--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken.
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -828.02 -836.79
2 -828.08 -836.92
--------------------------------------
TOTAL -828.05 -836.86
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.056682 0.524639 0.001752 0.019659 0.008434 1501.00 1501.00 1.000
r(A<->C){all} 0.209159 0.017518 0.010657 0.462985 0.184038 103.13 136.57 1.000
r(A<->G){all} 0.184908 0.014318 0.005072 0.420270 0.161020 165.63 167.20 1.010
r(A<->T){all} 0.086217 0.007363 0.000002 0.269374 0.058445 214.90 224.15 1.000
r(C<->G){all} 0.112863 0.010153 0.000062 0.322966 0.084870 248.38 268.36 1.002
r(C<->T){all} 0.311954 0.021072 0.065160 0.600749 0.292497 102.49 111.83 1.005
r(G<->T){all} 0.094900 0.007322 0.000045 0.259979 0.072133 210.82 252.89 1.003
pi(A){all} 0.258678 0.000309 0.223364 0.292093 0.258806 1110.52 1213.97 1.002
pi(C){all} 0.176181 0.000231 0.148628 0.207398 0.175812 1149.56 1276.52 1.000
pi(G){all} 0.242962 0.000308 0.208930 0.277794 0.242547 1231.96 1241.04 1.001
pi(T){all} 0.322179 0.000351 0.286509 0.358659 0.322099 973.18 1044.17 1.000
alpha{1,2} 0.975215 0.886799 0.000586 2.853342 0.695292 934.69 1101.74 1.000
alpha{3} 1.005310 1.041265 0.000148 3.072599 0.694297 1198.74 1241.19 1.001
pinvar{all} 0.527105 0.084223 0.051099 0.987119 0.541623 414.91 533.03 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
Model 1: NearlyNeutral -762.328571
Model 2: PositiveSelection -755.973758
Model 7: beta -762.330601
Model 8: beta&w>1 -755.973754
Model 2 vs 1 12.709626
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
160 Q 1.000** 557.928
167 T 1.000** 557.928
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
167 T 0.798 5.250 +- 3.368
Model 8 vs 7 12.713694
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
160 Q 1.000** 557.921
167 T 1.000** 557.921
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
160 Q 0.631 4.046 +- 3.538
167 T 0.897 5.644 +- 3.241
-- Starting log on Fri Oct 21 22:38:33 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=195
C1 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFD
C2 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFD
C3 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFD
C4 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFD
**************************************************
C1 HEASVQKKIQRMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDM
C2 HEASVQKKIQRMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDM
C3 HEASVQKKIQRMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDM
C4 HEASVQKKIQRMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDM
**************************************************
C1 SSINQLMELAKDGCIPMAIIPAAAATKLTVITPDLESFSKIRVDNNIYYA
C2 SSINQLMELAKDGCIPMAIIPAAAATKLTVITPDLESFSKIRVDNNIYYA
C3 SSINQLMELAKDGCIPMAIIPAAAATKLTVITPDLESFSKIRVDNNIYYA
C4 SSINQLMELAKDGCIPMAIIPAAAATKLTVITPDLESFSKIRVDNNIYYA
**************************************************
C1 GAAWSITDVQDADGRVTILKEINADNKDALVWPLHVTCERVVKLQ
C2 GAAWSITDVKDADGRVVILKEINADNKDALVWPLHVTCERVVKLQ
C3 GAAWSITDVKDADGRVVILKEINADNKDALVWPLHVTCERVVKLQ
C4 GAAWSITDVKDADGRVVILKEINADNKDALVWPLHVTCERVVKLQ
*********:******.****************************
-- Starting log on Fri Oct 21 22:39:18 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=4, Len=195
C1 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFD
C2 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFD
C3 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFD
C4 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFD
**************************************************
C1 HEASVQKKIQRMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDM
C2 HEASVQKKIQRMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDM
C3 HEASVQKKIQRMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDM
C4 HEASVQKKIQRMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDM
**************************************************
C1 SSINQLMELAKDGCIPMAIIPAAAATKLTVITPDLESFSKIRVDNNIYYA
C2 SSINQLMELAKDGCIPMAIIPAAAATKLTVITPDLESFSKIRVDNNIYYA
C3 SSINQLMELAKDGCIPMAIIPAAAATKLTVITPDLESFSKIRVDNNIYYA
C4 SSINQLMELAKDGCIPMAIIPAAAATKLTVITPDLESFSKIRVDNNIYYA
**************************************************
C1 GAAWSITDVQDADGRVTILKEINADNKDALVWPLHVTCERVVKLQ
C2 GAAWSITDVKDADGRVVILKEINADNKDALVWPLHVTCERVVKLQ
C3 GAAWSITDVKDADGRVVILKEINADNKDALVWPLHVTCERVVKLQ
C4 GAAWSITDVKDADGRVVILKEINADNKDALVWPLHVTCERVVKLQ
*********:******.****************************
-- Starting log on Fri Oct 21 22:49:41 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/gapped_alignment/codeml,HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 585 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666392583
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 106862411
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8550805031
Seed = 234084038
Swapseed = 1666392583
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.00 % Dirichlet(Revmat{all})
1.00 % Slider(Revmat{all})
1.00 % Dirichlet(Pi{all})
1.00 % Slider(Pi{all})
2.00 % Multiplier(Alpha{1,2})
2.00 % Multiplier(Alpha{3})
2.00 % Slider(Pinvar{all})
10.00 % ExtSPR(Tau{all},V{all})
10.00 % NNI(Tau{all},V{all})
10.00 % ParsSPR(Tau{all},V{all})
40.00 % Multiplier(V{all})
14.00 % Nodeslider(V{all})
6.00 % TLMultiplier(V{all})
Division 1 has 6 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 5 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -887.314526 -- 13.556448
Chain 2 -- -887.314526 -- 13.556448
Chain 3 -- -887.314526 -- 13.556448
Chain 4 -- -887.314526 -- 13.556448
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -887.314526 -- 13.556448
Chain 2 -- -887.314526 -- 13.556448
Chain 3 -- -887.314526 -- 13.556448
Chain 4 -- -887.314526 -- 13.556448
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-887.315] (-887.315) (-887.315) (-887.315) * [-887.315] (-887.315) (-887.315) (-887.315)
1000 -- (-828.914) (-835.648) [-831.016] (-830.721) * [-831.771] (-831.445) (-831.332) (-832.528) -- 0:00:00
2000 -- [-829.279] (-830.201) (-829.893) (-835.184) * (-830.430) [-832.404] (-830.905) (-835.231) -- 0:00:00
3000 -- (-827.947) (-829.207) (-832.415) [-828.915] * (-830.841) [-829.071] (-833.479) (-829.448) -- 0:00:00
4000 -- (-836.095) (-831.039) (-834.937) [-829.069] * (-827.792) (-828.380) (-831.979) [-826.561] -- 0:00:00
5000 -- (-828.006) [-829.319] (-832.990) (-832.190) * (-838.783) (-827.416) (-831.722) [-832.004] -- 0:00:00
Average standard deviation of split frequencies: 0.157135
6000 -- [-825.998] (-835.908) (-833.622) (-828.137) * [-829.529] (-831.094) (-833.594) (-831.717) -- 0:00:00
7000 -- (-830.034) (-832.302) (-832.467) [-826.701] * (-830.246) [-828.718] (-832.293) (-831.587) -- 0:00:00
8000 -- [-826.470] (-828.860) (-832.217) (-828.712) * [-835.205] (-834.914) (-831.150) (-828.275) -- 0:02:04
9000 -- [-832.827] (-830.231) (-833.401) (-827.180) * (-833.239) [-831.406] (-829.318) (-842.465) -- 0:01:50
10000 -- [-828.861] (-829.404) (-832.436) (-829.269) * (-832.757) (-827.154) (-833.168) [-828.596] -- 0:01:39
Average standard deviation of split frequencies: 0.147314
11000 -- (-832.124) [-829.937] (-836.473) (-829.917) * (-831.792) [-829.223] (-831.369) (-829.125) -- 0:01:29
12000 -- [-826.113] (-829.338) (-831.362) (-830.050) * [-829.378] (-831.491) (-829.647) (-832.152) -- 0:01:22
13000 -- [-827.027] (-832.690) (-828.688) (-826.822) * (-828.652) (-830.884) (-830.553) [-829.999] -- 0:01:15
14000 -- (-830.746) [-829.859] (-830.032) (-830.827) * (-829.389) (-837.299) (-832.415) [-829.581] -- 0:01:10
15000 -- (-831.442) [-828.925] (-830.499) (-828.830) * (-830.178) [-829.324] (-830.383) (-832.765) -- 0:01:05
Average standard deviation of split frequencies: 0.078567
16000 -- (-834.637) (-827.456) (-833.590) [-827.600] * (-828.185) [-830.936] (-832.440) (-829.901) -- 0:01:01
17000 -- (-830.034) (-832.493) (-830.030) [-828.735] * [-828.061] (-833.568) (-837.196) (-829.072) -- 0:00:57
18000 -- (-834.283) (-827.321) [-830.698] (-831.511) * (-828.550) (-831.345) [-831.652] (-828.164) -- 0:01:49
19000 -- (-832.229) [-830.890] (-826.998) (-831.343) * (-829.233) (-831.982) (-835.584) [-827.772] -- 0:01:43
20000 -- [-832.085] (-834.037) (-827.314) (-828.991) * (-829.878) (-833.320) (-831.544) [-833.682] -- 0:01:38
Average standard deviation of split frequencies: 0.076033
21000 -- [-830.894] (-830.314) (-832.624) (-844.466) * (-830.552) (-834.709) [-832.197] (-834.577) -- 0:01:33
22000 -- (-834.928) [-829.536] (-828.216) (-839.898) * (-829.887) (-831.625) (-838.737) [-826.136] -- 0:01:28
23000 -- (-832.966) [-833.867] (-829.525) (-841.383) * (-829.838) (-830.281) [-828.160] (-827.038) -- 0:01:24
24000 -- [-829.618] (-832.083) (-834.595) (-844.578) * [-826.864] (-830.218) (-832.104) (-827.414) -- 0:01:21
25000 -- [-831.014] (-831.627) (-830.550) (-839.692) * [-829.439] (-830.459) (-830.618) (-829.679) -- 0:01:18
Average standard deviation of split frequencies: 0.072524
26000 -- (-831.671) (-832.368) [-830.012] (-839.323) * [-829.065] (-835.600) (-834.918) (-831.225) -- 0:01:14
27000 -- (-830.905) (-834.058) [-828.953] (-839.472) * [-831.049] (-828.848) (-831.041) (-829.038) -- 0:01:12
28000 -- (-834.609) (-832.781) [-831.753] (-839.856) * (-831.646) [-827.868] (-829.872) (-830.130) -- 0:01:09
29000 -- (-838.681) [-828.990] (-830.439) (-842.510) * (-826.053) [-829.372] (-833.557) (-831.758) -- 0:01:40
30000 -- [-829.661] (-829.104) (-827.644) (-841.204) * (-829.061) (-835.941) (-831.452) [-827.640] -- 0:01:37
Average standard deviation of split frequencies: 0.040992
31000 -- (-834.710) [-830.887] (-830.447) (-840.071) * [-829.534] (-836.640) (-830.850) (-840.437) -- 0:01:33
32000 -- [-836.396] (-831.773) (-830.679) (-839.375) * [-828.127] (-835.718) (-831.287) (-840.726) -- 0:01:30
33000 -- [-831.041] (-826.296) (-834.672) (-842.396) * (-828.499) (-832.517) [-828.633] (-842.326) -- 0:01:27
34000 -- (-829.249) [-827.229] (-832.459) (-840.771) * [-825.242] (-831.040) (-830.563) (-839.639) -- 0:01:25
35000 -- [-830.204] (-828.320) (-829.669) (-840.563) * (-826.297) (-838.767) [-832.645] (-839.301) -- 0:01:22
Average standard deviation of split frequencies: 0.008730
36000 -- (-831.543) [-830.670] (-841.056) (-847.352) * [-825.735] (-837.615) (-828.212) (-841.100) -- 0:01:20
37000 -- (-825.993) [-827.906] (-840.349) (-836.292) * [-826.958] (-840.842) (-830.758) (-839.128) -- 0:01:18
38000 -- (-833.820) [-828.694] (-840.679) (-841.327) * (-826.636) (-841.561) [-828.815] (-843.316) -- 0:01:15
39000 -- [-829.694] (-834.119) (-839.115) (-838.884) * (-826.257) (-838.186) [-829.633] (-839.277) -- 0:01:38
40000 -- [-825.913] (-827.080) (-840.791) (-842.442) * [-825.972] (-839.772) (-831.291) (-842.371) -- 0:01:36
Average standard deviation of split frequencies: 0.023184
41000 -- (-828.150) [-827.698] (-844.750) (-839.101) * [-829.063] (-842.513) (-831.401) (-840.256) -- 0:01:33
42000 -- (-827.369) [-832.231] (-839.136) (-840.606) * (-829.371) (-842.171) [-836.717] (-839.949) -- 0:01:31
43000 -- (-831.976) [-826.261] (-841.271) (-840.058) * [-827.479] (-836.934) (-833.046) (-842.143) -- 0:01:29
44000 -- [-828.279] (-827.444) (-842.592) (-837.168) * [-828.125] (-839.820) (-833.645) (-839.679) -- 0:01:26
45000 -- [-829.344] (-832.209) (-840.231) (-839.052) * (-828.245) (-838.350) [-829.241] (-840.869) -- 0:01:24
Average standard deviation of split frequencies: 0.047824
46000 -- (-830.910) [-827.710] (-840.796) (-835.203) * [-830.650] (-839.066) (-831.322) (-840.552) -- 0:01:22
47000 -- [-832.956] (-828.303) (-840.649) (-837.176) * (-833.909) (-843.124) [-833.898] (-841.634) -- 0:01:21
48000 -- (-832.228) [-831.786] (-839.860) (-837.581) * [-830.462] (-839.926) (-839.610) (-838.294) -- 0:01:19
49000 -- [-832.798] (-826.201) (-839.520) (-840.688) * [-828.104] (-841.094) (-836.841) (-838.819) -- 0:01:17
50000 -- (-826.411) [-830.909] (-840.032) (-839.126) * [-831.265] (-841.163) (-840.542) (-845.681) -- 0:01:35
Average standard deviation of split frequencies: 0.062027
51000 -- [-827.088] (-829.319) (-847.331) (-838.501) * [-829.907] (-840.288) (-843.501) (-841.526) -- 0:01:33
52000 -- [-831.558] (-828.675) (-840.145) (-843.896) * [-829.265] (-842.807) (-834.429) (-839.361) -- 0:01:31
53000 -- [-829.398] (-828.607) (-838.624) (-840.309) * [-828.141] (-842.884) (-839.019) (-843.283) -- 0:01:29
54000 -- (-832.017) [-826.346] (-836.027) (-839.744) * [-827.570] (-838.437) (-841.683) (-841.941) -- 0:01:27
55000 -- [-828.999] (-828.432) (-839.865) (-840.742) * [-829.421] (-842.250) (-843.163) (-839.451) -- 0:01:25
Average standard deviation of split frequencies: 0.044896
56000 -- [-826.379] (-830.806) (-840.686) (-843.425) * [-829.420] (-839.877) (-841.208) (-838.946) -- 0:01:24
57000 -- (-830.866) [-828.536] (-841.291) (-842.771) * (-829.542) (-839.298) (-842.589) [-840.564] -- 0:01:22
58000 -- (-834.549) [-831.293] (-840.997) (-840.596) * [-834.188] (-840.200) (-844.714) (-839.318) -- 0:01:21
59000 -- (-829.708) [-830.888] (-840.627) (-840.845) * [-829.189] (-840.556) (-842.226) (-840.338) -- 0:01:19
60000 -- [-828.523] (-827.804) (-832.616) (-843.887) * [-833.459] (-826.820) (-842.726) (-842.302) -- 0:01:18
Average standard deviation of split frequencies: 0.041442
61000 -- (-829.675) [-827.970] (-839.813) (-839.692) * (-828.860) [-827.109] (-839.288) (-840.725) -- 0:01:32
62000 -- (-833.511) [-827.556] (-842.203) (-838.579) * [-833.622] (-830.191) (-841.984) (-841.133) -- 0:01:30
63000 -- [-830.769] (-827.502) (-840.005) (-840.447) * [-831.646] (-841.283) (-844.023) (-839.276) -- 0:01:29
64000 -- (-829.617) [-829.916] (-841.000) (-839.576) * [-828.383] (-838.939) (-843.717) (-839.250) -- 0:01:27
65000 -- (-825.195) [-832.887] (-839.935) (-842.455) * [-828.212] (-841.348) (-844.628) (-838.156) -- 0:01:26
Average standard deviation of split frequencies: 0.042855
66000 -- (-829.737) [-829.415] (-840.195) (-840.899) * [-828.788] (-841.469) (-839.676) (-837.868) -- 0:01:24
67000 -- [-825.950] (-828.951) (-841.735) (-841.748) * [-832.290] (-843.950) (-839.287) (-839.256) -- 0:01:23
68000 -- (-828.386) [-829.517] (-841.610) (-839.673) * [-833.208] (-840.406) (-840.210) (-839.161) -- 0:01:22
69000 -- (-828.846) (-830.441) [-830.418] (-840.818) * [-828.724] (-840.307) (-840.573) (-841.311) -- 0:01:20
70000 -- (-828.982) (-834.503) [-828.802] (-842.402) * [-828.107] (-840.095) (-839.792) (-838.530) -- 0:01:19
Average standard deviation of split frequencies: 0.031130
71000 -- [-827.994] (-830.046) (-829.600) (-840.370) * [-838.270] (-832.115) (-839.874) (-840.741) -- 0:01:31
72000 -- [-831.180] (-836.656) (-830.337) (-837.538) * [-831.685] (-840.479) (-840.260) (-840.450) -- 0:01:30
73000 -- (-827.727) (-839.257) [-827.578] (-835.028) * [-833.922] (-839.277) (-842.107) (-838.984) -- 0:01:28
74000 -- (-834.556) (-834.517) [-828.324] (-838.266) * [-834.504] (-837.254) (-839.434) (-839.228) -- 0:01:27
75000 -- [-827.730] (-838.474) (-831.266) (-838.007) * [-833.492] (-840.664) (-840.315) (-833.632) -- 0:01:26
Average standard deviation of split frequencies: 0.028946
76000 -- [-827.475] (-837.841) (-826.179) (-840.709) * [-830.655] (-839.498) (-841.119) (-837.085) -- 0:01:25
77000 -- (-831.619) (-838.047) [-827.082] (-839.661) * (-829.455) (-839.798) (-842.702) [-839.817] -- 0:01:23
78000 -- [-828.947] (-835.056) (-831.354) (-838.079) * (-828.778) (-836.532) (-841.801) [-834.042] -- 0:01:22
79000 -- [-826.838] (-835.214) (-830.216) (-837.724) * [-833.490] (-838.857) (-838.989) (-832.575) -- 0:01:21
80000 -- (-826.793) (-835.815) [-829.848] (-839.362) * [-836.177] (-835.221) (-841.218) (-837.931) -- 0:01:20
Average standard deviation of split frequencies: 0.015584
81000 -- [-829.620] (-839.308) (-833.874) (-842.700) * [-835.395] (-839.155) (-842.579) (-832.457) -- 0:01:19
82000 -- (-827.121) (-839.811) [-831.859] (-837.850) * [-829.534] (-839.027) (-841.112) (-828.641) -- 0:01:29
83000 -- (-829.648) (-839.023) (-831.196) [-830.814] * [-828.642] (-840.867) (-838.870) (-840.251) -- 0:01:28
84000 -- (-832.531) (-841.289) [-827.300] (-832.270) * [-828.914] (-844.478) (-839.777) (-845.536) -- 0:01:27
85000 -- (-830.968) (-839.471) (-834.387) [-831.079] * [-831.249] (-838.974) (-843.959) (-841.086) -- 0:01:26
Average standard deviation of split frequencies: 0.018271
86000 -- [-834.725] (-841.614) (-849.123) (-832.672) * (-827.516) (-841.688) [-831.159] (-841.246) -- 0:01:25
87000 -- (-831.568) (-843.517) [-828.628] (-830.062) * [-830.360] (-849.944) (-829.749) (-840.381) -- 0:01:23
88000 -- (-833.467) (-841.806) (-830.194) [-831.104] * (-829.791) (-841.706) [-831.615] (-839.425) -- 0:01:22
89000 -- (-831.025) (-841.529) [-828.437] (-829.860) * (-829.735) (-842.383) [-828.082] (-841.285) -- 0:01:21
90000 -- [-832.568] (-840.756) (-830.909) (-830.187) * (-832.711) [-830.178] (-830.191) (-841.727) -- 0:01:20
Average standard deviation of split frequencies: 0.024263
91000 -- (-841.354) (-841.800) (-828.159) [-828.988] * (-831.977) (-835.065) [-830.467] (-839.140) -- 0:01:19
92000 -- (-839.519) (-838.389) [-830.588] (-829.770) * [-833.490] (-840.594) (-833.943) (-844.223) -- 0:01:28
93000 -- (-838.887) (-844.380) [-828.038] (-828.213) * [-829.944] (-841.775) (-832.927) (-839.702) -- 0:01:27
94000 -- (-839.463) (-836.033) (-832.305) [-833.407] * (-828.606) [-839.375] (-832.314) (-839.582) -- 0:01:26
95000 -- (-839.985) (-843.215) [-829.156] (-827.528) * [-830.273] (-841.333) (-829.019) (-844.524) -- 0:01:25
Average standard deviation of split frequencies: 0.026189
96000 -- (-838.946) (-840.281) [-829.674] (-840.939) * (-827.886) (-839.522) [-826.640] (-839.967) -- 0:01:24
97000 -- (-840.647) (-842.341) (-829.048) [-830.112] * [-829.047] (-835.272) (-827.660) (-841.499) -- 0:01:23
98000 -- (-847.613) (-843.467) (-829.677) [-830.614] * (-840.039) (-827.839) [-832.009] (-839.488) -- 0:01:22
99000 -- (-839.432) (-844.907) (-828.085) [-828.505] * [-831.229] (-833.334) (-834.587) (-843.064) -- 0:01:21
100000 -- (-840.922) (-841.343) (-828.084) [-828.881] * (-829.158) (-826.944) [-829.951] (-840.485) -- 0:01:21
Average standard deviation of split frequencies: 0.009366
101000 -- (-840.338) (-839.379) (-826.822) [-827.197] * [-830.083] (-827.113) (-828.379) (-841.748) -- 0:01:20
102000 -- (-844.415) (-841.268) [-827.236] (-831.380) * (-828.121) [-827.611] (-826.196) (-846.218) -- 0:01:19
103000 -- (-840.224) (-841.227) [-826.250] (-831.737) * (-828.690) [-829.082] (-828.543) (-842.212) -- 0:01:27
104000 -- (-836.900) (-843.458) [-829.273] (-832.782) * (-832.535) [-825.912] (-829.350) (-839.659) -- 0:01:26
105000 -- (-836.204) (-839.878) (-830.081) [-827.783] * [-829.854] (-829.438) (-828.671) (-841.314) -- 0:01:25
Average standard deviation of split frequencies: 0.005930
106000 -- (-834.969) (-838.378) (-827.919) [-832.072] * (-831.199) (-829.790) [-828.497] (-842.240) -- 0:01:24
107000 -- (-836.848) (-836.210) (-828.467) [-829.840] * [-829.822] (-836.185) (-830.942) (-841.606) -- 0:01:23
108000 -- (-842.163) (-842.769) [-826.737] (-831.030) * [-828.962] (-837.466) (-827.241) (-840.688) -- 0:01:22
109000 -- (-840.100) (-836.492) (-828.834) [-831.646] * [-827.127] (-834.608) (-832.617) (-838.537) -- 0:01:21
110000 -- (-837.221) (-838.435) [-825.986] (-832.517) * [-827.254] (-836.219) (-828.889) (-840.023) -- 0:01:20
Average standard deviation of split frequencies: 0.008519
111000 -- (-847.134) (-841.439) [-829.371] (-832.196) * (-826.882) (-839.718) [-828.587] (-840.067) -- 0:01:20
112000 -- (-837.993) (-849.395) [-825.571] (-830.570) * [-827.340] (-839.201) (-829.663) (-846.771) -- 0:01:19
113000 -- (-841.623) (-838.850) [-829.282] (-830.341) * (-836.024) (-839.295) [-828.183] (-841.073) -- 0:01:18
114000 -- (-838.245) (-839.768) [-835.038] (-831.000) * (-830.285) (-844.450) [-826.985] (-839.173) -- 0:01:25
115000 -- (-839.845) (-844.267) [-829.922] (-831.581) * [-827.933] (-840.933) (-830.817) (-839.720) -- 0:01:24
Average standard deviation of split frequencies: 0.018965
116000 -- (-838.561) (-843.891) (-827.873) [-829.858] * (-826.917) (-840.190) [-826.237] (-841.867) -- 0:01:23
117000 -- (-842.025) (-840.603) (-830.129) [-832.849] * (-829.673) (-837.503) [-829.514] (-838.301) -- 0:01:23
118000 -- (-841.697) (-841.392) [-829.011] (-829.982) * (-829.779) (-839.150) [-831.516] (-841.764) -- 0:01:22
119000 -- (-841.276) (-840.080) (-831.468) [-836.368] * [-833.701] (-839.748) (-832.316) (-840.878) -- 0:01:21
120000 -- (-835.614) (-839.215) [-827.701] (-831.698) * [-829.384] (-843.597) (-828.623) (-833.358) -- 0:01:20
Average standard deviation of split frequencies: 0.020836
121000 -- (-841.853) (-840.155) (-829.058) [-830.531] * [-829.041] (-837.910) (-828.870) (-832.910) -- 0:01:19
122000 -- (-837.263) (-838.758) [-831.375] (-830.938) * [-833.826] (-839.342) (-832.737) (-832.563) -- 0:01:19
123000 -- (-841.683) (-837.665) (-831.624) [-833.982] * [-835.158] (-839.870) (-839.319) (-829.624) -- 0:01:18
124000 -- (-843.408) (-840.955) (-837.837) [-830.569] * [-832.344] (-832.340) (-842.264) (-831.451) -- 0:01:17
125000 -- (-838.587) (-838.807) (-828.105) [-831.912] * [-830.178] (-847.512) (-841.441) (-828.005) -- 0:01:24
Average standard deviation of split frequencies: 0.019954
126000 -- (-840.780) (-839.785) [-832.902] (-829.921) * (-829.056) (-843.956) (-833.920) [-827.995] -- 0:01:23
127000 -- (-837.966) (-840.475) (-831.139) [-831.528] * [-828.905] (-837.553) (-840.669) (-829.612) -- 0:01:22
128000 -- (-840.737) (-837.003) (-827.853) [-828.389] * (-832.591) (-840.834) (-839.979) [-827.560] -- 0:01:21
129000 -- (-842.790) (-838.616) [-828.278] (-831.025) * [-829.058] (-842.187) (-836.572) (-835.352) -- 0:01:21
130000 -- (-839.862) (-841.246) (-830.059) [-828.866] * [-834.472] (-839.606) (-837.453) (-839.237) -- 0:01:20
Average standard deviation of split frequencies: 0.012026
131000 -- (-848.092) (-842.791) (-828.625) [-830.829] * [-829.312] (-838.657) (-837.625) (-838.912) -- 0:01:19
132000 -- (-841.310) (-840.791) [-827.745] (-832.901) * [-831.540] (-840.361) (-840.046) (-842.071) -- 0:01:18
133000 -- (-844.537) (-842.148) (-826.303) [-831.036] * [-830.671] (-841.826) (-841.582) (-843.530) -- 0:01:18
134000 -- (-840.301) (-839.003) (-828.446) [-832.233] * [-831.222] (-838.510) (-830.568) (-837.655) -- 0:01:17
135000 -- (-839.940) (-839.462) [-826.583] (-830.352) * [-829.116] (-839.714) (-832.257) (-838.747) -- 0:01:23
Average standard deviation of split frequencies: 0.006932
136000 -- (-839.438) (-840.851) (-832.205) [-830.910] * [-830.520] (-841.523) (-828.435) (-839.822) -- 0:01:22
137000 -- (-843.992) (-839.138) (-830.176) [-827.561] * [-836.238] (-839.405) (-833.733) (-839.184) -- 0:01:21
138000 -- (-839.571) (-840.063) (-827.176) [-827.113] * (-831.583) (-843.068) [-828.419] (-840.935) -- 0:01:21
139000 -- (-839.150) (-840.544) [-829.705] (-831.794) * (-830.474) (-839.402) [-827.827] (-839.206) -- 0:01:20
140000 -- (-843.875) (-842.126) [-830.977] (-831.527) * [-832.205] (-833.852) (-832.973) (-837.051) -- 0:01:19
Average standard deviation of split frequencies: 0.008937
141000 -- (-842.327) (-837.043) [-832.482] (-831.306) * (-832.143) (-839.508) [-830.482] (-836.680) -- 0:01:19
142000 -- (-842.009) (-838.871) [-830.939] (-834.089) * (-828.863) (-840.416) [-829.162] (-838.472) -- 0:01:18
143000 -- (-841.875) (-841.991) [-827.271] (-833.957) * [-826.884] (-846.189) (-830.650) (-839.860) -- 0:01:17
144000 -- (-839.532) [-827.668] (-829.880) (-832.596) * (-829.677) (-840.614) [-834.005] (-838.217) -- 0:01:17
145000 -- (-840.338) [-831.651] (-826.183) (-829.090) * [-832.591] (-840.348) (-831.797) (-839.486) -- 0:01:16
Average standard deviation of split frequencies: 0.017220
146000 -- (-840.657) [-828.256] (-830.585) (-833.735) * [-831.086] (-840.283) (-832.249) (-842.866) -- 0:01:21
147000 -- (-841.372) (-828.265) [-829.230] (-833.396) * [-829.109] (-841.590) (-828.085) (-844.033) -- 0:01:21
148000 -- (-839.468) (-828.811) (-832.277) [-832.740] * (-827.805) (-838.796) [-828.552] (-840.568) -- 0:01:20
149000 -- (-838.549) (-827.455) (-827.152) [-829.529] * (-830.351) (-844.984) [-829.589] (-841.461) -- 0:01:19
150000 -- (-838.270) [-828.684] (-829.263) (-841.843) * [-826.762] (-839.452) (-829.173) (-842.208) -- 0:01:19
Average standard deviation of split frequencies: 0.012515
151000 -- (-840.709) [-830.555] (-828.967) (-839.149) * [-827.940] (-841.610) (-826.922) (-843.759) -- 0:01:18
152000 -- (-841.441) (-826.946) [-836.647] (-841.814) * (-830.586) (-841.796) [-827.386] (-843.205) -- 0:01:18
153000 -- (-841.834) [-828.045] (-831.702) (-840.589) * (-830.252) (-841.403) [-831.137] (-840.665) -- 0:01:17
154000 -- (-839.537) [-828.630] (-829.079) (-839.532) * (-831.147) (-839.721) [-828.670] (-838.384) -- 0:01:16
155000 -- (-840.589) [-825.436] (-829.933) (-839.886) * [-829.281] (-841.076) (-828.287) (-841.218) -- 0:01:16
Average standard deviation of split frequencies: 0.008058
156000 -- (-838.827) (-825.917) [-827.747] (-840.598) * [-829.603] (-841.219) (-833.479) (-840.821) -- 0:01:15
157000 -- (-841.618) [-828.547] (-829.342) (-836.723) * (-829.464) (-841.941) [-829.763] (-841.727) -- 0:01:20
158000 -- (-841.509) [-828.258] (-828.684) (-839.539) * [-826.472] (-846.181) (-827.768) (-839.846) -- 0:01:19
159000 -- (-840.021) (-827.718) [-829.554] (-838.074) * [-832.423] (-839.867) (-829.929) (-839.218) -- 0:01:19
160000 -- (-841.932) [-826.802] (-828.977) (-839.561) * [-829.894] (-840.890) (-830.981) (-839.009) -- 0:01:18
Average standard deviation of split frequencies: 0.009780
161000 -- (-837.785) (-829.869) [-830.336] (-838.831) * (-833.544) (-838.216) [-830.092] (-838.113) -- 0:01:18
162000 -- (-838.775) [-826.099] (-829.247) (-838.452) * (-831.446) (-838.871) [-828.287] (-837.983) -- 0:01:17
163000 -- (-837.572) [-827.631] (-835.784) (-840.692) * [-831.887] (-839.488) (-827.824) (-842.134) -- 0:01:17
164000 -- (-842.254) [-829.339] (-830.155) (-842.249) * (-834.858) (-839.871) [-830.888] (-840.145) -- 0:01:16
165000 -- (-841.858) [-827.830] (-834.344) (-839.562) * (-828.455) (-839.372) [-829.505] (-844.461) -- 0:01:15
Average standard deviation of split frequencies: 0.005680
166000 -- (-845.259) [-829.239] (-834.502) (-842.944) * (-832.305) (-838.596) [-828.381] (-844.528) -- 0:01:15
167000 -- (-840.603) [-832.456] (-829.334) (-838.170) * (-834.739) (-846.003) [-830.959] (-840.773) -- 0:01:19
168000 -- (-841.403) (-829.154) [-830.382] (-845.801) * (-833.269) (-839.525) [-830.994] (-839.184) -- 0:01:19
169000 -- (-841.129) [-828.525] (-834.831) (-840.181) * (-829.932) (-840.906) [-834.822] (-839.718) -- 0:01:18
170000 -- (-838.514) [-827.102] (-830.563) (-841.392) * (-829.157) (-839.679) [-830.134] (-839.539) -- 0:01:18
Average standard deviation of split frequencies: 0.003683
171000 -- (-840.862) (-827.612) [-833.583] (-840.542) * [-829.043] (-839.178) (-830.659) (-839.594) -- 0:01:17
172000 -- (-838.969) (-831.895) [-829.260] (-837.883) * (-831.471) (-842.321) [-828.962] (-841.448) -- 0:01:17
173000 -- (-841.509) (-839.721) [-830.679] (-840.840) * [-835.137] (-841.410) (-829.587) (-842.174) -- 0:01:16
174000 -- (-840.827) (-841.903) [-829.509] (-839.380) * [-830.416] (-839.904) (-841.519) (-840.735) -- 0:01:15
175000 -- (-839.319) (-841.231) [-829.936] (-840.395) * (-831.633) (-840.330) (-839.171) [-833.317] -- 0:01:15
Average standard deviation of split frequencies: 0.005357
176000 -- (-839.771) (-839.906) [-829.352] (-829.103) * [-832.814] (-845.163) (-841.796) (-833.497) -- 0:01:14
177000 -- (-840.562) (-840.911) [-832.419] (-836.578) * [-828.152] (-842.174) (-840.541) (-831.255) -- 0:01:19
178000 -- (-845.555) (-841.798) [-831.545] (-831.387) * (-828.766) (-842.591) (-842.041) [-830.778] -- 0:01:18
179000 -- (-840.278) (-840.288) [-830.352] (-834.956) * [-827.297] (-833.982) (-841.104) (-829.145) -- 0:01:17
180000 -- (-839.776) (-839.248) [-829.298] (-836.187) * (-833.326) (-844.352) (-842.439) [-831.853] -- 0:01:17
Average standard deviation of split frequencies: 0.008698
181000 -- (-839.216) (-843.165) [-829.476] (-837.083) * (-829.519) (-839.054) (-840.040) [-831.370] -- 0:01:16
182000 -- (-843.455) (-837.337) [-828.242] (-835.107) * [-828.673] (-842.761) (-839.076) (-830.252) -- 0:01:16
183000 -- (-841.910) (-840.957) [-829.834] (-839.195) * (-829.584) (-840.197) (-835.038) [-831.845] -- 0:01:15
184000 -- (-840.175) (-836.099) [-829.167] (-839.409) * (-830.054) (-839.826) (-838.664) [-836.531] -- 0:01:15
185000 -- (-839.999) (-840.895) [-827.237] (-840.123) * [-830.369] (-840.856) (-837.387) (-830.819) -- 0:01:14
Average standard deviation of split frequencies: 0.010138
186000 -- (-838.594) (-838.536) [-828.287] (-840.667) * [-827.985] (-840.841) (-841.616) (-831.926) -- 0:01:14
187000 -- (-838.763) (-843.502) [-829.334] (-843.233) * (-834.470) (-841.208) (-838.183) [-829.183] -- 0:01:18
188000 -- (-839.541) (-839.936) [-828.298] (-840.319) * [-828.977] (-842.986) (-839.222) (-835.341) -- 0:01:17
189000 -- (-841.380) (-839.666) [-829.884] (-839.103) * [-828.039] (-839.498) (-840.071) (-833.289) -- 0:01:17
190000 -- (-840.207) (-838.135) [-831.810] (-840.115) * (-829.684) (-841.041) (-838.278) [-832.665] -- 0:01:16
Average standard deviation of split frequencies: 0.011538
191000 -- (-841.830) (-838.612) [-831.004] (-839.596) * (-832.108) (-841.509) (-839.173) [-828.695] -- 0:01:16
192000 -- (-846.764) (-841.398) [-832.778] (-840.582) * [-828.866] (-840.815) (-836.781) (-829.678) -- 0:01:15
193000 -- (-843.384) (-838.839) [-833.478] (-839.775) * (-831.594) (-841.696) (-840.050) [-832.359] -- 0:01:15
194000 -- (-839.946) (-839.800) [-831.864] (-839.249) * (-833.356) (-841.862) (-839.549) [-832.384] -- 0:01:14
195000 -- (-842.181) (-838.214) [-830.211] (-838.814) * (-829.094) (-841.127) (-838.748) [-834.385] -- 0:01:14
Average standard deviation of split frequencies: 0.012827
196000 -- (-838.162) (-839.223) [-831.943] (-841.353) * [-831.978] (-841.441) (-843.855) (-829.020) -- 0:01:13
197000 -- (-840.791) (-838.314) [-831.895] (-845.419) * (-837.695) (-842.515) (-842.245) [-830.987] -- 0:01:13
198000 -- (-839.952) (-840.061) [-828.127] (-843.072) * (-831.069) [-828.560] (-841.332) (-830.988) -- 0:01:16
199000 -- (-838.552) (-841.879) [-829.813] (-841.626) * (-832.973) [-831.829] (-842.284) (-831.081) -- 0:01:16
200000 -- (-841.332) (-839.124) [-834.526] (-838.628) * (-826.820) [-832.527] (-839.796) (-831.320) -- 0:01:16
Average standard deviation of split frequencies: 0.015661
201000 -- (-843.075) [-839.440] (-827.970) (-838.535) * [-831.492] (-836.349) (-838.701) (-829.708) -- 0:01:15
202000 -- (-834.141) (-843.739) [-830.871] (-842.700) * (-835.392) (-830.346) (-841.420) [-829.280] -- 0:01:15
203000 -- (-840.834) (-840.236) (-829.375) [-838.549] * (-839.495) (-830.737) (-839.359) [-832.019] -- 0:01:14
204000 -- (-837.102) (-841.626) [-836.540] (-843.452) * (-841.014) (-832.885) (-842.695) [-830.035] -- 0:01:14
205000 -- (-837.204) (-842.080) [-830.052] (-837.529) * (-831.748) [-830.055] (-839.424) (-830.236) -- 0:01:13
Average standard deviation of split frequencies: 0.009153
206000 -- (-838.382) [-836.404] (-830.548) (-838.166) * (-833.332) [-827.771] (-839.995) (-831.274) -- 0:01:13
207000 -- (-838.763) (-838.947) [-829.170] (-838.430) * (-830.431) (-828.007) (-841.667) [-831.851] -- 0:01:12
208000 -- (-839.964) (-832.746) [-831.222] (-836.638) * [-830.481] (-835.876) (-839.593) (-831.830) -- 0:01:12
209000 -- (-835.687) [-829.934] (-834.086) (-843.955) * [-832.484] (-842.989) (-841.086) (-832.130) -- 0:01:15
210000 -- (-839.156) [-829.963] (-840.271) (-844.042) * [-827.383] (-839.635) (-842.659) (-826.376) -- 0:01:15
Average standard deviation of split frequencies: 0.013426
211000 -- (-838.062) [-831.084] (-840.803) (-839.359) * (-829.433) (-840.978) (-840.436) [-828.582] -- 0:01:14
212000 -- (-836.114) [-827.633] (-841.262) (-839.084) * (-827.421) (-846.429) (-839.639) [-826.880] -- 0:01:14
213000 -- (-841.526) (-829.347) [-835.771] (-842.641) * [-828.559] (-839.960) (-837.613) (-828.686) -- 0:01:13
214000 -- (-840.526) (-832.645) [-836.520] (-840.469) * [-831.201] (-840.062) (-838.513) (-829.067) -- 0:01:13
215000 -- (-839.296) (-832.594) [-833.014] (-840.257) * (-832.626) (-841.849) (-838.801) [-830.078] -- 0:01:13
Average standard deviation of split frequencies: 0.013095
216000 -- (-839.378) (-840.046) [-830.974] (-839.369) * (-831.113) (-846.926) (-841.719) [-829.860] -- 0:01:12
217000 -- (-839.514) (-840.378) [-836.470] (-841.871) * [-830.656] (-839.593) (-838.880) (-829.981) -- 0:01:12
218000 -- (-846.727) (-836.787) [-832.000] (-832.537) * (-832.395) (-839.822) (-842.359) [-830.083] -- 0:01:11
219000 -- (-836.838) (-839.879) (-831.031) [-829.362] * [-830.649] (-839.045) (-842.853) (-834.144) -- 0:01:14
220000 -- (-840.056) (-838.981) [-828.077] (-828.559) * [-828.502] (-842.099) (-840.197) (-831.048) -- 0:01:14
Average standard deviation of split frequencies: 0.017090
221000 -- (-843.324) (-838.760) (-827.447) [-830.559] * (-842.133) (-839.049) (-829.213) [-830.175] -- 0:01:14
222000 -- (-839.349) (-841.883) [-829.711] (-828.547) * (-841.214) (-833.968) [-826.003] (-832.627) -- 0:01:13
223000 -- (-841.111) (-840.061) [-833.475] (-826.704) * (-842.133) (-832.033) [-828.570] (-830.771) -- 0:01:13
224000 -- (-838.539) (-840.181) (-830.797) [-826.871] * (-839.976) (-832.583) [-830.458] (-833.775) -- 0:01:12
225000 -- (-839.637) (-838.411) [-831.314] (-829.629) * (-842.701) (-832.846) (-830.190) [-829.472] -- 0:01:12
Average standard deviation of split frequencies: 0.019468
226000 -- (-842.118) (-842.895) (-830.172) [-826.554] * (-838.958) (-827.740) [-824.902] (-834.282) -- 0:01:11
227000 -- (-838.928) (-839.665) (-830.261) [-827.912] * (-839.391) [-828.532] (-828.148) (-829.622) -- 0:01:11
228000 -- (-836.517) (-840.728) (-833.547) [-828.629] * (-839.302) (-830.763) (-831.551) [-830.957] -- 0:01:11
229000 -- (-837.160) (-838.699) [-833.639] (-828.187) * (-836.545) (-832.186) [-829.063] (-828.455) -- 0:01:10
230000 -- (-839.579) (-842.481) [-836.608] (-831.782) * (-839.618) (-829.986) [-827.263] (-828.284) -- 0:01:13
Average standard deviation of split frequencies: 0.020437
231000 -- (-838.810) (-839.499) (-831.432) [-829.174] * (-841.507) [-828.199] (-832.107) (-827.082) -- 0:01:13
232000 -- (-836.970) (-843.087) (-832.047) [-824.907] * (-840.948) [-827.958] (-826.520) (-829.013) -- 0:01:12
233000 -- (-835.690) (-842.268) [-832.031] (-827.000) * (-839.547) (-836.165) (-828.323) [-827.292] -- 0:01:12
234000 -- (-837.009) (-833.307) (-834.668) [-829.454] * (-840.170) (-830.149) [-828.063] (-828.604) -- 0:01:12
235000 -- (-839.220) (-830.726) (-830.084) [-831.561] * (-844.848) (-827.833) [-830.727] (-829.532) -- 0:01:11
Average standard deviation of split frequencies: 0.017311
236000 -- (-837.376) [-830.427] (-829.052) (-829.186) * (-838.762) [-829.346] (-830.746) (-826.425) -- 0:01:11
237000 -- (-844.252) (-830.806) [-827.970] (-830.362) * (-839.577) [-827.475] (-828.635) (-833.654) -- 0:01:10
238000 -- (-840.817) (-831.612) (-829.517) [-825.416] * (-839.430) [-828.940] (-831.252) (-827.305) -- 0:01:10
239000 -- (-840.648) (-830.122) (-826.399) [-828.265] * (-841.445) (-833.323) (-836.736) [-829.246] -- 0:01:10
240000 -- (-842.621) [-831.412] (-828.905) (-831.357) * (-842.121) [-833.947] (-828.281) (-829.302) -- 0:01:12
Average standard deviation of split frequencies: 0.014364
241000 -- [-829.453] (-827.720) (-831.356) (-830.472) * (-840.196) [-831.953] (-832.117) (-829.459) -- 0:01:12
242000 -- [-830.947] (-828.969) (-826.682) (-831.803) * (-841.644) [-833.814] (-832.112) (-828.515) -- 0:01:12
243000 -- (-832.939) [-827.660] (-833.380) (-831.131) * (-842.576) [-830.711] (-836.396) (-831.027) -- 0:01:11
244000 -- (-829.010) (-830.325) [-826.789] (-827.196) * (-839.485) (-829.225) [-828.601] (-828.871) -- 0:01:11
245000 -- (-830.713) (-830.921) (-841.856) [-833.293] * (-839.498) [-829.301] (-828.560) (-830.379) -- 0:01:10
Average standard deviation of split frequencies: 0.012775
246000 -- [-828.345] (-828.593) (-841.250) (-835.770) * (-840.349) [-830.314] (-831.793) (-839.181) -- 0:01:10
247000 -- (-830.992) [-828.450] (-843.450) (-832.602) * (-843.464) (-834.160) [-830.303] (-841.983) -- 0:01:10
248000 -- [-830.763] (-831.762) (-840.948) (-832.993) * (-837.853) (-835.923) [-829.037] (-835.897) -- 0:01:09
249000 -- (-831.696) [-827.549] (-840.403) (-833.190) * (-839.903) [-832.932] (-825.710) (-841.129) -- 0:01:09
250000 -- [-828.851] (-834.693) (-836.375) (-830.295) * (-841.054) [-829.978] (-831.841) (-840.877) -- 0:01:09
Average standard deviation of split frequencies: 0.011284
251000 -- (-828.773) [-829.695] (-839.667) (-832.009) * (-839.737) (-844.362) [-829.314] (-843.325) -- 0:01:11
252000 -- [-830.126] (-829.036) (-835.397) (-839.602) * (-846.193) (-841.904) [-827.931] (-841.100) -- 0:01:11
253000 -- [-827.366] (-831.025) (-840.744) (-839.729) * (-842.635) (-838.375) [-827.847] (-840.545) -- 0:01:10
254000 -- (-831.928) [-827.193] (-839.992) (-829.864) * (-843.604) (-839.206) [-830.338] (-839.599) -- 0:01:10
255000 -- [-830.492] (-834.341) (-837.959) (-832.981) * (-839.542) (-840.013) [-829.326] (-844.160) -- 0:01:10
Average standard deviation of split frequencies: 0.012276
256000 -- (-827.747) (-828.755) (-834.591) [-829.027] * (-848.594) (-835.933) [-829.798] (-839.074) -- 0:01:09
257000 -- (-829.897) [-827.630] (-829.571) (-827.184) * (-839.943) (-828.301) [-831.662] (-840.342) -- 0:01:09
258000 -- (-827.697) (-838.219) (-830.951) [-827.976] * (-841.362) (-830.007) [-827.347] (-840.620) -- 0:01:09
259000 -- (-829.398) [-829.330] (-834.145) (-839.783) * (-840.356) [-833.663] (-833.091) (-839.958) -- 0:01:08
260000 -- (-830.772) [-829.154] (-839.084) (-839.060) * (-841.081) (-831.892) [-830.057] (-840.982) -- 0:01:08
Average standard deviation of split frequencies: 0.015673
261000 -- [-827.423] (-831.127) (-842.573) (-840.573) * (-844.197) [-832.083] (-831.664) (-838.822) -- 0:01:10
262000 -- (-828.950) [-828.349] (-840.424) (-843.547) * (-844.417) (-828.521) [-827.568] (-839.071) -- 0:01:10
263000 -- [-829.006] (-830.135) (-844.525) (-843.639) * (-841.865) [-826.690] (-831.609) (-842.315) -- 0:01:10
264000 -- [-830.988] (-827.600) (-840.091) (-840.536) * (-848.992) [-829.540] (-832.034) (-840.970) -- 0:01:09
265000 -- [-830.073] (-830.864) (-839.779) (-842.989) * (-840.545) [-832.382] (-832.508) (-842.561) -- 0:01:09
Average standard deviation of split frequencies: 0.015359
266000 -- [-827.095] (-835.775) (-845.196) (-842.032) * (-840.000) [-828.907] (-829.771) (-846.060) -- 0:01:08
267000 -- (-827.248) [-828.361] (-840.926) (-841.493) * (-842.895) [-830.504] (-833.643) (-840.034) -- 0:01:08
268000 -- (-827.648) [-827.690] (-839.461) (-836.452) * (-834.739) (-829.776) [-828.493] (-843.244) -- 0:01:08
269000 -- [-829.402] (-828.857) (-840.105) (-840.116) * (-838.157) [-831.451] (-830.409) (-843.778) -- 0:01:07
270000 -- [-828.671] (-831.679) (-839.996) (-842.598) * (-841.679) [-831.180] (-829.014) (-836.572) -- 0:01:07
Average standard deviation of split frequencies: 0.010450
271000 -- [-829.716] (-828.545) (-840.144) (-839.393) * (-841.405) [-829.206] (-830.749) (-840.045) -- 0:01:07
272000 -- (-828.073) [-836.523] (-841.887) (-839.662) * (-844.563) (-829.625) [-827.139] (-840.808) -- 0:01:09
273000 -- (-833.298) [-831.114] (-839.304) (-838.020) * (-840.413) (-827.649) [-833.476] (-839.184) -- 0:01:09
274000 -- (-830.658) [-830.043] (-840.143) (-840.625) * (-843.079) (-828.248) [-829.945] (-840.773) -- 0:01:08
275000 -- [-827.599] (-828.629) (-836.390) (-839.781) * (-847.438) [-827.265] (-832.773) (-841.657) -- 0:01:08
Average standard deviation of split frequencies: 0.012525
276000 -- [-830.158] (-840.912) (-839.379) (-830.780) * (-844.465) [-829.530] (-828.357) (-839.366) -- 0:01:08
277000 -- [-827.771] (-842.518) (-843.629) (-830.937) * (-840.763) (-833.684) [-827.477] (-831.598) -- 0:01:07
278000 -- (-831.547) (-843.949) (-841.261) [-832.664] * (-843.123) [-828.389] (-832.032) (-839.990) -- 0:01:07
279000 -- [-829.547] (-842.610) (-840.628) (-827.378) * (-839.763) [-830.190] (-829.298) (-839.343) -- 0:01:07
280000 -- [-835.384] (-838.787) (-839.997) (-831.620) * (-837.914) [-825.137] (-829.590) (-840.773) -- 0:01:06
Average standard deviation of split frequencies: 0.011197
281000 -- [-831.674] (-837.186) (-839.548) (-827.156) * (-839.742) [-827.644] (-831.823) (-841.409) -- 0:01:06
282000 -- [-829.532] (-839.540) (-840.081) (-828.449) * (-839.002) (-832.012) [-831.152] (-841.159) -- 0:01:06
283000 -- (-829.762) (-841.309) (-836.903) [-831.012] * (-843.586) [-826.785] (-827.918) (-840.106) -- 0:01:08
284000 -- [-828.226] (-840.074) (-838.678) (-827.314) * (-839.734) (-828.567) [-830.371] (-840.151) -- 0:01:08
285000 -- [-830.015] (-840.691) (-837.820) (-828.450) * (-841.270) (-827.445) [-830.771] (-838.913) -- 0:01:07
Average standard deviation of split frequencies: 0.014285
286000 -- [-829.378] (-839.465) (-839.486) (-832.413) * (-843.221) (-836.389) [-834.483] (-842.795) -- 0:01:07
287000 -- (-828.183) (-840.137) (-841.150) [-829.843] * (-839.363) [-828.158] (-829.611) (-840.634) -- 0:01:07
288000 -- (-826.617) (-840.535) (-840.540) [-827.916] * (-840.032) [-826.841] (-830.150) (-839.086) -- 0:01:06
289000 -- (-828.451) (-837.021) (-838.453) [-835.694] * (-839.703) (-828.843) [-827.487] (-842.072) -- 0:01:06
290000 -- (-827.362) (-839.670) (-839.401) [-830.545] * (-840.861) (-837.665) [-828.603] (-836.955) -- 0:01:06
Average standard deviation of split frequencies: 0.016218
291000 -- (-826.994) (-844.503) (-838.337) [-831.457] * (-839.506) (-839.266) [-829.509] (-843.873) -- 0:01:05
292000 -- (-832.451) (-839.195) (-845.727) [-825.901] * [-841.732] (-839.978) (-829.268) (-840.775) -- 0:01:05
293000 -- (-834.667) (-841.746) (-841.201) [-830.539] * (-845.268) (-839.546) [-828.363] (-840.175) -- 0:01:05
294000 -- [-830.189] (-843.178) (-844.579) (-829.100) * (-840.464) (-839.318) [-828.626] (-840.862) -- 0:01:07
295000 -- [-831.174] (-839.642) (-838.538) (-832.463) * (-839.071) (-840.392) [-827.530] (-834.039) -- 0:01:06
Average standard deviation of split frequencies: 0.013802
296000 -- (-831.282) (-839.254) (-836.796) [-827.491] * (-838.015) (-836.326) (-837.109) [-828.137] -- 0:01:06
297000 -- [-829.366] (-840.425) (-830.886) (-832.074) * (-842.473) (-840.296) (-837.578) [-830.954] -- 0:01:06
298000 -- [-827.755] (-840.274) (-828.160) (-832.729) * (-843.398) (-841.848) (-838.745) [-828.702] -- 0:01:05
299000 -- [-826.381] (-839.572) (-830.948) (-828.739) * (-846.555) (-839.800) [-831.040] (-829.721) -- 0:01:05
300000 -- [-832.244] (-840.157) (-832.882) (-831.123) * (-843.530) (-837.345) [-829.218] (-830.779) -- 0:01:05
Average standard deviation of split frequencies: 0.013588
301000 -- (-830.226) (-839.962) (-827.398) [-826.753] * (-842.544) (-839.616) (-834.221) [-830.571] -- 0:01:05
302000 -- (-832.923) (-838.834) (-827.940) [-828.878] * (-840.697) (-842.996) (-829.061) [-832.474] -- 0:01:04
303000 -- (-834.001) (-837.611) (-834.582) [-831.493] * (-841.394) (-839.039) [-829.157] (-842.199) -- 0:01:04
304000 -- (-835.047) (-844.168) [-829.873] (-827.706) * (-835.861) (-846.440) (-829.114) [-831.469] -- 0:01:06
305000 -- [-833.770] (-840.120) (-825.068) (-827.538) * (-846.096) (-840.798) [-827.616] (-829.052) -- 0:01:06
Average standard deviation of split frequencies: 0.012324
306000 -- (-833.809) (-839.249) [-832.412] (-830.433) * (-839.674) [-830.538] (-842.992) (-832.478) -- 0:01:05
307000 -- (-835.786) (-841.163) [-828.929] (-828.815) * (-842.382) (-832.049) (-840.211) [-833.352] -- 0:01:05
308000 -- (-834.703) (-841.969) [-826.713] (-830.658) * (-840.542) [-826.467] (-834.981) (-831.757) -- 0:01:05
309000 -- (-839.855) (-842.525) (-829.642) [-831.005] * (-840.749) (-832.424) (-838.257) [-832.444] -- 0:01:04
310000 -- (-840.236) (-841.059) [-827.453] (-832.116) * (-840.478) [-832.182] (-840.793) (-831.966) -- 0:01:04
Average standard deviation of split frequencies: 0.014162
311000 -- (-836.103) (-841.946) [-825.497] (-830.704) * (-839.142) [-829.789] (-840.228) (-831.294) -- 0:01:04
312000 -- (-842.035) (-842.648) [-830.971] (-831.419) * (-841.741) (-829.338) (-837.545) [-829.824] -- 0:01:03
313000 -- (-841.832) (-842.827) [-832.441] (-830.807) * (-839.401) [-826.499] (-844.336) (-828.719) -- 0:01:03
314000 -- (-840.306) (-832.660) (-829.384) [-827.481] * (-840.526) (-831.860) (-840.954) [-827.564] -- 0:01:03
315000 -- (-839.464) (-831.239) [-830.133] (-830.282) * (-842.930) [-830.354] (-843.758) (-833.669) -- 0:01:05
Average standard deviation of split frequencies: 0.010940
316000 -- (-840.219) (-833.449) [-826.186] (-832.503) * (-840.048) (-830.771) (-840.794) [-830.007] -- 0:01:04
317000 -- (-840.110) [-830.865] (-831.620) (-829.841) * (-839.880) [-832.269] (-841.299) (-832.385) -- 0:01:04
318000 -- (-841.885) (-830.653) [-827.951] (-835.345) * (-841.704) [-834.946] (-843.309) (-831.580) -- 0:01:04
319000 -- (-839.758) [-833.633] (-828.962) (-831.268) * (-839.948) (-827.316) (-835.937) [-831.822] -- 0:01:04
320000 -- (-841.476) (-839.862) [-828.062] (-831.068) * (-840.170) (-842.171) (-838.717) [-827.155] -- 0:01:03
Average standard deviation of split frequencies: 0.008820
321000 -- (-841.008) (-843.137) (-830.819) [-829.526] * (-836.568) (-844.431) (-839.211) [-834.618] -- 0:01:03
322000 -- (-841.473) (-840.024) (-829.943) [-827.320] * (-839.572) (-841.710) (-840.799) [-833.919] -- 0:01:03
323000 -- (-844.381) (-843.371) (-829.291) [-830.018] * (-835.752) (-839.809) (-838.368) [-831.016] -- 0:01:02
324000 -- (-840.313) (-842.221) (-827.519) [-830.082] * (-841.330) (-841.362) (-840.149) [-828.943] -- 0:01:02
325000 -- (-840.273) (-840.849) [-831.600] (-828.539) * (-839.540) (-836.315) (-837.743) [-829.778] -- 0:01:02
Average standard deviation of split frequencies: 0.007712
326000 -- (-840.983) (-841.893) [-827.555] (-832.385) * (-839.321) [-830.721] (-836.480) (-827.748) -- 0:01:04
327000 -- (-841.652) (-841.905) [-828.713] (-833.472) * (-841.000) [-829.005] (-838.783) (-828.481) -- 0:01:03
328000 -- (-839.672) (-842.472) (-829.310) [-828.104] * (-841.585) (-836.486) (-839.290) [-827.409] -- 0:01:03
329000 -- (-841.233) (-839.631) [-832.970] (-828.015) * (-846.305) (-838.623) (-837.604) [-827.576] -- 0:01:03
330000 -- (-843.302) (-841.402) [-828.987] (-830.492) * (-844.329) (-838.101) [-836.578] (-827.081) -- 0:01:02
Average standard deviation of split frequencies: 0.006653
331000 -- (-839.452) (-838.132) [-830.932] (-827.526) * (-839.451) (-840.719) [-830.611] (-828.192) -- 0:01:02
332000 -- (-839.848) (-842.971) (-831.108) [-835.120] * (-840.875) (-841.128) [-826.736] (-828.934) -- 0:01:02
333000 -- (-842.327) (-840.985) (-833.621) [-827.748] * (-837.702) (-840.082) [-831.300] (-830.278) -- 0:01:02
334000 -- (-839.635) (-839.407) (-826.248) [-828.041] * (-838.977) (-842.764) [-830.789] (-828.031) -- 0:01:01
335000 -- (-841.097) (-842.349) [-824.756] (-829.775) * (-839.653) (-837.888) (-828.505) [-827.774] -- 0:01:01
Average standard deviation of split frequencies: 0.005612
336000 -- (-840.048) (-841.874) (-827.558) [-826.887] * (-846.871) (-839.038) [-832.604] (-830.280) -- 0:01:01
337000 -- (-839.908) (-846.453) [-832.612] (-834.960) * (-839.447) (-838.448) [-828.459] (-828.011) -- 0:01:02
338000 -- (-839.841) (-842.894) (-832.794) [-828.954] * (-840.911) (-843.340) [-831.801] (-833.010) -- 0:01:02
339000 -- (-838.897) (-840.384) [-830.048] (-832.334) * (-836.855) (-840.501) [-826.997] (-828.434) -- 0:01:02
340000 -- (-836.959) (-843.874) (-828.581) [-827.531] * (-837.698) (-839.005) (-832.398) [-827.110] -- 0:01:02
Average standard deviation of split frequencies: 0.004613
341000 -- (-839.737) (-844.541) (-827.219) [-829.203] * (-839.648) (-843.569) [-828.551] (-827.594) -- 0:01:01
342000 -- (-840.734) (-839.618) [-828.234] (-829.928) * (-841.379) (-842.211) [-829.356] (-830.768) -- 0:01:01
343000 -- (-835.145) (-838.969) (-829.958) [-828.024] * (-840.824) (-840.704) [-827.633] (-828.667) -- 0:01:01
344000 -- (-836.264) (-839.420) [-825.303] (-832.670) * (-841.301) (-836.503) (-830.736) [-829.897] -- 0:01:01
345000 -- (-842.575) (-837.885) (-831.679) [-826.600] * (-842.402) (-839.267) [-830.987] (-827.568) -- 0:01:00
Average standard deviation of split frequencies: 0.006358
346000 -- (-840.724) (-840.751) (-829.210) [-829.315] * (-841.747) (-839.588) (-828.486) [-827.440] -- 0:01:00
347000 -- (-839.561) (-842.036) (-829.889) [-832.161] * (-842.186) (-844.063) (-828.351) [-827.625] -- 0:01:00
348000 -- (-839.557) (-836.000) (-830.107) [-828.650] * (-841.538) (-839.819) (-827.144) [-831.407] -- 0:01:01
349000 -- (-841.297) (-839.781) (-829.042) [-827.321] * (-839.855) (-830.127) [-827.062] (-843.558) -- 0:01:01
350000 -- (-839.623) (-839.286) (-831.609) [-829.581] * (-839.119) (-830.878) [-830.564] (-838.812) -- 0:01:01
Average standard deviation of split frequencies: 0.005377
351000 -- (-838.897) (-839.081) (-829.278) [-828.838] * (-841.119) (-839.008) [-826.350] (-839.916) -- 0:01:01
352000 -- (-840.966) (-836.713) (-829.639) [-826.666] * (-840.659) (-839.397) [-826.724] (-834.710) -- 0:01:00
353000 -- (-839.641) (-838.314) (-828.613) [-831.440] * (-839.992) (-837.426) [-839.432] (-835.477) -- 0:01:00
354000 -- (-838.767) (-839.547) [-828.100] (-828.923) * (-840.613) (-841.423) (-827.404) [-833.906] -- 0:01:00
355000 -- (-842.135) (-838.962) [-829.480] (-829.007) * (-840.709) (-839.940) [-828.842] (-833.068) -- 0:00:59
Average standard deviation of split frequencies: 0.004414
356000 -- (-840.009) (-839.176) (-829.398) [-832.044] * (-842.808) (-841.494) [-826.959] (-829.866) -- 0:00:59
357000 -- (-839.891) (-837.638) [-827.191] (-833.657) * (-840.457) (-843.892) (-826.909) [-830.298] -- 0:00:59
358000 -- (-838.082) (-839.343) (-833.972) [-829.558] * (-839.858) (-841.964) [-829.378] (-828.334) -- 0:01:00
359000 -- (-844.937) (-846.674) (-828.733) [-829.676] * (-844.177) (-840.706) [-827.890] (-828.109) -- 0:01:00
360000 -- (-843.017) (-840.272) (-827.458) [-829.226] * (-841.282) (-839.500) (-831.154) [-828.238] -- 0:01:00
Average standard deviation of split frequencies: 0.004357
361000 -- (-840.456) (-841.129) [-829.456] (-827.864) * (-830.708) (-839.600) (-827.507) [-833.715] -- 0:01:00
362000 -- (-841.016) (-841.134) (-827.330) [-829.449] * (-828.772) (-840.144) [-830.265] (-829.974) -- 0:00:59
363000 -- (-838.771) (-839.987) (-827.066) [-828.206] * (-838.243) (-840.934) [-830.394] (-830.287) -- 0:00:59
364000 -- (-842.718) (-839.607) [-832.767] (-830.120) * (-842.609) (-839.985) [-826.656] (-827.919) -- 0:00:59
365000 -- (-838.450) (-841.533) (-829.709) [-829.340] * (-833.408) (-840.393) (-834.228) [-828.671] -- 0:00:59
Average standard deviation of split frequencies: 0.003435
366000 -- (-842.596) (-841.216) [-828.018] (-828.477) * (-827.524) (-842.046) [-829.809] (-833.276) -- 0:00:58
367000 -- (-842.733) (-841.831) (-827.832) [-828.236] * (-828.479) (-840.065) (-825.106) [-835.186] -- 0:00:58
368000 -- (-840.737) (-841.044) [-827.158] (-826.889) * (-829.444) (-844.130) (-831.594) [-825.600] -- 0:00:58
369000 -- (-840.752) (-840.621) [-828.464] (-827.023) * (-833.914) (-841.736) (-829.958) [-825.836] -- 0:00:59
370000 -- (-839.335) (-839.890) (-827.128) [-828.001] * (-827.826) (-842.609) [-829.601] (-830.380) -- 0:00:59
Average standard deviation of split frequencies: 0.007631
371000 -- (-840.474) (-833.951) [-828.189] (-828.198) * (-832.865) (-839.977) (-829.675) [-826.547] -- 0:00:59
372000 -- (-840.286) (-840.076) (-827.710) [-827.882] * (-833.673) (-837.826) (-831.529) [-828.146] -- 0:00:59
373000 -- (-841.642) (-838.849) [-829.830] (-830.310) * [-834.687] (-841.426) (-831.524) (-827.804) -- 0:00:58
374000 -- (-841.678) (-841.376) [-830.802] (-828.526) * [-830.314] (-842.231) (-827.921) (-830.675) -- 0:00:58
375000 -- (-842.319) (-843.855) [-828.341] (-826.198) * (-829.767) (-843.005) (-840.436) [-833.246] -- 0:00:58
Average standard deviation of split frequencies: 0.006687
376000 -- (-841.606) (-838.968) (-832.759) [-833.925] * [-834.620] (-840.322) (-842.067) (-832.036) -- 0:00:58
377000 -- (-842.424) (-843.087) [-830.306] (-831.272) * [-833.652] (-840.486) (-840.769) (-830.675) -- 0:00:57
378000 -- (-840.706) (-839.542) (-827.527) [-829.649] * [-827.109] (-840.279) (-840.355) (-829.540) -- 0:00:57
379000 -- (-840.683) (-839.615) [-828.734] (-829.298) * (-828.871) (-840.091) (-838.067) [-828.373] -- 0:00:57
380000 -- (-840.778) (-843.924) [-830.420] (-830.863) * (-831.653) (-839.750) (-840.308) [-831.235] -- 0:00:58
Average standard deviation of split frequencies: 0.004128
381000 -- (-842.694) (-840.924) [-826.579] (-836.181) * (-827.724) (-839.395) (-838.262) [-830.624] -- 0:00:58
382000 -- (-840.213) (-841.917) (-837.540) [-831.152] * (-829.486) (-842.428) (-828.309) [-827.810] -- 0:00:58
383000 -- (-842.463) (-842.546) (-837.020) [-832.240] * [-827.491] (-841.074) (-832.614) (-831.369) -- 0:00:57
384000 -- (-848.509) (-840.086) (-842.109) [-830.179] * (-827.413) (-841.593) (-839.006) [-833.188] -- 0:00:57
385000 -- (-839.641) (-839.432) (-831.896) [-831.455] * [-826.573] (-840.702) (-841.401) (-830.791) -- 0:00:57
Average standard deviation of split frequencies: 0.007328
386000 -- (-838.600) (-839.682) (-834.305) [-829.532] * (-832.501) (-843.427) (-837.695) [-829.671] -- 0:00:57
387000 -- (-839.251) (-840.291) [-830.008] (-831.755) * [-831.627] (-841.957) (-844.969) (-835.316) -- 0:00:57
388000 -- (-843.096) (-841.386) [-826.971] (-828.957) * (-831.984) (-832.510) (-839.394) [-830.262] -- 0:00:56
389000 -- (-837.616) (-842.335) (-829.336) [-830.927] * (-832.077) (-840.687) (-840.499) [-828.813] -- 0:00:56
390000 -- (-840.236) (-841.358) [-833.197] (-828.507) * [-828.528] (-841.319) (-844.184) (-832.448) -- 0:00:57
Average standard deviation of split frequencies: 0.007240
391000 -- (-843.022) (-840.041) [-828.425] (-827.437) * (-828.899) (-840.456) (-843.951) [-834.372] -- 0:00:57
392000 -- (-840.673) (-839.322) [-828.834] (-830.945) * [-829.550] (-839.131) (-843.515) (-832.145) -- 0:00:57
393000 -- [-843.404] (-839.476) (-837.834) (-828.601) * (-834.591) (-843.259) (-842.653) [-829.619] -- 0:00:57
394000 -- (-833.542) (-841.355) (-838.211) [-829.672] * (-830.552) (-839.533) (-846.597) [-830.848] -- 0:00:56
395000 -- (-832.922) (-841.152) [-832.889] (-827.472) * (-831.549) (-839.755) (-839.836) [-835.190] -- 0:00:56
Average standard deviation of split frequencies: 0.009523
396000 -- (-828.710) (-840.144) (-841.385) [-826.791] * (-830.084) (-839.872) (-840.689) [-834.722] -- 0:00:56
397000 -- (-833.305) [-832.590] (-842.802) (-834.179) * [-827.232] (-844.549) (-842.607) (-835.819) -- 0:00:56
398000 -- (-829.423) (-841.600) (-840.261) [-827.862] * (-828.776) (-841.211) (-839.344) [-831.779] -- 0:00:55
399000 -- [-830.492] (-842.229) (-842.264) (-830.174) * (-828.987) (-839.683) (-838.828) [-829.637] -- 0:00:55
400000 -- [-830.652] (-842.854) (-839.426) (-827.740) * [-827.280] (-838.841) (-839.031) (-834.266) -- 0:00:55
Average standard deviation of split frequencies: 0.012550
401000 -- [-829.946] (-838.278) (-841.237) (-831.456) * [-827.258] (-840.774) (-839.346) (-835.061) -- 0:00:56
402000 -- (-832.498) (-839.132) (-841.139) [-828.341] * (-828.923) (-841.854) (-840.824) [-830.785] -- 0:00:56
403000 -- [-830.562] (-841.335) (-837.037) (-833.478) * [-826.256] (-843.353) (-841.014) (-826.684) -- 0:00:56
404000 -- [-828.553] (-837.358) (-839.953) (-831.053) * (-830.782) (-843.547) (-841.856) [-829.077] -- 0:00:56
405000 -- [-825.418] (-831.152) (-840.154) (-829.813) * (-828.760) (-840.109) (-838.483) [-829.152] -- 0:00:55
Average standard deviation of split frequencies: 0.015481
406000 -- [-827.595] (-828.096) (-842.702) (-827.472) * (-829.244) (-839.856) (-839.884) [-829.863] -- 0:00:55
407000 -- [-828.873] (-828.140) (-840.055) (-830.404) * [-828.100] (-841.743) (-828.965) (-839.329) -- 0:00:55
408000 -- [-829.423] (-832.806) (-843.373) (-827.024) * [-827.335] (-840.335) (-832.104) (-844.717) -- 0:00:55
409000 -- [-831.255] (-830.289) (-842.784) (-827.271) * [-824.886] (-843.997) (-834.288) (-839.581) -- 0:00:54
410000 -- (-830.279) (-830.422) (-840.475) [-829.394] * [-827.404] (-840.985) (-829.248) (-839.805) -- 0:00:54
Average standard deviation of split frequencies: 0.014540
411000 -- [-828.747] (-838.823) (-843.244) (-833.595) * (-829.273) (-844.423) [-827.094] (-840.055) -- 0:00:54
412000 -- (-831.260) (-826.878) (-839.588) [-829.943] * [-827.232] (-839.095) (-827.129) (-838.864) -- 0:00:55
413000 -- (-838.858) [-831.732] (-840.219) (-832.893) * (-831.620) (-838.318) [-827.922] (-840.940) -- 0:00:55
414000 -- (-840.191) [-829.841] (-841.136) (-830.530) * (-835.004) (-841.752) [-827.738] (-841.968) -- 0:00:55
415000 -- (-840.235) (-831.825) (-844.415) [-832.649] * [-831.600] (-831.701) (-831.962) (-844.499) -- 0:00:54
Average standard deviation of split frequencies: 0.015109
416000 -- (-842.181) [-828.256] (-839.101) (-832.156) * [-828.575] (-842.899) (-827.266) (-831.005) -- 0:00:54
417000 -- (-844.675) (-828.870) (-837.282) [-831.522] * (-830.726) (-842.963) [-827.354] (-840.843) -- 0:00:54
418000 -- (-842.840) [-828.645] (-841.357) (-831.957) * (-828.203) (-839.661) [-830.269] (-840.834) -- 0:00:54
419000 -- (-841.687) [-831.060] (-841.166) (-827.391) * [-828.849] (-841.915) (-838.884) (-840.044) -- 0:00:54
420000 -- (-837.989) (-828.603) (-839.772) [-829.213] * [-829.888] (-841.173) (-838.377) (-838.767) -- 0:00:53
Average standard deviation of split frequencies: 0.011953
421000 -- (-842.586) (-833.036) (-838.428) [-833.557] * (-828.534) (-838.152) [-830.025] (-843.996) -- 0:00:53
422000 -- (-840.091) [-827.268] (-838.995) (-829.568) * [-828.505] (-840.677) (-829.556) (-839.443) -- 0:00:53
423000 -- (-841.331) (-832.164) (-841.257) [-828.301] * [-829.346] (-838.844) (-832.902) (-840.384) -- 0:00:54
424000 -- (-839.058) [-828.611] (-840.272) (-827.695) * [-826.908] (-830.049) (-828.904) (-840.395) -- 0:00:54
425000 -- (-842.912) [-831.608] (-840.920) (-832.920) * [-826.888] (-843.081) (-830.841) (-840.511) -- 0:00:54
Average standard deviation of split frequencies: 0.010328
426000 -- (-842.278) (-832.868) (-840.075) [-828.234] * (-827.518) (-837.329) [-828.857] (-842.747) -- 0:00:53
427000 -- (-840.263) [-830.018] (-839.146) (-829.471) * (-828.662) (-840.702) [-828.883] (-839.620) -- 0:00:53
428000 -- (-843.452) [-833.091] (-839.153) (-828.632) * (-828.724) [-832.633] (-837.635) (-839.750) -- 0:00:53
429000 -- (-840.125) (-829.446) (-842.960) [-826.517] * [-830.987] (-848.256) (-841.002) (-843.257) -- 0:00:53
430000 -- (-841.982) [-829.087] (-836.837) (-830.969) * (-831.601) [-829.386] (-834.556) (-844.146) -- 0:00:53
Average standard deviation of split frequencies: 0.010946
431000 -- (-840.440) (-828.889) (-842.283) [-828.349] * [-827.202] (-833.905) (-838.622) (-841.654) -- 0:00:52
432000 -- (-837.382) (-828.142) [-826.796] (-828.455) * (-830.386) [-830.864] (-840.232) (-841.525) -- 0:00:52
433000 -- (-840.500) [-830.883] (-827.206) (-829.854) * [-829.506] (-829.141) (-840.283) (-839.802) -- 0:00:52
434000 -- (-835.405) [-831.176] (-827.805) (-834.530) * (-831.748) [-830.472] (-839.302) (-838.417) -- 0:00:53
435000 -- (-841.435) (-829.880) (-828.817) [-828.350] * (-832.037) [-831.537] (-845.408) (-839.796) -- 0:00:53
Average standard deviation of split frequencies: 0.012254
436000 -- (-841.408) (-828.942) (-827.773) [-828.982] * [-833.310] (-833.978) (-842.686) (-842.220) -- 0:00:53
437000 -- (-839.972) (-837.355) [-827.902] (-831.678) * [-835.156] (-833.447) (-842.129) (-844.404) -- 0:00:52
438000 -- (-840.669) (-840.713) [-827.811] (-829.858) * (-827.915) [-834.991] (-841.465) (-838.413) -- 0:00:52
439000 -- (-839.790) (-839.358) (-828.106) [-831.910] * (-829.905) [-828.793] (-840.995) (-844.007) -- 0:00:52
440000 -- (-841.614) (-840.833) [-826.711] (-826.889) * [-827.335] (-834.137) (-841.248) (-839.131) -- 0:00:52
Average standard deviation of split frequencies: 0.012124
441000 -- (-838.892) (-843.028) [-829.831] (-828.564) * [-828.075] (-832.862) (-839.527) (-839.687) -- 0:00:51
442000 -- (-842.779) (-841.004) (-828.678) [-828.501] * (-832.700) [-834.549] (-840.318) (-839.668) -- 0:00:51
443000 -- (-841.074) (-841.664) [-827.064] (-829.941) * [-828.013] (-832.902) (-837.948) (-838.569) -- 0:00:51
444000 -- (-841.772) (-840.951) [-832.212] (-831.421) * [-830.201] (-829.671) (-833.918) (-843.567) -- 0:00:51
445000 -- (-844.496) (-839.502) [-828.468] (-828.512) * [-827.385] (-839.518) (-837.677) (-840.075) -- 0:00:52
Average standard deviation of split frequencies: 0.010570
446000 -- (-844.271) (-842.816) (-830.992) [-828.875] * [-826.917] (-841.788) (-838.218) (-833.957) -- 0:00:52
447000 -- (-844.201) (-840.182) [-830.466] (-828.774) * (-831.674) (-832.876) (-840.096) [-831.306] -- 0:00:51
448000 -- (-842.231) (-839.438) (-831.155) [-829.087] * [-828.306] (-829.721) (-846.792) (-829.026) -- 0:00:51
449000 -- (-840.578) (-838.549) (-829.696) [-831.808] * [-828.727] (-827.634) (-840.979) (-837.462) -- 0:00:51
450000 -- (-839.565) (-841.681) (-829.791) [-827.226] * (-830.948) (-827.096) (-842.137) [-829.509] -- 0:00:51
Average standard deviation of split frequencies: 0.009763
451000 -- (-844.242) (-843.449) (-829.524) [-833.822] * (-828.636) (-829.181) (-843.963) [-831.328] -- 0:00:51
452000 -- (-841.550) (-841.502) [-830.116] (-831.428) * [-828.884] (-828.530) (-843.828) (-830.948) -- 0:00:50
453000 -- (-844.120) (-841.186) [-830.420] (-829.248) * (-828.059) [-833.134] (-842.153) (-829.996) -- 0:00:50
454000 -- (-841.377) (-839.538) [-828.421] (-830.328) * (-830.412) (-828.264) (-847.371) [-829.112] -- 0:00:50
455000 -- (-840.663) (-840.521) [-834.761] (-828.753) * (-832.700) (-832.537) (-841.589) [-828.119] -- 0:00:50
Average standard deviation of split frequencies: 0.011027
456000 -- (-838.466) (-839.186) [-826.504] (-826.378) * (-838.099) [-831.457] (-841.508) (-829.147) -- 0:00:51
457000 -- (-840.586) (-840.340) (-835.218) [-827.944] * (-834.490) (-832.899) (-842.021) [-830.686] -- 0:00:51
458000 -- (-841.241) (-847.527) [-828.335] (-833.496) * (-839.604) (-829.354) (-844.778) [-827.902] -- 0:00:50
459000 -- (-840.913) (-839.993) (-830.808) [-831.872] * (-843.415) (-827.517) (-842.259) [-828.929] -- 0:00:50
460000 -- (-843.421) (-841.345) [-826.985] (-832.214) * (-842.146) [-829.763] (-840.111) (-828.957) -- 0:00:50
Average standard deviation of split frequencies: 0.012962
461000 -- (-840.129) (-838.812) (-833.523) [-834.638] * (-838.555) [-831.099] (-840.992) (-829.766) -- 0:00:50
462000 -- (-843.788) (-842.044) (-829.935) [-828.684] * (-840.073) (-833.406) (-842.278) [-828.214] -- 0:00:50
463000 -- (-842.119) (-840.457) [-834.000] (-830.221) * (-838.697) (-834.556) (-841.447) [-826.128] -- 0:00:49
464000 -- (-839.527) (-840.153) (-829.376) [-829.548] * (-838.708) [-829.598] (-841.027) (-837.772) -- 0:00:49
465000 -- (-843.026) (-841.875) [-831.984] (-827.860) * (-840.116) [-827.299] (-840.955) (-828.560) -- 0:00:49
Average standard deviation of split frequencies: 0.012814
466000 -- (-842.801) (-846.419) (-829.442) [-828.880] * (-835.858) [-827.277] (-840.604) (-827.113) -- 0:00:49
467000 -- (-840.163) (-845.185) [-829.756] (-832.192) * (-839.544) [-828.064] (-841.113) (-837.797) -- 0:00:50
468000 -- (-842.080) (-835.916) (-829.334) [-829.117] * (-840.482) (-828.135) (-840.573) [-827.935] -- 0:00:50
469000 -- (-839.352) (-841.307) (-831.395) [-829.614] * (-840.732) (-826.389) (-839.188) [-827.816] -- 0:00:49
470000 -- (-838.112) (-839.170) [-827.600] (-829.754) * (-843.631) (-828.267) (-839.209) [-828.147] -- 0:00:49
Average standard deviation of split frequencies: 0.012019
471000 -- (-838.605) (-841.078) [-830.301] (-829.781) * (-839.621) [-828.297] (-841.630) (-831.853) -- 0:00:49
472000 -- (-840.773) (-839.329) (-831.117) [-830.187] * (-840.296) (-828.770) (-841.073) [-828.217] -- 0:00:49
473000 -- (-834.884) (-836.871) (-830.837) [-831.479] * (-837.876) (-832.518) (-840.675) [-826.788] -- 0:00:49
474000 -- (-840.540) (-839.400) [-828.839] (-828.648) * (-839.514) [-828.473] (-839.873) (-833.805) -- 0:00:48
475000 -- (-840.997) (-840.266) (-834.361) [-830.319] * (-839.439) [-830.640] (-839.807) (-828.167) -- 0:00:48
Average standard deviation of split frequencies: 0.014525
476000 -- (-837.356) (-840.100) (-829.603) [-830.606] * (-839.551) (-832.228) (-837.603) [-828.208] -- 0:00:48
477000 -- (-844.076) (-834.688) [-828.739] (-832.013) * (-839.799) (-829.729) (-837.741) [-828.411] -- 0:00:48
478000 -- (-839.473) (-841.693) [-831.042] (-837.506) * (-839.619) (-833.094) (-834.106) [-827.496] -- 0:00:49
479000 -- (-843.515) (-841.150) [-828.093] (-840.562) * (-841.052) [-826.777] (-832.161) (-831.392) -- 0:00:48
480000 -- (-840.091) (-840.553) [-834.159] (-840.701) * (-837.427) (-827.946) (-829.811) [-826.643] -- 0:00:48
Average standard deviation of split frequencies: 0.016346
481000 -- [-840.379] (-841.845) (-831.680) (-840.211) * (-830.956) (-836.872) [-828.505] (-833.578) -- 0:00:48
482000 -- (-841.556) (-840.212) [-829.074] (-838.955) * [-829.697] (-838.691) (-828.910) (-827.354) -- 0:00:48
483000 -- (-843.693) (-838.851) [-829.549] (-842.488) * [-828.473] (-839.223) (-829.291) (-830.099) -- 0:00:48
484000 -- (-841.380) (-838.870) [-826.509] (-836.245) * (-829.000) (-839.616) [-828.445] (-829.623) -- 0:00:47
485000 -- (-840.475) (-827.315) [-828.564] (-839.601) * [-829.816] (-841.153) (-831.388) (-827.130) -- 0:00:47
Average standard deviation of split frequencies: 0.016166
486000 -- (-844.218) (-831.997) [-828.393] (-840.701) * (-838.130) (-841.540) [-833.246] (-831.041) -- 0:00:47
487000 -- (-840.177) (-836.517) [-828.688] (-841.380) * (-837.235) (-836.798) (-833.175) [-827.929] -- 0:00:47
488000 -- (-845.828) (-840.362) [-834.424] (-840.796) * (-840.082) (-838.034) (-835.643) [-828.499] -- 0:00:47
489000 -- (-840.793) (-840.917) [-835.021] (-842.102) * (-837.743) (-841.427) [-830.408] (-830.836) -- 0:00:48
490000 -- (-840.310) (-841.943) [-830.622] (-839.789) * (-840.236) (-843.010) (-830.341) [-828.305] -- 0:00:47
Average standard deviation of split frequencies: 0.016012
491000 -- (-839.074) [-829.430] (-833.007) (-836.496) * (-837.693) (-841.115) [-828.473] (-829.198) -- 0:00:47
492000 -- (-840.407) [-836.524] (-831.330) (-838.770) * (-840.198) (-841.344) (-830.183) [-829.308] -- 0:00:47
493000 -- (-842.325) [-834.600] (-829.557) (-840.585) * (-838.433) (-840.056) [-828.017] (-830.018) -- 0:00:47
494000 -- (-844.886) [-830.750] (-836.880) (-841.835) * (-841.153) (-840.589) (-830.911) [-834.430] -- 0:00:47
495000 -- (-839.885) [-829.353] (-833.161) (-838.346) * (-842.711) (-838.780) [-832.574] (-831.257) -- 0:00:46
Average standard deviation of split frequencies: 0.015207
496000 -- (-838.469) [-829.131] (-832.098) (-840.302) * (-841.074) (-844.792) (-837.609) [-830.506] -- 0:00:46
497000 -- (-841.870) [-831.111] (-831.719) (-839.392) * (-840.835) (-843.791) (-840.139) [-828.459] -- 0:00:46
498000 -- (-842.031) [-832.184] (-832.492) (-840.348) * (-843.365) (-842.995) (-838.365) [-833.634] -- 0:00:46
499000 -- (-839.656) [-828.496] (-830.533) (-831.602) * (-839.555) (-841.526) (-839.620) [-829.931] -- 0:00:46
500000 -- (-840.269) (-831.663) [-832.150] (-840.919) * (-841.225) (-837.097) (-832.956) [-830.792] -- 0:00:47
Average standard deviation of split frequencies: 0.014437
501000 -- (-833.993) [-829.377] (-843.740) (-844.002) * (-840.036) (-836.599) [-830.153] (-840.561) -- 0:00:46
502000 -- [-836.819] (-832.272) (-839.176) (-841.587) * (-841.963) (-837.823) [-830.475] (-834.981) -- 0:00:46
503000 -- [-841.928] (-832.799) (-840.364) (-840.256) * (-844.591) (-844.084) (-830.958) [-830.052] -- 0:00:46
504000 -- (-828.734) [-828.537] (-837.913) (-839.829) * (-841.286) (-840.458) [-827.609] (-834.591) -- 0:00:46
505000 -- [-829.500] (-831.082) (-839.187) (-840.759) * (-840.986) (-840.097) [-827.330] (-838.789) -- 0:00:46
Average standard deviation of split frequencies: 0.013043
506000 -- (-829.156) [-833.143] (-840.926) (-838.926) * (-842.026) (-844.419) [-829.333] (-842.389) -- 0:00:45
507000 -- [-831.819] (-831.157) (-842.174) (-837.304) * (-841.032) (-837.669) [-826.486] (-834.930) -- 0:00:45
508000 -- (-831.719) (-830.647) [-830.988] (-840.723) * (-841.009) (-836.351) [-828.793] (-839.797) -- 0:00:45
509000 -- (-834.731) (-832.366) [-829.478] (-829.024) * (-841.242) [-834.414] (-828.594) (-840.907) -- 0:00:45
510000 -- (-830.155) (-830.086) [-827.965] (-839.345) * (-842.906) (-832.676) [-829.397] (-839.695) -- 0:00:46
Average standard deviation of split frequencies: 0.012924
511000 -- (-838.477) [-826.662] (-835.284) (-836.536) * (-840.566) [-829.709] (-841.447) (-840.426) -- 0:00:45
512000 -- (-840.108) (-831.043) [-834.895] (-830.883) * (-839.655) (-830.419) (-840.235) [-833.839] -- 0:00:45
513000 -- (-840.027) [-831.527] (-841.126) (-831.959) * (-837.566) [-830.025] (-841.617) (-829.226) -- 0:00:45
514000 -- (-842.359) (-830.793) [-834.495] (-829.294) * (-837.861) (-834.349) (-842.892) [-829.279] -- 0:00:45
515000 -- (-841.981) (-829.749) (-833.243) [-830.814] * (-840.451) (-831.243) (-835.744) [-828.109] -- 0:00:45
Average standard deviation of split frequencies: 0.012181
516000 -- (-839.982) (-839.422) (-834.374) [-831.616] * (-842.756) [-828.064] (-833.526) (-827.137) -- 0:00:45
517000 -- (-839.445) (-839.994) [-831.668] (-827.740) * (-840.528) (-831.310) [-830.604] (-833.268) -- 0:00:44
518000 -- (-840.725) (-835.033) [-831.055] (-826.977) * (-840.608) [-830.819] (-827.963) (-829.733) -- 0:00:44
519000 -- (-840.649) (-842.004) (-831.463) [-832.255] * (-839.374) (-827.652) [-832.614] (-828.830) -- 0:00:44
520000 -- (-842.417) (-839.852) (-839.210) [-832.570] * (-838.504) [-828.670] (-828.769) (-829.819) -- 0:00:44
Average standard deviation of split frequencies: 0.011468
521000 -- (-839.551) [-834.113] (-836.884) (-833.006) * (-838.627) [-825.812] (-828.041) (-838.580) -- 0:00:45
522000 -- (-845.145) (-839.152) (-838.496) [-831.496] * (-841.737) (-829.722) [-830.373] (-832.091) -- 0:00:44
523000 -- (-842.126) (-840.563) (-841.898) [-828.401] * (-840.451) (-837.621) [-830.143] (-834.226) -- 0:00:44
524000 -- (-845.008) (-839.770) [-833.269] (-839.008) * (-843.300) (-837.651) [-832.004] (-838.417) -- 0:00:44
525000 -- (-841.600) (-839.039) [-829.467] (-840.357) * (-844.366) (-840.950) [-827.139] (-837.857) -- 0:00:44
Average standard deviation of split frequencies: 0.008962
526000 -- (-832.581) (-844.079) [-832.956] (-840.003) * (-829.841) (-838.147) [-829.525] (-839.564) -- 0:00:44
527000 -- (-832.540) (-839.338) [-831.366] (-838.526) * [-833.141] (-837.683) (-830.718) (-839.083) -- 0:00:43
528000 -- (-833.665) (-829.221) [-829.074] (-842.786) * (-831.492) (-838.860) [-831.371] (-840.607) -- 0:00:43
529000 -- (-829.227) (-830.713) [-826.801] (-840.282) * (-833.375) (-839.148) [-828.647] (-840.077) -- 0:00:43
530000 -- (-829.714) (-840.564) [-827.546] (-840.512) * [-828.541] (-839.671) (-829.530) (-835.188) -- 0:00:43
Average standard deviation of split frequencies: 0.005922
531000 -- (-828.644) (-841.395) [-827.874] (-841.999) * [-832.176] (-827.649) (-834.202) (-839.858) -- 0:00:43
532000 -- [-827.243] (-840.731) (-829.453) (-842.124) * (-831.943) (-828.945) [-826.510] (-836.107) -- 0:00:43
533000 -- [-828.021] (-842.068) (-829.430) (-837.083) * (-827.781) (-828.621) [-826.258] (-837.420) -- 0:00:43
534000 -- (-829.356) (-845.537) [-830.164] (-839.084) * (-831.770) (-833.056) [-826.266] (-837.613) -- 0:00:43
535000 -- (-830.345) (-840.132) [-828.610] (-839.706) * [-831.186] (-835.259) (-832.745) (-840.131) -- 0:00:43
Average standard deviation of split frequencies: 0.005277
536000 -- (-830.171) (-843.029) [-827.844] (-841.097) * [-832.888] (-833.463) (-829.327) (-839.939) -- 0:00:43
537000 -- [-830.125] (-837.730) (-840.158) (-841.113) * (-831.554) (-826.981) [-829.513] (-839.874) -- 0:00:43
538000 -- [-827.920] (-839.994) (-840.202) (-840.198) * (-828.558) (-828.437) [-826.277] (-840.737) -- 0:00:42
539000 -- [-829.485] (-841.261) (-845.179) (-841.539) * (-830.141) [-831.995] (-828.247) (-841.348) -- 0:00:42
540000 -- [-827.567] (-832.911) (-840.003) (-840.301) * [-833.300] (-829.279) (-828.331) (-840.733) -- 0:00:42
Average standard deviation of split frequencies: 0.002325
541000 -- [-827.572] (-832.279) (-838.670) (-845.346) * (-832.958) [-829.013] (-828.491) (-839.795) -- 0:00:42
542000 -- [-830.421] (-839.497) (-842.076) (-843.278) * [-834.645] (-827.941) (-825.727) (-839.249) -- 0:00:42
543000 -- [-829.758] (-838.757) (-831.735) (-837.957) * (-826.593) (-827.800) [-828.665] (-839.415) -- 0:00:42
544000 -- [-827.314] (-841.670) (-829.563) (-840.574) * (-839.141) (-829.498) [-827.994] (-841.028) -- 0:00:42
545000 -- (-838.453) (-842.762) [-826.414] (-843.857) * (-840.779) (-828.327) [-828.491] (-841.571) -- 0:00:42
Average standard deviation of split frequencies: 0.001727
546000 -- (-839.170) (-841.647) [-829.229] (-839.970) * (-839.776) (-836.771) [-827.371] (-839.188) -- 0:00:42
547000 -- (-836.907) (-839.552) [-829.142] (-842.078) * (-841.350) (-839.535) [-833.014] (-831.021) -- 0:00:42
548000 -- (-839.780) (-840.614) [-828.739] (-842.849) * (-840.305) (-839.642) (-841.461) [-830.911] -- 0:00:42
549000 -- (-836.150) (-838.970) [-830.963] (-841.078) * (-840.910) (-840.397) (-829.639) [-829.996] -- 0:00:41
550000 -- (-838.850) (-839.583) [-828.552] (-839.729) * (-844.225) (-838.684) [-829.975] (-829.519) -- 0:00:41
Average standard deviation of split frequencies: 0.001712
551000 -- (-840.722) (-842.780) [-826.730] (-838.415) * (-838.639) (-840.869) (-830.084) [-831.998] -- 0:00:41
552000 -- (-841.234) (-843.798) [-830.569] (-839.246) * (-840.213) (-841.403) [-830.635] (-830.704) -- 0:00:41
553000 -- (-830.451) (-842.452) [-825.998] (-838.350) * (-840.933) (-840.767) [-831.811] (-828.096) -- 0:00:41
554000 -- (-831.250) (-839.815) [-826.349] (-839.310) * (-839.648) (-840.653) (-830.011) [-829.476] -- 0:00:41
555000 -- [-828.036] (-846.704) (-826.852) (-840.339) * (-844.971) (-839.381) [-829.100] (-829.441) -- 0:00:41
Average standard deviation of split frequencies: 0.001130
556000 -- (-828.248) (-842.246) [-827.335] (-837.245) * (-839.997) (-838.698) (-828.230) [-830.025] -- 0:00:41
557000 -- [-830.706] (-846.259) (-825.579) (-840.404) * (-841.560) (-840.445) (-830.881) [-827.619] -- 0:00:41
558000 -- [-832.485] (-837.770) (-831.043) (-837.092) * (-841.550) (-839.235) [-832.605] (-831.979) -- 0:00:41
559000 -- [-835.340] (-836.116) (-830.055) (-841.138) * (-840.818) (-839.246) [-827.854] (-831.837) -- 0:00:41
560000 -- [-835.467] (-841.946) (-828.926) (-839.438) * (-840.680) (-843.551) [-830.269] (-827.132) -- 0:00:40
Average standard deviation of split frequencies: 0.002242
561000 -- (-836.457) (-839.411) [-829.090] (-843.007) * (-839.315) (-841.751) [-829.281] (-827.748) -- 0:00:40
562000 -- [-832.356] (-840.203) (-828.749) (-839.461) * (-842.252) (-840.101) [-828.833] (-834.945) -- 0:00:40
563000 -- [-835.821] (-840.973) (-827.010) (-837.808) * (-839.374) (-836.963) (-830.066) [-829.974] -- 0:00:40
564000 -- [-832.421] (-839.050) (-838.790) (-837.533) * (-842.847) (-840.533) [-828.604] (-829.041) -- 0:00:40
565000 -- [-836.252] (-838.681) (-840.846) (-837.481) * (-839.676) (-839.225) (-842.514) [-830.676] -- 0:00:40
Average standard deviation of split frequencies: 0.003331
566000 -- [-829.317] (-838.204) (-840.554) (-837.813) * (-838.639) (-837.898) (-840.030) [-831.451] -- 0:00:40
567000 -- [-828.493] (-839.414) (-840.924) (-835.467) * (-839.892) (-836.754) [-830.165] (-829.107) -- 0:00:40
568000 -- [-826.561] (-838.492) (-842.427) (-834.611) * (-841.258) (-841.510) (-832.496) [-831.607] -- 0:00:40
569000 -- [-827.437] (-840.118) (-840.755) (-840.181) * (-839.608) (-837.573) [-829.553] (-832.585) -- 0:00:40
570000 -- [-824.785] (-838.722) (-831.107) (-841.034) * (-841.539) (-840.204) [-835.495] (-834.393) -- 0:00:39
Average standard deviation of split frequencies: 0.003304
571000 -- (-826.834) (-842.301) [-835.039] (-840.056) * (-840.752) (-841.183) [-832.433] (-832.614) -- 0:00:39
572000 -- (-826.709) (-842.093) [-832.806] (-838.899) * (-842.688) (-840.570) (-840.631) [-835.578] -- 0:00:39
573000 -- (-828.172) (-839.382) [-828.292] (-839.542) * (-838.436) (-841.980) (-839.540) [-828.355] -- 0:00:39
574000 -- [-827.698] (-842.529) (-829.253) (-833.673) * [-834.108] (-840.196) (-841.456) (-832.597) -- 0:00:39
575000 -- (-833.509) (-840.972) [-832.529] (-839.898) * (-832.022) (-840.222) (-840.117) [-828.726] -- 0:00:39
Average standard deviation of split frequencies: 0.004365
576000 -- [-830.058] (-841.552) (-828.354) (-841.400) * (-837.145) (-840.073) (-840.808) [-832.283] -- 0:00:39
577000 -- (-831.368) (-839.523) [-828.888] (-839.694) * [-832.157] (-842.488) (-842.210) (-827.031) -- 0:00:39
578000 -- [-831.486] (-837.140) (-828.810) (-836.418) * [-831.361] (-840.158) (-842.984) (-827.681) -- 0:00:39
579000 -- [-826.411] (-839.529) (-829.873) (-839.425) * (-833.820) (-844.090) (-839.528) [-829.219] -- 0:00:39
580000 -- [-827.495] (-839.931) (-828.906) (-840.180) * [-831.978] (-841.802) (-840.926) (-829.691) -- 0:00:39
Average standard deviation of split frequencies: 0.004330
581000 -- (-827.387) (-841.395) (-831.986) [-826.220] * [-832.188] (-843.246) (-837.470) (-832.542) -- 0:00:38
582000 -- (-827.259) (-841.938) [-827.760] (-829.570) * (-828.892) (-844.904) (-838.190) [-829.853] -- 0:00:38
583000 -- (-829.207) (-841.902) (-827.906) [-828.614] * [-829.035] (-841.607) (-837.495) (-827.744) -- 0:00:38
584000 -- (-831.691) (-841.782) (-829.493) [-831.236] * [-827.538] (-841.613) (-841.252) (-827.393) -- 0:00:38
585000 -- (-827.693) (-845.450) (-832.955) [-827.598] * [-831.046] (-842.124) (-841.692) (-832.843) -- 0:00:38
Average standard deviation of split frequencies: 0.003218
586000 -- (-827.483) (-839.634) [-829.645] (-827.795) * (-833.088) (-839.473) (-838.760) [-830.727] -- 0:00:38
587000 -- (-827.175) (-839.506) (-830.485) [-827.069] * (-827.263) (-839.830) (-839.736) [-830.345] -- 0:00:38
588000 -- [-828.342] (-838.701) (-831.243) (-831.116) * (-831.287) (-840.164) (-840.385) [-830.546] -- 0:00:38
589000 -- (-827.734) (-843.144) (-838.461) [-826.861] * [-827.096] (-839.263) (-842.897) (-829.419) -- 0:00:38
590000 -- (-829.477) (-835.739) (-829.544) [-828.918] * (-829.507) (-828.821) (-839.531) [-829.340] -- 0:00:38
Average standard deviation of split frequencies: 0.003724
591000 -- (-827.760) (-840.249) (-835.359) [-829.392] * (-835.739) [-829.295] (-835.318) (-829.661) -- 0:00:38
592000 -- [-828.391] (-839.767) (-831.445) (-829.292) * [-826.479] (-827.922) (-841.528) (-832.798) -- 0:00:37
593000 -- (-830.272) (-839.002) (-846.404) [-825.658] * (-829.905) [-828.020] (-841.797) (-828.800) -- 0:00:37
594000 -- [-831.282] (-842.113) (-838.347) (-827.649) * (-829.250) (-830.544) (-840.121) [-835.050] -- 0:00:37
595000 -- [-831.328] (-842.334) (-840.142) (-833.980) * [-825.518] (-828.743) (-841.920) (-837.194) -- 0:00:37
Average standard deviation of split frequencies: 0.003691
596000 -- (-828.782) (-841.156) (-832.037) [-827.026] * [-827.941] (-834.208) (-840.992) (-831.461) -- 0:00:37
597000 -- (-830.978) (-839.470) (-843.779) [-827.536] * (-831.350) [-829.305] (-842.036) (-840.409) -- 0:00:37
598000 -- (-827.700) (-839.260) (-839.019) [-827.938] * (-832.454) [-832.320] (-840.535) (-840.607) -- 0:00:37
599000 -- (-830.993) (-838.911) (-840.719) [-827.291] * (-829.922) [-828.590] (-842.739) (-843.606) -- 0:00:37
600000 -- (-827.911) (-841.175) (-842.340) [-827.664] * [-831.115] (-828.424) (-840.587) (-842.089) -- 0:00:37
Average standard deviation of split frequencies: 0.005755
601000 -- [-828.055] (-842.748) (-839.165) (-833.691) * (-830.926) [-831.784] (-841.203) (-839.588) -- 0:00:37
602000 -- (-827.430) (-841.078) (-839.451) [-829.625] * [-832.433] (-830.177) (-839.552) (-841.449) -- 0:00:37
603000 -- (-827.761) (-840.436) [-827.923] (-829.191) * [-829.205] (-831.471) (-840.519) (-841.068) -- 0:00:36
604000 -- (-829.174) (-837.845) (-828.183) [-827.551] * (-834.688) [-828.758] (-842.710) (-840.968) -- 0:00:36
605000 -- (-832.094) (-840.801) [-828.632] (-828.185) * [-826.195] (-828.050) (-841.083) (-839.101) -- 0:00:36
Average standard deviation of split frequencies: 0.006223
606000 -- (-829.158) (-837.956) (-829.375) [-829.186] * (-831.147) [-827.604] (-840.027) (-839.978) -- 0:00:36
607000 -- (-830.559) (-834.354) [-833.512] (-828.052) * [-828.798] (-825.708) (-840.895) (-839.968) -- 0:00:36
608000 -- (-829.899) (-840.578) [-830.549] (-831.096) * (-829.446) [-827.227] (-845.522) (-851.898) -- 0:00:36
609000 -- [-827.551] (-835.086) (-836.792) (-829.687) * (-829.794) [-827.329] (-840.554) (-840.698) -- 0:00:36
610000 -- [-828.511] (-839.567) (-840.217) (-828.473) * (-828.900) [-829.348] (-842.097) (-838.122) -- 0:00:36
Average standard deviation of split frequencies: 0.005146
611000 -- (-831.537) (-841.166) (-841.865) [-831.844] * [-830.439] (-828.079) (-831.110) (-841.803) -- 0:00:36
612000 -- (-832.858) (-839.837) (-840.806) [-830.647] * [-832.928] (-829.256) (-842.080) (-839.989) -- 0:00:36
613000 -- (-829.306) (-839.952) (-839.363) [-826.138] * (-830.791) (-834.194) [-832.271] (-842.597) -- 0:00:35
614000 -- [-828.113] (-840.330) (-839.686) (-828.081) * [-836.045] (-835.329) (-831.243) (-839.671) -- 0:00:35
615000 -- [-828.323] (-840.064) (-842.085) (-828.713) * (-840.526) [-829.392] (-839.822) (-841.225) -- 0:00:35
Average standard deviation of split frequencies: 0.004592
616000 -- [-829.624] (-839.362) (-840.671) (-826.042) * (-845.285) (-831.002) [-833.568] (-837.307) -- 0:00:35
617000 -- (-832.100) (-839.275) (-841.646) [-827.824] * (-840.757) [-833.982] (-832.461) (-839.633) -- 0:00:35
618000 -- [-830.387] (-837.365) (-836.139) (-827.056) * (-841.180) (-829.631) [-832.473] (-841.015) -- 0:00:35
619000 -- (-828.421) (-841.051) (-838.223) [-825.926] * (-840.622) [-828.666] (-832.902) (-838.220) -- 0:00:35
620000 -- (-828.814) (-839.763) (-840.883) [-830.435] * (-841.811) (-829.587) [-829.076] (-841.147) -- 0:00:35
Average standard deviation of split frequencies: 0.005570
621000 -- [-833.435] (-839.256) (-841.028) (-830.008) * (-841.996) [-828.359] (-831.024) (-839.970) -- 0:00:35
622000 -- (-831.423) (-837.461) (-844.871) [-830.340] * (-839.222) [-829.070] (-829.345) (-839.210) -- 0:00:35
623000 -- (-830.001) (-841.767) (-840.783) [-829.410] * (-839.866) [-830.732] (-829.640) (-841.396) -- 0:00:35
624000 -- [-828.631] (-843.113) (-837.957) (-840.002) * (-841.802) (-833.579) [-830.686] (-841.568) -- 0:00:34
625000 -- [-831.041] (-832.877) (-843.127) (-837.296) * (-845.184) [-832.230] (-829.932) (-832.944) -- 0:00:34
Average standard deviation of split frequencies: 0.007530
626000 -- [-828.160] (-828.402) (-839.855) (-836.639) * (-839.555) (-829.359) [-831.359] (-841.050) -- 0:00:34
627000 -- [-828.483] (-837.771) (-839.213) (-840.151) * (-840.088) (-828.718) [-829.663] (-838.305) -- 0:00:34
628000 -- [-829.231] (-830.192) (-839.765) (-838.722) * (-840.059) [-826.018] (-835.697) (-833.224) -- 0:00:34
629000 -- [-831.635] (-828.215) (-843.010) (-837.876) * (-838.816) [-830.352] (-838.402) (-839.412) -- 0:00:34
630000 -- (-826.453) [-831.661] (-840.676) (-839.280) * (-836.262) [-829.842] (-840.949) (-835.631) -- 0:00:34
Average standard deviation of split frequencies: 0.007973
631000 -- [-826.143] (-829.815) (-840.251) (-841.246) * [-827.072] (-831.788) (-840.822) (-843.143) -- 0:00:34
632000 -- (-826.213) [-831.995] (-839.286) (-841.434) * [-827.303] (-830.047) (-840.984) (-837.998) -- 0:00:34
633000 -- (-833.001) [-831.359] (-838.699) (-839.650) * [-832.930] (-829.126) (-839.310) (-835.101) -- 0:00:34
634000 -- (-828.715) [-829.424] (-841.443) (-839.682) * (-830.389) [-831.738] (-841.755) (-841.578) -- 0:00:34
635000 -- [-826.820] (-832.564) (-840.153) (-843.259) * [-832.280] (-827.739) (-838.113) (-841.744) -- 0:00:33
Average standard deviation of split frequencies: 0.008400
636000 -- [-832.879] (-829.216) (-840.534) (-842.794) * [-829.629] (-830.066) (-831.295) (-840.606) -- 0:00:33
637000 -- (-831.123) [-829.688] (-842.342) (-839.188) * [-832.286] (-829.319) (-828.385) (-838.885) -- 0:00:33
638000 -- (-831.575) [-828.811] (-839.613) (-841.791) * (-830.045) [-826.975] (-828.871) (-842.654) -- 0:00:33
639000 -- [-834.328] (-828.853) (-840.867) (-838.591) * [-828.509] (-839.057) (-830.735) (-839.391) -- 0:00:33
640000 -- [-831.459] (-829.960) (-840.586) (-840.530) * (-831.111) (-841.429) [-831.787] (-843.340) -- 0:00:33
Average standard deviation of split frequencies: 0.007849
641000 -- [-829.812] (-826.906) (-839.926) (-836.563) * [-826.887] (-843.567) (-827.994) (-838.827) -- 0:00:33
642000 -- [-831.098] (-826.755) (-833.703) (-840.698) * [-827.822] (-838.590) (-829.890) (-835.927) -- 0:00:33
643000 -- (-829.343) [-827.113] (-843.606) (-838.169) * (-828.310) (-836.466) [-826.915] (-842.385) -- 0:00:33
644000 -- (-827.135) [-826.196] (-840.605) (-840.695) * (-827.336) (-840.043) [-829.027] (-840.947) -- 0:00:33
645000 -- (-827.191) [-827.390] (-839.938) (-838.947) * (-828.862) (-839.161) [-826.824] (-842.498) -- 0:00:33
Average standard deviation of split frequencies: 0.005838
646000 -- [-827.821] (-830.888) (-840.107) (-838.888) * (-826.640) (-838.230) [-829.082] (-840.015) -- 0:00:32
647000 -- [-828.565] (-827.263) (-835.212) (-840.674) * [-834.038] (-843.195) (-830.576) (-830.513) -- 0:00:32
648000 -- (-826.251) [-827.751] (-837.607) (-837.396) * (-841.583) (-838.555) [-829.483] (-826.994) -- 0:00:32
649000 -- [-826.849] (-827.688) (-841.848) (-839.815) * (-840.700) (-837.875) [-830.780] (-827.697) -- 0:00:32
650000 -- (-826.561) [-834.877] (-840.767) (-842.660) * (-841.468) (-840.671) [-831.714] (-829.006) -- 0:00:32
Average standard deviation of split frequencies: 0.004347
651000 -- (-825.970) [-828.175] (-841.718) (-839.078) * (-839.683) (-845.400) (-830.241) [-825.631] -- 0:00:32
652000 -- (-831.336) (-836.648) (-839.488) [-834.304] * (-840.764) (-841.268) [-827.005] (-830.590) -- 0:00:32
653000 -- [-829.957] (-839.393) (-840.080) (-828.698) * (-837.752) (-839.259) [-830.104] (-831.975) -- 0:00:32
654000 -- (-827.189) (-841.250) (-840.426) [-831.309] * (-835.373) (-839.953) [-829.831] (-827.241) -- 0:00:32
655000 -- (-828.436) (-843.980) (-843.165) [-831.095] * (-844.040) (-839.927) (-834.354) [-828.871] -- 0:00:32
Average standard deviation of split frequencies: 0.005270
656000 -- (-833.442) (-837.402) (-839.709) [-831.082] * (-841.720) (-843.958) [-830.553] (-829.136) -- 0:00:31
657000 -- (-832.467) (-839.906) (-842.090) [-830.093] * (-837.859) (-838.364) (-847.233) [-827.954] -- 0:00:31
658000 -- [-826.525] (-840.129) (-841.181) (-834.296) * (-839.480) (-839.938) (-838.982) [-827.328] -- 0:00:31
659000 -- (-832.959) (-840.291) (-839.464) [-827.791] * (-839.313) (-839.719) (-836.866) [-830.888] -- 0:00:31
660000 -- [-832.192] (-839.944) (-840.839) (-828.827) * (-839.734) (-838.384) (-829.630) [-831.579] -- 0:00:31
Average standard deviation of split frequencies: 0.004281
661000 -- (-839.207) (-832.010) (-840.722) [-827.999] * (-843.185) (-839.999) [-828.679] (-835.595) -- 0:00:31
662000 -- (-843.288) [-831.441] (-841.046) (-837.152) * (-840.857) (-840.041) (-838.846) [-834.437] -- 0:00:31
663000 -- (-840.678) (-829.922) (-839.586) [-830.626] * (-837.866) (-840.186) (-839.111) [-831.653] -- 0:00:31
664000 -- (-835.359) [-832.569] (-838.774) (-832.423) * (-842.988) (-840.599) (-838.404) [-832.991] -- 0:00:31
665000 -- (-840.548) (-831.514) (-843.499) [-826.472] * (-840.246) (-842.830) (-839.355) [-828.207] -- 0:00:31
Average standard deviation of split frequencies: 0.004719
666000 -- [-832.374] (-837.397) (-844.357) (-831.544) * (-838.887) (-842.291) (-844.986) [-831.127] -- 0:00:31
667000 -- (-836.226) (-839.931) (-840.521) [-832.187] * (-839.782) (-842.299) (-835.245) [-830.033] -- 0:00:30
668000 -- [-831.065] (-841.137) (-848.186) (-829.298) * (-837.660) (-834.524) (-844.209) [-829.666] -- 0:00:30
669000 -- [-830.096] (-844.419) (-842.575) (-828.471) * (-838.921) (-839.791) (-840.252) [-832.683] -- 0:00:30
670000 -- (-831.364) [-827.317] (-841.457) (-828.557) * (-840.639) (-837.705) (-839.515) [-832.435] -- 0:00:30
Average standard deviation of split frequencies: 0.005155
671000 -- (-831.946) (-831.704) (-846.407) [-826.630] * (-838.275) (-837.684) (-842.340) [-830.546] -- 0:00:30
672000 -- (-834.977) [-827.631] (-842.157) (-828.687) * (-840.647) (-845.653) (-842.408) [-830.509] -- 0:00:30
673000 -- (-829.280) (-831.883) (-842.021) [-831.785] * (-841.586) (-840.349) (-838.732) [-829.841] -- 0:00:30
674000 -- [-828.978] (-830.974) (-838.523) (-832.032) * (-838.733) (-844.385) (-842.457) [-829.822] -- 0:00:30
675000 -- [-830.796] (-838.324) (-840.681) (-829.936) * (-830.843) (-839.761) (-838.927) [-827.886] -- 0:00:30
Average standard deviation of split frequencies: 0.004649
676000 -- (-833.582) (-831.287) (-842.754) [-835.501] * (-837.855) (-839.887) (-841.289) [-825.284] -- 0:00:30
677000 -- (-827.011) [-832.577] (-840.012) (-833.791) * (-829.535) (-840.175) (-839.613) [-828.679] -- 0:00:30
678000 -- (-828.490) (-830.330) (-840.198) [-831.909] * (-830.600) (-839.271) (-840.639) [-831.815] -- 0:00:29
679000 -- (-831.021) [-832.087] (-842.827) (-830.977) * [-835.168] (-842.195) (-842.368) (-835.768) -- 0:00:29
680000 -- [-829.984] (-833.243) (-840.690) (-828.340) * (-831.932) (-841.590) [-838.193] (-833.209) -- 0:00:29
Average standard deviation of split frequencies: 0.005079
681000 -- [-827.583] (-833.392) (-841.446) (-829.539) * [-829.546] (-843.042) (-839.481) (-839.664) -- 0:00:29
682000 -- [-830.153] (-837.202) (-847.835) (-826.800) * [-833.238] (-840.272) (-841.676) (-840.051) -- 0:00:29
683000 -- (-831.724) (-830.794) (-843.845) [-831.483] * [-828.995] (-841.658) (-840.405) (-839.063) -- 0:00:29
684000 -- (-841.672) (-831.260) (-840.424) [-833.047] * [-830.276] (-840.297) (-835.567) (-842.657) -- 0:00:29
685000 -- (-838.744) (-832.195) (-840.336) [-827.638] * (-829.464) [-829.912] (-839.227) (-839.325) -- 0:00:29
Average standard deviation of split frequencies: 0.005039
686000 -- (-836.851) (-834.183) (-837.367) [-829.253] * [-829.469] (-828.409) (-843.224) (-839.477) -- 0:00:29
687000 -- (-842.682) (-835.351) (-840.435) [-829.461] * (-836.435) [-834.722] (-840.126) (-840.693) -- 0:00:29
688000 -- (-840.422) [-833.962] (-843.575) (-829.370) * (-836.998) [-830.925] (-840.398) (-837.611) -- 0:00:29
689000 -- (-839.522) (-832.987) (-839.921) [-826.740] * (-839.147) [-831.004] (-840.027) (-840.673) -- 0:00:28
690000 -- (-843.179) [-830.409] (-839.957) (-832.047) * (-839.370) [-831.557] (-832.472) (-838.890) -- 0:00:28
Average standard deviation of split frequencies: 0.003640
691000 -- (-842.866) (-829.237) (-840.336) [-827.344] * (-838.686) (-832.570) [-830.830] (-840.558) -- 0:00:28
692000 -- (-844.675) (-833.799) (-838.899) [-831.310] * (-841.481) (-835.428) [-828.542] (-829.476) -- 0:00:28
693000 -- (-839.649) [-830.378] (-839.725) (-826.693) * (-843.488) (-830.321) [-830.892] (-839.235) -- 0:00:28
694000 -- (-839.560) (-839.741) (-842.338) [-829.614] * (-838.512) [-829.150] (-832.578) (-838.693) -- 0:00:28
695000 -- (-841.500) (-840.198) (-840.145) [-829.046] * (-838.549) (-831.997) [-828.316] (-841.047) -- 0:00:28
Average standard deviation of split frequencies: 0.003612
696000 -- (-836.401) (-839.231) (-838.511) [-828.844] * (-835.839) [-833.243] (-828.039) (-839.447) -- 0:00:28
697000 -- (-841.625) (-839.583) (-841.592) [-828.957] * [-830.120] (-830.698) (-831.447) (-842.866) -- 0:00:28
698000 -- [-842.481] (-840.525) (-838.808) (-828.882) * (-832.932) (-829.331) [-832.462] (-838.003) -- 0:00:28
699000 -- (-840.115) (-839.230) (-841.720) [-829.091] * (-834.667) [-828.503] (-826.619) (-839.878) -- 0:00:27
700000 -- (-839.064) (-840.683) (-839.671) [-828.346] * (-839.067) (-828.502) [-830.026] (-840.096) -- 0:00:27
Average standard deviation of split frequencies: 0.004485
701000 -- [-831.067] (-839.219) (-841.918) (-832.285) * (-827.770) [-828.842] (-827.831) (-839.471) -- 0:00:27
702000 -- (-829.040) (-840.610) (-832.010) [-826.939] * (-829.540) [-831.791] (-830.808) (-839.758) -- 0:00:27
703000 -- (-830.550) (-837.992) (-828.432) [-830.976] * (-829.376) (-832.422) [-831.156] (-841.496) -- 0:00:27
704000 -- (-831.640) (-839.168) [-829.438] (-830.943) * (-827.671) [-830.715] (-826.147) (-842.846) -- 0:00:27
705000 -- (-829.013) (-839.855) [-829.053] (-831.160) * (-834.844) [-829.945] (-828.098) (-839.384) -- 0:00:27
Average standard deviation of split frequencies: 0.004006
706000 -- (-828.744) (-840.563) [-827.058] (-829.411) * (-827.281) (-828.758) [-834.327] (-845.566) -- 0:00:27
707000 -- [-830.609] (-841.341) (-827.281) (-828.402) * (-827.436) (-833.417) [-824.764] (-838.932) -- 0:00:27
708000 -- (-829.417) (-839.675) [-828.562] (-828.261) * (-830.465) (-833.794) [-831.601] (-843.794) -- 0:00:27
709000 -- (-828.977) (-839.108) (-829.768) [-826.952] * [-829.990] (-828.874) (-840.935) (-839.861) -- 0:00:27
710000 -- (-831.754) (-843.092) [-828.705] (-828.099) * (-828.148) [-837.273] (-839.665) (-839.829) -- 0:00:26
Average standard deviation of split frequencies: 0.001769
711000 -- (-841.005) (-840.531) [-826.522] (-829.052) * (-833.214) [-831.304] (-838.766) (-840.810) -- 0:00:26
712000 -- (-837.707) (-842.286) [-830.390] (-826.886) * [-835.942] (-833.318) (-840.920) (-840.701) -- 0:00:26
713000 -- (-840.702) (-840.501) [-835.049] (-828.720) * (-837.742) [-829.739] (-839.974) (-837.896) -- 0:00:26
714000 -- (-839.890) (-841.409) [-829.602] (-828.238) * (-841.077) [-829.597] (-840.724) (-839.012) -- 0:00:26
715000 -- (-843.206) (-840.431) [-829.514] (-829.198) * (-843.281) [-830.872] (-829.892) (-840.705) -- 0:00:26
Average standard deviation of split frequencies: 0.001317
716000 -- (-843.401) (-839.390) (-828.389) [-828.490] * (-839.759) (-833.123) [-830.181] (-842.512) -- 0:00:26
717000 -- (-840.637) (-836.897) (-826.339) [-826.794] * (-836.812) (-830.840) [-825.697] (-843.196) -- 0:00:26
718000 -- (-843.006) (-842.769) [-829.227] (-829.680) * (-843.523) [-829.341] (-827.082) (-840.337) -- 0:00:26
719000 -- (-839.113) (-837.986) [-836.888] (-833.939) * [-834.138] (-830.268) (-829.273) (-837.896) -- 0:00:26
720000 -- (-830.785) (-840.741) (-829.170) [-830.182] * (-839.945) (-832.234) [-828.713] (-842.613) -- 0:00:26
Average standard deviation of split frequencies: 0.000872
721000 -- (-832.225) (-849.060) [-831.757] (-828.436) * (-842.503) (-831.060) [-832.712] (-837.234) -- 0:00:25
722000 -- [-828.222] (-842.219) (-828.910) (-830.291) * (-838.718) [-830.991] (-830.325) (-828.323) -- 0:00:25
723000 -- (-830.856) (-842.920) [-833.117] (-839.016) * (-838.137) (-828.712) (-830.279) [-829.139] -- 0:00:25
724000 -- [-833.015] (-841.693) (-839.730) (-841.574) * (-844.258) (-829.172) [-828.363] (-831.161) -- 0:00:25
725000 -- [-831.439] (-841.061) (-838.309) (-840.980) * (-840.542) (-830.297) (-831.607) [-830.084] -- 0:00:25
Average standard deviation of split frequencies: 0.001299
726000 -- [-830.012] (-840.854) (-836.717) (-843.913) * (-840.203) [-827.945] (-834.241) (-830.339) -- 0:00:25
727000 -- [-830.712] (-838.941) (-838.706) (-839.913) * (-838.594) [-827.613] (-830.163) (-828.003) -- 0:00:25
728000 -- [-826.288] (-839.294) (-839.489) (-840.144) * (-843.010) [-826.890] (-831.641) (-829.394) -- 0:00:25
729000 -- (-826.646) (-845.688) [-832.887] (-839.677) * (-839.886) (-831.466) [-828.307] (-832.145) -- 0:00:25
730000 -- [-827.383] (-843.162) (-837.465) (-831.656) * (-845.330) (-828.983) [-826.669] (-826.897) -- 0:00:25
Average standard deviation of split frequencies: 0.002581
731000 -- [-829.845] (-839.381) (-840.106) (-826.447) * (-839.896) [-828.366] (-830.817) (-830.346) -- 0:00:25
732000 -- [-828.565] (-840.518) (-839.624) (-831.024) * (-839.211) (-827.954) (-833.230) [-827.968] -- 0:00:24
733000 -- (-827.821) (-843.130) (-841.153) [-829.690] * (-840.414) (-825.966) [-827.740] (-832.501) -- 0:00:24
734000 -- [-828.215] (-843.753) (-838.173) (-834.025) * (-839.324) (-830.029) (-828.591) [-829.335] -- 0:00:24
735000 -- (-828.341) [-831.755] (-840.665) (-831.135) * (-840.642) (-829.519) [-830.392] (-839.595) -- 0:00:24
Average standard deviation of split frequencies: 0.002562
736000 -- [-834.012] (-840.738) (-842.441) (-830.975) * (-839.954) [-826.677] (-831.531) (-842.047) -- 0:00:24
737000 -- (-828.965) (-839.568) (-841.052) [-829.496] * (-835.271) (-830.891) [-828.458] (-839.647) -- 0:00:24
738000 -- [-828.536] (-839.685) (-840.493) (-828.555) * (-839.661) [-829.852] (-832.678) (-840.466) -- 0:00:24
739000 -- [-829.453] (-840.003) (-839.262) (-833.773) * (-834.182) [-829.324] (-829.167) (-843.543) -- 0:00:24
740000 -- (-828.922) (-841.816) (-839.408) [-832.240] * (-842.916) (-828.380) [-829.321] (-837.889) -- 0:00:24
Average standard deviation of split frequencies: 0.005092
741000 -- (-831.276) (-843.211) (-840.950) [-830.592] * (-839.085) [-828.163] (-828.227) (-841.929) -- 0:00:24
742000 -- [-826.945] (-841.123) (-844.988) (-830.484) * (-840.565) (-825.680) [-829.938] (-839.708) -- 0:00:23
743000 -- [-829.937] (-841.064) (-839.171) (-835.568) * (-841.546) [-828.693] (-826.328) (-840.912) -- 0:00:23
744000 -- [-834.634] (-840.347) (-840.492) (-832.110) * (-844.020) (-827.372) [-826.120] (-841.274) -- 0:00:23
745000 -- [-830.682] (-839.706) (-840.232) (-827.200) * (-839.051) (-827.894) [-826.668] (-840.520) -- 0:00:23
Average standard deviation of split frequencies: 0.004213
746000 -- [-827.466] (-839.386) (-838.954) (-830.622) * (-839.877) (-830.206) [-828.077] (-848.850) -- 0:00:23
747000 -- (-830.430) (-842.379) (-846.301) [-831.358] * (-845.458) (-829.957) [-828.474] (-841.704) -- 0:00:23
748000 -- (-833.746) (-840.879) (-842.234) [-829.551] * (-844.411) [-827.471] (-830.778) (-836.204) -- 0:00:23
749000 -- [-832.827] (-831.690) (-839.879) (-829.079) * (-844.080) (-826.520) [-832.461] (-839.223) -- 0:00:23
750000 -- (-834.588) (-832.239) (-839.468) [-828.711] * (-834.466) [-826.169] (-834.180) (-842.417) -- 0:00:23
Average standard deviation of split frequencies: 0.005443
751000 -- [-831.197] (-829.193) (-840.138) (-831.231) * (-841.943) (-830.352) [-828.865] (-840.226) -- 0:00:23
752000 -- [-832.062] (-830.824) (-838.518) (-827.672) * (-842.607) (-827.842) [-831.361] (-841.242) -- 0:00:23
753000 -- [-836.326] (-833.630) (-841.964) (-828.632) * (-842.615) (-835.691) [-830.539] (-839.934) -- 0:00:22
754000 -- (-842.934) [-831.150] (-845.133) (-825.597) * (-845.496) (-830.250) [-830.644] (-845.130) -- 0:00:22
755000 -- (-840.394) (-831.198) (-841.167) [-830.825] * [-836.616] (-827.342) (-829.511) (-839.723) -- 0:00:22
Average standard deviation of split frequencies: 0.004157
756000 -- (-840.028) (-830.414) (-843.703) [-829.935] * (-839.723) [-829.958] (-830.887) (-840.616) -- 0:00:22
757000 -- (-840.694) [-827.340] (-842.029) (-834.375) * (-839.034) [-831.581] (-829.875) (-838.663) -- 0:00:22
758000 -- (-837.191) [-828.441] (-837.518) (-828.056) * (-839.963) [-832.376] (-828.451) (-839.101) -- 0:00:22
759000 -- (-838.286) (-827.517) (-840.685) [-833.543] * [-833.328] (-838.682) (-831.934) (-840.214) -- 0:00:22
760000 -- (-839.483) (-830.416) (-837.919) [-832.566] * (-838.484) [-830.485] (-827.073) (-840.565) -- 0:00:22
Average standard deviation of split frequencies: 0.003718
761000 -- (-842.813) [-832.037] (-840.049) (-838.781) * (-842.614) [-828.867] (-829.747) (-835.304) -- 0:00:22
762000 -- (-840.028) [-826.178] (-840.207) (-827.671) * (-839.908) (-830.616) [-831.025] (-841.451) -- 0:00:22
763000 -- (-840.118) (-828.433) (-841.376) [-830.511] * (-841.526) (-831.189) [-828.303] (-841.444) -- 0:00:22
764000 -- (-839.437) (-832.381) (-841.169) [-827.998] * (-840.021) [-833.007] (-829.671) (-841.248) -- 0:00:21
765000 -- (-843.741) (-828.934) (-840.071) [-829.041] * (-840.061) [-827.676] (-832.308) (-845.988) -- 0:00:21
Average standard deviation of split frequencies: 0.002872
766000 -- (-839.974) [-829.299] (-842.821) (-832.396) * (-840.010) (-828.378) [-827.887] (-841.094) -- 0:00:21
767000 -- (-839.682) [-828.610] (-840.185) (-831.662) * (-836.699) (-829.679) [-829.136] (-838.975) -- 0:00:21
768000 -- (-834.728) [-829.954] (-839.525) (-828.266) * (-838.617) [-830.143] (-828.003) (-828.203) -- 0:00:21
769000 -- (-842.909) [-828.269] (-840.612) (-832.890) * (-839.167) (-830.722) (-827.926) [-829.155] -- 0:00:21
770000 -- (-837.777) (-832.843) (-839.409) [-831.225] * (-841.978) (-829.370) [-831.773] (-833.473) -- 0:00:21
Average standard deviation of split frequencies: 0.002855
771000 -- (-839.689) (-833.979) (-837.927) [-826.640] * (-838.456) [-831.899] (-840.766) (-831.448) -- 0:00:21
772000 -- (-842.610) [-835.642] (-837.544) (-833.994) * (-836.718) [-832.344] (-848.047) (-829.904) -- 0:00:21
773000 -- (-842.505) [-833.601] (-839.467) (-829.132) * (-838.680) (-828.451) (-844.558) [-827.667] -- 0:00:21
774000 -- (-839.389) (-830.128) (-840.999) [-837.370] * (-836.081) (-834.323) (-846.055) [-830.386] -- 0:00:21
775000 -- (-842.436) [-830.553] (-839.104) (-828.291) * (-840.705) (-828.432) (-838.926) [-828.198] -- 0:00:20
Average standard deviation of split frequencies: 0.002835
776000 -- (-841.395) (-827.618) (-839.250) [-835.139] * (-840.237) [-832.569] (-840.037) (-827.603) -- 0:00:20
777000 -- (-836.095) (-839.856) (-831.914) [-831.931] * (-842.260) (-840.357) [-830.995] (-831.174) -- 0:00:20
778000 -- (-842.656) (-839.456) (-831.375) [-829.426] * (-839.857) (-838.729) [-831.166] (-832.677) -- 0:00:20
779000 -- (-839.186) (-841.237) (-829.831) [-825.428] * (-833.363) [-829.425] (-830.346) (-830.303) -- 0:00:20
780000 -- (-840.767) (-838.750) [-828.794] (-829.332) * (-843.050) (-844.658) [-832.789] (-834.913) -- 0:00:20
Average standard deviation of split frequencies: 0.002818
781000 -- (-839.809) (-840.656) [-833.749] (-828.800) * (-839.862) (-831.016) (-838.664) [-830.810] -- 0:00:20
782000 -- (-839.842) (-841.969) [-830.197] (-829.364) * (-840.256) (-835.249) (-836.162) [-831.920] -- 0:00:20
783000 -- (-843.107) (-842.820) [-831.959] (-828.623) * (-840.978) (-838.848) (-830.280) [-830.589] -- 0:00:20
784000 -- (-841.180) (-840.912) [-825.578] (-831.443) * (-840.133) (-838.285) [-831.071] (-832.464) -- 0:00:20
785000 -- (-843.881) (-839.538) [-827.929] (-829.742) * (-839.403) (-838.048) (-832.348) [-829.756] -- 0:00:19
Average standard deviation of split frequencies: 0.003199
786000 -- (-842.565) (-840.077) [-826.315] (-829.875) * (-840.158) (-839.879) [-830.360] (-830.739) -- 0:00:19
787000 -- (-839.818) (-839.250) [-830.513] (-831.720) * (-842.334) (-842.898) (-828.597) [-831.375] -- 0:00:19
788000 -- (-840.317) (-841.353) [-828.262] (-830.894) * (-839.075) (-846.619) [-832.298] (-829.572) -- 0:00:19
789000 -- (-835.266) (-841.814) (-833.210) [-829.756] * (-839.688) (-839.135) (-833.556) [-830.644] -- 0:00:19
790000 -- (-839.209) (-840.916) [-832.323] (-833.086) * (-841.603) (-837.980) (-828.372) [-827.419] -- 0:00:19
Average standard deviation of split frequencies: 0.002385
791000 -- (-841.510) (-837.403) (-827.397) [-828.106] * (-843.057) (-837.638) [-833.603] (-840.124) -- 0:00:19
792000 -- (-839.193) (-839.529) [-828.440] (-828.039) * (-833.193) (-840.041) [-830.955] (-840.254) -- 0:00:19
793000 -- (-840.950) (-840.135) (-831.407) [-832.352] * [-828.834] (-839.693) (-829.354) (-840.147) -- 0:00:19
794000 -- (-842.819) (-840.141) (-834.209) [-827.423] * (-829.867) (-841.025) [-827.984] (-837.957) -- 0:00:19
795000 -- (-843.870) (-840.975) [-827.652] (-826.883) * (-830.943) (-841.144) [-832.032] (-832.700) -- 0:00:19
Average standard deviation of split frequencies: 0.001579
796000 -- (-843.858) (-840.849) [-830.624] (-827.325) * (-828.788) (-841.596) [-829.664] (-832.195) -- 0:00:18
797000 -- (-838.398) (-840.056) (-829.895) [-828.334] * (-830.579) (-841.907) [-828.734] (-831.694) -- 0:00:18
798000 -- (-830.349) (-839.990) [-830.245] (-830.805) * (-829.145) (-840.683) (-828.571) [-828.324] -- 0:00:18
799000 -- (-831.569) (-844.092) [-831.270] (-834.865) * (-834.193) (-843.608) (-831.626) [-826.622] -- 0:00:18
800000 -- [-827.828] (-839.702) (-839.641) (-830.614) * (-828.447) (-842.231) (-831.567) [-829.547] -- 0:00:18
Average standard deviation of split frequencies: 0.000785
801000 -- (-831.196) (-838.567) (-843.467) [-831.859] * (-830.538) (-841.523) [-831.493] (-829.832) -- 0:00:18
802000 -- (-830.293) (-842.505) [-839.208] (-831.683) * (-840.124) (-842.762) [-832.163] (-829.151) -- 0:00:18
803000 -- (-839.401) (-840.905) [-832.741] (-831.769) * (-840.177) (-833.458) (-832.804) [-827.854] -- 0:00:18
804000 -- (-840.182) (-841.692) (-830.366) [-830.401] * (-839.848) [-833.383] (-832.598) (-827.182) -- 0:00:18
805000 -- (-838.688) (-840.911) (-833.964) [-830.825] * (-838.044) [-827.588] (-831.805) (-828.195) -- 0:00:18
Average standard deviation of split frequencies: 0.000780
806000 -- (-839.172) (-843.151) [-830.560] (-835.574) * (-841.355) (-830.994) (-834.888) [-828.111] -- 0:00:18
807000 -- (-845.600) (-842.534) (-832.516) [-831.589] * (-839.212) (-829.946) [-828.614] (-828.138) -- 0:00:17
808000 -- [-833.938] (-840.101) (-834.008) (-839.322) * (-839.648) (-829.922) (-841.283) [-833.959] -- 0:00:17
809000 -- (-831.632) (-839.668) [-829.460] (-838.565) * (-840.513) [-827.662] (-839.093) (-830.596) -- 0:00:17
810000 -- (-838.350) (-839.028) [-831.763] (-841.352) * (-831.966) [-829.050] (-839.926) (-830.044) -- 0:00:17
Average standard deviation of split frequencies: 0.000388
811000 -- (-839.891) (-837.545) [-827.676] (-842.515) * [-832.086] (-827.040) (-842.618) (-827.582) -- 0:00:17
812000 -- (-841.280) (-840.205) [-827.805] (-829.030) * (-840.060) [-827.426] (-845.868) (-828.719) -- 0:00:17
813000 -- (-839.249) (-844.688) [-827.357] (-828.674) * (-838.289) (-830.024) (-841.569) [-827.967] -- 0:00:17
814000 -- (-839.124) (-840.576) [-828.926] (-826.386) * (-839.224) (-831.383) (-839.619) [-828.901] -- 0:00:17
815000 -- (-840.214) (-840.297) (-831.945) [-827.961] * (-841.712) [-827.919] (-839.520) (-829.979) -- 0:00:17
Average standard deviation of split frequencies: 0.000385
816000 -- (-839.560) (-843.306) [-829.711] (-833.841) * (-841.404) [-830.912] (-832.652) (-829.163) -- 0:00:17
817000 -- (-843.546) (-839.643) (-833.391) [-828.869] * (-847.627) [-833.264] (-831.538) (-836.372) -- 0:00:17
818000 -- (-842.018) (-842.781) [-830.027] (-827.234) * (-841.075) (-833.618) [-829.115] (-832.972) -- 0:00:16
819000 -- (-840.789) (-837.979) [-829.385] (-826.328) * (-839.609) (-825.960) (-825.828) [-826.328] -- 0:00:17
820000 -- (-838.933) (-836.185) (-835.015) [-830.091] * (-842.351) [-826.471] (-832.021) (-828.650) -- 0:00:16
Average standard deviation of split frequencies: 0.001532
821000 -- (-842.242) (-838.542) [-832.808] (-829.827) * (-839.989) (-828.626) (-829.197) [-828.508] -- 0:00:16
822000 -- (-838.098) (-841.579) [-830.700] (-826.845) * (-839.414) (-831.226) [-834.614] (-830.225) -- 0:00:16
823000 -- (-839.720) (-839.168) [-832.123] (-832.590) * (-838.608) [-828.528] (-845.489) (-833.532) -- 0:00:16
824000 -- (-841.755) (-838.281) [-835.006] (-830.121) * (-840.078) [-829.924] (-842.062) (-830.222) -- 0:00:16
825000 -- (-843.960) (-839.300) (-828.151) [-831.765] * (-841.427) [-830.597] (-840.035) (-828.997) -- 0:00:16
Average standard deviation of split frequencies: 0.001141
826000 -- (-843.017) (-837.576) [-832.519] (-847.722) * (-843.362) [-834.511] (-840.632) (-839.506) -- 0:00:16
827000 -- (-841.573) (-842.220) [-832.636] (-848.401) * (-842.246) (-833.177) (-844.222) [-828.327] -- 0:00:16
828000 -- (-842.044) (-840.706) [-832.279] (-828.150) * (-838.393) (-828.455) (-844.001) [-826.058] -- 0:00:15
829000 -- (-839.401) (-839.945) (-829.568) [-828.799] * (-838.856) (-827.137) (-828.296) [-828.040] -- 0:00:16
830000 -- (-837.991) (-838.232) [-828.941] (-830.436) * (-839.669) (-829.325) [-825.684] (-827.188) -- 0:00:15
Average standard deviation of split frequencies: 0.000757
831000 -- (-836.380) (-842.099) (-828.887) [-827.198] * (-840.065) (-833.215) (-829.101) [-831.106] -- 0:00:15
832000 -- (-838.082) (-841.999) (-830.044) [-828.665] * (-840.125) (-834.301) [-831.541] (-828.443) -- 0:00:15
833000 -- (-842.553) (-845.671) (-830.776) [-830.087] * (-840.605) (-831.626) [-829.326] (-827.600) -- 0:00:15
834000 -- (-843.461) (-842.183) [-831.308] (-831.251) * (-841.529) (-839.185) [-835.333] (-830.055) -- 0:00:15
835000 -- (-841.254) (-840.383) [-826.681] (-828.336) * (-840.383) (-842.658) [-830.003] (-832.625) -- 0:00:15
Average standard deviation of split frequencies: 0.002256
836000 -- (-840.333) (-841.159) (-832.220) [-834.536] * (-840.079) (-839.968) (-829.063) [-828.143] -- 0:00:15
837000 -- (-839.261) (-839.427) (-829.746) [-836.226] * (-843.782) (-843.053) (-829.014) [-832.352] -- 0:00:15
838000 -- [-833.277] (-840.097) (-839.257) (-840.192) * (-841.751) (-840.112) [-833.471] (-829.744) -- 0:00:15
839000 -- [-832.894] (-840.496) (-828.792) (-839.372) * (-839.052) (-840.611) (-839.360) [-828.459] -- 0:00:14
840000 -- [-829.636] (-839.112) (-827.429) (-839.103) * (-841.148) (-845.453) (-833.496) [-827.983] -- 0:00:15
Average standard deviation of split frequencies: 0.002243
841000 -- [-831.473] (-837.767) (-829.027) (-840.619) * (-843.656) (-838.314) [-828.748] (-833.191) -- 0:00:14
842000 -- (-829.094) (-841.193) [-828.009] (-843.467) * (-847.039) (-842.257) (-831.891) [-829.107] -- 0:00:14
843000 -- [-829.952] (-841.822) (-829.961) (-840.871) * (-838.102) (-839.754) (-825.711) [-829.356] -- 0:00:14
844000 -- [-828.418] (-842.951) (-828.565) (-842.410) * (-840.389) (-839.138) [-832.193] (-833.164) -- 0:00:14
845000 -- [-829.545] (-840.370) (-828.270) (-838.288) * (-839.540) (-839.533) (-832.162) [-828.832] -- 0:00:14
Average standard deviation of split frequencies: 0.002229
846000 -- [-828.654] (-843.087) (-829.156) (-839.242) * (-839.501) (-844.442) (-830.453) [-825.582] -- 0:00:14
847000 -- (-831.790) (-839.133) [-830.102] (-841.741) * (-837.539) (-835.074) [-831.364] (-830.259) -- 0:00:14
848000 -- [-833.162] (-839.633) (-830.288) (-832.597) * (-842.070) (-845.903) [-830.461] (-831.723) -- 0:00:14
849000 -- [-831.649] (-838.703) (-828.346) (-832.458) * (-839.832) (-839.768) [-829.329] (-830.059) -- 0:00:14
850000 -- (-833.079) (-842.818) (-825.901) [-832.258] * (-842.102) (-842.971) [-832.655] (-832.057) -- 0:00:13
Average standard deviation of split frequencies: 0.002586
851000 -- [-831.921] (-839.337) (-831.931) (-831.252) * (-841.360) (-841.068) (-834.911) [-831.745] -- 0:00:14
852000 -- (-832.273) (-841.473) (-831.086) [-828.423] * (-839.862) (-840.489) (-841.901) [-829.346] -- 0:00:13
853000 -- [-832.742] (-839.594) (-835.920) (-829.967) * (-839.388) (-840.664) (-840.214) [-829.937] -- 0:00:13
854000 -- (-829.954) (-840.203) (-840.966) [-828.663] * [-836.828] (-840.308) (-839.427) (-832.602) -- 0:00:13
855000 -- (-828.901) (-842.035) (-843.016) [-829.281] * (-840.034) (-839.005) (-843.890) [-827.197] -- 0:00:13
Average standard deviation of split frequencies: 0.003304
856000 -- [-828.190] (-840.190) (-840.797) (-831.386) * (-841.101) (-839.517) (-842.175) [-827.471] -- 0:00:13
857000 -- (-829.303) (-838.879) (-838.695) [-828.673] * (-841.003) [-831.534] (-843.143) (-842.711) -- 0:00:13
858000 -- [-833.089] (-837.288) (-840.165) (-830.615) * [-837.210] (-830.337) (-841.111) (-839.098) -- 0:00:13
859000 -- [-827.733] (-839.008) (-834.093) (-829.647) * (-829.902) [-828.709] (-841.592) (-841.083) -- 0:00:13
860000 -- [-829.231] (-839.744) (-837.087) (-833.408) * (-831.592) [-832.597] (-837.209) (-836.971) -- 0:00:13
Average standard deviation of split frequencies: 0.003651
861000 -- [-834.560] (-839.786) (-839.193) (-837.399) * [-828.889] (-827.539) (-841.043) (-839.545) -- 0:00:12
862000 -- [-829.397] (-843.137) (-838.919) (-841.651) * (-834.871) [-827.653] (-838.959) (-839.786) -- 0:00:12
863000 -- [-829.554] (-841.451) (-844.304) (-842.207) * [-832.925] (-833.340) (-840.091) (-842.737) -- 0:00:12
864000 -- [-829.818] (-836.778) (-848.620) (-840.738) * (-829.347) [-831.174] (-839.229) (-839.637) -- 0:00:12
865000 -- [-827.481] (-839.822) (-841.290) (-840.844) * [-830.974] (-828.454) (-841.134) (-842.413) -- 0:00:12
Average standard deviation of split frequencies: 0.004355
866000 -- [-829.221] (-838.693) (-840.542) (-837.777) * (-828.209) [-829.226] (-842.616) (-840.004) -- 0:00:12
867000 -- [-826.689] (-840.306) (-838.034) (-841.421) * [-829.282] (-835.179) (-842.134) (-843.194) -- 0:00:12
868000 -- [-833.345] (-827.051) (-841.401) (-840.477) * (-827.987) [-826.813] (-841.893) (-836.849) -- 0:00:12
869000 -- (-832.292) [-829.684] (-844.378) (-842.452) * [-824.882] (-830.866) (-839.775) (-840.988) -- 0:00:12
870000 -- (-833.583) [-830.482] (-842.864) (-833.961) * [-826.494] (-833.067) (-838.101) (-841.208) -- 0:00:12
Average standard deviation of split frequencies: 0.003249
871000 -- [-831.942] (-832.815) (-842.014) (-838.516) * [-826.687] (-832.095) (-838.908) (-840.284) -- 0:00:11
872000 -- (-841.836) [-828.068] (-839.658) (-840.941) * (-829.300) (-835.507) (-842.508) [-835.799] -- 0:00:11
873000 -- (-837.906) [-837.182] (-840.494) (-839.571) * (-830.679) [-830.109] (-841.298) (-840.464) -- 0:00:11
874000 -- (-840.703) [-828.882] (-840.309) (-841.771) * (-829.338) [-829.021] (-840.305) (-843.854) -- 0:00:11
875000 -- (-841.149) [-831.188] (-829.948) (-842.411) * (-829.784) [-828.534] (-837.886) (-842.010) -- 0:00:11
Average standard deviation of split frequencies: 0.003229
876000 -- (-841.658) (-828.639) [-831.029] (-842.563) * [-829.562] (-834.501) (-843.786) (-842.709) -- 0:00:11
877000 -- (-840.177) (-832.546) [-831.547] (-839.412) * [-825.539] (-835.838) (-837.849) (-840.976) -- 0:00:11
878000 -- (-842.039) (-829.471) [-828.580] (-840.218) * [-825.150] (-827.062) (-836.425) (-839.829) -- 0:00:11
879000 -- (-832.667) [-827.634] (-839.802) (-839.210) * [-827.174] (-826.089) (-834.379) (-840.530) -- 0:00:11
880000 -- (-833.378) [-832.699] (-840.245) (-838.658) * (-827.535) [-834.089] (-838.477) (-840.515) -- 0:00:11
Average standard deviation of split frequencies: 0.002855
881000 -- [-832.243] (-839.705) (-838.072) (-843.177) * [-829.613] (-827.100) (-836.965) (-839.611) -- 0:00:11
882000 -- (-832.972) [-828.273] (-838.722) (-839.957) * (-829.526) (-840.396) [-825.989] (-838.455) -- 0:00:10
883000 -- [-829.122] (-831.438) (-839.732) (-840.170) * (-829.342) (-840.861) [-827.421] (-840.212) -- 0:00:10
884000 -- (-841.751) [-832.062] (-838.981) (-842.316) * (-840.669) (-841.323) [-835.757] (-841.118) -- 0:00:10
885000 -- (-840.984) [-830.444] (-839.837) (-841.096) * [-832.658] (-840.005) (-830.261) (-846.244) -- 0:00:10
Average standard deviation of split frequencies: 0.003547
886000 -- (-845.268) [-827.499] (-840.676) (-840.103) * [-830.246] (-837.731) (-832.250) (-842.993) -- 0:00:10
887000 -- (-838.345) [-829.686] (-839.470) (-847.127) * (-830.286) (-839.857) [-829.103] (-839.184) -- 0:00:10
888000 -- (-835.631) [-827.459] (-835.616) (-840.052) * (-831.108) (-841.153) [-833.556] (-838.195) -- 0:00:10
889000 -- (-827.355) [-826.615] (-838.715) (-840.925) * (-832.133) (-842.057) [-830.869] (-840.470) -- 0:00:10
890000 -- [-828.196] (-831.928) (-839.351) (-841.832) * [-830.241] (-839.659) (-842.002) (-841.678) -- 0:00:10
Average standard deviation of split frequencies: 0.002823
891000 -- [-826.830] (-834.273) (-837.314) (-841.052) * [-829.577] (-839.009) (-841.121) (-839.891) -- 0:00:10
892000 -- (-830.687) [-828.654] (-836.376) (-842.221) * [-830.621] (-839.712) (-844.363) (-840.677) -- 0:00:10
893000 -- [-828.101] (-831.373) (-842.337) (-843.938) * [-833.230] (-840.318) (-836.704) (-839.158) -- 0:00:09
894000 -- (-830.018) [-830.984] (-839.676) (-841.184) * [-831.134] (-839.321) (-837.020) (-838.372) -- 0:00:09
895000 -- [-831.842] (-827.220) (-841.317) (-840.700) * (-830.182) (-839.111) [-828.259] (-840.682) -- 0:00:09
Average standard deviation of split frequencies: 0.003157
896000 -- [-826.663] (-827.389) (-839.682) (-846.815) * (-831.346) (-839.150) [-827.299] (-837.467) -- 0:00:09
897000 -- [-827.683] (-830.469) (-839.695) (-843.770) * (-834.471) (-840.154) [-833.948] (-841.376) -- 0:00:09
898000 -- [-826.368] (-829.056) (-839.506) (-838.786) * (-828.256) (-842.320) [-832.166] (-831.299) -- 0:00:09
899000 -- [-826.363] (-838.390) (-840.498) (-841.339) * (-828.930) (-837.511) (-834.405) [-828.912] -- 0:00:09
900000 -- (-832.095) [-832.633] (-843.314) (-835.861) * (-829.471) (-839.881) [-831.020] (-832.637) -- 0:00:09
Average standard deviation of split frequencies: 0.002791
901000 -- [-830.270] (-828.271) (-839.342) (-839.450) * [-830.583] (-846.310) (-836.141) (-841.799) -- 0:00:09
902000 -- [-829.713] (-831.711) (-842.238) (-837.899) * [-830.648] (-842.110) (-828.564) (-841.605) -- 0:00:09
903000 -- (-831.849) [-829.237] (-840.375) (-839.933) * [-830.196] (-841.354) (-828.700) (-840.298) -- 0:00:09
904000 -- [-830.710] (-828.037) (-842.238) (-838.234) * [-827.135] (-842.081) (-844.114) (-840.810) -- 0:00:08
905000 -- [-833.011] (-832.990) (-838.974) (-839.499) * [-830.563] (-851.243) (-835.053) (-840.983) -- 0:00:08
Average standard deviation of split frequencies: 0.002081
906000 -- (-830.777) [-828.953] (-841.376) (-837.957) * [-831.020] (-840.164) (-827.544) (-840.454) -- 0:00:08
907000 -- [-830.856] (-829.253) (-842.834) (-840.831) * (-830.568) (-839.777) [-829.030] (-843.936) -- 0:00:08
908000 -- [-834.648] (-825.997) (-842.082) (-837.098) * (-828.339) (-841.621) [-830.497] (-840.639) -- 0:00:08
909000 -- (-831.744) [-833.876] (-840.151) (-843.777) * (-831.231) (-839.155) [-828.106] (-838.798) -- 0:00:08
910000 -- (-829.816) [-827.034] (-840.185) (-843.358) * (-831.340) (-839.942) [-829.710] (-839.859) -- 0:00:08
Average standard deviation of split frequencies: 0.001725
911000 -- (-829.078) [-827.195] (-839.487) (-840.742) * [-831.113] (-841.471) (-832.081) (-840.105) -- 0:00:08
912000 -- [-828.131] (-831.509) (-841.046) (-841.257) * (-835.387) (-842.810) [-827.298] (-838.660) -- 0:00:08
913000 -- (-828.170) [-828.845] (-842.379) (-840.452) * (-831.482) (-835.444) [-826.327] (-841.008) -- 0:00:08
914000 -- [-825.930] (-830.983) (-839.107) (-845.079) * (-828.521) (-841.925) [-828.763] (-843.725) -- 0:00:07
915000 -- (-829.498) [-835.177] (-838.605) (-840.498) * [-829.444] (-842.898) (-829.108) (-843.324) -- 0:00:07
Average standard deviation of split frequencies: 0.004117
916000 -- [-825.937] (-837.153) (-840.214) (-835.922) * (-829.492) (-840.395) [-827.819] (-843.991) -- 0:00:07
917000 -- [-827.791] (-840.836) (-840.685) (-829.134) * [-831.776] (-840.128) (-827.497) (-841.800) -- 0:00:07
918000 -- (-828.392) (-836.529) (-840.158) [-831.566] * [-828.886] (-842.261) (-828.135) (-838.699) -- 0:00:07
919000 -- (-829.865) (-839.153) (-840.157) [-831.378] * [-827.975] (-843.205) (-834.142) (-844.704) -- 0:00:07
920000 -- [-828.863] (-839.846) (-840.580) (-829.964) * (-831.283) (-839.412) [-829.868] (-839.732) -- 0:00:07
Average standard deviation of split frequencies: 0.005120
921000 -- [-828.973] (-841.553) (-842.522) (-829.315) * [-830.851] (-840.591) (-833.274) (-841.570) -- 0:00:07
922000 -- [-830.594] (-842.642) (-844.370) (-828.210) * [-830.761] (-841.702) (-833.174) (-842.148) -- 0:00:07
923000 -- (-837.773) (-839.562) (-839.874) [-830.127] * (-832.893) (-841.159) [-828.031] (-839.517) -- 0:00:07
924000 -- (-842.811) (-841.481) (-841.348) [-827.697] * (-831.326) (-839.443) [-835.220] (-840.138) -- 0:00:07
925000 -- (-844.305) (-843.483) (-840.340) [-829.034] * [-829.249] (-836.303) (-826.089) (-845.268) -- 0:00:06
Average standard deviation of split frequencies: 0.005091
926000 -- (-834.744) (-839.863) (-841.815) [-827.740] * [-828.929] (-841.999) (-830.458) (-840.893) -- 0:00:06
927000 -- [-831.735] (-843.101) (-839.597) (-839.347) * [-829.161] (-841.636) (-827.270) (-839.460) -- 0:00:06
928000 -- (-829.204) (-840.263) (-839.949) [-830.805] * (-829.535) (-841.063) [-829.374] (-840.379) -- 0:00:06
929000 -- (-830.903) (-840.947) (-836.960) [-833.205] * (-829.921) (-841.390) [-833.395] (-840.319) -- 0:00:06
930000 -- [-831.247] (-849.352) (-841.617) (-830.550) * [-829.840] (-839.666) (-827.354) (-838.845) -- 0:00:06
Average standard deviation of split frequencies: 0.006078
931000 -- (-839.415) (-842.584) (-835.783) [-832.981] * (-826.717) (-840.144) [-827.412] (-840.189) -- 0:00:06
932000 -- (-839.003) (-841.336) (-836.369) [-841.053] * (-833.389) (-839.690) [-829.022] (-838.985) -- 0:00:06
933000 -- (-835.893) (-840.114) [-833.564] (-832.546) * [-831.411] (-841.194) (-829.153) (-837.526) -- 0:00:06
934000 -- (-839.976) (-840.769) (-840.214) [-829.110] * [-834.081] (-844.644) (-833.801) (-843.728) -- 0:00:06
935000 -- (-842.052) (-839.294) (-841.948) [-834.334] * [-830.970] (-839.253) (-827.184) (-843.087) -- 0:00:06
Average standard deviation of split frequencies: 0.005036
936000 -- (-843.085) (-838.868) (-842.683) [-832.570] * (-836.564) (-846.105) [-832.469] (-840.763) -- 0:00:05
937000 -- (-843.846) (-840.952) (-842.456) [-830.079] * [-835.435] (-838.796) (-832.570) (-844.112) -- 0:00:05
938000 -- (-836.424) (-841.212) (-834.794) [-829.525] * [-828.192] (-839.448) (-830.626) (-836.009) -- 0:00:05
939000 -- (-836.879) (-839.524) (-839.957) [-829.684] * [-830.752] (-840.352) (-830.745) (-839.370) -- 0:00:05
940000 -- (-840.228) [-834.150] (-836.287) (-837.799) * (-831.062) (-842.290) [-830.004] (-840.212) -- 0:00:05
Average standard deviation of split frequencies: 0.004009
941000 -- (-840.337) (-839.832) (-839.495) [-831.103] * (-832.443) (-839.975) [-830.207] (-839.256) -- 0:00:05
942000 -- [-828.832] (-839.069) (-843.504) (-831.467) * [-832.284] (-839.833) (-831.846) (-840.695) -- 0:00:05
943000 -- (-831.625) (-839.485) (-841.000) [-827.007] * [-829.144] (-838.919) (-831.816) (-839.627) -- 0:00:05
944000 -- (-829.264) (-840.478) (-842.155) [-832.014] * [-829.823] (-840.810) (-827.440) (-841.729) -- 0:00:05
945000 -- (-827.370) (-840.106) (-843.794) [-828.873] * (-825.770) (-840.634) [-829.722] (-846.423) -- 0:00:05
Average standard deviation of split frequencies: 0.003987
946000 -- [-826.900] (-839.372) (-837.205) (-827.199) * (-826.289) [-831.641] (-830.776) (-841.185) -- 0:00:05
947000 -- (-826.560) (-841.990) (-839.761) [-828.748] * (-828.561) (-830.949) [-829.818] (-840.858) -- 0:00:04
948000 -- [-827.435] (-842.186) (-840.882) (-827.047) * (-830.573) [-829.409] (-833.300) (-839.026) -- 0:00:04
949000 -- [-832.593] (-840.092) (-838.786) (-825.901) * (-825.844) [-829.060] (-829.623) (-840.433) -- 0:00:04
950000 -- (-829.248) (-839.855) (-841.018) [-826.162] * (-829.563) (-832.332) [-830.387] (-839.934) -- 0:00:04
Average standard deviation of split frequencies: 0.004628
951000 -- [-831.512] (-839.619) (-836.784) (-825.017) * [-829.522] (-827.558) (-828.830) (-839.812) -- 0:00:04
952000 -- [-829.162] (-840.086) (-842.112) (-827.120) * [-829.601] (-843.286) (-831.081) (-842.518) -- 0:00:04
953000 -- (-831.607) (-836.821) (-843.813) [-825.958] * (-832.340) (-840.814) [-832.449] (-839.998) -- 0:00:04
954000 -- (-832.195) [-830.966] (-847.860) (-825.157) * (-829.595) (-840.572) [-829.755] (-842.480) -- 0:00:04
955000 -- (-830.361) (-831.887) (-839.937) [-826.996] * [-829.299] (-837.620) (-832.927) (-840.356) -- 0:00:04
Average standard deviation of split frequencies: 0.003616
956000 -- (-833.195) (-831.287) (-836.594) [-827.019] * (-827.428) (-838.690) [-829.483] (-840.138) -- 0:00:04
957000 -- (-832.364) [-829.705] (-838.952) (-835.537) * (-828.399) (-840.426) [-831.838] (-846.078) -- 0:00:03
958000 -- [-829.538] (-827.350) (-841.796) (-833.837) * (-826.481) (-837.518) (-831.581) [-832.035] -- 0:00:03
959000 -- [-827.453] (-830.700) (-839.180) (-833.475) * [-827.539] (-841.116) (-842.476) (-834.077) -- 0:00:03
960000 -- [-827.529] (-829.548) (-838.739) (-836.780) * [-830.479] (-842.392) (-841.222) (-831.105) -- 0:00:03
Average standard deviation of split frequencies: 0.004253
961000 -- (-830.423) [-827.153] (-839.435) (-828.392) * (-828.661) (-839.706) [-829.207] (-832.048) -- 0:00:03
962000 -- [-831.757] (-830.820) (-841.996) (-832.365) * (-832.490) (-838.211) [-828.741] (-830.554) -- 0:00:03
963000 -- (-831.900) [-833.769] (-842.059) (-837.266) * (-834.462) [-831.740] (-834.065) (-829.005) -- 0:00:03
964000 -- (-833.183) [-834.373] (-843.988) (-828.529) * (-832.941) (-830.590) (-840.662) [-832.000] -- 0:00:03
965000 -- (-829.525) (-828.345) (-840.793) [-831.006] * (-835.317) [-831.300] (-839.232) (-828.856) -- 0:00:03
Average standard deviation of split frequencies: 0.004880
966000 -- (-839.938) [-836.332] (-841.393) (-829.065) * (-839.916) (-839.996) (-837.870) [-830.593] -- 0:00:03
967000 -- (-840.919) [-829.391] (-838.701) (-829.292) * (-840.766) (-835.918) (-839.593) [-828.522] -- 0:00:03
968000 -- (-843.952) (-826.163) (-839.873) [-828.770] * (-840.028) (-840.759) (-840.684) [-829.885] -- 0:00:03
969000 -- (-841.878) (-828.383) (-840.923) [-828.575] * (-844.570) (-839.230) (-839.936) [-825.868] -- 0:00:02
970000 -- (-838.657) [-832.855] (-840.106) (-833.380) * (-837.953) (-843.401) (-846.690) [-830.620] -- 0:00:02
Average standard deviation of split frequencies: 0.004533
971000 -- (-840.827) [-831.765] (-839.253) (-829.699) * (-840.269) (-842.892) [-832.921] (-840.584) -- 0:00:02
972000 -- (-840.937) [-830.179] (-839.885) (-841.263) * (-840.474) (-842.572) [-831.406] (-838.103) -- 0:00:02
973000 -- (-838.130) (-827.986) (-841.751) [-827.126] * (-840.964) (-843.235) [-833.142] (-840.752) -- 0:00:02
974000 -- (-839.770) [-830.528] (-843.556) (-829.314) * (-839.548) (-832.251) [-829.858] (-838.012) -- 0:00:02
975000 -- (-835.289) (-826.840) (-845.672) [-826.929] * (-839.380) (-830.071) [-827.791] (-840.592) -- 0:00:02
Average standard deviation of split frequencies: 0.004508
976000 -- (-841.792) [-826.198] (-839.252) (-828.923) * (-843.321) [-831.779] (-835.408) (-841.629) -- 0:00:02
977000 -- (-837.849) (-831.930) (-838.772) [-826.152] * (-841.098) [-827.821] (-838.950) (-839.125) -- 0:00:02
978000 -- (-841.175) (-831.263) (-843.305) [-826.895] * [-830.186] (-828.745) (-843.012) (-838.605) -- 0:00:02
979000 -- (-839.816) [-828.994] (-839.240) (-830.507) * (-831.311) [-829.956] (-840.844) (-838.817) -- 0:00:01
980000 -- (-829.066) (-831.459) (-840.898) [-830.165] * [-833.880] (-829.044) (-843.414) (-843.697) -- 0:00:01
Average standard deviation of split frequencies: 0.005127
981000 -- (-827.814) (-828.505) (-840.495) [-831.022] * (-828.341) [-826.780] (-838.241) (-843.768) -- 0:00:01
982000 -- [-828.335] (-832.937) (-838.818) (-827.395) * (-831.157) [-826.084] (-840.570) (-841.715) -- 0:00:01
983000 -- (-830.396) [-830.806] (-838.630) (-828.279) * (-828.454) [-832.096] (-835.799) (-838.960) -- 0:00:01
984000 -- [-831.252] (-831.360) (-842.798) (-840.828) * [-826.844] (-830.204) (-839.404) (-839.160) -- 0:00:01
985000 -- [-828.566] (-832.270) (-841.667) (-843.162) * [-829.242] (-826.386) (-840.014) (-841.987) -- 0:00:01
Average standard deviation of split frequencies: 0.004781
986000 -- (-833.080) [-829.921] (-836.321) (-840.293) * [-827.606] (-833.864) (-840.424) (-846.688) -- 0:00:01
987000 -- [-828.106] (-829.985) (-840.928) (-839.469) * (-831.662) [-829.485] (-840.804) (-845.441) -- 0:00:01
988000 -- (-829.509) (-830.106) (-840.408) [-832.246] * [-835.450] (-830.607) (-833.437) (-839.892) -- 0:00:01
989000 -- (-829.818) [-827.769] (-841.905) (-830.030) * [-831.170] (-826.579) (-840.688) (-841.088) -- 0:00:01
990000 -- (-842.174) (-830.054) (-838.642) [-827.230] * (-827.436) [-826.649] (-841.299) (-840.315) -- 0:00:00
Average standard deviation of split frequencies: 0.004124
991000 -- (-840.579) (-831.994) (-840.805) [-829.928] * [-830.900] (-830.709) (-840.007) (-840.575) -- 0:00:00
992000 -- (-839.367) (-830.776) (-841.067) [-829.966] * (-829.921) (-831.215) (-841.422) [-829.828] -- 0:00:00
993000 -- (-838.876) (-833.931) (-837.405) [-830.699] * (-830.436) (-829.939) (-837.232) [-827.545] -- 0:00:00
994000 -- (-841.050) [-834.489] (-839.409) (-832.144) * (-831.974) (-830.009) (-844.856) [-829.058] -- 0:00:00
995000 -- (-841.837) (-829.798) (-836.523) [-837.328] * (-828.937) (-830.434) (-837.528) [-830.653] -- 0:00:00
Average standard deviation of split frequencies: 0.004733
996000 -- (-838.181) [-830.969] (-841.038) (-841.223) * [-833.934] (-840.216) (-839.168) (-827.826) -- 0:00:00
997000 -- (-845.000) [-834.834] (-840.148) (-829.806) * [-829.616] (-842.714) (-841.219) (-833.767) -- 0:00:00
998000 -- (-844.633) (-835.182) (-839.705) [-831.842] * [-833.181] (-843.776) (-827.302) (-831.526) -- 0:00:00
999000 -- (-839.952) (-834.417) (-839.703) [-830.614] * [-833.204] (-841.726) (-829.196) (-839.889) -- 0:00:00
1000000 -- (-840.577) [-828.689] (-840.014) (-831.854) * (-830.090) (-840.645) [-831.531] (-843.624) -- 0:00:00
Average standard deviation of split frequencies: 0.004397
Analysis completed in 1 mins 34 seconds
Analysis used 93.73 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -824.05
Likelihood of best state for "cold" chain of run 2 was -824.11
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
73.6 % ( 71 %) Dirichlet(Revmat{all})
92.9 % ( 87 %) Slider(Revmat{all})
29.0 % ( 26 %) Dirichlet(Pi{all})
31.0 % ( 28 %) Slider(Pi{all})
77.5 % ( 61 %) Multiplier(Alpha{1,2})
77.7 % ( 46 %) Multiplier(Alpha{3})
95.7 % ( 93 %) Slider(Pinvar{all})
98.2 % ( 99 %) ExtSPR(Tau{all},V{all})
99.6 % ( 99 %) NNI(Tau{all},V{all})
73.4 % ( 75 %) ParsSPR(Tau{all},V{all})
27.5 % ( 35 %) Multiplier(V{all})
64.8 % ( 53 %) Nodeslider(V{all})
31.6 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.6 % ( 60 %) Dirichlet(Revmat{all})
93.2 % ( 93 %) Slider(Revmat{all})
30.0 % ( 25 %) Dirichlet(Pi{all})
31.7 % ( 35 %) Slider(Pi{all})
78.0 % ( 50 %) Multiplier(Alpha{1,2})
77.6 % ( 46 %) Multiplier(Alpha{3})
95.3 % ( 90 %) Slider(Pinvar{all})
98.1 % (100 %) ExtSPR(Tau{all},V{all})
99.6 % ( 99 %) NNI(Tau{all},V{all})
73.3 % ( 70 %) ParsSPR(Tau{all},V{all})
27.5 % ( 21 %) Multiplier(V{all})
64.8 % ( 68 %) Nodeslider(V{all})
31.9 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.70 0.15 0.03
2 | 166511 0.32 0.12
3 | 166750 166573 0.64
4 | 166479 166956 166731
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.69 0.17 0.03
2 | 167204 0.35 0.12
3 | 165877 166655 0.62
4 | 166499 166513 167252
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -828.24
| 1 1 1 1 |
| 1 2 1 2 1 2 |
|1 22 2 2 1 |
| 2 1 2 1 2 1 1 1 |
| 2 1 1 1 2 1 2 2 1 2 22 |
| 1 1 1 2 1 2 1 12 2*21 |
| * 1 2 2 2 22 1 21 1 22 2* |
| 1 2 2 2 1 2 2 2 22 1 1 2 22|
|2 1 12 1 2 1 1 1 1 12 1 21 2 1 |
| 1 2 11 |
| 1 1 1 1 2 1|
| 21 2 2 2 1 |
| 2 2 2 |
| |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -832.01
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -828.02 -836.79
2 -828.08 -836.92
--------------------------------------
TOTAL -828.05 -836.86
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.056682 0.524639 0.001752 0.019659 0.008434 1501.00 1501.00 1.000
r(A<->C){all} 0.209159 0.017518 0.010657 0.462985 0.184038 103.13 136.57 1.000
r(A<->G){all} 0.184908 0.014318 0.005072 0.420270 0.161020 165.63 167.20 1.010
r(A<->T){all} 0.086217 0.007363 0.000002 0.269374 0.058445 214.90 224.15 1.000
r(C<->G){all} 0.112863 0.010153 0.000062 0.322966 0.084870 248.38 268.36 1.002
r(C<->T){all} 0.311954 0.021072 0.065160 0.600749 0.292497 102.49 111.83 1.005
r(G<->T){all} 0.094900 0.007322 0.000045 0.259979 0.072133 210.82 252.89 1.003
pi(A){all} 0.258678 0.000309 0.223364 0.292093 0.258806 1110.52 1213.97 1.002
pi(C){all} 0.176181 0.000231 0.148628 0.207398 0.175812 1149.56 1276.52 1.000
pi(G){all} 0.242962 0.000308 0.208930 0.277794 0.242547 1231.96 1241.04 1.001
pi(T){all} 0.322179 0.000351 0.286509 0.358659 0.322099 973.18 1044.17 1.000
alpha{1,2} 0.975215 0.886799 0.000586 2.853342 0.695292 934.69 1101.74 1.000
alpha{3} 1.005310 1.041265 0.000148 3.072599 0.694297 1198.74 1241.19 1.001
pinvar{all} 0.527105 0.084223 0.051099 0.987119 0.541623 414.91 533.03 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .**.
6 -- ..**
7 -- .*.*
----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 1006 0.335110 0.000942 0.334444 0.335776 2
6 998 0.332445 0.005653 0.328448 0.336442 2
7 998 0.332445 0.006595 0.327781 0.337109 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.021990 0.091399 0.000551 0.011925 0.004575 1.000 2
length{all}[2] 0.009040 0.023792 0.000001 0.003364 0.000646 1.000 2
length{all}[3] 0.007814 0.019372 0.000000 0.003441 0.000676 1.000 2
length{all}[4] 0.008595 0.014655 0.000000 0.003563 0.000638 1.000 2
length{all}[5] 0.008790 0.008885 0.000001 0.003479 0.000685 1.000 2
length{all}[6] 0.009048 0.032052 0.000002 0.003628 0.000620 1.000 2
length{all}[7] 0.009891 0.042127 0.000001 0.003478 0.000630 1.002 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004397
Maximum standard deviation of split frequencies = 0.006595
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\------------------------------------------------------------------------ C4 (4)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|---------- C2 (2)
+
|----------- C3 (3)
|
\---------- C4 (4)
|--------------| 0.001 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Fri Oct 21 22:38:33 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=195
C1 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFD
C2 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFD
C3 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFD
C4 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFD
**************************************************
C1 HEASVQKKIQRMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDM
C2 HEASVQKKIQRMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDM
C3 HEASVQKKIQRMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDM
C4 HEASVQKKIQRMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDM
**************************************************
C1 SSINQLMELAKDGCIPMAIIPAAAATKLTVITPDLESFSKIRVDNNIYYA
C2 SSINQLMELAKDGCIPMAIIPAAAATKLTVITPDLESFSKIRVDNNIYYA
C3 SSINQLMELAKDGCIPMAIIPAAAATKLTVITPDLESFSKIRVDNNIYYA
C4 SSINQLMELAKDGCIPMAIIPAAAATKLTVITPDLESFSKIRVDNNIYYA
**************************************************
C1 GAAWSITDVQDADGRVTILKEINADNKDALVWPLHVTCERVVKLQ
C2 GAAWSITDVKDADGRVVILKEINADNKDALVWPLHVTCERVVKLQ
C3 GAAWSITDVKDADGRVVILKEINADNKDALVWPLHVTCERVVKLQ
C4 GAAWSITDVKDADGRVVILKEINADNKDALVWPLHVTCERVVKLQ
*********:******.****************************
-- Starting log on Fri Oct 21 22:56:37 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/codeml,HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C1 585 sites
reading seq# 2 C2 585 sites
reading seq# 3 C3 585 sites
reading seq# 4 C4 585 sitesns = 4 ls = 585
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Sequences read..
Counting site patterns.. 0:00
Compressing, 49 patterns at 195 / 195 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 49 patterns at 195 / 195 sites (100.0%), 0:00
Counting codons..
48 bytes for distance
47824 bytes for conP
4312 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4); MP score: 3
0.017409 0.031191 0.040471 0.104535 0.300000 0.522840 0.516150
ntime & nrate & np: 4 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.083047
np = 7
lnL0 = -800.147360
Iterating by ming2
Initial: fx= 800.147360
x= 0.01741 0.03119 0.04047 0.10453 0.30000 0.52284 0.51615
1 h-m-p 0.0000 0.0002 323.5618 +++ 782.773344 m 0.0002 13 | 1/7
2 h-m-p 0.0000 0.0000 21785.6127 ++ 779.311973 m 0.0000 23 | 2/7
3 h-m-p 0.0000 0.0004 186.5004 ++ 767.483160 m 0.0004 33 | 3/7
4 h-m-p 0.0039 0.2841 8.0717 ++++ 762.536491 m 0.2841 45 | 4/7
5 h-m-p 0.0438 0.2192 1.1823 YCCCCC 762.494706 5 0.0528 64 | 4/7
6 h-m-p 1.0949 8.0000 0.0570 CCC 762.482640 2 1.2899 78 | 4/7
7 h-m-p 0.3855 8.0000 0.1906 +++ 762.340957 m 8.0000 92 | 4/7
8 h-m-p 1.6000 8.0000 0.2764 CYC 762.331824 2 1.1492 108 | 4/7
9 h-m-p 1.6000 8.0000 0.1712 CY 762.328885 1 1.7576 123 | 4/7
10 h-m-p 1.6000 8.0000 0.0510 YC 762.328574 1 1.1717 137 | 4/7
11 h-m-p 1.6000 8.0000 0.0095 Y 762.328571 0 1.2041 150 | 4/7
12 h-m-p 1.6000 8.0000 0.0001 Y 762.328571 0 1.0081 163 | 4/7
13 h-m-p 1.6000 8.0000 0.0000 -Y 762.328571 0 0.1000 177 | 4/7
14 h-m-p 0.4910 8.0000 0.0000 C 762.328571 0 0.4910 190 | 4/7
15 h-m-p 1.0491 8.0000 0.0000 -----Y 762.328571 0 0.0003 208
Out..
lnL = -762.328571
209 lfun, 627 eigenQcodon, 1672 P(t)
end of tree file.
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4); MP score: 3
0.022279 0.013249 0.090955 0.010973 4.830182 1.148029 0.114616 0.111746 1.374799
ntime & nrate & np: 4 3 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.321916
np = 9
lnL0 = -783.431483
Iterating by ming2
Initial: fx= 783.431483
x= 0.02228 0.01325 0.09096 0.01097 4.83018 1.14803 0.11462 0.11175 1.37480
1 h-m-p 0.0000 0.0001 301.0433 ++ 777.715477 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 375.7098 ++ 776.943478 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0008 109.0558 +++ 762.729517 m 0.0008 39 | 3/9
4 h-m-p 0.0499 0.2495 0.3566 +YCCC 762.535991 3 0.1360 57 | 3/9
5 h-m-p 0.2311 1.1554 0.1600 ++ 762.397477 m 1.1554 75 | 4/9
6 h-m-p 0.0234 0.1169 7.3149 +YCCC 762.300789 3 0.0690 99 | 4/9
7 h-m-p 1.2916 8.0000 0.3910 ++ 761.027377 m 8.0000 111 | 4/9
8 h-m-p 0.9661 8.0000 3.2375 +YCYC 759.765896 3 2.6843 133 | 4/9
9 h-m-p 1.6000 8.0000 3.1007 YCCC 759.169803 3 0.6896 150 | 4/9
10 h-m-p 0.5771 8.0000 3.7056 +YCCC 758.223426 3 4.5838 168 | 4/9
11 h-m-p 1.6000 8.0000 7.4847 CCCC 757.559434 3 2.1278 186 | 4/9
12 h-m-p 0.9807 8.0000 16.2391 YCCC 757.019558 3 1.8234 203 | 4/9
13 h-m-p 1.6000 8.0000 15.6240 YCCC 756.582948 3 3.2606 220 | 4/9
14 h-m-p 1.6000 8.0000 25.7809 CYC 756.381996 2 1.8032 235 | 4/9
15 h-m-p 1.4987 7.4936 24.4003 YCCC 756.257536 3 3.1580 252 | 4/9
16 h-m-p 0.8362 4.1809 25.2742 +YCCC 756.213238 3 2.2781 270 | 4/9
17 h-m-p 0.3901 1.9503 24.6904 ++ 756.196016 m 1.9503 282 | 4/9
18 h-m-p -0.0000 -0.0000 29.1393
h-m-p: -0.00000000e+00 -0.00000000e+00 2.91393262e+01 756.196016
.. | 4/9
19 h-m-p 0.0001 0.0521 3.6945 +++YCCCC 756.092512 4 0.0133 313 | 4/9
20 h-m-p 0.0796 1.5026 0.6189 +YYCCCC 756.025719 5 0.3471 334 | 4/9
21 h-m-p 1.6000 8.0000 0.0801 CC 756.012674 1 0.5490 353 | 4/9
22 h-m-p 1.6000 8.0000 0.0175 YC 756.012244 1 1.1303 371 | 4/9
23 h-m-p 1.6000 8.0000 0.0006 Y 756.012243 0 1.1357 388 | 4/9
24 h-m-p 1.2020 8.0000 0.0006 ++ 756.012241 m 8.0000 405 | 4/9
25 h-m-p 0.0166 8.0000 0.2728 +++YC 756.012102 1 2.0719 426 | 4/9
26 h-m-p 1.6000 8.0000 0.2855 ++ 756.010976 m 8.0000 443 | 4/9
27 h-m-p 0.0312 8.0000 73.1542 +++CC 755.984861 1 1.9979 465 | 4/9
28 h-m-p 1.6000 8.0000 2.4090 YC 755.984744 1 1.0850 478 | 4/9
29 h-m-p 1.6000 8.0000 1.5788 +YC 755.984704 1 4.2156 492 | 4/9
30 h-m-p 1.6000 8.0000 0.0160 ++ 755.984533 m 8.0000 504 | 4/9
31 h-m-p 0.0355 8.0000 3.6031 ++YCC 755.979918 2 1.1347 526 | 4/9
32 h-m-p 0.2081 8.0000 19.6461 ++YCC 755.974788 2 4.7316 543 | 4/9
33 h-m-p 1.6000 8.0000 13.5432 YYC 755.973806 2 1.1357 557 | 4/9
34 h-m-p 1.6000 8.0000 3.9837 C 755.973759 0 1.2985 569 | 4/9
35 h-m-p 1.6000 8.0000 0.0316 Y 755.973758 0 1.1195 581 | 4/9
36 h-m-p 0.4228 8.0000 0.0837 +Y 755.973758 0 1.3264 599 | 4/9
37 h-m-p 1.6000 8.0000 0.0038 Y 755.973758 0 0.9542 616 | 4/9
38 h-m-p 1.6000 8.0000 0.0001 Y 755.973758 0 1.6000 633 | 4/9
39 h-m-p 1.6000 8.0000 0.0001 ----------------.. | 4/9
40 h-m-p 0.0160 8.0000 0.0000 ---------Y 755.973758 0 0.0000 690
Out..
lnL = -755.973758
691 lfun, 2764 eigenQcodon, 8292 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -764.260870 S = -753.323305 -10.841642
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:04
did 20 / 49 patterns 0:04
did 30 / 49 patterns 0:05
did 40 / 49 patterns 0:05
did 49 / 49 patterns 0:05end of tree file.
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4); MP score: 3
0.054677 0.031976 0.054343 0.041993 25.832456 0.478330 1.951010
ntime & nrate & np: 4 1 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 1.429316
np = 7
lnL0 = -789.928847
Iterating by ming2
Initial: fx= 789.928847
x= 0.05468 0.03198 0.05434 0.04199 25.83246 0.47833 1.95101
1 h-m-p 0.0000 0.0002 323.1369 +++ 770.979032 m 0.0002 13 | 1/7
2 h-m-p 0.0000 0.0000 27048.3382 ++ 766.664014 m 0.0000 23 | 2/7
3 h-m-p 0.0000 0.0001 140.8045 ++ 764.169567 m 0.0001 33 | 3/7
4 h-m-p 0.0039 1.9713 1.0967 +++YCC 763.858982 2 0.4804 49 | 3/7
5 h-m-p 1.6000 8.0000 0.1506 YCCC 763.814501 3 3.5740 64 | 3/7
6 h-m-p 0.4772 2.3859 0.5506 YCYCCC 763.762031 5 1.1036 86 | 3/7
7 h-m-p 0.4895 2.4474 0.3799 +YYYYYYYCCC 763.349692 10 2.2700 115 | 3/7
8 h-m-p 0.0005 0.0025 29.8244 CYC 763.349004 2 0.0002 132 | 3/7
9 h-m-p 0.0152 0.3871 0.3608 +CYYYC 763.320673 4 0.1619 149 | 3/7
10 h-m-p 0.0477 0.2386 0.4413 CCCCC 763.303432 4 0.0658 171 | 3/7
11 h-m-p 0.1307 0.6535 0.2065 ++ 763.082348 m 0.6535 185 | 3/7
12 h-m-p 0.0000 0.0000 0.0331
h-m-p: 3.60197922e-16 1.80098961e-15 3.30920822e-02 763.082348
.. | 3/7
13 h-m-p 0.0001 0.0517 0.4270 C 763.082336 0 0.0001 210 | 3/7
14 h-m-p 0.0029 1.4295 0.0488 Y 763.082328 0 0.0066 224 | 3/7
15 h-m-p 0.0065 0.3468 0.0496 +++ 763.081810 m 0.3468 239 | 4/7
16 h-m-p 0.0160 8.0000 7.0014 -------------.. | 4/7
17 h-m-p 0.0086 4.3132 0.0306 Y 763.081808 0 0.0045 274 | 4/7
18 h-m-p 0.0160 8.0000 1.0983 +YCYC 763.080424 3 0.0504 293 | 4/7
19 h-m-p 0.0054 2.4361 10.3240 ++++YYYYCYYYYY 762.343829 10 1.9043 317 | 3/7
20 h-m-p 0.0000 0.0000 296879.7322 YYC 762.332116 2 0.0000 329 | 3/7
21 h-m-p 0.5195 8.0000 1.4965 C 762.331477 0 0.1281 339 | 3/7
22 h-m-p 0.4276 2.1379 0.0814 ++ 762.330851 m 2.1379 349 | 3/7
23 h-m-p -0.0000 -0.0000 0.0418
h-m-p: -0.00000000e+00 -0.00000000e+00 4.18040500e-02 762.330851
.. | 3/7
24 h-m-p 0.0001 0.0485 1.4793 +Y 762.330675 0 0.0002 375 | 3/7
25 h-m-p 0.0013 0.5859 0.2819 -Y 762.330670 0 0.0001 386 | 3/7
26 h-m-p 0.0088 0.3634 0.0045 +++ 762.330663 m 0.3634 401 | 3/7
27 h-m-p -0.0000 -0.0000 0.0045
h-m-p: -0.00000000e+00 -0.00000000e+00 4.48057159e-03 762.330663
.. | 3/7
28 h-m-p 0.0018 0.9147 0.0625 Y 762.330657 0 0.0034 426 | 3/7
29 h-m-p 0.0096 4.7933 0.0219 --C 762.330657 0 0.0001 442 | 3/7
30 h-m-p 0.0011 0.5429 0.0024 +++++ 762.330654 m 0.5429 459 | 3/7
31 h-m-p -0.0000 -0.0000 0.0120
h-m-p: -0.00000000e+00 -0.00000000e+00 1.19688377e-02 762.330654
.. | 3/7
32 h-m-p 0.0160 8.0000 0.0046 -Y 762.330654 0 0.0007 485 | 3/7
33 h-m-p 0.0036 1.7823 0.0199 Y 762.330654 0 0.0020 499 | 3/7
34 h-m-p 0.0134 0.1017 0.0029 ++ 762.330654 m 0.1017 513 | 4/7
35 h-m-p 0.0152 2.5363 0.0193 +C 762.330651 0 0.0890 528 | 4/7
36 h-m-p 0.1244 8.0000 0.0138 ++YC 762.330604 1 3.8750 544 | 4/7
37 h-m-p 1.6000 8.0000 0.0028 Y 762.330601 0 0.7588 557 | 4/7
38 h-m-p 1.6000 8.0000 0.0004 Y 762.330601 0 1.2191 570 | 4/7
39 h-m-p 1.6000 8.0000 0.0001 C 762.330601 0 1.3384 583 | 4/7
40 h-m-p 1.6000 8.0000 0.0000 C 762.330601 0 1.6000 596 | 4/7
41 h-m-p 1.6000 8.0000 0.0000 ---C 762.330601 0 0.0063 612
Out..
lnL = -762.330601
613 lfun, 6743 eigenQcodon, 24520 P(t)
end of tree file.
Time used: 0:14
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4); MP score: 3
0.039803 0.061547 0.083332 0.108225 4.788681 0.900000 0.513115 1.526284 1.300000
ntime & nrate & np: 4 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 4.408886
np = 9
lnL0 = -807.198455
Iterating by ming2
Initial: fx= 807.198455
x= 0.03980 0.06155 0.08333 0.10823 4.78868 0.90000 0.51311 1.52628 1.30000
1 h-m-p 0.0000 0.0004 282.0848 +++ 775.836209 m 0.0004 15 | 1/9
2 h-m-p 0.0000 0.0000 281667.7654 ++ 768.771295 m 0.0000 27 | 2/9
3 h-m-p 0.0000 0.0002 126.1069 ++ 764.147491 m 0.0002 39 | 3/9
4 h-m-p 0.0039 0.3899 2.1891 +++CCC 763.522407 2 0.2488 58 | 3/9
5 h-m-p 0.0225 0.1127 1.7828 ++ 763.098448 m 0.1127 70 | 4/9
6 h-m-p 0.0008 0.0058 104.6424 +YYYYCYYC 761.832580 7 0.0043 92 | 4/9
7 h-m-p 0.2455 1.2277 0.6818 CYCCC 761.713153 4 0.4481 111 | 4/9
8 h-m-p 0.1135 2.9235 2.6913 ++YYYCYCYCCC 760.180078 9 2.0535 143 | 4/9
9 h-m-p 0.0772 0.3858 5.5645 YYCCC 759.980940 4 0.1072 161 | 4/9
10 h-m-p 0.1795 0.8974 1.9709 YCYYC 759.813200 4 0.6064 179 | 4/9
11 h-m-p 0.7120 3.6363 1.6788 YCYCCC 759.502470 5 1.7769 199 | 4/9
12 h-m-p 1.1361 8.0000 2.6257 ++ 758.553537 m 8.0000 211 | 4/9
13 h-m-p 0.1531 0.7656 8.1477 YYYC 758.529028 3 0.1338 226 | 4/9
14 h-m-p 0.4174 2.0868 2.3985 YYYY 758.525779 3 0.4174 241 | 4/9
15 h-m-p 1.6000 8.0000 0.1448 ----------------.. | 4/9
16 h-m-p 0.0002 0.1096 86.0290 YYYCC 757.886595 4 0.0002 289 | 4/9
17 h-m-p 0.0004 0.0203 52.5099 CYC 757.822197 2 0.0001 305 | 4/9
18 h-m-p 0.0206 8.0000 0.1740 +++++ 757.803710 m 8.0000 320 | 4/9
19 h-m-p 1.6000 8.0000 0.0626 +CC 757.787546 1 5.5727 340 | 4/9
20 h-m-p 1.5680 8.0000 0.2227
QuantileBeta(0.15, 0.00500, 2.68761) = 9.331184e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.96538) = 8.295338e-161 2000 rounds
+ 757.755263 m 8.0000 357
QuantileBeta(0.15, 0.00500, 2.96538) = 8.295338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96538) = 8.295338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96538) = 8.295338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96538) = 8.295338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96538) = 8.295338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96538) = 8.295338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96538) = 8.295338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96538) = 8.295338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96538) = 8.295338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96538) = 8.584925e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96552) = 8.294871e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96524) = 8.295805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96538) = 8.295338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96538) = 8.295338e-161 2000 rounds
| 4/9
21 h-m-p 1.5196 8.0000 1.1722
QuantileBeta(0.15, 0.00500, 4.30254) = 5.400781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.31400) = 2.634771e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 10.00469) = 2.166700e-161 2000 rounds
+ 757.584384 m 8.0000 374
QuantileBeta(0.15, 0.00500, 10.00469) = 2.166700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.00469) = 2.166700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.00469) = 2.166700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.00469) = 2.166700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.00469) = 2.166700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.00469) = 2.166700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.00469) = 2.242338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.00469) = 2.166699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.00469) = 2.166700e-161 2000 rounds
| 4/9
22 h-m-p 0.9389 8.0000 9.9874
QuantileBeta(0.15, 0.00500, 16.98900) = 1.249464e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 37.94194) = 4.433997e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 50.88097) = 1.971874e-162 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 49.78623) = 2.015669e-162 2000 rounds
C
QuantileBeta(0.15, 0.00500, 43.86409) = 3.828519e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 49.06931) = 2.045419e-162 2000 rounds
C
QuantileBeta(0.15, 0.00500, 46.46670) = 3.611770e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 49.03245) = 2.046972e-162 2000 rounds
C 757.346127 3 5.2467 392
QuantileBeta(0.15, 0.00500, 49.03245) = 2.046972e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 49.03245) = 2.046972e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 49.03245) = 2.046972e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 49.03245) = 2.046972e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 49.03245) = 2.046972e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 49.03245) = 2.046972e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 49.03245) = 2.118565e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 49.03247) = 2.046971e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 49.03245) = 2.046972e-162 2000 rounds
| 4/9
23 h-m-p 1.1172 5.5858 12.0255
QuantileBeta(0.15, 0.00500, 59.02596) = 2.633690e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.40354) = 2.616809e-163 2000 rounds
CYCCC 757.223750 4 1.6528 411 | 4/9
24 h-m-p 0.6130 3.0650 15.4530 ++ 757.140644 m 3.0650 423 | 4/9
25 h-m-p 0.0000 0.0000 43.1289
h-m-p: 0.00000000e+00 0.00000000e+00 4.31289216e+01 757.140644
.. | 4/9
26 h-m-p 0.0001 0.0443 5.0248 YC 757.139857 1 0.0001 445 | 5/9
27 h-m-p 0.0002 0.0533 1.6932 ++CCC 757.133969 2 0.0044 463 | 5/9
28 h-m-p 0.4666 8.0000 0.0158 +++ 757.132379 m 8.0000 476 | 5/9
29 h-m-p 0.3337 8.0000 0.3793 ++YC 757.120513 1 4.4615 495 | 5/9
30 h-m-p 1.2475 8.0000 1.3566 ++ 756.952583 m 8.0000 511 | 5/9
31 h-m-p 0.0185 0.1003 585.4664 +YYYCCC 756.443459 5 0.0691 531 | 5/9
32 h-m-p 1.2878 6.4391 2.8425 CCCC 756.378163 3 1.3497 549 | 5/9
33 h-m-p 0.2786 3.5508 13.7686 YCCC 756.365169 3 0.1685 566 | 5/9
34 h-m-p 1.5574 7.7871 1.2953 YCCC 756.349568 3 0.9876 583 | 5/9
35 h-m-p 1.6000 8.0000 0.0720 YC 756.348061 1 0.8364 596 | 5/9
36 h-m-p 1.1745 8.0000 0.0513 +Y 756.347983 0 3.7141 613 | 5/9
37 h-m-p 1.6000 8.0000 0.0224 ++ 756.347131 m 8.0000 629 | 5/9
38 h-m-p 0.0160 8.0000 14.7022 +++YCCC 756.274887 3 2.3971 653 | 5/9
39 h-m-p 1.6000 8.0000 10.6805 +CCC 756.113803 2 6.4750 670 | 5/9
40 h-m-p 1.6000 8.0000 36.3863 YCCC 756.032191 3 2.6749 687 | 5/9
41 h-m-p 1.6000 8.0000 43.4826 CCCC 755.991622 3 1.8458 705 | 5/9
42 h-m-p 1.6000 8.0000 30.6287 YCCC 755.977356 3 3.0083 722 | 5/9
43 h-m-p 1.6000 8.0000 25.3794 CY 755.974517 1 1.4371 736 | 5/9
44 h-m-p 1.6000 8.0000 8.1753 CC 755.974055 1 2.3420 750 | 5/9
45 h-m-p 1.6000 8.0000 1.4487 +YC 755.973826 1 4.0737 764 | 5/9
46 h-m-p 0.8042 8.0000 7.3389 YC 755.973755 1 1.3569 777 | 5/9
47 h-m-p 1.6000 8.0000 0.2273 Y 755.973754 0 1.0354 789 | 5/9
48 h-m-p 1.6000 8.0000 0.0130 Y 755.973754 0 3.9524 805 | 5/9
49 h-m-p 0.4959 8.0000 0.1034 Y 755.973754 0 1.0955 821 | 5/9
50 h-m-p 1.6000 8.0000 0.0021 Y 755.973754 0 0.7998 837 | 5/9
51 h-m-p 1.6000 8.0000 0.0005 ---N 755.973754 0 0.0063 856
Out..
lnL = -755.973754
857 lfun, 10284 eigenQcodon, 37708 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -764.220015 S = -753.323294 -11.607686
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:45
did 20 / 49 patterns 0:46
did 30 / 49 patterns 0:46
did 40 / 49 patterns 0:46
did 49 / 49 patterns 0:46end of tree file.
Time used: 0:46
The loglikelihoods for models M1, M2, M7 and M8 are -762.328571 -755.973758 -762.330601 -755.973754 respectively
The loglikelihood for model M2a is significantly different from that for M1a. Twice the difference is 12.709626
The loglikelihood for model M8 is significantly different from that for M7. Twice the difference is 12.713694
CLUSTAL W (1.8) multiple sequence alignment (ALTER 1.3.3)
HKU2_GD_430_2006_nsp8_VIPR_P_148283140_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFDHEASVQKKIQ
HKU2_HK_298_2006_NA_VIPR_P_148283158_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFDHEASVQKKIQ
HKU2_HK_33_2006_NA_VIPR_P_148283167_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFDHEASVQKKIQ
HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFDHEASVQKKIQ
************************************************************
HKU2_GD_430_2006_nsp8_VIPR_P_148283140_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 RMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDMSSINQLMELAKDGCIPMAII
HKU2_HK_298_2006_NA_VIPR_P_148283158_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 RMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDMSSINQLMELAKDGCIPMAII
HKU2_HK_33_2006_NA_VIPR_P_148283167_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 RMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDMSSINQLMELAKDGCIPMAII
HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 RMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDMSSINQLMELAKDGCIPMAII
************************************************************
HKU2_GD_430_2006_nsp8_VIPR_P_148283140_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 PAAAATKLTVITPDLESFSKIRVDNNIYYAGAAWSITDVQDADGRVTILKEINADNKDAL
HKU2_HK_298_2006_NA_VIPR_P_148283158_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 PAAAATKLTVITPDLESFSKIRVDNNIYYAGAAWSITDVKDADGRVVILKEINADNKDAL
HKU2_HK_33_2006_NA_VIPR_P_148283167_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 PAAAATKLTVITPDLESFSKIRVDNNIYYAGAAWSITDVKDADGRVVILKEINADNKDAL
HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 PAAAATKLTVITPDLESFSKIRVDNNIYYAGAAWSITDVKDADGRVVILKEINADNKDAL
***************************************:******.*************
HKU2_GD_430_2006_nsp8_VIPR_P_148283140_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 VWPLHVTCERVVKLQ
HKU2_HK_298_2006_NA_VIPR_P_148283158_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 VWPLHVTCERVVKLQ
HKU2_HK_33_2006_NA_VIPR_P_148283167_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 VWPLHVTCERVVKLQ
HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 VWPLHVTCERVVKLQ
***************
>HKU2_GD_430_2006_nsp8_VIPR_P_148283140_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 AGTGTTGCATCTGCTTTTGCTAATATGCCTAGTTTTATTGCTTATGAGAAGGCTCGTATGAATTACGAGGATGCTATTGCTAATGATGCTGCTCCTGCTGTTGTTAAGCAGTTGAAGAAGGCTATGAATACTGCAAAGGGTGAGTTTGACCACGAGGCTTCAGTTCAGAAGAAGATTCAGCGTATGGCTGATGCGGCTGCAGCCCAGATGTATAAAGATGCTCGTGCTGTGGACCGTAAGTCTAAAGTTGTTAGTGCTATGCATTCACTGTTGTTTGGTATGCTTCGTAAGCTTGATATGTCTTCTATCAATCAGCTTATGGAACTTGCAAAAGACGGTTGCATACCTATGGCTATTATACCTGCTGCTGCAGCTACAAAACTTACAGTTATTACCCCTGATTTGGAGTCCTTTAGTAAAATACGTGTTGATAATAACATTTATTATGCTGGGGCTGCATGGAGTATTACTGATGTTCAAGATGCTGATGGCAGAGTTACCATTTTGAAGGAGATTAATGCTGACAACAAGGACGCTTTAGTTTGGCCATTACATGTCACCTGCGAGCGTGTTGTTAAACTCCAG >HKU2_HK_298_2006_NA_VIPR_P_148283158_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 AGTGTTGCATCTGCTTTTGCTAATATGCCTAGTTTTATTGCTTATGAGAAGGCTCGTATGAATTACGAGGATGCTATTGCTAATGATGCTGCTCCTGCTGTTGTTAAGCAGTTGAAGAAGGCTATGAATACTGCAAAGGGTGAGTTTGACCACGAGGCTTCAGTTCAGAAGAAGATTCAGCGTATGGCTGATGCGGCTGCAGCCCAGATGTATAAAGATGCTCGTGCTGTGGACCGTAAGTCTAAAGTTGTTAGTGCTATGCATTCACTGTTGTTTGGTATGCTTCGTAAGCTTGATATGTCTTCTATCAATCAGCTTATGGAACTTGCAAAAGACGGTTGCATACCTATGGCTATTATACCTGCTGCTGCAGCTACAAAACTTACAGTTATTACCCCTGATTTGGAGTCCTTTAGTAAAATACGTGTTGATAACAACATTTATTATGCTGGGGCTGCATGGAGTATTACTGATGTTAAAGATGCTGATGGCAGAGTTGTCATTTTGAAGGAGATTAATGCTGACAACAAGGACGCTTTAGTTTGGCCATTACATGTCACCTGCGAGCGTGTTGTTAAACTCCAG >HKU2_HK_33_2006_NA_VIPR_P_148283167_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 AGTGTTGCATCTGCTTTTGCTAATATGCCTAGTTTTATTGCTTATGAGAAGGCTCGTATGAATTACGAGGATGCTATTGCTAATGATGCTGCTCCTGCTGTTGTTAAGCAGTTGAAGAAGGCTATGAATACTGCAAAGGGTGAGTTTGACCACGAGGCTTCAGTTCAGAAGAAGATTCAGCGTATGGCTGATGCGGCTGCAGCCCAGATGTATAAAGATGCTCGTGCTGTGGACCGTAAGTCTAAAGTTGTTAGTGCTATGCATTCACTGTTGTTTGGTATGCTTCGTAAGCTTGATATGTCTTCTATCAATCAGCTTATGGAACTTGCAAAAGACGGTTGCATACCTATGGCTATTATACCTGCTGCTGCAGCTACAAAACTTACAGTTATTACCCCTGATTTGGAGTCCTTTAGTAAAATACGTGTTGATAACAACATTTATTATGCTGGGGCTGCATGGAGTATTACTGATGTTAAAGATGCTGATGGCAGAGTTGTCATTTTGAAGGAGATTAATGCTGACAACAAGGACGCTTTAGTTTGGCCATTACATGTCACCTGCGAGCGTGTTGTTAAACTCCAG >HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 AGTGTTGCATCTGCTTTTGCTAATATGCCTAGTTTTATTGCTTATGAGAAGGCTCGTATGAATTACGAGGATGCTATTGCTAATGATGCTGCTCCTGCTGTTGTTAAGCAGTTGAAGAAGGCTATGAATACTGCAAAGGGTGAGTTTGACCACGAGGCTTCAGTTCAGAAGAAGATTCAGCGTATGGCTGATGCGGCTGCAGCCCAGATGTATAAAGATGCTCGTGCTGTGGACCGTAAGTCTAAAGTTGTTAGTGCTATGCATTCACTGTTGTTTGGTATGCTTCGTAAGCTTGATATGTCTTCTATCAATCAGCTTATGGAACTTGCAAAAGACGGTTGCATACCTATGGCTATTATACCTGCTGCTGCAGCTACAAAACTTACAGTTATTACCCCTGATTTGGAGTCCTTTAGTAAAATACGTGTTGATAACAACATTTATTATGCTGGGGCTGCATGGAGTATTACTGATGTTAAAGATGCTGATGGCAGAGTTGTCATTTTGAAGGAGATTAATGCTGACAACAAGGACGCTTTAGTTTGGCCATTACATGTCACCTGCGAGCGTGTTGTTAAACTCCAG
>HKU2_GD_430_2006_nsp8_VIPR_P_148283140_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFDHEASVQKKIQRMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDMSSINQLMELAKDGCIPMAIIPAAAATKLTVITPDLESFSKIRVDNNIYYAGAAWSITDVQDADGRVTILKEINADNKDALVWPLHVTCERVVKLQ >HKU2_HK_298_2006_NA_VIPR_P_148283158_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFDHEASVQKKIQRMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDMSSINQLMELAKDGCIPMAIIPAAAATKLTVITPDLESFSKIRVDNNIYYAGAAWSITDVKDADGRVVILKEINADNKDALVWPLHVTCERVVKLQ >HKU2_HK_33_2006_NA_VIPR_P_148283167_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFDHEASVQKKIQRMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDMSSINQLMELAKDGCIPMAIIPAAAATKLTVITPDLESFSKIRVDNNIYYAGAAWSITDVKDADGRVVILKEINADNKDALVWPLHVTCERVVKLQ >HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SVASAFANMPSFIAYEKARMNYEDAIANDAAPAVVKQLKKAMNTAKGEFDHEASVQKKIQRMADAAAAQMYKDARAVDRKSKVVSAMHSLLFGMLRKLDMSSINQLMELAKDGCIPMAIIPAAAATKLTVITPDLESFSKIRVDNNIYYAGAAWSITDVKDADGRVVILKEINADNKDALVWPLHVTCERVVKLQ
Reading sequence file /data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/codeml/fasta/HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1 Found 4 sequences of length 585 Alignment looks like a valid DNA alignment. Estimated diversity is (pairwise deletion - ignoring missing/ambig): 0.3% Found 0 informative sites. Writing alignment of informative sites to: Phi.inf.sites Writing list of informative sites to: Phi.inf.list Calculating all pairwise incompatibilities... 100.0% Using a window size of 80 with k as 1 Too few informative sites to use normal approximation. Try doing a permutation test or increasing alignment length Can also try decreasing windowsize.
#NEXUS
[ID: 8550805031]
begin taxa;
dimensions ntax=4;
taxlabels
HKU2_GD_430_2006_nsp8_VIPR_P_148283140_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
HKU2_HK_298_2006_NA_VIPR_P_148283158_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
HKU2_HK_33_2006_NA_VIPR_P_148283167_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
;
end;
begin trees;
translate
1 HKU2_GD_430_2006_nsp8_VIPR_P_148283140_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2,
2 HKU2_HK_298_2006_NA_VIPR_P_148283158_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2,
3 HKU2_HK_33_2006_NA_VIPR_P_148283167_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2,
4 HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:4.574992e-03,2:6.463886e-04,3:6.760633e-04,4:6.375832e-04);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:4.574992e-03,2:6.463886e-04,3:6.760633e-04,4:6.375832e-04);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -828.02 -836.79
2 -828.08 -836.92
--------------------------------------
TOTAL -828.05 -836.86
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.056682 0.524639 0.001752 0.019659 0.008434 1501.00 1501.00 1.000
r(A<->C){all} 0.209159 0.017518 0.010657 0.462985 0.184038 103.13 136.57 1.000
r(A<->G){all} 0.184908 0.014318 0.005072 0.420270 0.161020 165.63 167.20 1.010
r(A<->T){all} 0.086217 0.007363 0.000002 0.269374 0.058445 214.90 224.15 1.000
r(C<->G){all} 0.112863 0.010153 0.000062 0.322966 0.084870 248.38 268.36 1.002
r(C<->T){all} 0.311954 0.021072 0.065160 0.600749 0.292497 102.49 111.83 1.005
r(G<->T){all} 0.094900 0.007322 0.000045 0.259979 0.072133 210.82 252.89 1.003
pi(A){all} 0.258678 0.000309 0.223364 0.292093 0.258806 1110.52 1213.97 1.002
pi(C){all} 0.176181 0.000231 0.148628 0.207398 0.175812 1149.56 1276.52 1.000
pi(G){all} 0.242962 0.000308 0.208930 0.277794 0.242547 1231.96 1241.04 1.001
pi(T){all} 0.322179 0.000351 0.286509 0.358659 0.322099 973.18 1044.17 1.000
alpha{1,2} 0.975215 0.886799 0.000586 2.853342 0.695292 934.69 1101.74 1.000
alpha{3} 1.005310 1.041265 0.000148 3.072599 0.694297 1198.74 1241.19 1.001
pinvar{all} 0.527105 0.084223 0.051099 0.987119 0.541623 414.91 533.03 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/HKU2_HK_46_2006_NA_VIPR_P_148283149_11109_11693_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 4 ls = 195
Codon usage in sequences
------------------------------------------------------------------------------------------------------
Phe TTT 5 5 5 5 | Ser TCT 4 4 4 4 | Tyr TAT 4 4 4 4 | Cys TGT 0 0 0 0
TTC 0 0 0 0 | TCC 1 1 1 1 | TAC 1 1 1 1 | TGC 2 2 2 2
Leu TTA 2 2 2 2 | TCA 2 2 2 2 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 4 4 4 4 | TCG 0 0 0 0 | TAG 0 0 0 0 | Trp TGG 2 2 2 2
------------------------------------------------------------------------------------------------------
Leu CTT 5 5 5 5 | Pro CCT 5 5 5 5 | His CAT 2 2 2 2 | Arg CGT 7 7 7 7
CTC 1 1 1 1 | CCC 0 0 0 0 | CAC 1 1 1 1 | CGC 0 0 0 0
CTA 0 0 0 0 | CCA 1 1 1 1 | Gln CAA 1 0 0 0 | CGA 0 0 0 0
CTG 1 1 1 1 | CCG 0 0 0 0 | CAG 6 6 6 6 | CGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Ile ATT 9 9 9 9 | Thr ACT 2 2 2 2 | Asn AAT 7 6 6 6 | Ser AGT 5 5 5 5
ATC 1 1 1 1 | ACC 3 2 2 2 | AAC 2 3 3 3 | AGC 0 0 0 0
ATA 3 3 3 3 | ACA 2 2 2 2 | Lys AAA 6 7 7 7 | Arg AGA 1 1 1 1
Met ATG 10 10 10 10 | ACG 0 0 0 0 | AAG 11 11 11 11 | AGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Val GTT 13 13 13 13 | Ala GCT 25 25 25 25 | Asp GAT 10 10 10 10 | Gly GGT 3 3 3 3
GTC 1 2 2 2 | GCC 1 1 1 1 | GAC 5 5 5 5 | GGC 1 1 1 1
GTA 0 0 0 0 | GCA 6 6 6 6 | Glu GAA 1 1 1 1 | GGA 0 0 0 0
GTG 1 1 1 1 | GCG 1 1 1 1 | GAG 7 7 7 7 | GGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C1
position 1: T:0.13846 C:0.15385 A:0.31795 G:0.38974
position 2: T:0.28718 C:0.27179 A:0.32821 G:0.11282
position 3: T:0.54359 C:0.10256 A:0.12821 G:0.22564
Average T:0.32308 C:0.17607 A:0.25812 G:0.24274
#2: C2
position 1: T:0.13846 C:0.14872 A:0.31795 G:0.39487
position 2: T:0.29231 C:0.26667 A:0.32821 G:0.11282
position 3: T:0.53846 C:0.10769 A:0.12821 G:0.22564
Average T:0.32308 C:0.17436 A:0.25812 G:0.24444
#3: C3
position 1: T:0.13846 C:0.14872 A:0.31795 G:0.39487
position 2: T:0.29231 C:0.26667 A:0.32821 G:0.11282
position 3: T:0.53846 C:0.10769 A:0.12821 G:0.22564
Average T:0.32308 C:0.17436 A:0.25812 G:0.24444
#4: C4
position 1: T:0.13846 C:0.14872 A:0.31795 G:0.39487
position 2: T:0.29231 C:0.26667 A:0.32821 G:0.11282
position 3: T:0.53846 C:0.10769 A:0.12821 G:0.22564
Average T:0.32308 C:0.17436 A:0.25812 G:0.24444
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 20 | Ser S TCT 16 | Tyr Y TAT 16 | Cys C TGT 0
TTC 0 | TCC 4 | TAC 4 | TGC 8
Leu L TTA 8 | TCA 8 | *** * TAA 0 | *** * TGA 0
TTG 16 | TCG 0 | TAG 0 | Trp W TGG 8
------------------------------------------------------------------------------
Leu L CTT 20 | Pro P CCT 20 | His H CAT 8 | Arg R CGT 28
CTC 4 | CCC 0 | CAC 4 | CGC 0
CTA 0 | CCA 4 | Gln Q CAA 1 | CGA 0
CTG 4 | CCG 0 | CAG 24 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 36 | Thr T ACT 8 | Asn N AAT 25 | Ser S AGT 20
ATC 4 | ACC 9 | AAC 11 | AGC 0
ATA 12 | ACA 8 | Lys K AAA 27 | Arg R AGA 4
Met M ATG 40 | ACG 0 | AAG 44 | AGG 0
------------------------------------------------------------------------------
Val V GTT 52 | Ala A GCT 100 | Asp D GAT 40 | Gly G GGT 12
GTC 7 | GCC 4 | GAC 20 | GGC 4
GTA 0 | GCA 24 | Glu E GAA 4 | GGA 0
GTG 4 | GCG 4 | GAG 28 | GGG 4
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13846 C:0.15000 A:0.31795 G:0.39359
position 2: T:0.29103 C:0.26795 A:0.32821 G:0.11282
position 3: T:0.53974 C:0.10641 A:0.12821 G:0.22564
Average T:0.32308 C:0.17479 A:0.25812 G:0.24402
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4); MP score: 3
lnL(ntime: 4 np: 7): -762.328571 +0.000000
5..1 5..2 5..3 5..4
0.021919 0.000004 0.000004 0.000004 4.830182 0.787020 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.021931
(1: 0.021919, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(C1: 0.021919, C2: 0.000004, C3: 0.000004, C4: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 4.83018
MLEs of dN/dS (w) for site classes (K=2)
p: 0.78702 0.21298
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.022 476.5 108.5 0.2130 0.0043 0.0204 2.1 2.2
5..2 0.000 476.5 108.5 0.2130 0.0000 0.0000 0.0 0.0
5..3 0.000 476.5 108.5 0.2130 0.0000 0.0000 0.0 0.0
5..4 0.000 476.5 108.5 0.2130 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4); MP score: 3
lnL(ntime: 4 np: 9): -755.973758 +0.000000
5..1 5..2 5..3 5..4
0.151892 0.000004 0.000004 0.000004 25.832456 0.987833 0.000000 0.000001 557.928269
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.151904
(1: 0.151892, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(C1: 0.151892, C2: 0.000004, C3: 0.000004, C4: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 25.83246
MLEs of dN/dS (w) for site classes (K=3)
p: 0.98783 0.00000 0.01217
w: 0.00000 1.00000 557.92827
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.152 469.7 115.3 6.7884 0.0609 0.0090 28.6 1.0
5..2 0.000 469.7 115.3 6.7884 0.0000 0.0000 0.0 0.0
5..3 0.000 469.7 115.3 6.7884 0.0000 0.0000 0.0 0.0
5..4 0.000 469.7 115.3 6.7884 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
160 Q 1.000** 557.928
167 T 1.000** 557.928
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
167 T 0.798 5.250 +- 3.368
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.178 0.152 0.130 0.112 0.097 0.084 0.074 0.065 0.057 0.051
w2: 0.119 0.104 0.096 0.093 0.092 0.093 0.096 0.099 0.102 0.106
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.015
0.008 0.014 0.017
0.004 0.006 0.009 0.016 0.020
0.002 0.003 0.004 0.007 0.011 0.019 0.023
0.002 0.002 0.003 0.004 0.005 0.009 0.013 0.023 0.026
0.001 0.001 0.002 0.002 0.003 0.004 0.006 0.010 0.015 0.026 0.030
0.001 0.001 0.001 0.002 0.002 0.003 0.004 0.005 0.007 0.012 0.018 0.031 0.034
0.001 0.001 0.001 0.001 0.002 0.002 0.002 0.003 0.004 0.006 0.009 0.015 0.022 0.037 0.038
0.001 0.001 0.001 0.001 0.001 0.002 0.002 0.002 0.003 0.004 0.005 0.007 0.010 0.018 0.027 0.043 0.042
0.001 0.001 0.001 0.001 0.001 0.001 0.001 0.002 0.002 0.003 0.003 0.005 0.006 0.009 0.012 0.021 0.032 0.050 0.046
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4); MP score: 3
lnL(ntime: 4 np: 7): -762.330601 +0.000000
5..1 5..2 5..3 5..4
0.021951 0.000004 0.000004 0.000004 4.788681 0.005000 0.020225
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.021963
(1: 0.021951, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(C1: 0.021951, C2: 0.000004, C3: 0.000004, C4: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 4.78868
Parameters in M7 (beta):
p = 0.00500 q = 0.02023
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.022 476.6 108.4 0.2000 0.0042 0.0210 2.0 2.3
5..2 0.000 476.6 108.4 0.2000 0.0000 0.0000 0.0 0.0
5..3 0.000 476.6 108.4 0.2000 0.0000 0.0000 0.0 0.0
5..4 0.000 476.6 108.4 0.2000 0.0000 0.0000 0.0 0.0
Time used: 0:14
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4); MP score: 3
lnL(ntime: 4 np: 9): -755.973754 +0.000000
5..1 5..2 5..3 5..4
0.151897 0.000004 0.000004 0.000004 25.832495 0.987832 0.005000 99.000000 557.921470
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.151909
(1: 0.151897, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(C1: 0.151897, C2: 0.000004, C3: 0.000004, C4: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 25.83249
Parameters in M8 (beta&w>1):
p0 = 0.98783 p = 0.00500 q = 99.00000
(p1 = 0.01217) w = 557.92147
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09878 0.09878 0.09878 0.09878 0.09878 0.09878 0.09878 0.09878 0.09878 0.09878 0.01217
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 557.92147
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.152 469.7 115.3 6.7886 0.0609 0.0090 28.6 1.0
5..2 0.000 469.7 115.3 6.7886 0.0000 0.0000 0.0 0.0
5..3 0.000 469.7 115.3 6.7886 0.0000 0.0000 0.0 0.0
5..4 0.000 469.7 115.3 6.7886 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
160 Q 1.000** 557.921
167 T 1.000** 557.921
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
160 Q 0.631 4.046 +- 3.538
167 T 0.897 5.644 +- 3.241
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.005 0.007 0.010 0.014 0.020 0.031 0.051 0.102 0.255 0.504
p : 0.186 0.144 0.119 0.103 0.091 0.082 0.076 0.070 0.066 0.063
q : 0.046 0.065 0.079 0.091 0.101 0.110 0.117 0.124 0.130 0.136
ws: 0.122 0.100 0.092 0.090 0.090 0.093 0.096 0.101 0.105 0.111
Time used: 0:46
Model 1: NearlyNeutral -762.328571
Model 2: PositiveSelection -755.973758
Model 7: beta -762.330601
Model 8: beta&w>1 -755.973754
Model 2 vs 1 12.709626
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
160 Q 1.000** 557.928
167 T 1.000** 557.928
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
167 T 0.798 5.250 +- 3.368
Model 8 vs 7 12.713694
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
160 Q 1.000** 557.921
167 T 1.000** 557.921
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
160 Q 0.631 4.046 +- 3.538
167 T 0.897 5.644 +- 3.241
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken. # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
