1144.047) -- 0:02:56
142000 -- [-1141.532] (-1144.612) (-1141.952) (-1142.059) * (-1146.134) (-1146.584) (-1144.370) [-1139.566] -- 0:02:55
143000 -- (-1145.360) (-1143.575) [-1139.825] (-1142.420) * (-1146.465) (-1140.104) [-1141.604] (-1141.922) -- 0:02:53
144000 -- (-1147.181) [-1144.949] (-1147.444) (-1141.871) * (-1147.747) (-1144.739) [-1137.031] (-1140.703) -- 0:02:52
145000 -- (-1150.942) (-1144.789) (-1142.895) [-1145.425] * (-1150.701) (-1144.414) [-1137.872] (-1153.928) -- 0:02:51
Average standard deviation of split frequencies: 0.010404
146000 -- (-1148.068) (-1145.609) (-1147.783) [-1139.144] * (-1148.413) (-1147.998) [-1142.037] (-1141.199) -- 0:02:55
147000 -- (-1145.707) (-1149.179) [-1140.938] (-1147.252) * (-1144.424) [-1142.870] (-1145.839) (-1143.148) -- 0:02:54
148000 -- (-1142.617) (-1149.361) [-1144.916] (-1138.021) * [-1146.690] (-1152.385) (-1142.101) (-1144.403) -- 0:02:52
149000 -- (-1142.193) (-1145.202) [-1138.879] (-1143.377) * (-1149.187) [-1140.391] (-1139.895) (-1143.075) -- 0:02:51
150000 -- [-1150.857] (-1141.505) (-1141.466) (-1145.198) * [-1144.761] (-1142.022) (-1142.067) (-1138.858) -- 0:02:50
Average standard deviation of split frequencies: 0.008691
151000 -- (-1149.546) [-1140.560] (-1143.428) (-1146.515) * (-1149.282) [-1142.905] (-1148.415) (-1145.784) -- 0:02:54
152000 -- [-1140.730] (-1136.872) (-1140.457) (-1146.706) * (-1143.119) (-1141.390) [-1144.226] (-1137.047) -- 0:02:52
153000 -- (-1140.482) [-1140.750] (-1141.942) (-1147.368) * (-1148.457) (-1147.310) [-1142.906] (-1142.884) -- 0:02:51
154000 -- [-1137.959] (-1139.943) (-1143.520) (-1155.881) * (-1149.085) (-1144.329) (-1141.799) [-1140.011] -- 0:02:50
155000 -- (-1147.845) (-1145.539) (-1145.434) [-1145.099] * [-1149.755] (-1144.983) (-1140.806) (-1141.190) -- 0:02:49
Average standard deviation of split frequencies: 0.009065
156000 -- (-1146.427) [-1143.803] (-1138.663) (-1145.365) * (-1139.470) (-1148.630) [-1145.576] (-1142.300) -- 0:02:53
157000 -- (-1140.193) [-1147.355] (-1148.784) (-1144.039) * (-1146.812) [-1140.834] (-1148.662) (-1138.380) -- 0:02:51
158000 -- (-1136.685) (-1148.414) [-1139.181] (-1142.574) * [-1144.050] (-1141.990) (-1146.180) (-1138.946) -- 0:02:50
159000 -- (-1145.135) (-1149.239) (-1142.531) [-1140.036] * [-1141.460] (-1140.939) (-1152.428) (-1145.118) -- 0:02:49
160000 -- (-1143.409) (-1144.163) [-1146.031] (-1146.242) * (-1157.916) [-1144.890] (-1141.182) (-1142.367) -- 0:02:48
Average standard deviation of split frequencies: 0.008476
161000 -- (-1140.211) (-1154.811) [-1144.132] (-1151.838) * (-1147.250) [-1141.978] (-1143.034) (-1146.931) -- 0:02:51
162000 -- (-1142.684) [-1146.186] (-1140.807) (-1147.909) * (-1145.546) [-1138.943] (-1144.140) (-1143.861) -- 0:02:50
163000 -- (-1147.498) (-1143.887) [-1140.787] (-1146.252) * (-1147.223) (-1146.518) (-1145.621) [-1137.538] -- 0:02:49
164000 -- [-1143.772] (-1146.649) (-1142.551) (-1140.411) * (-1147.471) (-1145.253) (-1140.786) [-1138.067] -- 0:02:48
165000 -- [-1150.130] (-1145.932) (-1142.901) (-1140.252) * [-1149.673] (-1138.275) (-1140.760) (-1147.866) -- 0:02:47
Average standard deviation of split frequencies: 0.010097
166000 -- (-1150.155) [-1150.752] (-1140.382) (-1145.468) * (-1138.953) [-1142.586] (-1142.798) (-1142.613) -- 0:02:50
167000 -- (-1149.672) (-1140.623) (-1143.452) [-1136.151] * [-1143.649] (-1142.457) (-1141.081) (-1138.998) -- 0:02:49
168000 -- (-1161.139) (-1146.512) (-1144.306) [-1144.856] * (-1157.825) (-1148.150) [-1143.737] (-1144.720) -- 0:02:48
169000 -- (-1147.403) (-1153.484) (-1147.327) [-1143.956] * (-1162.859) (-1136.789) [-1139.931] (-1141.961) -- 0:02:47
170000 -- (-1151.899) (-1141.529) (-1151.769) [-1145.356] * [-1149.017] (-1142.924) (-1139.055) (-1144.604) -- 0:02:46
Average standard deviation of split frequencies: 0.007980
171000 -- (-1144.737) (-1140.567) (-1154.068) [-1138.103] * (-1156.355) (-1138.667) (-1137.248) [-1136.950] -- 0:02:49
172000 -- (-1146.751) [-1142.497] (-1149.237) (-1150.008) * [-1144.171] (-1140.107) (-1142.898) (-1147.547) -- 0:02:48
173000 -- (-1144.317) [-1135.575] (-1142.195) (-1145.086) * (-1148.120) (-1145.005) (-1143.381) [-1139.763] -- 0:02:47
174000 -- (-1143.910) [-1138.171] (-1145.392) (-1145.098) * [-1139.098] (-1144.879) (-1143.711) (-1140.648) -- 0:02:46
175000 -- (-1145.872) (-1150.648) (-1151.215) [-1148.535] * (-1147.507) (-1147.207) [-1140.515] (-1142.634) -- 0:02:45
Average standard deviation of split frequencies: 0.004762
176000 -- (-1142.609) (-1148.360) [-1142.037] (-1149.553) * [-1144.518] (-1144.594) (-1148.730) (-1143.410) -- 0:02:48
177000 -- (-1147.055) (-1148.920) (-1148.317) [-1142.487] * [-1140.140] (-1142.294) (-1140.616) (-1145.230) -- 0:02:47
178000 -- (-1144.771) (-1155.837) [-1143.029] (-1145.082) * (-1150.736) (-1144.041) (-1148.642) [-1143.088] -- 0:02:46
179000 -- (-1143.846) [-1149.885] (-1146.673) (-1143.077) * (-1142.957) (-1145.221) [-1144.101] (-1140.659) -- 0:02:45
180000 -- (-1147.816) [-1141.260] (-1144.779) (-1149.977) * (-1145.443) [-1143.561] (-1145.392) (-1142.369) -- 0:02:44
Average standard deviation of split frequencies: 0.008408
181000 -- (-1144.246) (-1150.669) [-1140.084] (-1151.253) * (-1142.985) [-1146.602] (-1140.380) (-1145.913) -- 0:02:47
182000 -- [-1149.346] (-1147.130) (-1140.378) (-1144.787) * [-1144.635] (-1147.033) (-1143.986) (-1146.032) -- 0:02:46
183000 -- (-1142.064) (-1146.090) (-1153.223) [-1142.690] * (-1138.533) (-1137.384) [-1139.266] (-1147.497) -- 0:02:45
184000 -- [-1143.231] (-1138.981) (-1141.788) (-1143.086) * (-1144.489) [-1146.367] (-1144.062) (-1147.145) -- 0:02:44
185000 -- (-1142.034) (-1145.241) [-1147.712] (-1146.443) * (-1147.945) (-1141.763) [-1152.044] (-1148.322) -- 0:02:43
Average standard deviation of split frequencies: 0.009293
186000 -- (-1150.357) (-1140.967) (-1148.178) [-1143.917] * (-1146.119) [-1137.156] (-1148.757) (-1150.747) -- 0:02:46
187000 -- (-1143.710) (-1147.541) (-1150.151) [-1137.585] * [-1145.372] (-1140.627) (-1150.337) (-1144.512) -- 0:02:45
188000 -- (-1143.176) (-1146.036) [-1145.664] (-1140.148) * (-1150.666) (-1142.497) (-1155.084) [-1141.218] -- 0:02:44
189000 -- (-1143.282) (-1142.554) [-1136.945] (-1140.795) * (-1144.709) (-1140.814) (-1151.087) [-1144.262] -- 0:02:43
190000 -- (-1153.314) (-1138.881) (-1140.709) [-1143.574] * (-1146.646) [-1138.655] (-1148.575) (-1142.849) -- 0:02:42
Average standard deviation of split frequencies: 0.012911
191000 -- (-1141.972) (-1145.698) (-1143.854) [-1137.992] * (-1145.904) [-1137.057] (-1150.627) (-1149.182) -- 0:02:45
192000 -- [-1142.537] (-1152.374) (-1146.295) (-1141.305) * [-1147.266] (-1140.882) (-1159.119) (-1145.019) -- 0:02:44
193000 -- (-1141.742) [-1148.487] (-1142.061) (-1138.706) * [-1149.432] (-1143.860) (-1148.524) (-1143.507) -- 0:02:43
194000 -- (-1141.370) (-1147.320) (-1141.448) [-1142.524] * [-1145.775] (-1141.073) (-1147.581) (-1139.743) -- 0:02:42
195000 -- (-1141.140) (-1153.824) [-1145.621] (-1146.021) * [-1143.934] (-1144.123) (-1157.780) (-1146.589) -- 0:02:41
Average standard deviation of split frequencies: 0.010422
196000 -- [-1136.848] (-1141.543) (-1139.996) (-1144.873) * [-1146.422] (-1141.705) (-1144.536) (-1147.529) -- 0:02:44
197000 -- (-1148.016) (-1140.050) (-1149.384) [-1141.944] * (-1145.471) [-1137.405] (-1142.855) (-1147.796) -- 0:02:43
198000 -- (-1148.376) (-1151.048) [-1139.752] (-1142.082) * (-1144.223) [-1138.186] (-1139.326) (-1144.405) -- 0:02:42
199000 -- [-1143.085] (-1145.013) (-1142.610) (-1147.837) * (-1147.561) (-1143.201) (-1142.708) [-1143.806] -- 0:02:41
200000 -- [-1147.651] (-1144.790) (-1144.111) (-1145.055) * (-1146.665) (-1144.591) [-1141.842] (-1146.382) -- 0:02:40
Average standard deviation of split frequencies: 0.012268
201000 -- [-1137.998] (-1141.912) (-1145.248) (-1150.135) * [-1147.639] (-1147.134) (-1144.602) (-1145.271) -- 0:02:42
202000 -- (-1141.489) (-1141.304) [-1136.558] (-1142.837) * [-1143.682] (-1143.870) (-1148.426) (-1141.947) -- 0:02:41
203000 -- (-1137.803) (-1147.502) (-1149.251) [-1135.615] * [-1140.892] (-1146.236) (-1143.165) (-1145.429) -- 0:02:40
204000 -- (-1145.644) (-1145.366) (-1145.306) [-1142.840] * (-1145.938) (-1157.025) [-1142.143] (-1154.375) -- 0:02:39
205000 -- (-1141.409) [-1145.095] (-1140.791) (-1146.404) * (-1139.855) (-1138.849) (-1145.356) [-1148.174] -- 0:02:39
Average standard deviation of split frequencies: 0.013984
206000 -- (-1141.593) [-1138.076] (-1147.919) (-1139.159) * (-1160.342) (-1140.713) [-1144.636] (-1151.606) -- 0:02:41
207000 -- (-1143.034) [-1141.840] (-1145.164) (-1149.652) * (-1144.846) (-1149.937) [-1144.139] (-1154.097) -- 0:02:40
208000 -- (-1146.854) (-1148.915) [-1137.828] (-1153.204) * [-1141.123] (-1146.009) (-1147.316) (-1153.866) -- 0:02:39
209000 -- (-1142.476) (-1145.791) (-1150.538) [-1142.382] * (-1142.542) (-1147.281) (-1145.823) [-1142.060] -- 0:02:38
210000 -- [-1138.990] (-1140.125) (-1147.617) (-1140.222) * (-1147.145) (-1143.556) [-1144.405] (-1151.201) -- 0:02:38
Average standard deviation of split frequencies: 0.013177
211000 -- (-1140.329) [-1141.144] (-1146.331) (-1140.747) * [-1143.147] (-1145.173) (-1144.337) (-1142.418) -- 0:02:40
212000 -- (-1145.207) [-1136.947] (-1151.398) (-1147.134) * (-1143.423) (-1149.231) (-1143.631) [-1140.594] -- 0:02:39
213000 -- (-1150.564) (-1138.209) [-1145.728] (-1150.479) * [-1137.440] (-1141.676) (-1142.285) (-1140.521) -- 0:02:38
214000 -- (-1144.032) (-1147.917) (-1141.473) [-1147.035] * (-1145.076) (-1145.444) (-1145.538) [-1138.506] -- 0:02:37
215000 -- (-1147.330) (-1142.323) (-1140.028) [-1146.900] * (-1146.555) (-1147.016) [-1137.077] (-1142.927) -- 0:02:37
Average standard deviation of split frequencies: 0.013580
216000 -- (-1143.605) (-1149.746) [-1145.667] (-1149.976) * (-1146.639) (-1140.575) [-1142.013] (-1139.617) -- 0:02:39
217000 -- (-1139.878) [-1147.828] (-1144.645) (-1146.678) * (-1142.620) (-1150.050) (-1140.269) [-1139.855] -- 0:02:38
218000 -- (-1146.983) (-1148.450) (-1142.779) [-1146.492] * (-1140.684) [-1140.527] (-1146.382) (-1143.069) -- 0:02:37
219000 -- (-1146.114) [-1144.075] (-1149.204) (-1145.020) * (-1142.492) (-1146.552) (-1148.474) [-1141.874] -- 0:02:36
220000 -- (-1140.390) (-1143.643) (-1148.046) [-1141.558] * [-1145.397] (-1140.590) (-1145.240) (-1142.888) -- 0:02:36
Average standard deviation of split frequencies: 0.014004
221000 -- [-1139.593] (-1144.176) (-1154.846) (-1142.886) * [-1137.297] (-1142.134) (-1145.558) (-1149.300) -- 0:02:38
222000 -- [-1141.639] (-1144.628) (-1148.736) (-1140.916) * (-1142.257) (-1142.999) [-1146.854] (-1150.336) -- 0:02:37
223000 -- [-1140.806] (-1144.841) (-1147.355) (-1149.196) * (-1141.183) [-1150.934] (-1157.795) (-1149.247) -- 0:02:36
224000 -- (-1145.060) (-1145.589) (-1149.595) [-1142.509] * (-1147.343) (-1141.815) [-1145.443] (-1147.642) -- 0:02:35
225000 -- [-1149.254] (-1139.638) (-1140.655) (-1140.539) * (-1152.696) [-1142.051] (-1149.093) (-1140.720) -- 0:02:38
Average standard deviation of split frequencies: 0.012283
226000 -- (-1145.419) (-1148.601) [-1142.900] (-1143.747) * [-1139.105] (-1143.385) (-1144.769) (-1139.595) -- 0:02:37
227000 -- (-1139.672) [-1141.279] (-1148.399) (-1141.972) * [-1142.502] (-1145.339) (-1144.399) (-1141.150) -- 0:02:36
228000 -- (-1141.426) (-1149.482) [-1138.563] (-1141.918) * (-1139.037) (-1145.109) [-1144.668] (-1150.081) -- 0:02:35
229000 -- [-1143.973] (-1144.346) (-1148.148) (-1144.843) * (-1144.196) [-1138.556] (-1146.588) (-1143.274) -- 0:02:34
230000 -- (-1148.102) (-1147.055) (-1145.470) [-1145.934] * (-1149.666) (-1148.408) (-1141.747) [-1140.071] -- 0:02:37
Average standard deviation of split frequencies: 0.010218
231000 -- [-1138.188] (-1149.399) (-1145.454) (-1144.174) * (-1143.747) [-1147.622] (-1153.399) (-1144.944) -- 0:02:36
232000 -- (-1149.138) (-1140.206) [-1147.940] (-1145.422) * (-1142.388) (-1143.113) (-1142.913) [-1144.346] -- 0:02:35
233000 -- (-1140.475) (-1142.294) (-1144.651) [-1137.097] * (-1144.003) (-1145.906) (-1148.375) [-1137.226] -- 0:02:34
234000 -- [-1142.111] (-1140.632) (-1150.691) (-1140.202) * [-1143.714] (-1144.429) (-1146.241) (-1146.130) -- 0:02:33
235000 -- (-1146.947) (-1143.567) (-1138.628) [-1139.778] * (-1147.829) [-1149.317] (-1146.326) (-1144.097) -- 0:02:36
Average standard deviation of split frequencies: 0.009987
236000 -- (-1141.486) (-1139.316) [-1145.242] (-1144.362) * (-1148.036) (-1139.913) [-1145.969] (-1145.040) -- 0:02:35
237000 -- (-1159.014) [-1147.133] (-1150.814) (-1141.440) * (-1148.861) [-1141.514] (-1143.060) (-1147.641) -- 0:02:34
238000 -- (-1140.660) [-1141.114] (-1150.520) (-1145.793) * (-1154.745) [-1139.760] (-1143.629) (-1146.608) -- 0:02:33
239000 -- (-1144.716) (-1144.214) (-1142.951) [-1139.614] * (-1139.487) [-1140.130] (-1147.518) (-1146.362) -- 0:02:32
240000 -- (-1146.900) (-1145.049) (-1149.702) [-1148.757] * (-1139.158) [-1142.035] (-1149.177) (-1145.505) -- 0:02:35
Average standard deviation of split frequencies: 0.009358
241000 -- (-1142.115) (-1142.537) [-1138.324] (-1150.493) * (-1141.499) [-1144.029] (-1146.349) (-1144.900) -- 0:02:34
242000 -- (-1144.202) [-1139.708] (-1143.162) (-1149.937) * (-1144.134) (-1149.913) [-1144.091] (-1140.516) -- 0:02:33
243000 -- (-1145.501) (-1151.548) [-1140.503] (-1145.907) * [-1142.293] (-1147.622) (-1142.638) (-1147.663) -- 0:02:32
244000 -- (-1141.970) [-1142.628] (-1140.925) (-1141.981) * (-1145.721) (-1143.260) [-1138.424] (-1140.932) -- 0:02:31
245000 -- (-1146.509) (-1150.420) (-1135.337) [-1142.162] * (-1149.821) [-1143.488] (-1142.850) (-1143.202) -- 0:02:34
Average standard deviation of split frequencies: 0.009368
246000 -- [-1144.042] (-1143.077) (-1144.020) (-1151.950) * (-1142.796) (-1141.898) (-1152.949) [-1144.691] -- 0:02:33
247000 -- (-1140.955) [-1142.864] (-1141.342) (-1148.493) * (-1143.516) [-1143.322] (-1139.412) (-1148.569) -- 0:02:32
248000 -- (-1143.263) (-1142.441) (-1154.527) [-1144.572] * (-1153.891) (-1143.771) [-1147.356] (-1140.957) -- 0:02:31
249000 -- (-1148.920) [-1142.889] (-1136.486) (-1144.628) * (-1152.853) (-1146.794) (-1140.239) [-1146.144] -- 0:02:30
250000 -- (-1143.598) (-1142.149) [-1144.883] (-1146.310) * (-1143.799) [-1142.465] (-1146.469) (-1155.172) -- 0:02:33
Average standard deviation of split frequencies: 0.011702
251000 -- (-1140.980) [-1137.599] (-1144.836) (-1148.817) * [-1146.781] (-1147.336) (-1142.859) (-1149.185) -- 0:02:32
252000 -- [-1135.266] (-1151.383) (-1143.767) (-1152.396) * (-1143.837) (-1146.776) (-1140.212) [-1150.009] -- 0:02:31
253000 -- (-1142.222) [-1143.155] (-1137.765) (-1142.370) * (-1141.348) [-1140.232] (-1148.974) (-1143.898) -- 0:02:30
254000 -- [-1141.651] (-1146.017) (-1154.283) (-1148.539) * [-1146.642] (-1148.621) (-1145.984) (-1148.596) -- 0:02:29
255000 -- (-1148.024) [-1142.753] (-1144.829) (-1144.288) * [-1147.318] (-1147.679) (-1142.790) (-1146.419) -- 0:02:31
Average standard deviation of split frequencies: 0.010639
256000 -- [-1145.136] (-1144.997) (-1147.527) (-1146.999) * (-1153.653) (-1150.383) [-1141.845] (-1145.479) -- 0:02:31
257000 -- [-1142.712] (-1137.415) (-1153.045) (-1150.072) * (-1146.814) (-1144.634) (-1141.295) [-1145.018] -- 0:02:30
258000 -- (-1148.379) [-1144.911] (-1145.171) (-1144.940) * [-1146.939] (-1142.943) (-1145.642) (-1138.196) -- 0:02:29
259000 -- (-1141.077) (-1146.335) (-1149.451) [-1145.272] * (-1146.364) (-1141.747) (-1144.233) [-1139.796] -- 0:02:28
260000 -- (-1140.320) (-1149.012) [-1148.554] (-1147.382) * (-1153.282) [-1139.281] (-1156.450) (-1140.228) -- 0:02:30
Average standard deviation of split frequencies: 0.009042
261000 -- (-1138.227) [-1136.273] (-1140.655) (-1143.054) * (-1140.086) (-1138.621) (-1144.143) [-1142.423] -- 0:02:30
262000 -- (-1139.692) (-1150.277) [-1142.524] (-1149.206) * (-1149.441) (-1143.717) [-1139.291] (-1143.907) -- 0:02:29
263000 -- (-1141.625) (-1147.645) (-1140.750) [-1145.389] * (-1146.896) (-1146.570) [-1140.730] (-1140.628) -- 0:02:28
264000 -- (-1141.880) (-1145.133) (-1142.837) [-1139.483] * [-1140.864] (-1148.701) (-1143.688) (-1141.246) -- 0:02:27
265000 -- (-1143.932) (-1145.658) (-1140.623) [-1148.728] * (-1142.819) (-1141.088) (-1143.768) [-1142.701] -- 0:02:29
Average standard deviation of split frequencies: 0.011027
266000 -- (-1142.543) (-1138.513) [-1136.916] (-1147.835) * (-1145.789) [-1141.138] (-1151.288) (-1140.190) -- 0:02:29
267000 -- (-1138.590) [-1140.399] (-1144.310) (-1145.254) * (-1148.911) (-1140.623) [-1142.836] (-1146.820) -- 0:02:28
268000 -- [-1138.368] (-1148.410) (-1149.206) (-1146.646) * (-1144.965) [-1136.639] (-1141.264) (-1141.647) -- 0:02:27
269000 -- (-1141.979) (-1147.100) [-1144.852] (-1146.606) * (-1144.031) (-1146.988) (-1146.469) [-1144.729] -- 0:02:26
270000 -- [-1143.294] (-1152.276) (-1141.352) (-1145.611) * (-1145.397) [-1138.527] (-1140.457) (-1147.739) -- 0:02:28
Average standard deviation of split frequencies: 0.012772
271000 -- (-1154.825) (-1139.820) (-1144.153) [-1144.035] * (-1143.883) (-1143.836) [-1139.295] (-1142.307) -- 0:02:27
272000 -- (-1142.973) (-1147.433) [-1143.698] (-1140.293) * (-1142.348) (-1148.212) (-1140.637) [-1139.887] -- 0:02:27
273000 -- (-1145.588) (-1143.673) [-1152.800] (-1144.743) * (-1146.970) (-1149.475) [-1144.531] (-1146.523) -- 0:02:26
274000 -- (-1144.661) (-1145.741) (-1149.009) [-1143.203] * (-1149.729) [-1142.675] (-1145.672) (-1144.277) -- 0:02:25
275000 -- (-1140.997) [-1137.191] (-1154.511) (-1138.979) * (-1141.099) (-1143.497) (-1154.047) [-1140.225] -- 0:02:25
Average standard deviation of split frequencies: 0.011956
276000 -- (-1141.175) [-1141.073] (-1152.588) (-1150.429) * (-1151.776) (-1145.198) (-1146.396) [-1140.371] -- 0:02:26
277000 -- [-1142.446] (-1146.506) (-1142.090) (-1148.121) * [-1137.540] (-1141.474) (-1144.941) (-1143.686) -- 0:02:26
278000 -- (-1139.974) (-1143.083) (-1146.753) [-1142.731] * (-1146.842) (-1143.796) [-1142.373] (-1142.838) -- 0:02:25
279000 -- (-1138.844) (-1146.493) [-1143.948] (-1141.212) * (-1146.863) (-1146.158) [-1144.694] (-1143.816) -- 0:02:24
280000 -- (-1138.090) (-1145.096) (-1143.831) [-1144.982] * (-1142.643) (-1142.753) [-1140.564] (-1138.443) -- 0:02:24
Average standard deviation of split frequencies: 0.011757
281000 -- (-1148.743) (-1142.148) (-1140.861) [-1145.717] * (-1145.123) (-1140.289) [-1141.080] (-1140.549) -- 0:02:25
282000 -- (-1137.947) (-1144.996) [-1141.456] (-1140.540) * (-1143.216) (-1142.757) [-1144.771] (-1145.996) -- 0:02:25
283000 -- (-1142.321) (-1151.358) (-1145.858) [-1144.677] * (-1147.259) (-1141.926) [-1151.579] (-1145.763) -- 0:02:24
284000 -- [-1144.806] (-1151.827) (-1144.677) (-1139.944) * (-1141.371) [-1142.432] (-1159.110) (-1147.398) -- 0:02:23
285000 -- (-1150.438) (-1147.446) (-1147.325) [-1145.000] * (-1143.634) [-1140.504] (-1145.423) (-1144.913) -- 0:02:23
Average standard deviation of split frequencies: 0.011904
286000 -- (-1144.655) [-1145.561] (-1145.250) (-1151.905) * (-1140.490) (-1143.504) (-1144.899) [-1145.222] -- 0:02:24
287000 -- [-1140.616] (-1146.851) (-1149.831) (-1145.071) * (-1146.932) [-1139.307] (-1142.946) (-1147.020) -- 0:02:24
288000 -- [-1137.733] (-1152.141) (-1145.428) (-1144.593) * (-1143.346) (-1147.642) (-1144.722) [-1142.793] -- 0:02:23
289000 -- (-1146.059) (-1145.542) [-1142.796] (-1143.871) * (-1144.914) (-1144.070) (-1148.718) [-1141.149] -- 0:02:22
290000 -- [-1141.107] (-1143.104) (-1147.717) (-1148.057) * (-1144.658) (-1146.178) [-1139.186] (-1148.991) -- 0:02:22
Average standard deviation of split frequencies: 0.013875
291000 -- (-1146.362) (-1144.157) [-1145.539] (-1147.587) * (-1144.781) (-1146.961) (-1141.638) [-1140.556] -- 0:02:23
292000 -- [-1144.161] (-1146.473) (-1139.752) (-1153.293) * (-1145.416) (-1143.457) [-1137.119] (-1149.794) -- 0:02:23
293000 -- (-1146.030) [-1140.588] (-1145.980) (-1143.029) * (-1143.211) [-1146.193] (-1147.783) (-1148.968) -- 0:02:22
294000 -- (-1140.588) [-1144.031] (-1143.584) (-1148.111) * (-1147.097) (-1150.949) [-1146.311] (-1148.722) -- 0:02:21
295000 -- [-1146.729] (-1144.812) (-1144.162) (-1147.906) * (-1144.425) [-1137.579] (-1150.135) (-1143.591) -- 0:02:21
Average standard deviation of split frequencies: 0.011679
296000 -- [-1141.166] (-1140.850) (-1140.054) (-1145.647) * (-1148.991) (-1139.405) [-1141.985] (-1142.765) -- 0:02:22
297000 -- [-1144.728] (-1140.842) (-1147.138) (-1151.745) * [-1145.953] (-1147.220) (-1152.125) (-1143.608) -- 0:02:22
298000 -- (-1143.802) (-1145.119) [-1142.704] (-1142.296) * (-1142.831) [-1139.379] (-1147.159) (-1141.347) -- 0:02:21
299000 -- (-1145.873) (-1142.591) (-1144.375) [-1143.459] * (-1148.134) [-1140.469] (-1145.348) (-1142.751) -- 0:02:20
300000 -- (-1146.508) (-1149.205) [-1144.364] (-1139.044) * (-1139.152) (-1143.512) (-1145.512) [-1140.330] -- 0:02:20
Average standard deviation of split frequencies: 0.010975
301000 -- (-1149.954) [-1137.821] (-1148.118) (-1141.661) * (-1139.470) (-1153.006) [-1139.364] (-1142.990) -- 0:02:21
302000 -- (-1137.653) [-1143.940] (-1138.417) (-1144.370) * (-1150.345) [-1147.028] (-1142.607) (-1144.398) -- 0:02:20
303000 -- (-1143.129) (-1142.335) [-1143.029] (-1148.421) * [-1148.528] (-1144.037) (-1137.393) (-1146.221) -- 0:02:20
304000 -- (-1139.713) (-1141.765) [-1144.064] (-1146.358) * (-1146.628) (-1140.698) [-1145.264] (-1145.391) -- 0:02:19
305000 -- (-1143.975) (-1141.238) [-1138.158] (-1147.679) * (-1149.451) (-1150.249) [-1140.787] (-1144.307) -- 0:02:19
Average standard deviation of split frequencies: 0.011468
306000 -- (-1150.868) (-1136.791) [-1146.056] (-1156.588) * (-1147.372) (-1145.912) (-1143.308) [-1136.717] -- 0:02:20
307000 -- (-1149.920) (-1150.758) [-1142.850] (-1148.241) * [-1141.676] (-1145.395) (-1153.853) (-1148.458) -- 0:02:19
308000 -- (-1152.140) (-1142.029) [-1145.989] (-1146.856) * (-1145.211) (-1147.806) [-1140.913] (-1139.497) -- 0:02:19
309000 -- (-1143.505) (-1140.993) (-1143.880) [-1145.613] * (-1142.287) (-1150.397) [-1136.228] (-1148.496) -- 0:02:18
310000 -- (-1144.413) [-1142.261] (-1143.683) (-1145.886) * (-1144.985) (-1139.472) (-1144.048) [-1149.249] -- 0:02:18
Average standard deviation of split frequencies: 0.009610
311000 -- (-1149.522) (-1145.406) [-1142.234] (-1144.032) * (-1147.891) (-1142.857) (-1142.679) [-1140.590] -- 0:02:19
312000 -- (-1144.404) (-1140.767) [-1143.248] (-1144.212) * [-1146.063] (-1155.075) (-1144.758) (-1152.749) -- 0:02:18
313000 -- (-1143.859) (-1146.181) [-1144.032] (-1142.961) * [-1140.341] (-1147.808) (-1146.587) (-1143.261) -- 0:02:18
314000 -- [-1142.744] (-1144.713) (-1144.881) (-1148.037) * (-1140.367) [-1140.787] (-1142.851) (-1153.802) -- 0:02:17
315000 -- (-1141.582) [-1136.571] (-1145.932) (-1155.661) * (-1144.775) [-1140.764] (-1146.847) (-1144.956) -- 0:02:17
Average standard deviation of split frequencies: 0.008785
316000 -- (-1144.396) (-1147.294) (-1145.433) [-1148.675] * (-1144.836) [-1138.780] (-1140.833) (-1151.962) -- 0:02:18
317000 -- (-1144.582) (-1146.388) (-1142.738) [-1145.743] * (-1138.902) (-1143.073) [-1150.975] (-1145.109) -- 0:02:17
318000 -- (-1149.927) (-1141.925) [-1138.723] (-1141.610) * [-1142.765] (-1143.730) (-1140.439) (-1147.088) -- 0:02:17
319000 -- [-1144.497] (-1151.214) (-1138.047) (-1144.048) * (-1147.332) (-1137.151) [-1141.272] (-1143.176) -- 0:02:16
320000 -- (-1149.112) (-1141.040) [-1145.087] (-1147.895) * (-1144.582) [-1142.376] (-1144.472) (-1139.775) -- 0:02:16
Average standard deviation of split frequencies: 0.008330
321000 -- (-1149.259) [-1143.815] (-1144.835) (-1139.027) * (-1145.189) (-1146.476) (-1141.972) [-1145.039] -- 0:02:15
322000 -- (-1150.247) (-1145.115) [-1140.051] (-1143.155) * (-1146.466) (-1143.610) [-1138.460] (-1136.750) -- 0:02:16
323000 -- [-1141.862] (-1147.166) (-1142.369) (-1139.356) * [-1141.904] (-1147.888) (-1143.644) (-1158.031) -- 0:02:16
324000 -- (-1152.237) (-1141.554) (-1140.789) [-1143.711] * (-1154.034) (-1138.115) [-1139.604] (-1138.947) -- 0:02:15
325000 -- (-1149.892) (-1142.929) [-1137.506] (-1145.805) * (-1148.446) [-1139.638] (-1142.568) (-1143.455) -- 0:02:15
Average standard deviation of split frequencies: 0.006909
326000 -- (-1146.091) (-1150.109) [-1142.512] (-1152.504) * [-1146.540] (-1139.870) (-1148.904) (-1141.306) -- 0:02:14
327000 -- (-1152.533) (-1146.453) [-1140.279] (-1146.207) * (-1145.873) (-1143.369) (-1153.842) [-1141.283] -- 0:02:15
328000 -- (-1142.538) (-1142.604) [-1137.940] (-1146.827) * (-1146.332) [-1139.343] (-1143.694) (-1145.461) -- 0:02:15
329000 -- (-1142.869) [-1142.618] (-1139.860) (-1145.829) * (-1146.121) (-1142.763) (-1142.155) [-1141.505] -- 0:02:14
330000 -- [-1143.823] (-1147.021) (-1145.093) (-1148.120) * (-1147.292) [-1136.170] (-1142.390) (-1141.105) -- 0:02:14
Average standard deviation of split frequencies: 0.006494
331000 -- (-1141.397) [-1141.527] (-1140.764) (-1148.250) * (-1145.464) (-1145.709) (-1145.425) [-1148.221] -- 0:02:13
332000 -- (-1142.163) (-1151.333) (-1150.884) [-1143.515] * (-1150.898) [-1139.088] (-1147.772) (-1143.964) -- 0:02:14
333000 -- (-1143.787) (-1137.428) [-1145.906] (-1141.700) * (-1146.624) (-1138.009) (-1142.273) [-1142.471] -- 0:02:14
334000 -- (-1148.698) (-1143.058) (-1144.416) [-1140.131] * (-1147.437) (-1146.593) [-1147.291] (-1141.818) -- 0:02:13
335000 -- (-1143.545) (-1141.039) (-1142.076) [-1143.216] * (-1147.151) (-1141.898) [-1144.001] (-1148.997) -- 0:02:13
Average standard deviation of split frequencies: 0.006547
336000 -- (-1145.564) (-1139.778) [-1141.652] (-1146.453) * (-1146.182) (-1137.279) [-1143.844] (-1146.903) -- 0:02:12
337000 -- (-1145.859) [-1140.580] (-1155.149) (-1145.087) * (-1141.369) (-1147.143) (-1149.360) [-1138.538] -- 0:02:13
338000 -- (-1148.055) (-1143.427) (-1149.890) [-1144.624] * (-1150.364) [-1141.690] (-1144.776) (-1152.437) -- 0:02:13
339000 -- (-1150.525) (-1147.616) (-1147.960) [-1142.601] * (-1142.231) (-1140.948) (-1158.723) [-1143.167] -- 0:02:12
340000 -- (-1139.842) (-1152.960) (-1154.099) [-1139.673] * [-1139.501] (-1143.145) (-1148.897) (-1138.110) -- 0:02:12
Average standard deviation of split frequencies: 0.006765
341000 -- [-1147.484] (-1146.256) (-1161.872) (-1141.127) * (-1136.369) (-1134.951) [-1151.469] (-1141.895) -- 0:02:11
342000 -- (-1149.815) (-1140.750) [-1140.275] (-1141.619) * [-1137.640] (-1145.505) (-1154.510) (-1146.092) -- 0:02:12
343000 -- (-1143.696) (-1140.598) [-1146.323] (-1148.652) * (-1145.117) (-1143.909) (-1160.953) [-1137.169] -- 0:02:12
344000 -- (-1141.088) (-1147.493) (-1152.028) [-1144.166] * [-1148.591] (-1145.827) (-1152.999) (-1139.164) -- 0:02:11
345000 -- (-1150.871) (-1141.498) (-1150.481) [-1143.192] * (-1142.984) (-1146.152) (-1151.180) [-1138.304] -- 0:02:11
Average standard deviation of split frequencies: 0.006358
346000 -- (-1151.314) [-1143.744] (-1153.835) (-1154.880) * (-1148.653) (-1143.264) (-1143.072) [-1137.439] -- 0:02:10
347000 -- (-1146.796) (-1142.656) (-1154.079) [-1143.202] * (-1144.226) (-1149.167) (-1153.129) [-1139.140] -- 0:02:11
348000 -- (-1144.857) (-1147.437) (-1147.829) [-1139.536] * (-1142.889) (-1141.630) (-1148.402) [-1140.430] -- 0:02:11
349000 -- (-1143.926) [-1146.327] (-1147.313) (-1144.428) * (-1140.020) (-1141.288) [-1144.434] (-1139.965) -- 0:02:10
350000 -- (-1160.845) (-1142.522) (-1141.435) [-1144.031] * (-1144.895) (-1140.432) [-1144.440] (-1138.020) -- 0:02:10
Average standard deviation of split frequencies: 0.006572
351000 -- [-1144.986] (-1143.060) (-1145.616) (-1146.420) * (-1145.758) (-1143.260) (-1146.482) [-1146.441] -- 0:02:09
352000 -- [-1149.057] (-1146.622) (-1147.527) (-1146.757) * (-1147.139) [-1142.362] (-1140.601) (-1142.777) -- 0:02:10
353000 -- (-1146.783) (-1141.665) [-1141.765] (-1144.322) * (-1141.969) (-1148.926) [-1138.809] (-1150.256) -- 0:02:10
354000 -- (-1152.841) (-1140.710) [-1138.946] (-1143.046) * (-1137.976) (-1146.987) [-1146.308] (-1140.855) -- 0:02:09
355000 -- (-1152.567) (-1138.962) (-1147.985) [-1144.610] * (-1140.299) [-1146.601] (-1157.298) (-1139.591) -- 0:02:09
Average standard deviation of split frequencies: 0.007357
356000 -- (-1152.102) [-1135.724] (-1145.362) (-1146.750) * (-1141.096) (-1150.791) [-1146.697] (-1149.529) -- 0:02:08
357000 -- [-1141.788] (-1149.784) (-1145.948) (-1160.540) * (-1138.146) [-1141.443] (-1148.374) (-1155.950) -- 0:02:09
358000 -- (-1144.703) (-1142.601) [-1140.085] (-1146.056) * [-1137.343] (-1140.886) (-1144.861) (-1142.976) -- 0:02:09
359000 -- (-1146.901) (-1145.600) (-1152.108) [-1137.467] * [-1145.162] (-1147.344) (-1144.613) (-1142.399) -- 0:02:08
360000 -- (-1142.033) (-1152.366) [-1139.180] (-1142.594) * (-1150.071) (-1149.691) (-1143.962) [-1140.235] -- 0:02:08
Average standard deviation of split frequencies: 0.007552
361000 -- (-1139.683) (-1151.387) (-1144.598) [-1146.129] * [-1142.245] (-1147.138) (-1150.026) (-1145.103) -- 0:02:07
362000 -- (-1141.447) (-1152.770) (-1141.926) [-1146.044] * (-1142.720) (-1146.541) (-1153.510) [-1143.992] -- 0:02:08
363000 -- (-1142.152) (-1144.511) [-1146.676] (-1144.573) * [-1144.305] (-1145.993) (-1143.129) (-1151.141) -- 0:02:08
364000 -- [-1142.431] (-1147.315) (-1146.091) (-1146.862) * [-1144.721] (-1144.283) (-1144.490) (-1145.079) -- 0:02:07
365000 -- (-1143.296) (-1142.090) [-1143.189] (-1143.581) * (-1144.262) [-1141.214] (-1150.780) (-1144.377) -- 0:02:07
Average standard deviation of split frequencies: 0.007442
366000 -- [-1138.903] (-1149.898) (-1144.792) (-1152.200) * [-1142.988] (-1150.960) (-1142.513) (-1146.684) -- 0:02:06
367000 -- (-1140.716) (-1141.222) [-1146.024] (-1138.840) * (-1144.090) (-1142.150) (-1139.747) [-1137.982] -- 0:02:07
368000 -- (-1143.258) (-1143.212) (-1150.239) [-1140.358] * [-1139.044] (-1144.973) (-1147.434) (-1144.813) -- 0:02:07
369000 -- (-1141.588) (-1156.101) (-1155.638) [-1140.329] * [-1142.785] (-1143.835) (-1147.413) (-1148.695) -- 0:02:06
370000 -- [-1137.103] (-1142.940) (-1154.059) (-1143.949) * (-1148.325) (-1155.288) (-1139.842) [-1143.315] -- 0:02:06
Average standard deviation of split frequencies: 0.006500
371000 -- [-1142.108] (-1148.195) (-1138.125) (-1155.466) * (-1152.994) (-1143.617) (-1144.958) [-1139.613] -- 0:02:05
372000 -- (-1145.300) (-1136.363) [-1141.350] (-1144.069) * (-1142.325) (-1145.974) [-1145.384] (-1145.881) -- 0:02:06
373000 -- (-1143.906) (-1145.498) [-1138.084] (-1139.282) * [-1143.555] (-1141.637) (-1138.975) (-1154.877) -- 0:02:06
374000 -- [-1143.095] (-1144.831) (-1138.510) (-1142.765) * (-1148.028) (-1138.452) (-1145.332) [-1140.422] -- 0:02:05
375000 -- [-1144.859] (-1155.096) (-1142.146) (-1147.829) * (-1157.220) (-1145.191) [-1144.286] (-1146.414) -- 0:02:05
Average standard deviation of split frequencies: 0.007105
376000 -- [-1139.945] (-1142.828) (-1143.950) (-1141.584) * (-1144.180) (-1142.112) [-1143.431] (-1141.921) -- 0:02:04
377000 -- (-1149.365) [-1143.361] (-1143.871) (-1142.603) * (-1146.429) (-1154.723) [-1143.825] (-1142.612) -- 0:02:05
378000 -- (-1142.264) (-1140.746) [-1143.113] (-1141.412) * (-1153.352) [-1144.747] (-1147.225) (-1142.534) -- 0:02:05
379000 -- (-1146.323) (-1146.088) [-1139.335] (-1146.362) * [-1140.041] (-1147.285) (-1146.503) (-1144.142) -- 0:02:04
380000 -- (-1151.183) (-1140.703) (-1144.785) [-1145.636] * (-1146.605) (-1146.743) [-1138.309] (-1144.698) -- 0:02:04
Average standard deviation of split frequencies: 0.006742
381000 -- (-1143.568) (-1145.563) [-1142.008] (-1146.035) * (-1145.084) (-1155.008) [-1138.297] (-1138.545) -- 0:02:03
382000 -- [-1142.960] (-1141.886) (-1139.082) (-1141.581) * (-1145.727) (-1155.643) [-1153.731] (-1143.451) -- 0:02:04
383000 -- (-1141.288) [-1143.015] (-1141.446) (-1152.686) * (-1142.860) (-1154.359) [-1147.299] (-1137.942) -- 0:02:04
384000 -- (-1143.520) [-1141.438] (-1146.933) (-1144.662) * (-1141.695) (-1152.362) (-1144.089) [-1145.195] -- 0:02:03
385000 -- (-1148.088) [-1139.259] (-1141.044) (-1138.079) * (-1140.657) (-1142.559) (-1142.589) [-1144.583] -- 0:02:03
Average standard deviation of split frequencies: 0.006378
386000 -- (-1144.028) (-1137.638) (-1143.368) [-1143.076] * (-1147.264) (-1143.112) [-1142.593] (-1146.015) -- 0:02:02
387000 -- (-1146.886) (-1144.452) (-1141.223) [-1135.618] * (-1144.527) (-1141.963) (-1141.492) [-1140.747] -- 0:02:03
388000 -- (-1144.615) (-1136.966) (-1146.240) [-1142.771] * [-1149.380] (-1140.111) (-1146.371) (-1139.453) -- 0:02:03
389000 -- (-1146.068) (-1144.284) (-1145.315) [-1138.818] * (-1148.800) (-1139.792) (-1143.969) [-1143.328] -- 0:02:02
390000 -- (-1147.577) (-1146.967) [-1144.323] (-1145.714) * (-1140.708) (-1139.628) (-1139.434) [-1143.404] -- 0:02:02
Average standard deviation of split frequencies: 0.007240
391000 -- (-1147.966) (-1143.184) (-1140.128) [-1143.044] * [-1141.713] (-1142.531) (-1144.824) (-1142.158) -- 0:02:01
392000 -- (-1143.193) (-1141.662) [-1141.077] (-1145.970) * (-1149.172) (-1140.229) [-1141.686] (-1143.562) -- 0:02:02
393000 -- (-1148.398) (-1138.873) [-1140.690] (-1142.445) * (-1154.395) (-1138.850) [-1145.940] (-1137.420) -- 0:02:02
394000 -- (-1147.077) (-1145.127) [-1143.117] (-1149.022) * (-1144.673) [-1138.833] (-1139.710) (-1136.880) -- 0:02:01
395000 -- (-1143.855) (-1146.191) (-1144.333) [-1146.593] * [-1140.845] (-1158.185) (-1142.054) (-1146.571) -- 0:02:01
Average standard deviation of split frequencies: 0.007672
396000 -- (-1141.433) (-1141.898) (-1146.987) [-1139.345] * [-1141.459] (-1142.159) (-1145.884) (-1145.426) -- 0:02:00
397000 -- (-1143.098) [-1139.651] (-1147.536) (-1152.448) * (-1139.005) [-1147.750] (-1152.485) (-1141.678) -- 0:01:59
398000 -- [-1142.694] (-1148.316) (-1151.461) (-1142.707) * [-1145.795] (-1140.199) (-1147.097) (-1139.142) -- 0:02:01
399000 -- (-1145.451) (-1146.148) (-1144.906) [-1137.540] * [-1142.422] (-1143.452) (-1141.247) (-1139.343) -- 0:02:00
400000 -- [-1142.696] (-1138.111) (-1141.346) (-1151.222) * [-1140.283] (-1152.243) (-1148.806) (-1146.099) -- 0:02:00
Average standard deviation of split frequencies: 0.006536
401000 -- (-1152.076) (-1143.915) [-1143.644] (-1156.331) * (-1146.484) [-1142.706] (-1152.664) (-1143.054) -- 0:01:59
402000 -- (-1148.340) [-1138.281] (-1153.007) (-1140.972) * (-1139.985) (-1137.464) (-1147.144) [-1146.508] -- 0:01:59
403000 -- (-1140.077) (-1142.337) [-1146.947] (-1150.074) * [-1150.792] (-1142.017) (-1154.440) (-1145.568) -- 0:01:59
404000 -- (-1150.069) (-1139.605) (-1143.365) [-1138.364] * (-1145.681) [-1153.304] (-1148.930) (-1148.785) -- 0:01:59
405000 -- (-1149.252) (-1145.895) [-1139.404] (-1139.395) * (-1149.510) (-1150.932) (-1142.431) [-1140.040] -- 0:01:59
Average standard deviation of split frequencies: 0.007354
406000 -- (-1146.950) [-1145.113] (-1141.926) (-1139.790) * [-1141.568] (-1146.607) (-1147.902) (-1146.388) -- 0:01:58
407000 -- (-1141.396) (-1140.685) [-1148.746] (-1149.480) * (-1139.934) [-1139.928] (-1151.128) (-1142.427) -- 0:01:58
408000 -- [-1138.802] (-1140.905) (-1140.986) (-1147.471) * (-1144.493) (-1139.920) [-1146.592] (-1144.240) -- 0:01:58
409000 -- (-1148.327) [-1140.493] (-1144.608) (-1150.206) * [-1137.964] (-1149.000) (-1149.833) (-1147.226) -- 0:01:58
410000 -- [-1142.041] (-1141.424) (-1146.212) (-1147.010) * (-1151.219) (-1145.866) [-1143.955] (-1145.445) -- 0:01:58
Average standard deviation of split frequencies: 0.009311
411000 -- (-1144.999) [-1140.995] (-1144.796) (-1147.388) * (-1136.931) (-1139.317) [-1141.990] (-1145.034) -- 0:01:57
412000 -- (-1140.551) [-1142.936] (-1147.711) (-1142.614) * (-1139.395) (-1146.942) [-1136.867] (-1149.910) -- 0:01:57
413000 -- (-1147.903) [-1139.612] (-1144.524) (-1151.883) * (-1137.247) (-1139.338) (-1146.470) [-1145.680] -- 0:01:57
414000 -- [-1142.136] (-1139.071) (-1144.112) (-1152.287) * (-1143.854) [-1135.563] (-1144.456) (-1139.488) -- 0:01:57
415000 -- [-1138.354] (-1143.674) (-1148.804) (-1150.457) * (-1139.750) [-1143.903] (-1152.012) (-1153.031) -- 0:01:57
Average standard deviation of split frequencies: 0.009695
416000 -- [-1141.805] (-1144.350) (-1146.257) (-1147.284) * (-1143.885) (-1146.513) [-1140.692] (-1149.575) -- 0:01:56
417000 -- (-1145.634) (-1142.142) (-1138.747) [-1143.920] * (-1141.204) (-1140.499) [-1143.786] (-1142.116) -- 0:01:56
418000 -- [-1147.666] (-1139.631) (-1140.106) (-1141.335) * (-1146.751) (-1140.723) (-1146.964) [-1140.597] -- 0:01:56
419000 -- (-1139.414) [-1148.121] (-1144.597) (-1139.972) * (-1147.061) [-1142.101] (-1144.612) (-1140.372) -- 0:01:56
420000 -- (-1140.213) [-1144.935] (-1143.497) (-1144.903) * (-1143.862) (-1144.667) (-1157.498) [-1138.969] -- 0:01:56
Average standard deviation of split frequencies: 0.010459
421000 -- (-1143.081) (-1141.416) (-1144.494) [-1137.217] * (-1139.383) (-1142.822) [-1141.957] (-1142.042) -- 0:01:55
422000 -- [-1142.162] (-1143.706) (-1143.787) (-1147.453) * (-1145.192) (-1144.848) [-1145.499] (-1143.054) -- 0:01:55
423000 -- (-1145.026) (-1144.200) (-1142.231) [-1137.918] * (-1139.888) (-1147.478) [-1141.357] (-1142.435) -- 0:01:55
424000 -- (-1140.809) (-1146.920) [-1144.652] (-1146.535) * [-1145.463] (-1140.736) (-1141.961) (-1142.922) -- 0:01:55
425000 -- [-1152.619] (-1142.898) (-1144.547) (-1139.621) * (-1156.517) [-1141.563] (-1143.394) (-1138.713) -- 0:01:55
Average standard deviation of split frequencies: 0.010943
426000 -- (-1148.281) (-1142.267) [-1144.267] (-1141.205) * (-1147.424) (-1137.690) [-1140.036] (-1147.171) -- 0:01:54
427000 -- (-1152.358) (-1151.746) (-1140.505) [-1145.557] * [-1145.103] (-1146.253) (-1142.061) (-1144.882) -- 0:01:54
428000 -- (-1144.448) (-1146.097) [-1144.689] (-1142.557) * [-1138.991] (-1147.092) (-1141.840) (-1142.383) -- 0:01:54
429000 -- [-1139.782] (-1143.133) (-1145.507) (-1147.461) * (-1142.306) (-1145.901) [-1140.593] (-1143.682) -- 0:01:54
430000 -- [-1141.883] (-1146.286) (-1148.430) (-1139.577) * (-1140.151) (-1144.231) [-1139.271] (-1140.066) -- 0:01:54
Average standard deviation of split frequencies: 0.009122
431000 -- (-1138.730) (-1140.907) [-1144.397] (-1140.649) * (-1141.594) [-1144.329] (-1142.776) (-1151.008) -- 0:01:53
432000 -- (-1146.604) [-1143.232] (-1154.923) (-1147.668) * (-1141.696) [-1137.326] (-1149.849) (-1145.379) -- 0:01:53
433000 -- (-1150.042) [-1139.542] (-1144.661) (-1147.307) * (-1142.306) (-1145.033) (-1147.119) [-1144.609] -- 0:01:53
434000 -- (-1140.394) [-1140.727] (-1146.118) (-1145.199) * [-1144.019] (-1143.171) (-1152.570) (-1141.763) -- 0:01:53
435000 -- (-1143.076) (-1142.959) [-1141.213] (-1152.043) * (-1143.276) [-1140.357] (-1150.523) (-1147.234) -- 0:01:53
Average standard deviation of split frequencies: 0.009851
436000 -- [-1146.541] (-1143.696) (-1164.390) (-1152.299) * (-1145.407) (-1139.792) [-1145.502] (-1159.279) -- 0:01:52
437000 -- (-1145.008) [-1141.482] (-1152.367) (-1149.535) * [-1146.249] (-1146.103) (-1137.625) (-1147.995) -- 0:01:52
438000 -- (-1145.114) [-1143.269] (-1145.357) (-1144.811) * (-1145.200) [-1146.796] (-1149.083) (-1153.331) -- 0:01:52
439000 -- [-1142.625] (-1140.368) (-1141.927) (-1143.357) * (-1146.787) [-1141.075] (-1145.059) (-1143.387) -- 0:01:52
440000 -- (-1146.129) (-1149.123) [-1144.509] (-1149.686) * (-1140.635) (-1146.630) (-1148.301) [-1140.510] -- 0:01:52
Average standard deviation of split frequencies: 0.009271
441000 -- (-1145.515) [-1144.412] (-1149.502) (-1148.830) * (-1142.648) [-1142.752] (-1141.120) (-1157.946) -- 0:01:51
442000 -- (-1161.096) (-1140.555) [-1142.863] (-1143.892) * (-1138.844) [-1140.304] (-1142.240) (-1145.090) -- 0:01:51
443000 -- (-1145.866) [-1141.525] (-1147.684) (-1146.746) * (-1141.801) (-1145.399) [-1143.717] (-1147.706) -- 0:01:51
444000 -- (-1147.466) (-1141.206) [-1143.366] (-1143.259) * (-1144.820) [-1146.856] (-1144.211) (-1157.368) -- 0:01:51
445000 -- (-1144.452) (-1138.744) [-1140.621] (-1144.411) * (-1148.644) (-1140.038) (-1143.629) [-1141.696] -- 0:01:51
Average standard deviation of split frequencies: 0.008456
446000 -- [-1139.962] (-1140.548) (-1143.150) (-1141.881) * (-1145.457) [-1138.465] (-1147.761) (-1147.808) -- 0:01:50
447000 -- (-1137.167) (-1142.402) (-1137.700) [-1143.564] * (-1145.075) (-1142.886) (-1144.964) [-1135.056] -- 0:01:50
448000 -- (-1143.606) (-1142.975) [-1145.296] (-1142.645) * (-1151.431) (-1144.026) [-1138.897] (-1142.781) -- 0:01:50
449000 -- [-1141.850] (-1154.736) (-1149.825) (-1142.001) * (-1149.241) (-1147.964) [-1140.976] (-1142.057) -- 0:01:50
450000 -- (-1142.161) (-1144.034) (-1146.387) [-1145.701] * [-1148.173] (-1144.943) (-1149.439) (-1142.673) -- 0:01:50
Average standard deviation of split frequencies: 0.009065
451000 -- (-1156.315) (-1139.098) (-1141.787) [-1140.020] * (-1148.093) (-1140.376) [-1140.690] (-1143.243) -- 0:01:49
452000 -- (-1147.987) [-1145.263] (-1143.481) (-1144.046) * (-1141.803) (-1149.479) [-1141.556] (-1140.903) -- 0:01:50
453000 -- (-1143.818) (-1145.347) [-1143.195] (-1146.997) * [-1139.478] (-1149.388) (-1145.858) (-1144.528) -- 0:01:49
454000 -- (-1144.218) (-1142.156) (-1143.819) [-1142.318] * (-1142.363) (-1148.312) [-1139.813] (-1136.926) -- 0:01:49
455000 -- (-1145.480) (-1153.539) (-1150.767) [-1142.977] * (-1140.438) (-1146.752) (-1141.746) [-1137.952] -- 0:01:49
Average standard deviation of split frequencies: 0.008730
456000 -- (-1138.493) (-1149.109) [-1146.503] (-1149.874) * (-1143.815) (-1142.782) [-1143.466] (-1140.061) -- 0:01:48
457000 -- (-1147.295) (-1142.180) [-1142.835] (-1146.526) * (-1147.419) (-1151.937) [-1141.175] (-1140.941) -- 0:01:49
458000 -- [-1137.198] (-1141.898) (-1155.729) (-1145.214) * (-1149.156) (-1146.076) [-1138.438] (-1144.704) -- 0:01:48
459000 -- (-1142.842) (-1143.046) (-1145.929) [-1143.079] * (-1147.072) (-1141.794) (-1145.838) [-1146.239] -- 0:01:48
460000 -- [-1141.923] (-1148.145) (-1148.207) (-1140.960) * [-1144.538] (-1151.062) (-1142.978) (-1149.636) -- 0:01:48
Average standard deviation of split frequencies: 0.008073
461000 -- [-1141.265] (-1148.010) (-1142.433) (-1143.272) * (-1148.490) (-1141.895) (-1140.007) [-1142.954] -- 0:01:47
462000 -- [-1148.408] (-1142.935) (-1145.933) (-1139.831) * (-1146.261) (-1137.574) (-1146.702) [-1141.030] -- 0:01:48
463000 -- [-1143.808] (-1149.911) (-1150.586) (-1139.640) * (-1142.455) (-1139.035) [-1144.863] (-1140.341) -- 0:01:47
464000 -- [-1146.531] (-1143.350) (-1144.555) (-1146.076) * (-1152.482) (-1141.588) (-1145.786) [-1148.436] -- 0:01:47
465000 -- [-1142.689] (-1145.671) (-1146.342) (-1152.764) * (-1143.040) (-1148.319) (-1143.376) [-1146.439] -- 0:01:47
Average standard deviation of split frequencies: 0.008318
466000 -- [-1141.255] (-1143.196) (-1145.407) (-1145.996) * [-1147.424] (-1147.811) (-1143.549) (-1145.088) -- 0:01:46
467000 -- (-1142.969) [-1144.121] (-1141.127) (-1150.418) * (-1142.755) [-1139.228] (-1143.427) (-1144.157) -- 0:01:47
468000 -- (-1143.268) (-1139.647) (-1138.300) [-1141.505] * (-1145.066) [-1139.533] (-1147.485) (-1144.586) -- 0:01:46
469000 -- (-1147.893) (-1140.786) [-1138.004] (-1138.471) * (-1148.163) [-1139.281] (-1153.540) (-1143.302) -- 0:01:46
470000 -- [-1140.104] (-1154.198) (-1146.664) (-1150.218) * (-1143.449) (-1142.615) (-1143.595) [-1143.985] -- 0:01:46
Average standard deviation of split frequencies: 0.008458
471000 -- [-1138.577] (-1147.347) (-1145.399) (-1146.199) * (-1145.805) [-1139.858] (-1143.181) (-1140.928) -- 0:01:45
472000 -- (-1143.700) (-1151.037) [-1145.034] (-1147.267) * (-1139.729) (-1136.839) [-1143.630] (-1142.354) -- 0:01:45
473000 -- (-1147.034) [-1144.323] (-1148.508) (-1155.392) * (-1142.578) [-1146.839] (-1143.590) (-1144.019) -- 0:01:45
474000 -- (-1143.994) (-1144.033) (-1143.812) [-1155.985] * [-1137.877] (-1142.389) (-1138.410) (-1147.166) -- 0:01:45
475000 -- (-1144.927) [-1137.674] (-1142.892) (-1148.033) * (-1141.315) (-1146.995) (-1149.116) [-1150.266] -- 0:01:45
Average standard deviation of split frequencies: 0.008913
476000 -- (-1146.813) (-1147.013) (-1138.166) [-1144.905] * (-1141.634) (-1141.433) [-1138.485] (-1145.164) -- 0:01:44
477000 -- (-1139.517) (-1143.955) [-1142.610] (-1146.523) * (-1145.998) (-1150.563) (-1143.059) [-1139.855] -- 0:01:44
478000 -- (-1142.520) [-1140.770] (-1145.176) (-1145.568) * (-1144.033) (-1140.820) [-1144.182] (-1143.859) -- 0:01:44
479000 -- [-1138.122] (-1143.099) (-1150.996) (-1138.526) * [-1138.622] (-1149.935) (-1152.126) (-1144.385) -- 0:01:44
480000 -- (-1144.660) [-1145.012] (-1147.955) (-1140.273) * (-1146.717) (-1152.280) [-1148.400] (-1143.947) -- 0:01:44
Average standard deviation of split frequencies: 0.008827
481000 -- [-1143.616] (-1147.583) (-1140.799) (-1143.684) * (-1153.245) [-1140.012] (-1146.848) (-1137.939) -- 0:01:43
482000 -- (-1153.399) (-1137.171) (-1145.348) [-1142.067] * (-1139.565) (-1147.833) (-1143.530) [-1145.797] -- 0:01:43
483000 -- [-1140.580] (-1140.190) (-1148.014) (-1144.177) * (-1146.067) [-1138.053] (-1143.187) (-1143.206) -- 0:01:43
484000 -- (-1151.576) (-1146.141) (-1150.232) [-1139.968] * (-1157.008) (-1144.900) (-1142.529) [-1136.617] -- 0:01:43
485000 -- (-1145.355) (-1147.465) (-1152.192) [-1146.364] * (-1147.406) (-1149.881) [-1142.573] (-1143.335) -- 0:01:43
Average standard deviation of split frequencies: 0.008406
486000 -- [-1139.109] (-1148.631) (-1145.632) (-1140.002) * (-1142.638) (-1143.619) (-1142.820) [-1152.771] -- 0:01:42
487000 -- (-1141.792) (-1142.765) [-1142.415] (-1149.176) * [-1143.084] (-1148.885) (-1138.891) (-1146.961) -- 0:01:42
488000 -- (-1141.729) (-1150.306) [-1139.973] (-1140.706) * [-1138.907] (-1141.831) (-1144.305) (-1139.944) -- 0:01:42
489000 -- (-1139.473) (-1144.935) (-1140.051) [-1141.230] * (-1142.937) [-1144.785] (-1140.453) (-1144.887) -- 0:01:42
490000 -- [-1142.198] (-1145.079) (-1145.680) (-1145.743) * [-1142.991] (-1147.871) (-1143.307) (-1141.386) -- 0:01:42
Average standard deviation of split frequencies: 0.009394
491000 -- [-1141.691] (-1145.039) (-1139.119) (-1150.133) * (-1142.467) (-1148.343) (-1142.664) [-1145.631] -- 0:01:41
492000 -- (-1151.548) (-1142.525) (-1153.288) [-1145.433] * [-1143.759] (-1140.884) (-1146.539) (-1145.346) -- 0:01:41
493000 -- (-1147.690) (-1147.607) [-1143.980] (-1161.206) * (-1149.006) (-1145.909) (-1149.739) [-1145.679] -- 0:01:41
494000 -- (-1143.115) (-1147.260) (-1141.313) [-1141.022] * (-1145.959) (-1141.074) [-1144.504] (-1146.663) -- 0:01:41
495000 -- (-1144.205) [-1148.368] (-1143.017) (-1141.124) * (-1155.617) [-1141.711] (-1142.666) (-1145.607) -- 0:01:41
Average standard deviation of split frequencies: 0.008659
496000 -- [-1141.564] (-1146.771) (-1141.183) (-1141.584) * (-1148.286) (-1144.634) [-1143.744] (-1142.197) -- 0:01:40
497000 -- (-1143.124) (-1145.094) [-1140.342] (-1142.254) * (-1145.036) (-1142.483) [-1140.988] (-1148.184) -- 0:01:40
498000 -- (-1143.220) (-1144.331) [-1145.076] (-1143.075) * (-1151.070) [-1137.695] (-1143.411) (-1149.159) -- 0:01:40
499000 -- (-1138.873) (-1147.684) (-1143.458) [-1141.602] * (-1142.071) (-1140.046) [-1143.504] (-1146.074) -- 0:01:40
500000 -- (-1146.213) (-1140.642) (-1142.989) [-1145.149] * (-1146.418) (-1136.461) (-1152.253) [-1139.964] -- 0:01:40
Average standard deviation of split frequencies: 0.007532
501000 -- (-1143.336) [-1139.612] (-1147.946) (-1143.778) * (-1145.112) (-1145.557) (-1140.820) [-1142.540] -- 0:01:39
502000 -- (-1144.518) (-1141.754) [-1147.743] (-1139.976) * (-1139.894) (-1139.644) [-1144.058] (-1145.029) -- 0:01:39
503000 -- [-1135.598] (-1146.565) (-1139.599) (-1147.300) * (-1148.420) (-1141.767) (-1146.107) [-1143.398] -- 0:01:39
504000 -- (-1143.166) (-1143.953) (-1147.899) [-1135.810] * [-1145.973] (-1140.771) (-1149.014) (-1142.015) -- 0:01:39
505000 -- (-1141.911) (-1143.895) (-1163.359) [-1143.447] * (-1140.899) [-1143.620] (-1141.620) (-1142.530) -- 0:01:39
Average standard deviation of split frequencies: 0.008281
506000 -- (-1145.353) (-1140.545) [-1150.374] (-1156.969) * (-1146.507) [-1142.304] (-1140.163) (-1147.306) -- 0:01:38
507000 -- (-1141.578) [-1139.819] (-1139.544) (-1142.058) * (-1141.874) (-1137.833) (-1144.003) [-1142.684] -- 0:01:38
508000 -- (-1143.228) (-1142.060) (-1147.362) [-1144.619] * (-1149.394) (-1140.828) (-1146.543) [-1147.023] -- 0:01:38
509000 -- (-1146.540) (-1143.926) [-1138.345] (-1136.504) * [-1146.732] (-1135.630) (-1142.357) (-1147.241) -- 0:01:38
510000 -- (-1150.418) [-1140.825] (-1142.118) (-1145.506) * [-1150.235] (-1142.140) (-1140.767) (-1141.698) -- 0:01:38
Average standard deviation of split frequencies: 0.008718
511000 -- (-1146.465) (-1148.211) (-1143.369) [-1139.998] * (-1146.883) (-1139.918) (-1150.016) [-1149.386] -- 0:01:37
512000 -- (-1150.394) (-1148.405) (-1141.026) [-1142.975] * (-1146.397) [-1140.323] (-1143.972) (-1139.101) -- 0:01:37
513000 -- [-1137.807] (-1143.501) (-1142.268) (-1143.281) * [-1143.360] (-1142.012) (-1152.223) (-1149.479) -- 0:01:37
514000 -- (-1141.651) [-1136.796] (-1146.747) (-1147.268) * (-1137.271) [-1143.728] (-1144.802) (-1144.135) -- 0:01:37
515000 -- (-1145.279) (-1145.310) [-1142.101] (-1147.048) * [-1141.242] (-1145.778) (-1141.266) (-1144.492) -- 0:01:37
Average standard deviation of split frequencies: 0.009846
516000 -- [-1137.408] (-1141.068) (-1143.950) (-1145.805) * (-1146.451) [-1144.013] (-1142.850) (-1147.624) -- 0:01:36
517000 -- (-1143.697) (-1145.114) (-1141.984) [-1142.163] * (-1138.676) (-1147.821) (-1148.105) [-1144.752] -- 0:01:36
518000 -- (-1145.574) (-1145.423) [-1143.038] (-1142.561) * [-1146.538] (-1143.081) (-1151.852) (-1143.710) -- 0:01:36
519000 -- (-1148.100) (-1146.746) [-1142.616] (-1145.926) * (-1139.072) (-1142.269) (-1146.753) [-1141.729] -- 0:01:36
520000 -- [-1142.823] (-1146.785) (-1148.821) (-1139.153) * [-1140.301] (-1149.642) (-1135.077) (-1140.223) -- 0:01:36
Average standard deviation of split frequencies: 0.009154
521000 -- (-1142.165) [-1140.396] (-1148.917) (-1141.636) * (-1144.951) (-1140.183) (-1146.136) [-1143.327] -- 0:01:35
522000 -- (-1147.543) (-1151.962) (-1157.844) [-1138.547] * (-1146.207) (-1147.204) (-1146.801) [-1135.105] -- 0:01:35
523000 -- (-1146.415) (-1143.759) (-1148.520) [-1141.493] * (-1138.517) (-1147.343) (-1140.764) [-1140.609] -- 0:01:35
524000 -- (-1145.039) (-1143.681) (-1143.931) [-1146.394] * (-1148.251) (-1139.762) [-1142.300] (-1142.237) -- 0:01:35
525000 -- (-1142.976) (-1143.824) (-1142.914) [-1136.805] * (-1152.522) [-1140.218] (-1140.400) (-1146.110) -- 0:01:35
Average standard deviation of split frequencies: 0.010057
526000 -- (-1143.330) [-1142.833] (-1151.817) (-1140.629) * (-1150.822) (-1139.788) [-1158.712] (-1155.319) -- 0:01:34
527000 -- (-1141.401) (-1139.193) (-1152.923) [-1140.211] * (-1138.932) (-1150.703) [-1141.443] (-1141.588) -- 0:01:34
528000 -- (-1141.825) (-1149.101) [-1143.634] (-1141.348) * (-1136.853) [-1142.337] (-1141.279) (-1142.585) -- 0:01:34
529000 -- (-1148.478) (-1150.090) [-1138.867] (-1139.333) * (-1148.236) [-1142.302] (-1151.467) (-1145.357) -- 0:01:34
530000 -- (-1151.096) (-1140.365) (-1141.188) [-1140.900] * (-1145.278) [-1140.126] (-1143.406) (-1141.069) -- 0:01:34
Average standard deviation of split frequencies: 0.009081
531000 -- (-1147.700) [-1139.136] (-1144.875) (-1141.047) * [-1144.191] (-1137.199) (-1139.247) (-1136.380) -- 0:01:33
532000 -- (-1144.224) (-1140.395) (-1138.937) [-1143.670] * [-1141.677] (-1141.400) (-1142.819) (-1139.102) -- 0:01:33
533000 -- (-1146.745) (-1140.440) [-1142.462] (-1144.936) * (-1146.774) (-1142.118) (-1141.684) [-1140.431] -- 0:01:33
534000 -- (-1147.449) [-1143.633] (-1140.044) (-1141.328) * (-1143.195) [-1142.092] (-1148.155) (-1143.091) -- 0:01:33
535000 -- [-1144.306] (-1144.849) (-1142.890) (-1142.036) * (-1149.780) (-1141.176) (-1148.388) [-1137.392] -- 0:01:33
Average standard deviation of split frequencies: 0.009772
536000 -- (-1142.797) (-1140.588) [-1141.713] (-1140.718) * (-1148.149) (-1137.992) [-1141.328] (-1136.907) -- 0:01:32
537000 -- (-1146.292) (-1142.877) (-1142.281) [-1142.808] * [-1147.665] (-1144.969) (-1140.065) (-1140.359) -- 0:01:32
538000 -- (-1144.935) (-1143.869) (-1152.476) [-1140.222] * [-1146.347] (-1151.701) (-1147.519) (-1138.402) -- 0:01:32
539000 -- (-1143.741) (-1142.910) (-1142.838) [-1143.341] * [-1142.488] (-1142.559) (-1146.695) (-1144.405) -- 0:01:32
540000 -- (-1141.928) (-1146.789) (-1144.715) [-1146.077] * (-1145.553) [-1142.697] (-1140.309) (-1146.870) -- 0:01:32
Average standard deviation of split frequencies: 0.009300
541000 -- (-1141.158) [-1139.906] (-1146.515) (-1142.609) * (-1142.522) [-1145.148] (-1140.533) (-1145.317) -- 0:01:31
542000 -- (-1141.950) [-1146.171] (-1145.262) (-1148.214) * (-1140.777) [-1144.101] (-1139.515) (-1147.127) -- 0:01:31
543000 -- (-1147.329) [-1142.355] (-1140.889) (-1147.988) * (-1141.297) (-1145.570) (-1143.364) [-1146.135] -- 0:01:31
544000 -- [-1138.195] (-1147.752) (-1148.637) (-1149.857) * (-1146.571) [-1136.102] (-1145.023) (-1150.791) -- 0:01:31
545000 -- (-1146.543) (-1140.275) [-1141.700] (-1143.140) * (-1142.005) (-1141.835) [-1143.633] (-1144.021) -- 0:01:31
Average standard deviation of split frequencies: 0.009497
546000 -- (-1140.795) (-1140.711) (-1145.886) [-1143.869] * (-1147.914) (-1140.806) (-1150.031) [-1151.566] -- 0:01:30
547000 -- (-1145.752) (-1144.921) (-1145.265) [-1145.507] * (-1143.680) [-1142.819] (-1141.411) (-1146.125) -- 0:01:30
548000 -- (-1148.728) (-1138.191) (-1143.897) [-1140.921] * (-1146.533) [-1138.560] (-1147.875) (-1148.555) -- 0:01:29
549000 -- (-1144.708) (-1138.924) (-1148.087) [-1142.992] * (-1144.896) [-1139.651] (-1145.646) (-1143.658) -- 0:01:30
550000 -- (-1139.545) (-1141.230) (-1143.693) [-1137.577] * (-1144.846) [-1139.617] (-1154.674) (-1142.434) -- 0:01:30
Average standard deviation of split frequencies: 0.009512
551000 -- (-1154.338) [-1147.082] (-1145.016) (-1147.725) * (-1145.302) [-1139.414] (-1150.161) (-1142.393) -- 0:01:29
552000 -- [-1149.292] (-1145.210) (-1143.723) (-1144.531) * (-1151.174) [-1140.520] (-1156.320) (-1148.051) -- 0:01:29
553000 -- (-1141.265) [-1151.705] (-1144.830) (-1148.647) * [-1139.430] (-1145.482) (-1151.600) (-1158.011) -- 0:01:28
554000 -- [-1142.372] (-1140.817) (-1146.313) (-1145.664) * [-1142.165] (-1146.044) (-1147.708) (-1149.123) -- 0:01:29
555000 -- [-1137.868] (-1140.561) (-1145.761) (-1145.381) * (-1150.601) (-1143.851) (-1153.433) [-1141.863] -- 0:01:29
Average standard deviation of split frequencies: 0.010268
556000 -- (-1142.188) [-1138.791] (-1148.833) (-1143.011) * (-1145.842) [-1138.956] (-1144.913) (-1139.798) -- 0:01:28
557000 -- (-1147.394) (-1142.216) (-1147.415) [-1142.755] * (-1150.052) [-1142.141] (-1149.539) (-1141.087) -- 0:01:28
558000 -- [-1137.325] (-1141.793) (-1145.016) (-1145.971) * (-1143.855) [-1139.093] (-1140.157) (-1140.596) -- 0:01:27
559000 -- (-1137.629) [-1146.504] (-1141.028) (-1150.854) * (-1142.368) (-1147.989) (-1139.208) [-1148.221] -- 0:01:28
560000 -- (-1139.823) (-1141.751) (-1141.374) [-1143.737] * (-1141.280) (-1142.894) [-1144.756] (-1142.819) -- 0:01:28
Average standard deviation of split frequencies: 0.009996
561000 -- (-1149.306) (-1141.208) (-1145.208) [-1143.035] * (-1140.833) (-1140.527) (-1142.442) [-1142.061] -- 0:01:27
562000 -- (-1141.280) [-1139.460] (-1142.589) (-1143.451) * [-1140.366] (-1144.134) (-1153.737) (-1142.434) -- 0:01:27
563000 -- [-1146.765] (-1148.263) (-1140.837) (-1144.362) * (-1142.371) (-1142.232) [-1147.982] (-1143.899) -- 0:01:27
564000 -- (-1141.805) (-1141.007) (-1150.592) [-1141.636] * [-1140.314] (-1141.174) (-1145.822) (-1142.320) -- 0:01:27
565000 -- (-1143.637) [-1143.347] (-1150.994) (-1142.792) * (-1148.087) (-1149.485) (-1143.581) [-1145.049] -- 0:01:27
Average standard deviation of split frequencies: 0.009902
566000 -- (-1146.381) [-1137.439] (-1148.095) (-1140.928) * (-1144.224) [-1141.330] (-1148.473) (-1148.734) -- 0:01:26
567000 -- (-1138.867) (-1144.760) [-1141.413] (-1138.496) * [-1152.403] (-1150.110) (-1143.152) (-1144.429) -- 0:01:26
568000 -- (-1141.469) [-1142.410] (-1140.845) (-1147.616) * (-1149.940) (-1148.644) (-1139.615) [-1140.181] -- 0:01:26
569000 -- [-1141.491] (-1142.192) (-1142.171) (-1144.460) * (-1146.825) (-1152.607) (-1140.342) [-1142.494] -- 0:01:26
570000 -- (-1147.789) [-1139.233] (-1154.389) (-1143.933) * [-1142.287] (-1151.571) (-1144.389) (-1140.789) -- 0:01:26
Average standard deviation of split frequencies: 0.010096
571000 -- (-1143.264) (-1143.603) [-1144.864] (-1147.942) * [-1139.728] (-1144.673) (-1155.022) (-1142.275) -- 0:01:25
572000 -- [-1146.277] (-1142.099) (-1144.266) (-1146.406) * (-1155.950) (-1143.638) (-1146.095) [-1139.507] -- 0:01:25
573000 -- [-1138.064] (-1144.251) (-1144.890) (-1151.327) * (-1145.962) [-1144.743] (-1145.508) (-1143.589) -- 0:01:24
574000 -- (-1141.899) [-1142.070] (-1143.973) (-1143.363) * (-1147.447) (-1144.411) [-1141.142] (-1139.118) -- 0:01:25
575000 -- (-1150.496) [-1138.799] (-1138.707) (-1142.393) * (-1144.875) [-1143.178] (-1148.330) (-1143.586) -- 0:01:25
Average standard deviation of split frequencies: 0.010912
576000 -- (-1139.221) (-1147.683) (-1140.550) [-1146.643] * (-1142.668) (-1141.718) (-1152.947) [-1142.270] -- 0:01:24
577000 -- [-1144.210] (-1145.294) (-1150.506) (-1146.291) * [-1150.621] (-1142.684) (-1140.462) (-1142.181) -- 0:01:24
578000 -- (-1143.325) (-1145.239) (-1143.198) [-1142.057] * (-1144.001) (-1140.190) [-1143.849] (-1143.985) -- 0:01:23
579000 -- (-1139.051) (-1139.360) [-1142.382] (-1153.693) * (-1139.089) (-1149.307) [-1140.632] (-1145.872) -- 0:01:24
580000 -- (-1143.951) [-1143.289] (-1150.943) (-1150.037) * (-1145.708) (-1143.007) [-1139.491] (-1144.166) -- 0:01:24
Average standard deviation of split frequencies: 0.011185
581000 -- (-1143.163) (-1147.604) (-1140.225) [-1143.624] * [-1139.334] (-1147.929) (-1143.738) (-1143.490) -- 0:01:23
582000 -- (-1144.083) (-1145.634) (-1138.681) [-1144.210] * (-1147.555) (-1148.005) (-1136.725) [-1140.090] -- 0:01:23
583000 -- [-1143.732] (-1150.732) (-1145.224) (-1142.987) * [-1142.815] (-1142.772) (-1146.556) (-1145.568) -- 0:01:22
584000 -- (-1143.490) (-1143.978) (-1144.431) [-1143.402] * [-1146.665] (-1143.205) (-1152.384) (-1140.099) -- 0:01:23
585000 -- [-1139.466] (-1147.905) (-1145.966) (-1139.647) * (-1143.270) (-1144.695) [-1137.075] (-1146.637) -- 0:01:23
Average standard deviation of split frequencies: 0.011083
586000 -- (-1145.491) (-1146.539) [-1138.606] (-1137.536) * (-1140.945) (-1142.199) [-1145.887] (-1146.183) -- 0:01:22
587000 -- (-1161.544) [-1142.428] (-1148.250) (-1141.780) * (-1144.069) (-1151.225) [-1138.962] (-1142.725) -- 0:01:22
588000 -- (-1147.794) [-1139.253] (-1144.389) (-1151.048) * (-1147.280) (-1148.601) [-1140.024] (-1148.128) -- 0:01:21
589000 -- (-1145.092) [-1146.109] (-1142.282) (-1145.717) * (-1145.174) [-1141.859] (-1146.220) (-1151.133) -- 0:01:22
590000 -- (-1137.235) (-1147.972) [-1147.522] (-1141.795) * [-1155.863] (-1142.099) (-1145.755) (-1143.596) -- 0:01:22
Average standard deviation of split frequencies: 0.011173
591000 -- (-1146.573) (-1144.362) [-1139.743] (-1143.233) * (-1144.888) [-1144.727] (-1146.912) (-1139.944) -- 0:01:21
592000 -- (-1142.801) (-1141.170) (-1148.695) [-1143.602] * (-1147.858) (-1147.784) [-1143.388] (-1143.525) -- 0:01:21
593000 -- (-1147.959) (-1145.346) (-1150.549) [-1154.015] * (-1147.723) [-1139.371] (-1145.139) (-1140.326) -- 0:01:20
594000 -- (-1141.170) (-1149.748) [-1144.159] (-1143.805) * (-1144.966) [-1140.857] (-1140.427) (-1143.538) -- 0:01:21
595000 -- [-1140.448] (-1144.163) (-1137.425) (-1143.498) * (-1144.218) (-1146.630) [-1148.325] (-1137.869) -- 0:01:21
Average standard deviation of split frequencies: 0.012128
596000 -- (-1142.174) [-1138.270] (-1142.869) (-1148.792) * (-1149.861) (-1155.447) (-1143.730) [-1139.827] -- 0:01:20
597000 -- (-1147.867) (-1141.770) (-1139.839) [-1139.028] * (-1143.095) (-1151.484) [-1142.633] (-1152.159) -- 0:01:20
598000 -- (-1140.794) (-1148.073) (-1137.981) [-1141.588] * [-1144.140] (-1141.730) (-1143.306) (-1141.445) -- 0:01:19
599000 -- (-1138.479) (-1147.898) (-1144.825) [-1138.060] * (-1154.267) (-1150.294) [-1137.403] (-1141.733) -- 0:01:20
600000 -- (-1142.618) (-1150.701) [-1143.289] (-1149.924) * (-1141.691) (-1148.569) (-1151.357) [-1141.548] -- 0:01:20
Average standard deviation of split frequencies: 0.011162
601000 -- (-1144.537) (-1144.744) (-1150.453) [-1144.108] * (-1148.386) (-1142.509) (-1152.268) [-1153.565] -- 0:01:19
602000 -- (-1145.903) (-1143.177) (-1144.759) [-1142.730] * [-1140.521] (-1148.069) (-1145.365) (-1144.838) -- 0:01:19
603000 -- (-1147.779) (-1142.998) (-1141.112) [-1139.222] * (-1140.627) (-1148.076) (-1150.173) [-1145.242] -- 0:01:19
604000 -- (-1146.292) (-1147.166) [-1136.059] (-1148.249) * (-1143.485) (-1145.736) (-1148.382) [-1143.861] -- 0:01:19
605000 -- (-1150.413) (-1145.908) [-1141.507] (-1137.086) * (-1149.777) [-1143.297] (-1159.709) (-1144.005) -- 0:01:19
Average standard deviation of split frequencies: 0.010545
606000 -- (-1156.770) [-1143.170] (-1142.926) (-1144.514) * (-1140.529) (-1148.241) [-1143.929] (-1149.093) -- 0:01:18
607000 -- (-1143.080) (-1140.916) [-1138.161] (-1142.827) * (-1154.019) (-1141.714) (-1142.381) [-1143.606] -- 0:01:18
608000 -- [-1141.457] (-1143.899) (-1148.780) (-1145.982) * (-1148.892) (-1141.398) (-1143.815) [-1146.434] -- 0:01:18
609000 -- (-1145.052) (-1151.323) [-1143.748] (-1144.848) * (-1153.336) (-1138.750) (-1135.431) [-1142.310] -- 0:01:18
610000 -- (-1150.537) (-1156.014) [-1141.697] (-1141.987) * (-1143.531) (-1143.491) (-1143.738) [-1143.963] -- 0:01:18
Average standard deviation of split frequencies: 0.011493
611000 -- (-1148.199) [-1149.528] (-1139.265) (-1142.331) * [-1144.507] (-1148.682) (-1147.116) (-1142.398) -- 0:01:17
612000 -- (-1143.610) (-1147.228) [-1141.319] (-1141.206) * [-1139.562] (-1145.357) (-1149.468) (-1143.406) -- 0:01:17
613000 -- (-1144.144) (-1141.810) (-1148.405) [-1147.577] * (-1142.075) [-1142.057] (-1148.397) (-1140.738) -- 0:01:17
614000 -- (-1152.069) (-1150.323) (-1141.100) [-1142.115] * [-1142.210] (-1146.393) (-1149.781) (-1146.425) -- 0:01:17
615000 -- (-1150.876) (-1144.797) [-1135.875] (-1147.650) * [-1138.554] (-1141.867) (-1152.768) (-1146.482) -- 0:01:17
Average standard deviation of split frequencies: 0.011224
616000 -- (-1154.166) [-1142.839] (-1138.159) (-1142.748) * [-1144.032] (-1138.725) (-1143.005) (-1146.195) -- 0:01:16
617000 -- [-1141.595] (-1148.018) (-1145.819) (-1142.813) * [-1140.972] (-1142.635) (-1149.453) (-1142.042) -- 0:01:16
618000 -- (-1145.583) (-1142.596) (-1142.532) [-1140.052] * (-1145.581) [-1141.945] (-1149.898) (-1138.339) -- 0:01:16
619000 -- (-1149.709) (-1154.019) [-1138.298] (-1143.969) * [-1138.880] (-1138.957) (-1151.708) (-1142.422) -- 0:01:16
620000 -- [-1146.018] (-1155.582) (-1140.386) (-1141.385) * [-1137.385] (-1153.502) (-1149.287) (-1144.720) -- 0:01:16
Average standard deviation of split frequencies: 0.011308
621000 -- (-1141.369) (-1143.693) [-1146.560] (-1141.382) * (-1149.011) [-1143.234] (-1145.862) (-1145.750) -- 0:01:15
622000 -- [-1143.670] (-1148.098) (-1140.846) (-1148.044) * (-1148.879) (-1137.335) (-1143.512) [-1143.670] -- 0:01:15
623000 -- [-1145.421] (-1138.585) (-1141.966) (-1144.772) * (-1145.154) [-1142.376] (-1148.404) (-1139.256) -- 0:01:15
624000 -- (-1138.880) (-1145.305) [-1143.423] (-1142.876) * (-1151.489) [-1138.993] (-1150.459) (-1143.885) -- 0:01:15
625000 -- [-1143.584] (-1144.016) (-1152.298) (-1147.929) * [-1143.165] (-1142.710) (-1148.375) (-1140.623) -- 0:01:15
Average standard deviation of split frequencies: 0.011045
626000 -- (-1145.389) [-1143.205] (-1148.951) (-1141.857) * (-1149.877) (-1143.809) (-1147.294) [-1143.538] -- 0:01:14
627000 -- [-1146.836] (-1148.870) (-1142.985) (-1139.488) * (-1145.497) (-1151.006) [-1143.078] (-1141.200) -- 0:01:14
628000 -- (-1146.647) [-1144.351] (-1138.923) (-1151.782) * [-1144.684] (-1144.901) (-1143.633) (-1143.308) -- 0:01:14
629000 -- (-1149.151) (-1149.688) [-1142.652] (-1140.541) * (-1143.488) (-1157.193) (-1143.086) [-1141.943] -- 0:01:14
630000 -- (-1141.433) [-1143.612] (-1139.005) (-1146.523) * [-1136.132] (-1144.232) (-1146.330) (-1145.432) -- 0:01:14
Average standard deviation of split frequencies: 0.011960
631000 -- [-1145.262] (-1142.967) (-1142.203) (-1142.029) * (-1139.456) (-1142.022) [-1146.659] (-1144.695) -- 0:01:13
632000 -- (-1141.638) [-1136.707] (-1142.962) (-1141.427) * (-1141.526) (-1144.411) (-1144.255) [-1144.799] -- 0:01:13
633000 -- [-1143.533] (-1147.510) (-1145.438) (-1154.551) * (-1148.435) (-1145.472) (-1151.859) [-1142.459] -- 0:01:13
634000 -- (-1144.093) [-1141.779] (-1149.921) (-1141.919) * (-1158.179) (-1143.361) [-1139.096] (-1144.786) -- 0:01:13
635000 -- (-1143.900) (-1141.467) (-1142.489) [-1137.857] * (-1140.499) [-1142.644] (-1144.486) (-1142.504) -- 0:01:13
Average standard deviation of split frequencies: 0.010871
636000 -- [-1137.715] (-1142.750) (-1141.995) (-1143.503) * (-1146.436) [-1141.503] (-1141.278) (-1138.938) -- 0:01:12
637000 -- (-1149.809) (-1145.260) [-1139.480] (-1148.280) * (-1141.278) (-1149.667) [-1144.821] (-1141.773) -- 0:01:12
638000 -- (-1140.033) (-1138.373) (-1142.734) [-1139.111] * [-1141.149] (-1141.944) (-1141.359) (-1149.019) -- 0:01:12
639000 -- [-1139.782] (-1141.229) (-1144.666) (-1152.970) * [-1139.477] (-1144.336) (-1137.473) (-1142.959) -- 0:01:12
640000 -- (-1151.364) [-1143.009] (-1148.570) (-1143.299) * (-1143.710) [-1147.768] (-1148.273) (-1137.688) -- 0:01:12
Average standard deviation of split frequencies: 0.011364
641000 -- (-1148.845) [-1154.346] (-1142.689) (-1140.244) * (-1142.196) [-1137.377] (-1148.937) (-1146.037) -- 0:01:11
642000 -- (-1145.013) (-1146.638) [-1139.285] (-1140.882) * [-1145.007] (-1141.274) (-1147.927) (-1147.571) -- 0:01:11
643000 -- [-1141.574] (-1142.963) (-1142.878) (-1148.017) * (-1160.937) [-1146.022] (-1146.664) (-1147.369) -- 0:01:11
644000 -- (-1148.319) [-1144.801] (-1141.951) (-1138.640) * (-1144.735) (-1142.651) [-1141.391] (-1140.342) -- 0:01:11
645000 -- (-1139.504) (-1144.521) (-1143.877) [-1139.738] * (-1148.239) (-1148.893) (-1145.715) [-1146.151] -- 0:01:11
Average standard deviation of split frequencies: 0.011432
646000 -- (-1143.419) (-1142.638) [-1139.883] (-1143.029) * (-1143.816) (-1142.752) (-1146.343) [-1145.403] -- 0:01:10
647000 -- (-1145.414) (-1142.921) (-1144.946) [-1140.175] * (-1142.322) (-1145.961) (-1141.374) [-1140.115] -- 0:01:10
648000 -- (-1150.367) (-1144.724) (-1138.359) [-1142.949] * (-1139.980) [-1145.982] (-1142.925) (-1144.274) -- 0:01:10
649000 -- [-1139.937] (-1152.019) (-1147.439) (-1148.064) * (-1141.336) [-1140.789] (-1141.755) (-1136.774) -- 0:01:10
650000 -- (-1144.960) (-1142.007) [-1138.041] (-1143.708) * [-1141.438] (-1140.951) (-1142.703) (-1149.843) -- 0:01:10
Average standard deviation of split frequencies: 0.010867
651000 -- (-1146.203) (-1140.182) [-1140.776] (-1141.668) * [-1142.463] (-1144.703) (-1143.212) (-1144.247) -- 0:01:09
652000 -- (-1144.111) (-1142.093) [-1143.077] (-1143.892) * (-1141.977) (-1152.323) [-1142.384] (-1151.197) -- 0:01:09
653000 -- (-1147.804) (-1146.240) [-1151.788] (-1139.262) * (-1146.064) [-1140.237] (-1145.258) (-1149.347) -- 0:01:09
654000 -- [-1137.426] (-1141.183) (-1146.381) (-1139.926) * [-1142.584] (-1153.720) (-1143.335) (-1148.006) -- 0:01:09
655000 -- (-1158.736) (-1142.923) [-1147.346] (-1143.691) * [-1143.238] (-1142.758) (-1144.045) (-1143.607) -- 0:01:09
Average standard deviation of split frequencies: 0.010779
656000 -- [-1135.174] (-1149.538) (-1152.869) (-1144.939) * (-1149.571) [-1141.300] (-1142.699) (-1147.446) -- 0:01:08
657000 -- (-1143.342) [-1145.130] (-1147.530) (-1151.772) * [-1138.493] (-1139.006) (-1142.749) (-1147.250) -- 0:01:08
658000 -- (-1140.918) (-1148.991) [-1141.519] (-1150.934) * [-1140.285] (-1146.465) (-1149.888) (-1147.461) -- 0:01:08
659000 -- (-1143.087) (-1152.247) [-1136.573] (-1145.114) * (-1142.441) [-1146.857] (-1142.848) (-1146.048) -- 0:01:08
660000 -- (-1142.647) (-1143.541) (-1144.486) [-1146.118] * (-1139.890) [-1141.044] (-1145.187) (-1141.959) -- 0:01:08
Average standard deviation of split frequencies: 0.010544
661000 -- (-1144.067) [-1138.854] (-1144.865) (-1146.087) * (-1144.931) (-1139.645) [-1144.040] (-1141.950) -- 0:01:07
662000 -- (-1141.839) (-1146.577) [-1140.212] (-1143.031) * [-1143.256] (-1147.368) (-1144.269) (-1144.872) -- 0:01:07
663000 -- (-1143.652) (-1151.156) [-1141.388] (-1141.884) * (-1140.864) (-1146.815) [-1140.112] (-1152.717) -- 0:01:07
664000 -- (-1143.897) [-1136.180] (-1158.324) (-1144.597) * (-1142.941) (-1139.078) [-1139.016] (-1142.738) -- 0:01:07
665000 -- (-1141.519) (-1141.534) [-1143.151] (-1140.021) * (-1142.674) (-1140.343) [-1139.640] (-1148.876) -- 0:01:07
Average standard deviation of split frequencies: 0.011089
666000 -- (-1141.499) [-1138.152] (-1142.759) (-1144.621) * (-1155.723) (-1142.873) [-1137.231] (-1142.739) -- 0:01:06
667000 -- (-1148.143) (-1140.153) [-1143.446] (-1141.460) * (-1158.453) (-1145.581) [-1146.991] (-1155.066) -- 0:01:06
668000 -- (-1152.859) (-1144.944) (-1146.335) [-1146.720] * (-1151.795) (-1145.213) (-1143.175) [-1139.096] -- 0:01:06
669000 -- [-1147.384] (-1136.251) (-1144.871) (-1138.710) * (-1139.853) [-1140.669] (-1140.141) (-1146.275) -- 0:01:06
670000 -- (-1149.869) (-1144.765) [-1140.855] (-1137.539) * (-1143.794) (-1147.182) [-1141.208] (-1145.517) -- 0:01:06
Average standard deviation of split frequencies: 0.012105
671000 -- (-1148.449) (-1140.766) [-1143.411] (-1159.965) * (-1138.122) (-1145.135) [-1144.450] (-1143.665) -- 0:01:05
672000 -- (-1152.464) [-1142.089] (-1148.582) (-1147.724) * [-1146.952] (-1142.348) (-1144.449) (-1144.409) -- 0:01:05
673000 -- [-1141.701] (-1138.106) (-1145.174) (-1141.921) * (-1138.860) (-1146.824) (-1146.717) [-1144.006] -- 0:01:05
674000 -- (-1156.702) [-1142.572] (-1144.904) (-1146.819) * (-1144.024) [-1144.168] (-1142.576) (-1144.502) -- 0:01:05
675000 -- (-1147.723) (-1148.113) [-1140.833] (-1139.507) * (-1145.724) [-1144.207] (-1145.160) (-1150.544) -- 0:01:05
Average standard deviation of split frequencies: 0.011932
676000 -- (-1149.720) [-1144.053] (-1144.807) (-1143.846) * (-1141.223) (-1142.341) (-1148.895) [-1149.332] -- 0:01:04
677000 -- (-1143.290) (-1148.928) (-1140.604) [-1140.808] * (-1142.281) [-1147.280] (-1149.964) (-1144.486) -- 0:01:04
678000 -- [-1138.594] (-1145.659) (-1147.642) (-1142.938) * [-1135.974] (-1145.950) (-1139.171) (-1148.030) -- 0:01:04
679000 -- [-1143.758] (-1151.492) (-1146.343) (-1150.401) * [-1139.861] (-1153.142) (-1141.001) (-1149.876) -- 0:01:04
680000 -- [-1141.525] (-1148.443) (-1149.193) (-1146.940) * (-1145.620) (-1139.913) (-1140.939) [-1142.830] -- 0:01:04
Average standard deviation of split frequencies: 0.011543
681000 -- [-1142.021] (-1146.771) (-1148.282) (-1142.709) * [-1140.940] (-1150.297) (-1145.374) (-1143.263) -- 0:01:03
682000 -- (-1148.824) (-1142.981) (-1143.841) [-1140.809] * [-1152.147] (-1148.918) (-1145.509) (-1155.054) -- 0:01:03
683000 -- (-1147.184) [-1139.881] (-1148.777) (-1152.927) * (-1141.224) [-1136.830] (-1144.373) (-1141.322) -- 0:01:03
684000 -- (-1150.076) (-1144.394) (-1150.344) [-1141.431] * (-1155.759) (-1143.455) [-1142.681] (-1143.175) -- 0:01:03
685000 -- [-1143.515] (-1147.948) (-1138.993) (-1147.574) * (-1145.177) [-1138.877] (-1144.795) (-1141.525) -- 0:01:03
Average standard deviation of split frequencies: 0.010995
686000 -- [-1146.117] (-1143.972) (-1140.151) (-1141.618) * (-1140.372) [-1145.689] (-1141.501) (-1141.799) -- 0:01:02
687000 -- [-1143.625] (-1140.370) (-1146.657) (-1146.840) * (-1146.146) [-1142.507] (-1144.404) (-1148.590) -- 0:01:02
688000 -- (-1143.929) (-1155.730) [-1141.699] (-1146.502) * (-1153.525) (-1147.530) [-1139.690] (-1147.878) -- 0:01:02
689000 -- (-1145.458) (-1144.544) [-1145.503] (-1148.783) * (-1143.233) [-1145.752] (-1144.852) (-1143.500) -- 0:01:02
690000 -- (-1146.322) (-1147.904) [-1143.303] (-1140.697) * (-1147.566) (-1143.600) [-1141.728] (-1142.298) -- 0:01:02
Average standard deviation of split frequencies: 0.010921
691000 -- (-1143.650) (-1143.164) (-1146.499) [-1140.466] * (-1149.898) [-1142.177] (-1139.795) (-1158.890) -- 0:01:01
692000 -- (-1140.024) [-1140.049] (-1142.974) (-1141.201) * (-1148.004) (-1140.127) [-1140.033] (-1145.601) -- 0:01:01
693000 -- (-1142.878) (-1138.251) (-1140.064) [-1140.085] * (-1143.712) (-1144.503) (-1139.103) [-1140.133] -- 0:01:01
694000 -- (-1144.057) [-1141.407] (-1143.050) (-1141.251) * [-1138.974] (-1140.386) (-1148.477) (-1142.121) -- 0:01:01
695000 -- [-1148.839] (-1140.293) (-1149.032) (-1140.040) * (-1141.088) (-1142.804) [-1149.228] (-1161.164) -- 0:01:01
Average standard deviation of split frequencies: 0.010084
696000 -- (-1145.414) (-1144.231) (-1146.167) [-1139.309] * (-1146.197) (-1142.640) [-1143.531] (-1148.668) -- 0:01:00
697000 -- [-1138.876] (-1142.862) (-1146.766) (-1141.051) * [-1141.345] (-1145.542) (-1145.469) (-1152.284) -- 0:01:00
698000 -- [-1143.902] (-1141.884) (-1150.755) (-1149.762) * (-1143.059) [-1145.275] (-1148.521) (-1152.429) -- 0:01:00
699000 -- (-1152.539) [-1142.773] (-1145.907) (-1147.132) * (-1148.552) (-1147.116) [-1140.850] (-1153.596) -- 0:01:00
700000 -- [-1139.401] (-1147.399) (-1152.135) (-1151.299) * [-1140.429] (-1152.395) (-1142.463) (-1155.046) -- 0:01:00
Average standard deviation of split frequencies: 0.010914
701000 -- (-1140.641) (-1146.831) (-1147.053) [-1139.565] * [-1139.733] (-1147.185) (-1143.437) (-1144.048) -- 0:00:59
702000 -- (-1143.470) (-1147.635) [-1139.862] (-1149.815) * [-1139.047] (-1140.406) (-1144.289) (-1152.726) -- 0:00:59
703000 -- (-1147.227) (-1139.395) (-1139.992) [-1143.820] * [-1142.795] (-1142.245) (-1152.089) (-1151.252) -- 0:00:59
704000 -- (-1149.904) (-1142.168) [-1142.905] (-1141.881) * (-1145.192) (-1137.625) (-1143.385) [-1146.090] -- 0:00:59
705000 -- (-1146.466) (-1143.615) [-1144.155] (-1141.495) * (-1141.107) (-1136.628) [-1145.798] (-1145.138) -- 0:00:59
Average standard deviation of split frequencies: 0.011277
706000 -- (-1151.252) [-1137.076] (-1148.117) (-1139.681) * [-1142.712] (-1141.733) (-1143.251) (-1148.764) -- 0:00:58
707000 -- (-1147.686) [-1138.063] (-1147.058) (-1142.737) * (-1143.860) (-1147.665) [-1147.942] (-1138.012) -- 0:00:58
708000 -- [-1140.390] (-1147.917) (-1140.696) (-1149.695) * (-1144.192) (-1147.700) [-1141.315] (-1146.716) -- 0:00:58
709000 -- (-1154.139) [-1148.662] (-1140.036) (-1146.617) * (-1138.941) (-1151.813) [-1139.387] (-1138.430) -- 0:00:58
710000 -- (-1149.796) (-1142.322) [-1141.954] (-1139.450) * (-1140.421) (-1146.449) (-1141.572) [-1147.577] -- 0:00:58
Average standard deviation of split frequencies: 0.010466
711000 -- (-1139.196) (-1146.630) [-1144.979] (-1143.359) * (-1142.438) [-1139.881] (-1146.827) (-1147.319) -- 0:00:57
712000 -- [-1147.678] (-1144.750) (-1143.546) (-1138.823) * [-1141.343] (-1139.998) (-1153.499) (-1147.686) -- 0:00:57
713000 -- (-1147.551) [-1139.028] (-1147.407) (-1146.452) * (-1156.425) (-1142.042) [-1142.421] (-1143.489) -- 0:00:57
714000 -- (-1143.048) (-1141.043) [-1148.076] (-1144.418) * (-1140.350) [-1144.155] (-1149.614) (-1142.266) -- 0:00:57
715000 -- (-1147.991) (-1143.283) (-1149.709) [-1149.462] * (-1143.074) (-1143.065) (-1144.289) [-1142.575] -- 0:00:57
Average standard deviation of split frequencies: 0.010680
716000 -- [-1142.308] (-1137.796) (-1142.206) (-1144.169) * (-1153.649) (-1141.255) [-1146.534] (-1142.356) -- 0:00:56
717000 -- [-1141.501] (-1144.490) (-1140.360) (-1139.401) * [-1140.601] (-1140.491) (-1142.317) (-1144.721) -- 0:00:56
718000 -- [-1139.165] (-1140.273) (-1141.695) (-1146.690) * [-1144.880] (-1146.633) (-1154.758) (-1139.625) -- 0:00:56
719000 -- (-1146.087) (-1135.602) [-1139.754] (-1154.919) * (-1149.341) (-1145.016) (-1149.227) [-1144.845] -- 0:00:56
720000 -- (-1144.503) [-1137.790] (-1147.274) (-1144.770) * (-1142.516) (-1144.071) (-1138.082) [-1149.527] -- 0:00:56
Average standard deviation of split frequencies: 0.010466
721000 -- [-1143.789] (-1145.193) (-1144.403) (-1134.578) * (-1143.007) [-1141.775] (-1140.005) (-1137.923) -- 0:00:55
722000 -- [-1140.928] (-1152.607) (-1140.846) (-1144.677) * (-1147.465) [-1142.480] (-1143.327) (-1145.736) -- 0:00:55
723000 -- [-1147.947] (-1143.608) (-1145.190) (-1144.970) * (-1150.976) (-1148.687) (-1145.113) [-1144.949] -- 0:00:55
724000 -- (-1144.516) [-1140.839] (-1142.200) (-1143.349) * (-1140.178) (-1151.056) (-1144.745) [-1138.275] -- 0:00:55
725000 -- (-1151.066) [-1144.518] (-1148.919) (-1152.935) * [-1143.741] (-1148.399) (-1146.650) (-1142.447) -- 0:00:55
Average standard deviation of split frequencies: 0.010389
726000 -- [-1141.428] (-1147.237) (-1151.199) (-1143.093) * (-1137.522) (-1150.220) [-1141.961] (-1145.776) -- 0:00:54
727000 -- (-1143.888) (-1144.460) (-1146.483) [-1138.459] * (-1140.016) (-1148.004) [-1141.256] (-1149.848) -- 0:00:54
728000 -- [-1142.368] (-1152.072) (-1146.892) (-1142.463) * (-1143.462) (-1139.719) [-1135.698] (-1149.126) -- 0:00:54
729000 -- (-1148.919) [-1144.694] (-1144.012) (-1142.047) * (-1141.850) [-1138.953] (-1142.724) (-1148.480) -- 0:00:54
730000 -- [-1137.869] (-1143.532) (-1144.684) (-1149.952) * (-1137.693) (-1137.875) (-1142.091) [-1143.481] -- 0:00:54
Average standard deviation of split frequencies: 0.010609
731000 -- [-1140.639] (-1140.542) (-1141.919) (-1149.764) * (-1141.803) [-1140.145] (-1147.045) (-1151.890) -- 0:00:53
732000 -- [-1139.191] (-1152.786) (-1137.546) (-1139.327) * [-1142.954] (-1153.155) (-1142.719) (-1142.773) -- 0:00:53
733000 -- (-1149.619) [-1142.025] (-1142.698) (-1142.294) * (-1144.077) (-1146.652) (-1143.859) [-1142.784] -- 0:00:53
734000 -- (-1141.287) (-1141.516) (-1141.100) [-1141.813] * (-1149.447) [-1149.122] (-1149.021) (-1143.385) -- 0:00:53
735000 -- [-1145.564] (-1141.332) (-1143.726) (-1150.740) * (-1143.651) [-1140.345] (-1152.388) (-1141.114) -- 0:00:53
Average standard deviation of split frequencies: 0.009821
736000 -- (-1147.880) (-1141.598) (-1143.556) [-1144.035] * (-1139.866) (-1146.646) [-1142.443] (-1148.685) -- 0:00:52
737000 -- [-1139.802] (-1145.215) (-1146.815) (-1145.195) * [-1140.171] (-1143.546) (-1146.008) (-1150.052) -- 0:00:52
738000 -- [-1145.602] (-1146.279) (-1146.289) (-1147.805) * (-1138.902) (-1147.221) [-1136.885] (-1142.731) -- 0:00:52
739000 -- (-1139.526) [-1144.010] (-1148.286) (-1146.003) * [-1143.151] (-1149.605) (-1147.813) (-1149.558) -- 0:00:52
740000 -- (-1143.565) (-1145.761) (-1139.919) [-1139.220] * (-1146.973) (-1146.177) (-1147.934) [-1146.812] -- 0:00:52
Average standard deviation of split frequencies: 0.009900
741000 -- (-1145.943) (-1142.836) [-1144.407] (-1149.414) * (-1142.291) [-1138.406] (-1143.701) (-1145.705) -- 0:00:51
742000 -- (-1143.179) (-1140.985) (-1147.460) [-1140.255] * (-1147.505) (-1142.699) [-1140.854] (-1149.172) -- 0:00:51
743000 -- (-1148.197) [-1141.542] (-1148.347) (-1146.617) * (-1146.279) (-1147.701) [-1143.276] (-1146.225) -- 0:00:51
744000 -- (-1144.853) [-1147.522] (-1144.047) (-1149.125) * (-1142.197) [-1146.509] (-1143.681) (-1143.212) -- 0:00:51
745000 -- (-1141.232) (-1140.121) [-1144.039] (-1149.949) * [-1146.390] (-1144.592) (-1142.729) (-1147.552) -- 0:00:51
Average standard deviation of split frequencies: 0.008987
746000 -- (-1150.865) (-1143.895) [-1143.000] (-1143.805) * (-1141.283) [-1141.553] (-1147.750) (-1151.623) -- 0:00:50
747000 -- (-1145.045) (-1139.203) [-1143.626] (-1142.021) * [-1139.804] (-1154.371) (-1147.504) (-1144.001) -- 0:00:50
748000 -- [-1141.763] (-1145.559) (-1144.385) (-1140.472) * (-1139.615) (-1142.901) [-1138.413] (-1142.929) -- 0:00:50
749000 -- (-1140.874) (-1140.744) (-1139.592) [-1141.343] * (-1145.585) (-1143.193) [-1143.466] (-1147.727) -- 0:00:50
750000 -- (-1149.845) (-1141.830) [-1140.519] (-1143.741) * [-1139.081] (-1142.059) (-1150.462) (-1147.655) -- 0:00:50
Average standard deviation of split frequencies: 0.008792
751000 -- (-1142.628) [-1144.210] (-1146.374) (-1150.012) * (-1154.710) (-1141.004) (-1140.944) [-1145.814] -- 0:00:49
752000 -- (-1148.832) (-1148.701) [-1145.526] (-1153.332) * (-1141.133) (-1147.172) [-1144.652] (-1142.664) -- 0:00:49
753000 -- [-1140.983] (-1139.658) (-1145.549) (-1139.274) * (-1147.645) (-1151.194) (-1148.621) [-1145.971] -- 0:00:49
754000 -- (-1152.846) [-1141.641] (-1143.648) (-1147.639) * (-1146.332) (-1146.968) (-1143.103) [-1143.139] -- 0:00:49
755000 -- [-1142.593] (-1144.732) (-1139.190) (-1140.073) * (-1137.457) [-1140.607] (-1146.395) (-1141.752) -- 0:00:49
Average standard deviation of split frequencies: 0.008868
756000 -- (-1142.995) (-1148.094) (-1139.718) [-1146.853] * [-1138.218] (-1145.716) (-1143.461) (-1145.550) -- 0:00:48
757000 -- (-1142.434) (-1147.857) [-1148.770] (-1141.175) * (-1150.787) (-1138.674) [-1142.525] (-1140.157) -- 0:00:48
758000 -- [-1138.729] (-1146.995) (-1143.365) (-1147.030) * (-1140.257) [-1136.637] (-1142.329) (-1144.410) -- 0:00:48
759000 -- (-1146.222) (-1146.860) [-1145.319] (-1141.098) * (-1149.363) (-1139.410) [-1145.066] (-1140.259) -- 0:00:48
760000 -- (-1145.884) (-1142.157) [-1145.591] (-1151.746) * (-1137.568) (-1143.540) (-1148.135) [-1142.247] -- 0:00:48
Average standard deviation of split frequencies: 0.008952
761000 -- (-1142.996) [-1141.563] (-1139.940) (-1145.731) * (-1148.430) [-1144.127] (-1145.401) (-1141.388) -- 0:00:47
762000 -- [-1141.006] (-1136.632) (-1141.216) (-1146.640) * (-1139.451) [-1138.929] (-1142.455) (-1139.781) -- 0:00:47
763000 -- [-1146.278] (-1139.085) (-1144.240) (-1142.187) * (-1141.799) [-1142.734] (-1143.174) (-1151.840) -- 0:00:47
764000 -- (-1145.104) [-1138.151] (-1144.903) (-1142.537) * (-1145.232) (-1139.868) [-1147.016] (-1154.237) -- 0:00:47
765000 -- (-1149.299) (-1145.220) [-1142.985] (-1144.259) * (-1137.823) [-1143.406] (-1138.674) (-1154.223) -- 0:00:47
Average standard deviation of split frequencies: 0.008547
766000 -- (-1148.450) (-1143.532) (-1139.240) [-1138.500] * (-1144.053) (-1141.109) [-1143.028] (-1146.613) -- 0:00:46
767000 -- (-1142.480) (-1142.547) (-1135.946) [-1150.381] * (-1143.486) (-1141.513) [-1139.014] (-1146.351) -- 0:00:46
768000 -- (-1143.918) [-1139.397] (-1145.091) (-1145.752) * (-1144.143) (-1144.134) [-1138.863] (-1143.527) -- 0:00:46
769000 -- (-1143.111) [-1143.846] (-1146.275) (-1146.416) * (-1138.822) (-1142.603) [-1137.237] (-1149.014) -- 0:00:46
770000 -- (-1145.857) (-1140.025) [-1146.879] (-1143.898) * [-1140.995] (-1148.072) (-1144.428) (-1145.911) -- 0:00:46
Average standard deviation of split frequencies: 0.009039
771000 -- [-1144.306] (-1138.374) (-1141.847) (-1145.422) * [-1137.273] (-1139.188) (-1143.931) (-1146.715) -- 0:00:45
772000 -- (-1138.440) [-1139.798] (-1142.981) (-1143.198) * (-1143.099) [-1143.602] (-1145.430) (-1144.259) -- 0:00:45
773000 -- (-1140.243) [-1138.084] (-1142.812) (-1147.580) * (-1142.560) (-1137.665) [-1141.871] (-1148.121) -- 0:00:45
774000 -- (-1152.375) [-1148.961] (-1146.540) (-1143.798) * (-1147.485) (-1148.693) (-1149.181) [-1147.474] -- 0:00:45
775000 -- (-1145.346) [-1143.590] (-1142.987) (-1143.927) * (-1144.995) (-1142.302) [-1149.197] (-1138.783) -- 0:00:45
Average standard deviation of split frequencies: 0.008572
776000 -- (-1147.626) (-1144.740) (-1152.714) [-1142.722] * (-1141.717) [-1150.061] (-1145.583) (-1143.294) -- 0:00:44
777000 -- (-1152.381) [-1140.789] (-1149.743) (-1148.765) * (-1146.057) [-1141.744] (-1147.561) (-1146.990) -- 0:00:44
778000 -- (-1141.234) [-1143.603] (-1141.824) (-1144.823) * (-1144.052) (-1150.135) (-1142.232) [-1137.055] -- 0:00:44
779000 -- (-1139.249) (-1144.032) (-1145.675) [-1139.975] * (-1138.992) (-1143.273) (-1150.841) [-1145.733] -- 0:00:44
780000 -- [-1142.210] (-1140.894) (-1156.736) (-1141.690) * (-1143.328) (-1142.995) (-1148.027) [-1138.399] -- 0:00:44
Average standard deviation of split frequencies: 0.008521
781000 -- (-1145.098) (-1142.834) (-1145.857) [-1143.459] * [-1143.552] (-1145.998) (-1148.622) (-1138.837) -- 0:00:43
782000 -- (-1148.001) (-1148.662) [-1143.939] (-1144.762) * [-1139.760] (-1144.920) (-1147.068) (-1139.604) -- 0:00:43
783000 -- (-1146.218) (-1139.765) (-1147.864) [-1146.137] * (-1144.251) [-1141.424] (-1143.294) (-1148.548) -- 0:00:43
784000 -- [-1139.591] (-1145.678) (-1143.763) (-1141.523) * (-1152.201) (-1144.504) [-1142.953] (-1146.353) -- 0:00:43
785000 -- (-1149.140) [-1140.082] (-1145.711) (-1151.184) * [-1144.590] (-1144.697) (-1144.454) (-1146.137) -- 0:00:43
Average standard deviation of split frequencies: 0.008596
786000 -- (-1146.580) [-1139.091] (-1142.891) (-1152.621) * (-1145.050) (-1149.588) [-1145.352] (-1148.287) -- 0:00:42
787000 -- (-1145.650) (-1140.588) [-1142.492] (-1140.795) * (-1143.614) (-1151.636) [-1137.411] (-1148.483) -- 0:00:42
788000 -- (-1142.283) (-1142.595) (-1146.494) [-1146.793] * [-1140.457] (-1148.577) (-1142.215) (-1146.695) -- 0:00:42
789000 -- (-1142.697) (-1141.814) (-1143.779) [-1146.262] * (-1142.624) [-1143.914] (-1144.265) (-1158.115) -- 0:00:42
790000 -- (-1140.621) [-1142.311] (-1135.114) (-1145.803) * (-1143.985) (-1144.150) [-1142.736] (-1147.635) -- 0:00:42
Average standard deviation of split frequencies: 0.008082
791000 -- (-1147.552) (-1142.645) [-1146.498] (-1140.175) * (-1144.693) (-1154.798) [-1139.696] (-1145.759) -- 0:00:41
792000 -- (-1148.778) (-1141.495) [-1142.655] (-1152.244) * (-1148.507) (-1148.513) [-1144.525] (-1141.645) -- 0:00:41
793000 -- [-1153.950] (-1139.069) (-1147.346) (-1142.518) * (-1143.969) (-1137.435) (-1141.542) [-1140.940] -- 0:00:41
794000 -- (-1146.270) [-1142.616] (-1150.581) (-1147.124) * [-1142.524] (-1141.801) (-1142.327) (-1146.370) -- 0:00:41
795000 -- [-1140.958] (-1142.135) (-1144.247) (-1155.025) * (-1151.161) [-1145.292] (-1143.551) (-1145.482) -- 0:00:41
Average standard deviation of split frequencies: 0.007896
796000 -- (-1147.712) (-1142.012) [-1141.637] (-1142.920) * (-1143.378) (-1154.530) [-1148.026] (-1139.465) -- 0:00:40
797000 -- (-1137.851) (-1143.400) [-1139.412] (-1148.987) * (-1143.444) (-1137.806) (-1143.435) [-1140.013] -- 0:00:40
798000 -- (-1139.694) (-1141.899) [-1140.103] (-1147.801) * (-1146.063) [-1138.934] (-1141.718) (-1141.820) -- 0:00:40
799000 -- [-1137.942] (-1147.059) (-1146.246) (-1145.081) * (-1144.720) [-1145.973] (-1146.470) (-1138.106) -- 0:00:40
800000 -- [-1140.971] (-1149.937) (-1141.667) (-1139.435) * (-1150.124) (-1146.339) [-1143.706] (-1147.407) -- 0:00:40
Average standard deviation of split frequencies: 0.007458
801000 -- (-1141.062) [-1143.911] (-1147.540) (-1143.194) * [-1144.878] (-1143.614) (-1144.663) (-1147.139) -- 0:00:39
802000 -- (-1145.869) (-1152.213) (-1150.341) [-1140.539] * (-1144.970) (-1143.913) [-1147.205] (-1142.086) -- 0:00:39
803000 -- (-1144.489) (-1145.501) (-1147.466) [-1138.052] * [-1139.139] (-1145.292) (-1145.020) (-1142.759) -- 0:00:39
804000 -- [-1140.505] (-1141.331) (-1143.788) (-1145.591) * [-1142.818] (-1141.020) (-1150.272) (-1139.542) -- 0:00:39
805000 -- (-1141.129) (-1141.355) (-1144.306) [-1142.162] * [-1140.771] (-1145.117) (-1154.243) (-1136.942) -- 0:00:39
Average standard deviation of split frequencies: 0.007213
806000 -- [-1141.588] (-1138.907) (-1144.138) (-1145.108) * (-1143.240) (-1148.487) (-1142.599) [-1140.718] -- 0:00:38
807000 -- [-1144.895] (-1144.417) (-1143.545) (-1143.784) * (-1150.160) [-1139.157] (-1144.770) (-1138.603) -- 0:00:38
808000 -- (-1149.095) [-1142.208] (-1138.669) (-1142.878) * (-1142.872) (-1140.702) [-1138.373] (-1140.878) -- 0:00:38
809000 -- (-1145.732) (-1141.926) [-1137.806] (-1144.751) * (-1145.906) (-1143.603) (-1142.402) [-1136.639] -- 0:00:38
810000 -- (-1141.617) (-1146.483) [-1140.212] (-1139.973) * [-1138.945] (-1141.217) (-1140.260) (-1140.966) -- 0:00:38
Average standard deviation of split frequencies: 0.006913
811000 -- (-1144.242) (-1140.588) (-1150.416) [-1140.110] * (-1151.863) (-1140.536) [-1141.598] (-1141.761) -- 0:00:37
812000 -- [-1143.162] (-1139.274) (-1145.830) (-1143.549) * (-1146.509) [-1147.206] (-1141.427) (-1142.109) -- 0:00:37
813000 -- (-1144.478) (-1145.671) (-1144.205) [-1146.641] * (-1146.869) (-1145.113) (-1139.928) [-1143.224] -- 0:00:37
814000 -- (-1143.594) [-1140.104] (-1139.526) (-1152.621) * (-1149.287) [-1140.037] (-1143.034) (-1143.676) -- 0:00:37
815000 -- (-1141.875) [-1141.005] (-1144.709) (-1140.851) * [-1142.399] (-1145.547) (-1143.942) (-1150.497) -- 0:00:37
Average standard deviation of split frequencies: 0.006804
816000 -- (-1140.894) (-1149.823) [-1142.393] (-1145.306) * [-1139.586] (-1151.452) (-1147.593) (-1144.088) -- 0:00:36
817000 -- (-1142.065) [-1147.415] (-1145.244) (-1147.843) * (-1144.898) [-1145.710] (-1139.817) (-1148.470) -- 0:00:36
818000 -- (-1136.891) (-1145.937) (-1142.530) [-1147.647] * (-1144.867) (-1144.491) (-1143.789) [-1142.289] -- 0:00:36
819000 -- (-1144.817) (-1147.779) [-1144.420] (-1139.636) * (-1141.047) (-1143.420) [-1139.736] (-1146.011) -- 0:00:36
820000 -- (-1149.615) [-1146.601] (-1147.821) (-1139.729) * [-1142.598] (-1141.894) (-1147.740) (-1142.318) -- 0:00:36
Average standard deviation of split frequencies: 0.006255
821000 -- (-1146.862) (-1149.433) [-1143.518] (-1138.346) * (-1147.037) (-1143.432) [-1141.489] (-1143.630) -- 0:00:35
822000 -- (-1147.314) (-1146.760) [-1143.839] (-1147.225) * (-1146.084) [-1147.675] (-1141.015) (-1148.134) -- 0:00:35
823000 -- [-1147.657] (-1140.776) (-1142.631) (-1149.829) * (-1142.518) [-1141.926] (-1150.674) (-1139.044) -- 0:00:35
824000 -- (-1145.666) (-1148.129) [-1152.775] (-1148.303) * (-1138.538) [-1148.401] (-1152.986) (-1143.574) -- 0:00:35
825000 -- (-1146.945) (-1143.188) [-1141.999] (-1148.467) * [-1150.462] (-1143.622) (-1150.254) (-1141.124) -- 0:00:35
Average standard deviation of split frequencies: 0.006278
826000 -- [-1144.947] (-1142.725) (-1149.687) (-1146.849) * (-1147.030) (-1148.833) [-1143.730] (-1151.962) -- 0:00:34
827000 -- (-1142.557) (-1149.801) (-1147.322) [-1141.867] * [-1138.807] (-1152.337) (-1137.634) (-1142.445) -- 0:00:34
828000 -- (-1144.864) (-1138.892) (-1147.574) [-1146.595] * (-1141.167) (-1146.048) [-1137.941] (-1142.723) -- 0:00:34
829000 -- (-1142.774) [-1141.662] (-1141.924) (-1143.857) * (-1151.465) (-1147.719) (-1145.274) [-1146.622] -- 0:00:34
830000 -- (-1147.404) [-1140.759] (-1145.282) (-1146.220) * [-1143.727] (-1153.152) (-1146.047) (-1148.268) -- 0:00:34
Average standard deviation of split frequencies: 0.006179
831000 -- (-1147.814) (-1147.430) (-1151.899) [-1142.613] * (-1150.717) (-1142.527) (-1150.313) [-1140.368] -- 0:00:33
832000 -- (-1141.281) (-1149.027) [-1139.538] (-1150.302) * (-1144.568) (-1152.334) [-1139.355] (-1149.654) -- 0:00:33
833000 -- [-1144.553] (-1147.369) (-1140.086) (-1145.842) * (-1145.531) [-1145.182] (-1146.823) (-1149.838) -- 0:00:33
834000 -- [-1143.883] (-1150.982) (-1145.951) (-1143.085) * (-1143.787) (-1151.746) [-1136.796] (-1139.894) -- 0:00:33
835000 -- (-1151.375) [-1143.558] (-1148.031) (-1145.422) * (-1145.366) (-1144.523) (-1150.841) [-1139.279] -- 0:00:33
Average standard deviation of split frequencies: 0.006328
836000 -- (-1142.526) (-1150.800) (-1145.807) [-1140.684] * (-1139.926) [-1144.871] (-1144.696) (-1143.907) -- 0:00:32
837000 -- [-1147.367] (-1140.149) (-1141.945) (-1143.286) * (-1151.559) [-1141.986] (-1145.630) (-1143.725) -- 0:00:32
838000 -- (-1142.657) (-1145.665) [-1144.496] (-1141.027) * [-1140.485] (-1140.657) (-1145.159) (-1141.917) -- 0:00:32
839000 -- [-1143.321] (-1138.760) (-1141.068) (-1152.063) * [-1141.363] (-1145.636) (-1153.776) (-1145.593) -- 0:00:32
840000 -- (-1143.577) (-1148.133) (-1139.472) [-1142.574] * (-1144.249) (-1140.649) (-1138.656) [-1142.503] -- 0:00:32
Average standard deviation of split frequencies: 0.005545
841000 -- [-1146.170] (-1137.520) (-1139.863) (-1141.656) * (-1140.347) (-1137.405) (-1145.531) [-1142.884] -- 0:00:31
842000 -- (-1144.276) (-1147.224) [-1140.399] (-1144.426) * (-1142.522) [-1146.052] (-1144.091) (-1143.418) -- 0:00:31
843000 -- (-1146.623) (-1148.616) [-1139.510] (-1142.041) * (-1150.233) (-1142.930) (-1143.704) [-1143.412] -- 0:00:31
844000 -- (-1142.979) (-1143.497) [-1141.307] (-1143.138) * (-1146.480) (-1148.852) [-1146.474] (-1144.516) -- 0:00:31
845000 -- (-1139.158) [-1138.468] (-1143.830) (-1149.974) * (-1144.768) (-1142.098) [-1140.995] (-1143.329) -- 0:00:31
Average standard deviation of split frequencies: 0.005263
846000 -- (-1147.910) [-1140.969] (-1153.030) (-1137.698) * (-1140.581) (-1151.180) (-1142.475) [-1142.303] -- 0:00:30
847000 -- (-1142.556) [-1137.776] (-1141.732) (-1144.687) * (-1150.292) [-1143.700] (-1144.849) (-1144.116) -- 0:00:30
848000 -- (-1140.073) [-1140.827] (-1142.448) (-1144.264) * (-1144.366) (-1144.869) [-1141.179] (-1139.620) -- 0:00:30
849000 -- (-1142.404) (-1141.905) (-1142.570) [-1145.059] * (-1142.821) [-1137.875] (-1138.922) (-1151.982) -- 0:00:30
850000 -- (-1137.739) [-1139.271] (-1142.772) (-1150.988) * (-1144.711) (-1142.500) [-1143.706] (-1147.993) -- 0:00:30
Average standard deviation of split frequencies: 0.005295
851000 -- [-1139.472] (-1139.177) (-1141.362) (-1139.245) * (-1146.294) [-1140.591] (-1140.784) (-1141.483) -- 0:00:29
852000 -- (-1139.478) (-1153.674) [-1141.535] (-1146.157) * [-1147.166] (-1143.679) (-1150.377) (-1147.457) -- 0:00:29
853000 -- [-1141.520] (-1147.231) (-1141.736) (-1143.987) * [-1141.206] (-1142.096) (-1160.150) (-1138.730) -- 0:00:29
854000 -- (-1148.857) (-1143.893) (-1141.987) [-1142.918] * (-1145.885) [-1147.441] (-1139.951) (-1151.852) -- 0:00:29
855000 -- (-1144.237) (-1142.725) (-1143.254) [-1148.477] * (-1140.866) [-1146.107] (-1142.143) (-1153.289) -- 0:00:29
Average standard deviation of split frequencies: 0.005507
856000 -- (-1145.772) (-1141.718) (-1147.723) [-1138.383] * (-1144.976) (-1144.951) (-1142.565) [-1142.262] -- 0:00:28
857000 -- (-1137.184) (-1143.425) [-1142.588] (-1142.771) * [-1141.748] (-1143.707) (-1148.366) (-1147.060) -- 0:00:28
858000 -- (-1140.107) [-1143.270] (-1142.902) (-1147.391) * (-1139.147) (-1142.000) [-1137.864] (-1143.305) -- 0:00:28
859000 -- [-1144.808] (-1148.438) (-1140.149) (-1142.671) * (-1140.024) (-1141.801) [-1138.954] (-1143.762) -- 0:00:28
860000 -- [-1145.500] (-1144.290) (-1143.579) (-1141.425) * (-1140.770) (-1146.264) (-1153.036) [-1139.177] -- 0:00:28
Average standard deviation of split frequencies: 0.005964
861000 -- (-1142.510) (-1150.494) [-1141.423] (-1149.615) * [-1143.339] (-1146.753) (-1138.214) (-1154.289) -- 0:00:27
862000 -- (-1140.638) (-1142.519) (-1140.726) [-1143.886] * (-1145.298) (-1142.507) (-1145.007) [-1143.060] -- 0:00:27
863000 -- (-1141.212) (-1141.867) (-1146.650) [-1136.352] * (-1140.316) [-1141.658] (-1145.544) (-1147.568) -- 0:00:27
864000 -- (-1146.608) (-1157.552) (-1144.793) [-1149.112] * [-1139.479] (-1136.355) (-1151.395) (-1145.219) -- 0:00:27
865000 -- [-1141.626] (-1135.830) (-1147.354) (-1148.504) * (-1143.801) [-1135.384] (-1150.913) (-1151.177) -- 0:00:27
Average standard deviation of split frequencies: 0.006169
866000 -- (-1142.870) (-1141.518) (-1145.593) [-1146.107] * [-1139.979] (-1141.318) (-1150.771) (-1141.848) -- 0:00:26
867000 -- [-1142.013] (-1148.251) (-1147.753) (-1142.694) * [-1144.119] (-1138.041) (-1148.640) (-1149.838) -- 0:00:26
868000 -- [-1142.741] (-1147.227) (-1142.424) (-1143.737) * (-1143.111) (-1141.827) (-1144.104) [-1143.536] -- 0:00:26
869000 -- (-1142.921) (-1139.432) [-1141.629] (-1138.534) * (-1145.020) (-1140.314) [-1140.867] (-1141.410) -- 0:00:26
870000 -- [-1142.918] (-1144.909) (-1143.230) (-1147.274) * (-1145.531) (-1149.298) (-1139.160) [-1138.901] -- 0:00:26
Average standard deviation of split frequencies: 0.005715
871000 -- [-1140.913] (-1141.330) (-1145.457) (-1149.276) * (-1144.372) [-1150.313] (-1150.098) (-1141.694) -- 0:00:25
872000 -- (-1141.353) [-1143.011] (-1144.171) (-1139.350) * (-1143.648) (-1150.901) [-1144.183] (-1138.563) -- 0:00:25
873000 -- (-1144.618) (-1144.406) (-1147.633) [-1137.622] * (-1150.682) (-1148.003) (-1142.011) [-1147.395] -- 0:00:25
874000 -- (-1142.104) (-1143.691) (-1145.046) [-1137.180] * (-1142.826) [-1137.363] (-1155.133) (-1140.747) -- 0:00:25
875000 -- (-1155.789) (-1141.377) (-1139.851) [-1145.476] * [-1142.954] (-1152.342) (-1157.073) (-1140.277) -- 0:00:25
Average standard deviation of split frequencies: 0.005919
876000 -- (-1141.178) [-1142.334] (-1150.342) (-1143.289) * (-1142.693) [-1143.431] (-1140.293) (-1150.064) -- 0:00:24
877000 -- (-1147.209) (-1143.799) (-1149.375) [-1146.623] * (-1150.357) (-1138.458) [-1141.118] (-1143.979) -- 0:00:24
878000 -- (-1144.536) [-1142.775] (-1142.306) (-1139.448) * [-1137.925] (-1143.846) (-1143.766) (-1145.324) -- 0:00:24
879000 -- (-1144.659) [-1143.764] (-1146.914) (-1145.438) * [-1146.248] (-1144.620) (-1148.260) (-1143.960) -- 0:00:24
880000 -- [-1140.591] (-1147.098) (-1141.595) (-1145.659) * [-1146.620] (-1147.674) (-1143.973) (-1146.621) -- 0:00:24
Average standard deviation of split frequencies: 0.005888
881000 -- (-1141.187) (-1148.932) [-1147.325] (-1143.781) * (-1146.558) (-1140.622) [-1142.268] (-1145.476) -- 0:00:23
882000 -- (-1141.546) (-1146.014) (-1150.018) [-1140.284] * (-1146.472) (-1143.730) (-1142.718) [-1144.142] -- 0:00:23
883000 -- (-1152.083) [-1139.723] (-1145.003) (-1143.587) * (-1141.136) [-1138.810] (-1143.628) (-1144.510) -- 0:00:23
884000 -- (-1159.050) (-1144.791) [-1143.333] (-1145.612) * (-1145.283) [-1142.290] (-1143.259) (-1140.518) -- 0:00:23
885000 -- (-1143.557) (-1142.523) [-1140.951] (-1141.718) * (-1151.939) (-1142.401) [-1138.619] (-1142.699) -- 0:00:23
Average standard deviation of split frequencies: 0.005143
886000 -- (-1141.608) (-1140.528) (-1149.373) [-1142.198] * (-1137.984) (-1144.848) (-1158.366) [-1145.184] -- 0:00:22
887000 -- (-1143.300) (-1142.896) (-1147.887) [-1148.768] * [-1137.817] (-1146.294) (-1144.683) (-1140.038) -- 0:00:22
888000 -- [-1139.342] (-1142.684) (-1142.980) (-1146.818) * [-1140.697] (-1153.700) (-1149.804) (-1147.711) -- 0:00:22
889000 -- (-1140.164) (-1139.776) (-1147.310) [-1139.985] * (-1139.398) (-1148.382) [-1137.138] (-1142.798) -- 0:00:22
890000 -- (-1138.243) (-1145.836) (-1142.211) [-1141.962] * (-1145.701) (-1149.348) (-1138.010) [-1140.720] -- 0:00:22
Average standard deviation of split frequencies: 0.005352
891000 -- [-1144.410] (-1139.057) (-1144.834) (-1148.160) * (-1146.579) (-1145.928) [-1152.382] (-1143.213) -- 0:00:21
892000 -- (-1151.157) (-1140.131) (-1148.888) [-1147.015] * [-1141.383] (-1142.016) (-1145.977) (-1138.048) -- 0:00:21
893000 -- (-1142.969) (-1140.534) [-1143.760] (-1139.337) * (-1140.484) (-1142.589) (-1148.747) [-1144.517] -- 0:00:21
894000 -- [-1139.758] (-1142.389) (-1145.064) (-1150.522) * (-1142.560) (-1144.887) (-1142.892) [-1139.369] -- 0:00:21
895000 -- (-1143.469) [-1138.996] (-1144.322) (-1149.668) * [-1146.903] (-1143.358) (-1145.695) (-1140.865) -- 0:00:21
Average standard deviation of split frequencies: 0.005261
896000 -- [-1145.304] (-1142.226) (-1139.636) (-1142.559) * (-1148.247) [-1142.836] (-1141.224) (-1141.085) -- 0:00:20
897000 -- [-1142.126] (-1145.498) (-1141.066) (-1148.591) * [-1140.184] (-1143.349) (-1144.056) (-1144.984) -- 0:00:20
898000 -- [-1142.794] (-1143.270) (-1143.478) (-1147.828) * [-1139.265] (-1145.342) (-1143.478) (-1141.266) -- 0:00:20
899000 -- [-1141.174] (-1143.783) (-1141.442) (-1149.105) * [-1141.901] (-1143.279) (-1148.956) (-1152.707) -- 0:00:20
900000 -- (-1140.603) [-1139.884] (-1142.057) (-1139.240) * [-1144.021] (-1142.013) (-1140.832) (-1139.062) -- 0:00:20
Average standard deviation of split frequencies: 0.005118
901000 -- [-1146.932] (-1141.329) (-1141.642) (-1142.429) * [-1141.290] (-1147.284) (-1143.811) (-1147.802) -- 0:00:19
902000 -- (-1140.211) (-1143.146) (-1149.199) [-1144.386] * (-1141.795) (-1146.132) (-1141.447) [-1142.056] -- 0:00:19
903000 -- (-1141.958) (-1146.973) [-1146.271] (-1146.381) * (-1144.511) [-1144.414] (-1148.689) (-1138.324) -- 0:00:19
904000 -- (-1140.608) (-1148.919) (-1143.579) [-1143.706] * (-1145.923) (-1140.392) [-1144.222] (-1143.138) -- 0:00:19
905000 -- [-1146.861] (-1147.695) (-1145.891) (-1141.955) * (-1142.615) [-1140.381] (-1150.569) (-1149.613) -- 0:00:19
Average standard deviation of split frequencies: 0.005550
906000 -- (-1141.738) (-1142.432) (-1138.654) [-1143.754] * [-1139.916] (-1148.770) (-1148.070) (-1142.602) -- 0:00:18
907000 -- (-1146.740) (-1143.090) [-1141.949] (-1146.255) * [-1141.499] (-1138.377) (-1148.361) (-1145.342) -- 0:00:18
908000 -- (-1146.025) [-1144.138] (-1149.334) (-1141.926) * (-1140.181) [-1139.844] (-1153.017) (-1149.576) -- 0:00:18
909000 -- (-1141.874) [-1138.702] (-1147.988) (-1155.365) * (-1144.832) [-1141.987] (-1144.740) (-1145.497) -- 0:00:18
910000 -- [-1144.222] (-1149.123) (-1143.419) (-1148.039) * [-1143.663] (-1147.134) (-1144.349) (-1141.150) -- 0:00:18
Average standard deviation of split frequencies: 0.005982
911000 -- [-1139.010] (-1137.920) (-1153.812) (-1140.531) * [-1140.874] (-1143.395) (-1141.389) (-1144.193) -- 0:00:17
912000 -- (-1139.629) [-1143.546] (-1152.456) (-1139.581) * (-1146.258) (-1145.466) (-1144.229) [-1139.544] -- 0:00:17
913000 -- (-1146.119) [-1144.787] (-1145.775) (-1140.821) * (-1144.835) [-1146.674] (-1148.843) (-1143.703) -- 0:00:17
914000 -- (-1149.442) [-1145.140] (-1142.973) (-1134.936) * (-1145.134) [-1134.683] (-1137.996) (-1139.923) -- 0:00:17
915000 -- [-1141.841] (-1146.959) (-1144.367) (-1140.893) * [-1151.386] (-1139.590) (-1140.620) (-1145.340) -- 0:00:17
Average standard deviation of split frequencies: 0.006061
916000 -- [-1137.794] (-1148.459) (-1141.573) (-1136.340) * (-1144.171) (-1140.366) [-1141.330] (-1141.758) -- 0:00:16
917000 -- (-1145.238) (-1152.194) (-1145.006) [-1144.555] * [-1144.694] (-1146.863) (-1141.052) (-1150.349) -- 0:00:16
918000 -- [-1141.105] (-1139.477) (-1148.240) (-1148.362) * [-1141.394] (-1156.782) (-1146.701) (-1139.214) -- 0:00:16
919000 -- [-1140.646] (-1140.401) (-1139.351) (-1144.387) * (-1149.655) (-1147.699) (-1144.768) [-1148.166] -- 0:00:16
920000 -- (-1147.174) [-1146.569] (-1141.046) (-1139.715) * (-1153.643) [-1142.230] (-1145.005) (-1151.650) -- 0:00:16
Average standard deviation of split frequencies: 0.006486
921000 -- (-1143.248) (-1143.623) [-1138.755] (-1145.865) * (-1153.423) [-1138.453] (-1143.056) (-1148.327) -- 0:00:15
922000 -- (-1148.329) (-1143.550) (-1144.658) [-1137.785] * (-1144.018) [-1145.875] (-1148.453) (-1141.006) -- 0:00:15
923000 -- (-1144.781) (-1142.748) (-1144.224) [-1142.634] * (-1140.634) (-1145.475) (-1148.950) [-1138.335] -- 0:00:15
924000 -- (-1140.419) (-1149.621) (-1139.499) [-1138.980] * [-1141.928] (-1137.770) (-1142.395) (-1141.549) -- 0:00:15
925000 -- [-1138.898] (-1144.430) (-1147.020) (-1152.775) * (-1142.102) (-1143.008) (-1141.893) [-1144.613] -- 0:00:15
Average standard deviation of split frequencies: 0.006052
926000 -- (-1144.670) (-1145.654) (-1145.057) [-1142.290] * [-1140.864] (-1147.610) (-1142.831) (-1144.269) -- 0:00:14
927000 -- (-1144.606) (-1141.133) [-1140.454] (-1140.530) * (-1139.232) [-1144.431] (-1144.000) (-1144.504) -- 0:00:14
928000 -- [-1143.474] (-1149.911) (-1144.616) (-1146.063) * (-1140.816) (-1143.952) (-1153.962) [-1142.638] -- 0:00:14
929000 -- (-1144.386) (-1142.342) (-1135.563) [-1143.891] * (-1142.610) [-1138.208] (-1147.662) (-1139.604) -- 0:00:14
930000 -- (-1141.755) (-1141.712) [-1143.576] (-1146.124) * [-1139.784] (-1146.734) (-1140.580) (-1146.740) -- 0:00:14
Average standard deviation of split frequencies: 0.005347
931000 -- [-1139.263] (-1148.115) (-1136.330) (-1140.835) * (-1145.942) (-1144.717) (-1146.983) [-1143.763] -- 0:00:13
932000 -- (-1140.567) [-1141.075] (-1152.606) (-1143.291) * (-1148.539) (-1146.662) [-1145.483] (-1146.227) -- 0:00:13
933000 -- (-1143.391) (-1142.514) [-1148.459] (-1147.434) * (-1151.974) [-1139.955] (-1145.070) (-1148.953) -- 0:00:13
934000 -- (-1149.528) [-1143.503] (-1143.771) (-1138.967) * (-1154.571) (-1139.903) [-1142.137] (-1139.387) -- 0:00:13
935000 -- (-1143.821) (-1142.743) [-1139.789] (-1152.076) * (-1141.502) (-1142.923) [-1143.753] (-1143.668) -- 0:00:13
Average standard deviation of split frequencies: 0.005372
936000 -- (-1140.535) (-1138.907) [-1140.362] (-1153.972) * [-1142.007] (-1152.875) (-1146.385) (-1144.780) -- 0:00:12
937000 -- (-1138.060) [-1140.049] (-1140.209) (-1142.041) * (-1138.728) (-1144.156) (-1142.223) [-1141.599] -- 0:00:12
938000 -- [-1144.987] (-1145.400) (-1144.479) (-1139.024) * (-1147.690) (-1152.989) (-1149.417) [-1143.766] -- 0:00:12
939000 -- (-1144.791) (-1146.711) [-1138.752] (-1142.612) * [-1138.395] (-1137.549) (-1145.528) (-1145.589) -- 0:00:12
940000 -- (-1139.981) [-1139.675] (-1148.988) (-1143.017) * (-1144.527) (-1150.423) (-1143.038) [-1143.894] -- 0:00:12
Average standard deviation of split frequencies: 0.005290
941000 -- [-1139.526] (-1155.038) (-1145.708) (-1146.961) * (-1137.054) (-1154.113) [-1139.039] (-1143.133) -- 0:00:11
942000 -- (-1145.807) [-1142.727] (-1148.893) (-1140.967) * (-1140.566) [-1139.698] (-1151.089) (-1141.447) -- 0:00:11
943000 -- (-1147.841) (-1142.720) (-1139.551) [-1146.040] * (-1147.000) [-1143.954] (-1144.388) (-1141.813) -- 0:00:11
944000 -- (-1147.461) [-1136.109] (-1148.187) (-1143.696) * [-1142.982] (-1146.938) (-1141.976) (-1144.647) -- 0:00:11
945000 -- (-1143.967) (-1145.711) (-1141.803) [-1146.418] * [-1150.062] (-1139.521) (-1144.013) (-1141.446) -- 0:00:11
Average standard deviation of split frequencies: 0.005149
946000 -- (-1142.827) [-1142.581] (-1149.272) (-1142.862) * (-1146.196) (-1142.585) (-1139.144) [-1142.408] -- 0:00:10
947000 -- (-1143.523) (-1150.229) [-1145.002] (-1143.011) * [-1138.193] (-1144.767) (-1145.154) (-1140.394) -- 0:00:10
948000 -- [-1146.294] (-1141.187) (-1139.568) (-1138.797) * (-1139.337) [-1145.565] (-1151.457) (-1147.927) -- 0:00:10
949000 -- [-1151.809] (-1138.198) (-1144.955) (-1146.530) * [-1138.075] (-1138.390) (-1142.523) (-1151.715) -- 0:00:10
950000 -- [-1142.253] (-1143.381) (-1140.833) (-1149.390) * (-1139.222) (-1149.340) [-1142.973] (-1140.931) -- 0:00:10
Average standard deviation of split frequencies: 0.005344
951000 -- (-1152.340) (-1137.266) [-1139.680] (-1142.681) * (-1157.504) [-1139.625] (-1142.948) (-1156.970) -- 0:00:09
952000 -- (-1150.573) (-1140.783) (-1141.189) [-1143.727] * (-1142.896) (-1146.942) [-1138.618] (-1149.087) -- 0:00:09
953000 -- (-1146.115) (-1143.246) [-1140.794] (-1144.231) * (-1148.399) (-1144.627) [-1146.321] (-1146.592) -- 0:00:09
954000 -- (-1144.019) (-1146.027) [-1142.967] (-1146.508) * (-1146.805) [-1144.546] (-1145.279) (-1142.202) -- 0:00:09
955000 -- [-1141.997] (-1139.079) (-1137.495) (-1153.152) * (-1148.686) [-1144.408] (-1148.740) (-1145.556) -- 0:00:09
Average standard deviation of split frequencies: 0.004876
956000 -- (-1153.893) (-1146.454) (-1140.989) [-1142.412] * (-1146.853) [-1138.161] (-1147.381) (-1143.290) -- 0:00:08
957000 -- (-1147.662) (-1142.285) [-1142.126] (-1145.874) * [-1140.996] (-1151.230) (-1143.175) (-1145.614) -- 0:00:08
958000 -- (-1151.903) (-1146.230) [-1139.249] (-1137.668) * [-1140.372] (-1143.838) (-1141.994) (-1137.530) -- 0:00:08
959000 -- (-1148.433) (-1154.103) [-1139.232] (-1144.030) * [-1145.333] (-1141.861) (-1141.841) (-1142.492) -- 0:00:08
960000 -- (-1146.205) (-1149.414) (-1146.859) [-1139.624] * [-1138.504] (-1146.913) (-1136.066) (-1143.126) -- 0:00:08
Average standard deviation of split frequencies: 0.004089
961000 -- [-1141.437] (-1142.232) (-1141.274) (-1147.850) * [-1146.911] (-1141.243) (-1144.222) (-1149.636) -- 0:00:07
962000 -- (-1144.065) (-1142.636) (-1144.721) [-1141.285] * (-1142.308) (-1147.070) [-1146.591] (-1141.086) -- 0:00:07
963000 -- [-1144.971] (-1153.424) (-1143.377) (-1142.408) * (-1146.970) [-1136.496] (-1141.072) (-1146.481) -- 0:00:07
964000 -- (-1141.658) (-1147.983) [-1137.930] (-1147.780) * [-1140.685] (-1148.452) (-1139.026) (-1145.907) -- 0:00:07
965000 -- (-1141.708) (-1144.941) (-1145.586) [-1141.088] * [-1138.845] (-1138.527) (-1143.024) (-1150.981) -- 0:00:07
Average standard deviation of split frequencies: 0.004446
966000 -- (-1139.476) (-1147.577) (-1144.329) [-1141.488] * (-1149.975) [-1144.293] (-1136.715) (-1139.752) -- 0:00:06
967000 -- (-1145.088) (-1141.841) [-1140.943] (-1147.854) * (-1143.103) (-1142.881) [-1137.585] (-1146.612) -- 0:00:06
968000 -- (-1144.168) (-1150.569) (-1157.599) [-1141.946] * (-1154.121) (-1135.731) (-1144.387) [-1136.432] -- 0:00:06
969000 -- (-1143.013) [-1136.431] (-1138.061) (-1143.973) * [-1141.946] (-1145.847) (-1144.906) (-1138.604) -- 0:00:06
970000 -- (-1139.250) [-1141.396] (-1144.024) (-1151.846) * (-1140.349) [-1144.719] (-1150.317) (-1144.335) -- 0:00:06
Average standard deviation of split frequencies: 0.003777
971000 -- [-1145.373] (-1140.085) (-1147.152) (-1141.092) * (-1148.090) [-1140.479] (-1145.831) (-1140.760) -- 0:00:05
972000 -- (-1147.279) [-1140.319] (-1150.487) (-1142.880) * (-1145.208) (-1146.087) [-1141.650] (-1141.723) -- 0:00:05
973000 -- (-1147.475) (-1139.561) (-1161.050) [-1148.938] * (-1141.807) (-1145.010) (-1144.515) [-1138.495] -- 0:00:05
974000 -- (-1145.543) (-1143.070) [-1141.644] (-1141.999) * (-1145.447) (-1146.451) [-1142.096] (-1142.511) -- 0:00:05
975000 -- [-1144.234] (-1145.895) (-1148.391) (-1141.293) * [-1144.417] (-1142.879) (-1139.428) (-1143.457) -- 0:00:05
Average standard deviation of split frequencies: 0.003757
976000 -- [-1145.770] (-1142.865) (-1142.645) (-1143.211) * (-1144.090) (-1152.228) (-1149.924) [-1142.421] -- 0:00:04
977000 -- (-1142.597) (-1147.503) [-1143.133] (-1149.144) * [-1138.859] (-1146.079) (-1149.105) (-1145.954) -- 0:00:04
978000 -- (-1152.393) (-1150.391) (-1145.555) [-1148.764] * (-1142.492) (-1143.855) [-1141.706] (-1152.144) -- 0:00:04
979000 -- (-1147.095) (-1148.022) (-1160.879) [-1143.190] * (-1150.956) (-1145.185) (-1143.017) [-1145.977] -- 0:00:04
980000 -- (-1143.058) (-1142.787) [-1142.917] (-1137.853) * (-1149.486) (-1142.757) [-1144.904] (-1144.264) -- 0:00:04
Average standard deviation of split frequencies: 0.003739
981000 -- (-1143.474) (-1139.219) [-1142.147] (-1150.032) * (-1140.358) (-1146.747) [-1138.882] (-1149.631) -- 0:00:03
982000 -- [-1139.695] (-1142.582) (-1144.438) (-1152.210) * (-1143.459) (-1141.491) (-1143.443) [-1142.407] -- 0:00:03
983000 -- (-1144.448) (-1137.298) (-1154.678) [-1145.153] * (-1141.720) (-1140.451) [-1144.217] (-1151.674) -- 0:00:03
984000 -- [-1145.171] (-1147.695) (-1146.167) (-1143.531) * (-1143.021) (-1143.006) (-1146.050) [-1151.996] -- 0:00:03
985000 -- (-1143.343) [-1143.238] (-1144.448) (-1153.086) * (-1150.678) (-1143.554) [-1146.227] (-1148.888) -- 0:00:03
Average standard deviation of split frequencies: 0.003825
986000 -- (-1142.032) (-1146.964) [-1138.527] (-1146.727) * (-1149.150) [-1146.521] (-1147.763) (-1142.498) -- 0:00:02
987000 -- (-1141.143) (-1150.290) [-1143.090] (-1147.573) * (-1143.972) (-1148.905) [-1146.472] (-1141.243) -- 0:00:02
988000 -- (-1146.832) (-1143.336) (-1145.918) [-1137.818] * (-1144.053) (-1145.077) (-1142.781) [-1136.494] -- 0:00:02
989000 -- (-1143.722) (-1144.950) [-1140.180] (-1142.887) * (-1143.991) [-1143.910] (-1141.198) (-1144.051) -- 0:00:02
990000 -- (-1151.299) (-1144.541) [-1139.928] (-1148.102) * (-1140.266) (-1144.465) [-1140.786] (-1143.023) -- 0:00:02
Average standard deviation of split frequencies: 0.004124
991000 -- (-1142.910) (-1140.616) (-1139.899) [-1141.975] * [-1143.833] (-1145.844) (-1146.266) (-1148.209) -- 0:00:01
992000 -- (-1147.396) [-1139.332] (-1144.479) (-1144.309) * (-1146.409) (-1146.146) [-1141.519] (-1148.485) -- 0:00:01
993000 -- (-1143.608) (-1154.984) [-1139.273] (-1144.619) * (-1141.980) (-1145.856) (-1145.696) [-1141.664] -- 0:00:01
994000 -- [-1140.000] (-1143.085) (-1146.572) (-1146.358) * (-1145.422) [-1138.168] (-1158.460) (-1144.150) -- 0:00:01
995000 -- (-1145.007) [-1138.261] (-1150.347) (-1151.043) * (-1145.497) [-1143.587] (-1141.795) (-1140.742) -- 0:00:01
Average standard deviation of split frequencies: 0.004207
996000 -- (-1152.311) (-1144.910) (-1152.920) [-1144.520] * (-1142.791) (-1149.161) (-1145.629) [-1141.209] -- 0:00:00
997000 -- (-1140.967) (-1144.105) (-1145.786) [-1146.590] * (-1153.999) (-1144.068) (-1143.774) [-1143.942] -- 0:00:00
998000 -- [-1139.908] (-1146.189) (-1142.154) (-1143.471) * (-1146.109) [-1144.583] (-1144.679) (-1151.367) -- 0:00:00
999000 -- (-1155.493) (-1148.888) (-1143.361) [-1143.040] * (-1146.876) (-1147.241) [-1140.494] (-1143.645) -- 0:00:00
1000000 -- (-1147.765) (-1148.919) (-1144.114) [-1147.281] * (-1147.246) (-1142.039) (-1148.707) [-1141.725] -- 0:00:00
Average standard deviation of split frequencies: 0.004292
Analysis completed in 3 mins 20 seconds
Analysis used 198.91 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1132.65
Likelihood of best state for "cold" chain of run 2 was -1132.66
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
68.2 % ( 64 %) Dirichlet(Revmat{all})
82.6 % ( 76 %) Slider(Revmat{all})
27.6 % ( 19 %) Dirichlet(Pi{all})
30.2 % ( 32 %) Slider(Pi{all})
79.8 % ( 64 %) Multiplier(Alpha{1,2})
73.7 % ( 47 %) Multiplier(Alpha{3})
92.3 % ( 81 %) Slider(Pinvar{all})
38.4 % ( 42 %) ExtSPR(Tau{all},V{all})
10.5 % ( 9 %) ExtTBR(Tau{all},V{all})
40.6 % ( 32 %) NNI(Tau{all},V{all})
40.1 % ( 47 %) ParsSPR(Tau{all},V{all})
27.3 % ( 33 %) Multiplier(V{all})
55.5 % ( 57 %) Nodeslider(V{all})
26.4 % ( 32 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
67.6 % ( 64 %) Dirichlet(Revmat{all})
82.7 % ( 83 %) Slider(Revmat{all})
27.9 % ( 28 %) Dirichlet(Pi{all})
30.7 % ( 26 %) Slider(Pi{all})
80.2 % ( 68 %) Multiplier(Alpha{1,2})
74.1 % ( 48 %) Multiplier(Alpha{3})
92.4 % ( 76 %) Slider(Pinvar{all})
38.7 % ( 36 %) ExtSPR(Tau{all},V{all})
10.4 % ( 9 %) ExtTBR(Tau{all},V{all})
40.6 % ( 40 %) NNI(Tau{all},V{all})
40.3 % ( 38 %) ParsSPR(Tau{all},V{all})
27.1 % ( 20 %) Multiplier(V{all})
55.5 % ( 50 %) Nodeslider(V{all})
26.5 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.77 0.58 0.42
2 | 166559 0.79 0.61
3 | 167012 166022 0.80
4 | 166325 167584 166498
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.77 0.58 0.42
2 | 166176 0.79 0.60
3 | 166784 167113 0.80
4 | 166318 166739 166870
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1140.84
| 1 1 |
| 2 1 2 |
| 2 2 |
| 2 1 1 1 2 1 1 2 |
| 2 1 1 1 2 1 2 |
| *2 2 2 112 21 1 1 * 2 22 1 122 1 1 2|
| 2 2 2 2 1 2 1 22 22 2 1 1 1|
| 1 112 2 1 2 2 11 1 1 2 1* 2 1 |
|* * 1 2 1 2 1 2 1 2 1 1 2 1 |
| 1 1 22 2 2 2 1 2 2 |
| 1 2 1 2 1 1 2 |
| 1 2 |
| 1 2 1 1 |
| 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1144.41
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1138.99 -1150.11
2 -1138.92 -1151.65
--------------------------------------
TOTAL -1138.96 -1151.15
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.049991 0.000094 0.032747 0.070314 0.049216 1169.66 1237.95 1.000
r(A<->C){all} 0.057955 0.001639 0.000054 0.135203 0.048454 367.55 595.99 1.000
r(A<->G){all} 0.308498 0.006472 0.159727 0.472576 0.304598 481.72 484.15 1.000
r(A<->T){all} 0.059258 0.001149 0.007039 0.127443 0.052757 604.63 824.56 1.000
r(C<->G){all} 0.068379 0.002223 0.000070 0.162695 0.059199 366.84 470.88 1.000
r(C<->T){all} 0.430546 0.007266 0.273412 0.598583 0.427641 459.20 488.09 1.000
r(G<->T){all} 0.075364 0.001676 0.008881 0.156847 0.068968 503.68 594.86 1.000
pi(A){all} 0.249189 0.000264 0.218814 0.280954 0.249079 1105.15 1231.64 1.000
pi(C){all} 0.206031 0.000212 0.179091 0.235370 0.205697 1038.33 1079.15 1.000
pi(G){all} 0.210622 0.000231 0.181055 0.239878 0.210508 1238.34 1273.56 1.000
pi(T){all} 0.334158 0.000311 0.300140 0.368910 0.333791 1349.19 1383.28 1.000
alpha{1,2} 0.957541 0.986826 0.000033 2.874150 0.652734 1266.28 1274.06 1.000
alpha{3} 1.334892 1.154283 0.000990 3.348768 1.078726 1082.63 1153.10 1.000
pinvar{all} 0.299916 0.040714 0.000055 0.667298 0.271195 751.07 871.97 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
--------------
1 -- .*******
2 -- .*......
3 -- ..*.....
4 -- ...*....
5 -- ....*...
6 -- .....*..
7 -- ......*.
8 -- .......*
9 -- .*****..
10 -- ..****..
11 -- ...***..
12 -- ...*.*..
13 -- .*****.*
14 -- ......**
15 -- ....**..
16 -- .******.
17 -- ...**...
--------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
9 3002 1.000000 0.000000 1.000000 1.000000 2
10 3002 1.000000 0.000000 1.000000 1.000000 2
11 2889 0.962358 0.002355 0.960693 0.964024 2
12 1039 0.346103 0.011777 0.337775 0.354430 2
13 1030 0.343105 0.003769 0.340440 0.345769 2
14 1028 0.342438 0.002827 0.340440 0.344437 2
15 982 0.327115 0.008480 0.321119 0.333111 2
16 944 0.314457 0.006595 0.309793 0.319121 2
17 918 0.305796 0.002827 0.303797 0.307795 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.001144 0.000001 0.000001 0.003365 0.000801 1.000 2
length{all}[2] 0.001124 0.000001 0.000000 0.003323 0.000759 1.000 2
length{all}[3] 0.011995 0.000019 0.004105 0.020265 0.011400 1.000 2
length{all}[4] 0.001105 0.000001 0.000000 0.003241 0.000761 1.001 2
length{all}[5] 0.001043 0.000001 0.000001 0.003076 0.000716 1.000 2
length{all}[6] 0.001142 0.000001 0.000000 0.003415 0.000806 1.000 2
length{all}[7] 0.005578 0.000007 0.001335 0.010525 0.005247 1.000 2
length{all}[8] 0.002207 0.000003 0.000011 0.005331 0.001851 1.000 2
length{all}[9] 0.003312 0.000004 0.000328 0.007185 0.002903 1.000 2
length{all}[10] 0.015102 0.000022 0.007628 0.025402 0.014512 1.000 2
length{all}[11] 0.004153 0.000006 0.000265 0.008638 0.003714 1.000 2
length{all}[12] 0.001122 0.000001 0.000000 0.003247 0.000810 1.000 2
length{all}[13] 0.001140 0.000001 0.000001 0.003454 0.000783 1.000 2
length{all}[14] 0.001125 0.000001 0.000001 0.003322 0.000758 0.999 2
length{all}[15] 0.001047 0.000001 0.000001 0.003204 0.000714 1.003 2
length{all}[16] 0.001106 0.000001 0.000000 0.003374 0.000761 0.999 2
length{all}[17] 0.001050 0.000001 0.000002 0.003200 0.000711 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004292
Maximum standard deviation of split frequencies = 0.011777
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C7 (7)
|
+------------------------------------------------------------------------ C8 (8)
|
| /------------------------------------------------------ C2 (2)
| |
\-------100-------+ /------------------------------------ C3 (3)
| |
\-------100-------+ /------------------ C4 (4)
| |
\--------96-------+------------------ C5 (5)
|
\------------------ C6 (6)
Phylogram (based on average branch lengths):
/-- C1 (1)
|
|------------- C7 (7)
|
+----- C8 (8)
|
| /-- C2 (2)
| |
\------+ /---------------------------- C3 (3)
| |
\------------------------------------+ /-- C4 (4)
| |
\--------+-- C5 (5)
|
\-- C6 (6)
|-----------| 0.005 expected changes per site
Calculating tree probabilities...
Credible sets of trees (43 trees sampled):
50 % credible set contains 5 trees
90 % credible set contains 9 trees
95 % credible set contains 9 trees
99 % credible set contains 27 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Fri Oct 21 22:38:19 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_M_ABQ57219_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.08 sec, SCORE=1000, Nseq=8, Len=229
C1 -MTDSNNTVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C2 MSTDSNNTVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C3 MSSNSTESVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C4 MSTSSNETVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C5 MSTSSNETVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C6 MSTSSNETVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C7 MMTDSNNTVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
C8 -MTDSNNTVPVTEVLEHLRNWNFSWNIILTVFIAVLQYGNMKYSFFLYGV
:.*.::******************************************
C1 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C2 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C3 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C4 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C5 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C6 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C7 EVLIMWLLWLLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
C8 KMLIMWLLWPLVIALSIFNAYADFGVNWWFFSFSILMLVITLVLWLMYII
::******* ****************************************
C1 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C2 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C3 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C4 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C5 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C6 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
C7 NSFKLYRRTRTFWAFNPETDAIAVISVFGRFYSIPMPVAPTGITLTILSG
C8 NSFKLYRRTRTFWAFNPETDAIAVISVFGRSYSIPMPVAPTGITLTILSG
****************************** *******************
C1 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C2 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C3 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C4 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C5 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C6 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C7 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
C8 TLFFDGIRIATGVQPAHLPQFVTVAKPGTTIIYTRAGRSLNASTNTGWAF
**************************************************
C1 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C2 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C3 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C4 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C5 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C6 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C7 YVRSKHGDYSALSNSSDNLTENDRLLHLV
C8 YVRSKHGDYSALSNSSDNLTENDRLLHLV
*****************************
-- Starting log on Fri Oct 21 22:56:31 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/HKU2_HK_46_2006_M_ABQ57219_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/codeml,HKU2_HK_46_2006_M_ABQ57219_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C1 687 sites
reading seq# 2 C2 687 sites
reading seq# 3 C3 687 sites
reading seq# 4 C4 687 sites
reading seq# 5 C5 687 sites
reading seq# 6 C6 687 sites
reading seq# 7 C7 687 sites
reading seq# 8 C8 687 sitesns = 8 ls = 687
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Sites with gaps or missing data are removed.
3 ambiguity characters in seq. 1
3 ambiguity characters in seq. 8
1 sites are removed. 1
Sequences read..
Counting site patterns.. 0:00
Compressing, 83 patterns at 228 / 228 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 83 patterns at 228 / 228 sites (100.0%), 0:00
Counting codons..
224 bytes for distance
81008 bytes for conP
7304 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 7, 8, (2, (3, (4, 5, 6)))); MP score: 29
162016 bytes for conP, adjusted
0.022654 0.088925 0.091629 0.077056 0.102808 0.081608 0.011597 0.101843 0.029163 0.108594 0.100262 0.300000 0.798808 0.588962
ntime & nrate & np: 11 2 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.849511
np = 14
lnL0 = -1268.800944
Iterating by ming2
Initial: fx= 1268.800944
x= 0.02265 0.08893 0.09163 0.07706 0.10281 0.08161 0.01160 0.10184 0.02916 0.10859 0.10026 0.30000 0.79881 0.58896
1 h-m-p 0.0000 0.0001 798.0738 ++ 1225.719075 m 0.0001 19 | 1/14
2 h-m-p 0.0000 0.0000 1303.5541 ++ 1215.931882 m 0.0000 36 | 2/14
3 h-m-p 0.0000 0.0001 2327.7404 ++ 1149.624930 m 0.0001 53 | 3/14
4 h-m-p 0.0000 0.0000 1800.1132 ++ 1148.001861 m 0.0000 70 | 4/14
5 h-m-p 0.0000 0.0000 2357.7503 ++ 1146.266953 m 0.0000 87 | 5/14
6 h-m-p 0.0000 0.0007 103.6665 ++YYYYCCCCC 1143.682760 8 0.0004 118 | 5/14
7 h-m-p 0.0008 0.0039 59.2284 +YYYCYCCC 1137.386746 7 0.0033 147 | 5/14
8 h-m-p 0.0003 0.0014 274.9348 +YCYCCC 1133.117350 5 0.0008 173 | 5/14
9 h-m-p 0.0033 0.0164 10.6775 ++ 1129.212545 m 0.0164 190 | 6/14
10 h-m-p 0.0011 0.0054 50.0886 +YYCCCC 1124.381485 5 0.0036 216 | 6/14
11 h-m-p 0.0173 0.0867 2.9645 YCYCCC 1121.840526 5 0.0427 241 | 5/14
12 h-m-p 0.0001 0.0006 229.8319 +CYCCC 1118.292468 4 0.0005 266 | 5/14
13 h-m-p 0.0032 0.0160 4.4070 +YYYYYCYCCC 1111.341551 10 0.0134 297 | 5/14
14 h-m-p 0.1571 0.7855 0.3245 +YYCCCC 1106.786732 5 0.5046 323 | 5/14
15 h-m-p 0.2575 1.2873 0.3771 +YCCCC 1103.450556 4 0.7462 357 | 5/14
16 h-m-p 0.0621 0.3106 0.6062 ++ 1101.386669 m 0.3106 383 | 6/14
17 h-m-p 0.5077 3.1052 0.3698 YCCCC 1099.216844 4 1.1109 416 | 6/14
18 h-m-p 1.6000 8.0000 0.1893 CYCCC 1098.698824 4 0.9894 448 | 6/14
19 h-m-p 0.5283 4.3782 0.3545 +YCCC 1097.391470 3 1.4802 479 | 6/14
20 h-m-p 1.6000 8.0000 0.2965 CYCC 1096.207439 3 2.2450 509 | 6/14
21 h-m-p 1.4307 7.1535 0.2723 YCCC 1095.431894 3 2.4663 539 | 6/14
22 h-m-p 0.7924 3.9621 0.3938 YCCCC 1094.817322 4 1.4749 571 | 6/14
23 h-m-p 1.6000 8.0000 0.1284 CCC 1094.539604 2 1.7227 600 | 6/14
24 h-m-p 0.8581 8.0000 0.2578 YCC 1094.387182 2 1.6397 628 | 6/14
25 h-m-p 1.6000 8.0000 0.2086 CCC 1094.302340 2 2.1153 657 | 6/14
26 h-m-p 1.6000 8.0000 0.1589 CYC 1094.269955 2 1.9073 685 | 6/14
27 h-m-p 1.6000 8.0000 0.1407 CC 1094.260662 1 1.8670 712 | 6/14
28 h-m-p 1.6000 8.0000 0.0158 C 1094.260237 0 1.4108 737 | 6/14
29 h-m-p 1.6000 8.0000 0.0021 C 1094.260212 0 1.2889 762 | 6/14
30 h-m-p 1.6000 8.0000 0.0002 Y 1094.260212 0 1.2036 787 | 6/14
31 h-m-p 1.6000 8.0000 0.0001 Y 1094.260212 0 1.0947 812 | 6/14
32 h-m-p 1.6000 8.0000 0.0000 C 1094.260212 0 1.6000 837 | 6/14
33 h-m-p 1.6000 8.0000 0.0000 -Y 1094.260212 0 0.1000 863
Out..
lnL = -1094.260212
864 lfun, 2592 eigenQcodon, 19008 P(t)
end of tree file.
Time used: 0:07
Model 2: PositiveSelection
TREE # 1
(1, 7, 8, (2, (3, (4, 5, 6)))); MP score: 29
0.030725 0.074405 0.106849 0.074698 0.025591 0.095311 0.049631 0.103155 0.028687 0.072933 0.022548 6.143172 1.727527 0.289518 0.378929 1.399336
ntime & nrate & np: 11 3 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 2.973296
np = 16
lnL0 = -1184.837603
Iterating by ming2
Initial: fx= 1184.837603
x= 0.03073 0.07441 0.10685 0.07470 0.02559 0.09531 0.04963 0.10315 0.02869 0.07293 0.02255 6.14317 1.72753 0.28952 0.37893 1.39934
1 h-m-p 0.0000 0.0001 569.7359 ++ 1148.694138 m 0.0001 21 | 1/16
2 h-m-p 0.0000 0.0000 9217.6601 ++ 1142.875268 m 0.0000 40 | 2/16
3 h-m-p 0.0000 0.0000 983.2614 ++ 1139.586896 m 0.0000 59 | 3/16
4 h-m-p 0.0000 0.0000 1295.9283 ++ 1137.840240 m 0.0000 78 | 4/16
5 h-m-p 0.0000 0.0001 1227.3608 ++ 1119.618579 m 0.0001 97 | 5/16
6 h-m-p 0.0001 0.0004 147.2243 +YYCYYYYC 1112.164715 7 0.0004 125 | 5/16
7 h-m-p 0.0002 0.0009 42.3611 +YYYYCCC 1108.358582 6 0.0007 153 | 5/16
8 h-m-p 0.0002 0.0009 115.0723 +YCYCCC 1105.182584 5 0.0005 181 | 5/16
9 h-m-p 0.0001 0.0003 250.9909 +YYCCCC 1102.930172 5 0.0002 209 | 5/16
10 h-m-p 0.0079 0.0610 5.6892 +YYYYCCC 1101.312953 6 0.0320 237 | 5/16
11 h-m-p 0.0094 0.0468 6.6587 ++ 1099.142373 m 0.0468 256 | 6/16
12 h-m-p 0.0055 0.0274 18.6664 ++ 1094.836132 m 0.0274 275 | 7/16
13 h-m-p 0.4127 2.0637 0.3915 YYCC 1094.408956 3 0.3774 298 | 6/16
14 h-m-p 0.1063 0.6804 1.3898 +YCCC 1093.965112 3 0.3077 332 | 6/16
15 h-m-p 0.2482 5.1294 1.7228 YCCC 1093.456059 3 0.5776 356 | 6/16
16 h-m-p 1.0259 5.1293 0.8062 CCCC 1092.992274 3 1.3546 381 | 6/16
17 h-m-p 0.6226 3.1128 1.0858 YYC 1092.779564 2 0.4788 412 | 6/16
18 h-m-p 1.6000 8.0000 0.2436 CCC 1092.736645 2 0.5524 435 | 6/16
19 h-m-p 0.9132 8.0000 0.1474 CC 1092.722633 1 0.9738 466 | 6/16
20 h-m-p 0.9860 8.0000 0.1455 YC 1092.710700 1 1.5926 496 | 6/16
21 h-m-p 1.3035 8.0000 0.1778 YC 1092.696299 1 2.1672 526 | 6/16
22 h-m-p 1.6000 8.0000 0.1431 CC 1092.689846 1 1.4088 557 | 6/16
23 h-m-p 1.6000 8.0000 0.0480 CC 1092.688239 1 2.2410 588 | 6/16
24 h-m-p 1.6000 8.0000 0.0383 ++ 1092.684203 m 8.0000 617 | 6/16
25 h-m-p 1.6000 8.0000 0.1228 +C 1092.669959 0 6.2634 647 | 6/16
26 h-m-p 1.6000 8.0000 0.3039 CC 1092.663915 1 1.6474 678 | 6/16
27 h-m-p 1.6000 8.0000 0.1711 CC 1092.660690 1 1.2551 709 | 6/16
28 h-m-p 0.4930 8.0000 0.4355 +C 1092.656960 0 1.9719 739 | 6/16
29 h-m-p 1.6000 8.0000 0.2265 CYC 1092.655202 2 1.8614 771 | 6/16
30 h-m-p 1.0701 8.0000 0.3939 YC 1092.653811 1 2.2791 801 | 6/16
31 h-m-p 1.6000 8.0000 0.3515 CY 1092.653305 1 1.9352 832 | 6/16
32 h-m-p 1.6000 8.0000 0.3218 C 1092.653059 0 1.5001 861 | 6/16
33 h-m-p 0.9489 8.0000 0.5088 YC 1092.652884 1 1.6233 891 | 6/16
34 h-m-p 1.6000 8.0000 0.3539 YC 1092.652798 1 2.7908 921 | 6/16
35 h-m-p 1.6000 8.0000 0.3738 C 1092.652764 0 2.1705 950 | 6/16
36 h-m-p 1.6000 8.0000 0.3320 Y 1092.652750 0 2.9381 979 | 6/16
37 h-m-p 1.6000 8.0000 0.3531 C 1092.652745 0 2.3112 1008 | 6/16
38 h-m-p 1.6000 8.0000 0.3568 Y 1092.652742 0 2.8874 1037 | 6/16
39 h-m-p 1.6000 8.0000 0.3408 C 1092.652742 0 2.2377 1066 | 6/16
40 h-m-p 1.6000 8.0000 0.3338 Y 1092.652741 0 2.8809 1095 | 6/16
41 h-m-p 1.6000 8.0000 0.3665 C 1092.652741 0 2.5251 1124 | 6/16
42 h-m-p 1.6000 8.0000 0.3185 C 1092.652741 0 2.1768 1153 | 6/16
43 h-m-p 1.6000 8.0000 0.3880 +Y 1092.652741 0 4.0376 1183 | 6/16
44 h-m-p 1.6000 8.0000 0.2832 C 1092.652741 0 1.3627 1212 | 6/16
45 h-m-p 1.1356 8.0000 0.3398 +C 1092.652741 0 4.5423 1242 | 6/16
46 h-m-p 1.6000 8.0000 0.3162 C 1092.652741 0 1.8981 1271 | 6/16
47 h-m-p 1.6000 8.0000 0.3039 C 1092.652741 0 1.6000 1300 | 6/16
48 h-m-p 1.6000 8.0000 0.1197 ---Y 1092.652741 0 0.0063 1332 | 6/16
49 h-m-p 0.0160 8.0000 0.4768 -------------.. | 6/16
50 h-m-p 0.0160 8.0000 0.0003 ------------- | 6/16
51 h-m-p 0.0160 8.0000 0.0003 -------------
Out..
lnL = -1092.652741
1453 lfun, 5812 eigenQcodon, 47949 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1098.892439 S = -1057.369583 -55.576589
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 83 patterns 0:24
did 20 / 83 patterns 0:24
did 30 / 83 patterns 0:24
did 40 / 83 patterns 0:24
did 50 / 83 patterns 0:24
did 60 / 83 patterns 0:25
did 70 / 83 patterns 0:25
did 80 / 83 patterns 0:25
did 83 / 83 patterns 0:25end of tree file.
Time used: 0:25
Model 7: beta
TREE # 1
(1, 7, 8, (2, (3, (4, 5, 6)))); MP score: 29
0.064823 0.062309 0.016370 0.052644 0.083942 0.091128 0.046440 0.084468 0.060196 0.093890 0.092439 6.927772 0.712336 1.518949
ntime & nrate & np: 11 1 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 3.786827
np = 14
lnL0 = -1199.773945
Iterating by ming2
Initial: fx= 1199.773945
x= 0.06482 0.06231 0.01637 0.05264 0.08394 0.09113 0.04644 0.08447 0.06020 0.09389 0.09244 6.92777 0.71234 1.51895
1 h-m-p 0.0000 0.0001 532.5553 ++ 1172.635241 m 0.0001 33 | 0/14
2 h-m-p 0.0000 0.0000 7163.6163 ++ 1123.237045 m 0.0000 64 | 1/14
3 h-m-p 0.0000 0.0000 4047.2070 ++ 1118.860011 m 0.0000 95 | 2/14
4 h-m-p 0.0000 0.0000 3561.0182 ++ 1106.459548 m 0.0000 125 | 3/14
5 h-m-p 0.0000 0.0000 467.6295 ++ 1102.955586 m 0.0000 154 | 4/14
6 h-m-p 0.0000 0.0000 875.0733 ++ 1102.640617 m 0.0000 182 | 5/14
7 h-m-p 0.0000 0.0048 20.5800 ++CCC 1102.541149 2 0.0003 215 | 5/14
8 h-m-p 0.0012 0.0136 6.1762 +YYYC 1101.982865 3 0.0042 245 | 5/14
9 h-m-p 0.0031 0.0156 3.3299 YC 1101.960982 1 0.0015 272 | 5/14
10 h-m-p 0.0003 0.0421 15.8868 +++YYCCC 1100.863636 4 0.0148 307 | 5/14
11 h-m-p 0.0931 0.4655 0.8525 YCC 1100.576613 2 0.0714 336 | 5/14
12 h-m-p 0.0374 1.1046 1.6262 +CYC 1100.234581 2 0.1364 366 | 5/14
13 h-m-p 0.1385 0.8742 1.6020 +CYCYYYCCCC 1097.052664 10 0.8372 409 | 5/14
14 h-m-p 0.0016 0.0080 10.3293 CYYC 1096.978913 3 0.0040 440 | 5/14
15 h-m-p 0.0004 0.0022 23.3278 ++ 1096.867570 m 0.0022 466 | 5/14
16 h-m-p 0.0000 0.0000 0.0984
h-m-p: 7.71816272e-17 3.85908136e-16 9.84108567e-02 1096.867570
.. | 5/14
17 h-m-p 0.0000 0.0004 2851.9036 YCYCYC 1095.041590 5 0.0000 522 | 5/14
18 h-m-p 0.0000 0.0004 247.9279 YYYC 1094.536933 3 0.0000 551 | 5/14
19 h-m-p 0.0001 0.0004 51.6868 CCCCC 1094.390138 4 0.0001 585 | 5/14
20 h-m-p 0.0002 0.0028 25.9399 CYC 1094.332605 2 0.0002 614 | 5/14
21 h-m-p 0.0007 0.0081 7.7721 YC 1094.329430 1 0.0001 641 | 5/14
22 h-m-p 0.0002 0.0146 3.8883 YC 1094.328324 1 0.0002 668 | 5/14
23 h-m-p 0.0066 0.6781 0.1075 C 1094.328306 0 0.0019 694 | 5/14
24 h-m-p 0.0014 0.1861 0.1496 ++++ 1094.325490 m 0.1861 722 | 6/14
25 h-m-p 0.0562 0.2904 0.4951 YYCYC 1094.323862 4 0.0439 754 | 6/14
26 h-m-p 0.0030 0.7544 7.2390 ++CCC 1094.302360 2 0.0639 785 | 6/14
27 h-m-p 1.6000 8.0000 0.0598 YC 1094.296759 1 2.9613 811 | 6/14
28 h-m-p 1.6000 8.0000 0.0207 C 1094.296639 0 1.6000 836 | 6/14
29 h-m-p 1.6000 8.0000 0.0006 +C 1094.296320 0 6.0835 862 | 6/14
30 h-m-p 0.5198 8.0000 0.0065 Y 1094.296307 0 1.0537 887 | 6/14
31 h-m-p 1.6000 8.0000 0.0001 C 1094.296307 0 2.0215 912 | 6/14
32 h-m-p 1.6000 8.0000 0.0000 ++ 1094.296307 m 8.0000 937 | 6/14
33 h-m-p 0.8041 8.0000 0.0001 C 1094.296307 0 0.9899 962 | 6/14
34 h-m-p 1.6000 8.0000 0.0000 Y 1094.296307 0 0.4000 987 | 6/14
35 h-m-p 0.9898 8.0000 0.0000 ----------------.. | 6/14
36 h-m-p 0.0160 8.0000 0.0002 -------------
Out..
lnL = -1094.296307
1063 lfun, 11693 eigenQcodon, 116930 P(t)
end of tree file.
Time used: 1:06
Model 8: beta&w>1
TREE # 1
(1, 7, 8, (2, (3, (4, 5, 6)))); MP score: 29
0.037653 0.060144 0.016506 0.103422 0.042265 0.033608 0.096051 0.067907 0.089586 0.057936 0.026573 6.037256 0.900000 0.894168 1.476117 1.300000
ntime & nrate & np: 11 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 3.504763
np = 16
lnL0 = -1180.016090
Iterating by ming2
Initial: fx= 1180.016090
x= 0.03765 0.06014 0.01651 0.10342 0.04227 0.03361 0.09605 0.06791 0.08959 0.05794 0.02657 6.03726 0.90000 0.89417 1.47612 1.30000
1 h-m-p 0.0000 0.0001 545.8302 ++ 1151.257657 m 0.0001 37 | 0/16
2 h-m-p 0.0000 0.0000 7963.4275 ++ 1146.464433 m 0.0000 72 | 1/16
3 h-m-p 0.0000 0.0000 1524.0871 ++ 1130.948318 m 0.0000 107 | 2/16
4 h-m-p 0.0000 0.0000 4561.5121 ++ 1128.624350 m 0.0000 141 | 2/16
5 h-m-p -0.0000 -0.0000 6225.1203
h-m-p: -0.00000000e+00 -0.00000000e+00 6.22512032e+03 1128.624350
.. | 2/16
6 h-m-p 0.0000 0.0000 23110.4284 -YYCCYCCC 1123.300801 7 0.0000 217 | 2/16
7 h-m-p 0.0000 0.0000 440.4867 ++ 1115.818367 m 0.0000 250 | 3/16
8 h-m-p 0.0000 0.0000 3766.9458 ++ 1112.459212 m 0.0000 283 | 4/16
9 h-m-p 0.0000 0.0000 3161.5045 ++ 1103.971913 m 0.0000 315 | 5/16
10 h-m-p 0.0001 0.0004 95.2736 +YYCCCC 1102.000727 5 0.0002 355 | 5/16
11 h-m-p 0.0003 0.0013 58.9436 YCYCCC 1099.164173 5 0.0007 393 | 5/16
12 h-m-p 0.0001 0.0006 40.5855 CYCCC 1098.869650 4 0.0002 430 | 5/16
13 h-m-p 0.0009 0.0084 8.6685 ++ 1098.425292 m 0.0084 460 | 5/16
14 h-m-p 0.0000 0.0000 108.3896
h-m-p: 0.00000000e+00 0.00000000e+00 1.08389568e+02 1098.425292
.. | 5/16
15 h-m-p 0.0000 0.0003 120.5024 ++YYYCC 1097.255399 4 0.0001 524 | 5/16
16 h-m-p 0.0000 0.0001 288.1341 YCCC 1097.096018 3 0.0000 559 | 5/16
17 h-m-p 0.0002 0.0027 18.1562 YCC 1097.075083 2 0.0001 592 | 5/16
18 h-m-p 0.0002 0.0012 15.5347 YC 1097.069754 1 0.0001 623 | 5/16
19 h-m-p 0.0006 0.2769 4.3607 CC 1097.068420 1 0.0002 655 | 5/16
20 h-m-p 0.0002 0.1186 8.0661 +++++ 1095.129068 m 0.1186 688 | 6/16
21 h-m-p 0.0036 0.0181 91.0428
QuantileBeta(0.15, 0.00500, 2.13308) = 1.241628e-160 2000 rounds
-CCC 1095.110718 2 0.0003 723 | 6/16
22 h-m-p 0.0063 0.6214 4.6293 +
QuantileBeta(0.15, 0.00500, 2.33296) = 1.109630e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.71843) = 6.373136e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.82003) = 8.807123e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.86613) = 8.638130e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.29228) = 7.335584e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95263) = 8.337867e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.95859) = 8.317918e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.12544) = 7.796096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96472) = 8.297531e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.04508) = 8.039047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
C 1093.889989 5 0.2378 762
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.585618e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96532) = 8.295540e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96504) = 8.296474e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96518) = 8.296007e-161 2000 rounds
| 6/16
23 h-m-p 0.1874 0.9370 1.8212
QuantileBeta(0.15, 0.00500, 3.17221) = 7.661296e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.79330) = 6.229443e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.17158) = 7.663073e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.48276) = 6.871890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.32917) = 7.240985e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.33263) = 7.232226e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.40769) = 7.047476e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35219) = 7.183175e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.35291) = 7.181366e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.38030) = 7.113794e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
C 1093.349752 5 0.3519 799
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.429414e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35409) = 7.178432e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35379) = 7.179177e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35394) = 7.178804e-161 2000 rounds
| 6/16
24 h-m-p 1.4436 8.0000 0.4440
QuantileBeta(0.15, 0.00500, 3.71845) = 6.373096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.81197) = 4.766062e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.10386) = 5.696502e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.02605) = 5.821303e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.99706) = 5.869208e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.85776) = 6.110818e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98978) = 5.881369e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.92377) = 5.993906e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
C 1092.858024 4 2.5135 834
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 6.088705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98878) = 5.883046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98845) = 5.883595e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.98861) = 5.883320e-161 2000 rounds
| 6/16
25 h-m-p 0.4374 2.1870 0.8670
QuantileBeta(0.15, 0.00500, 4.16196) = 5.606728e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.68202) = 4.913394e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09306) = 5.713500e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.13199) = 5.652686e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.14385) = 5.634410e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
C 1092.743124 3 0.3924 866
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.830688e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14428) = 5.633749e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14395) = 5.634264e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.14411) = 5.634006e-161 2000 rounds
| 6/16
26 h-m-p 1.6000 8.0000 0.2032
QuantileBeta(0.15, 0.00500, 4.15473) = 5.617744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18660) = 5.569515e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15098) = 5.623480e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.15052) = 5.624188e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.14732) = 5.629093e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15037) = 5.624418e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.14884) = 5.626754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
C 1092.693023 3 0.9405 900
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.820783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15052) = 5.624179e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15019) = 5.624692e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15036) = 5.624436e-161 2000 rounds
| 6/16
27 h-m-p 0.6364 8.0000 0.3003
QuantileBeta(0.15, 0.00500, 4.27899) = 5.434214e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.66490) = 4.933480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43237) = 5.223529e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
C 1092.667233 1 1.3996 930
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.404670e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43343) = 5.222129e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43308) = 5.222588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43326) = 5.222359e-161 2000 rounds
| 6/16
28 h-m-p 1.6000 8.0000 0.1163
QuantileBeta(0.15, 0.00500, 4.52453) = 5.104595e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79835) = 4.781085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50605) = 5.128006e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
C 1092.657931 1 1.2528 960
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.308772e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50490) = 5.129472e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50455) = 5.129919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50473) = 5.129696e-161 2000 rounds
| 6/16
29 h-m-p 1.2274 8.0000 0.1187
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.69033) = 4.903702e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.54992) = 5.072779e-161 2000 rounds
C 1092.654523 0 1.2274 989
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.248308e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55130) = 5.071052e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55095) = 5.071491e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55113) = 5.071271e-161 2000 rounds
| 6/16
30 h-m-p 1.6000 8.0000 0.0271
QuantileBeta(0.15, 0.00500, 4.56134) = 5.058584e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.59200) = 5.020899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040041e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
C 1092.653528 1 3.9524 1019
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.215991e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57654) = 5.039827e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57619) = 5.040262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57637) = 5.040045e-161 2000 rounds
| 6/16
31 h-m-p 1.6000 8.0000 0.0374
QuantileBeta(0.15, 0.00500, 4.56288) = 5.056678e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.52244) = 5.107240e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55722) = 5.063698e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.53983) = 5.085376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
C 1092.652753 1 2.2680 1050
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.240425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55743) = 5.063435e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55708) = 5.063874e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55726) = 5.063655e-161 2000 rounds
| 6/16
32 h-m-p 1.6000 8.0000 0.0050
QuantileBeta(0.15, 0.00500, 4.55354) = 5.068268e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.54240) = 5.082159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
Y 1092.652740 0 1.0592 1079
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.243585e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55497) = 5.066488e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55462) = 5.066927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55480) = 5.066708e-161 2000 rounds
| 6/16
33 h-m-p 1.6000 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 4.55468) = 5.066858e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55431) = 5.067309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
Y 1092.652740 0 1.0744 1108
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.243689e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55489) = 5.066589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55454) = 5.067028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55472) = 5.066809e-161 2000 rounds
| 6/16
34 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.55469) = 5.066842e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55461) = 5.066941e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
Y 1092.652740 0 0.9231 1137
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.243709e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55488) = 5.066608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55452) = 5.067047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
| 6/16
35 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066831e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
Y 1092.652740 0 0.0250 1168
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.243709e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55488) = 5.066608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55452) = 5.067047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
| 6/16
36 h-m-p 0.0160 8.0000 0.0004
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55469) = 5.066837e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
Y 1092.652740 0 0.0160 1197
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.243712e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55487) = 5.066611e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55452) = 5.067049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066830e-161 2000 rounds
| 6/16
37 h-m-p 0.9287 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066827e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
Y 1092.652740 0 0.9287 1226
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.243711e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55488) = 5.066610e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55452) = 5.067049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
| 6/16
38 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
C 1092.652740 0 0.4000 1255
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.243710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55488) = 5.066610e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55452) = 5.067048e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
| 6/16
39 h-m-p 0.0160 8.0000 0.0023
QuantileBeta(0.15, 0.00500, 4.55473) = 5.066795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55481) = 5.066691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
Y 1092.652740 0 0.0281 1284
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.243648e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55492) = 5.066549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55457) = 5.066988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
| 6/16
40 h-m-p 1.0440 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 4.55470) = 5.066829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55474) = 5.066784e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55474) = 5.066772e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
Y 1092.652740 0 0.0000 1321
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.243648e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55492) = 5.066549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55457) = 5.066988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066769e-161 2000 rounds
| 6/16
41 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
C 1092.652740 0 0.0040 1350
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.243648e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55492) = 5.066549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55457) = 5.066988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
| 6/16
42 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
Y 1092.652740 0 0.0000 1391
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
Out..
lnL = -1092.652740
1392 lfun, 16704 eigenQcodon, 168432 P(t)
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1098.029088 S = -1057.369582 -70.998613
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 83 patterns 2:11
did 20 / 83 patterns 2:11
did 30 / 83 patterns 2:12
did 40 / 83 patterns 2:12
did 50 / 83 patterns 2:12
did 60 / 83 patterns 2:12
did 70 / 83 patterns 2:12
did 80 / 83 patterns 2:13
did 83 / 83 patterns 2:13
QuantileBeta(0.15, 0.00500, 4.55475) = 5.066768e-161 2000 rounds
end of tree file.
Time used: 2:13
The loglikelihoods for models M1, M2, M7 and M8 are -1094.260212 -1092.652741 -1094.296307 -1092.652740 respectively