--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken.
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -522.96 -531.20
2 -522.93 -529.51
--------------------------------------
TOTAL -522.95 -530.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.067129 0.005479 0.020404 0.156036 0.052374 803.10 930.81 1.000
r(A<->C){all} 0.077425 0.005248 0.000116 0.213177 0.057067 333.77 478.53 1.009
r(A<->G){all} 0.237039 0.012814 0.027209 0.454012 0.226231 298.20 425.25 1.001
r(A<->T){all} 0.137357 0.007187 0.002153 0.300616 0.121676 325.09 377.46 1.005
r(C<->G){all} 0.070768 0.004301 0.000009 0.194659 0.054487 537.33 539.33 1.000
r(C<->T){all} 0.312634 0.013815 0.094085 0.535790 0.301517 459.99 461.76 1.000
r(G<->T){all} 0.164777 0.007820 0.011285 0.332747 0.154379 227.99 339.48 1.000
pi(A){all} 0.214226 0.000470 0.172139 0.256951 0.213774 1356.39 1377.09 1.000
pi(C){all} 0.203237 0.000456 0.161211 0.244329 0.202569 1336.73 1370.13 1.000
pi(G){all} 0.241667 0.000532 0.199794 0.289365 0.241808 1282.90 1315.82 1.000
pi(T){all} 0.340870 0.000629 0.290643 0.386766 0.340811 1360.98 1396.75 1.000
alpha{1,2} 0.677870 0.736841 0.000397 2.434321 0.350909 1126.88 1188.02 1.000
alpha{3} 1.378713 1.270098 0.000417 3.607951 1.079052 1038.91 1057.73 1.000
pinvar{all} 0.501948 0.072726 0.029839 0.903398 0.531543 267.26 505.28 1.004
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
Model 1: NearlyNeutral -496.263851
Model 2: PositiveSelection -494.638704
Model 7: beta -496.370827
Model 8: beta&w>1 -494.640550
Model 2 vs 1 3.250294
Model 8 vs 7 3.460554
-- Starting log on Fri Oct 21 22:38:34 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=110
C1 MSINQLTLAVASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVASGLQ
C2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
C3 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
C4 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
*********:************************************ ***
C1 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLEE
C2 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
C3 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
C4 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
************************************************:*
C1 FHVIFGKRGG
C2 FQVIFGKRGG
C3 FQVIFGKRGG
C4 FQVIFGKRGG
*:********
-- Starting log on Fri Oct 21 22:39:15 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=110
C1 MSINQLTLAVASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVASGLQ
C2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
C3 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
C4 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
*********:************************************ ***
C1 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLEE
C2 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
C3 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
C4 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
************************************************:*
C1 FHVIFGKRGG
C2 FQVIFGKRGG
C3 FQVIFGKRGG
C4 FQVIFGKRGG
*:********
-- Starting log on Fri Oct 21 22:53:02 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/gapped_alignment/codeml,HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 330 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666392784
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1077112897
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8942909580
Seed = 667459073
Swapseed = 1666392784
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.00 % Dirichlet(Revmat{all})
1.00 % Slider(Revmat{all})
1.00 % Dirichlet(Pi{all})
1.00 % Slider(Pi{all})
2.00 % Multiplier(Alpha{1,2})
2.00 % Multiplier(Alpha{3})
2.00 % Slider(Pinvar{all})
10.00 % ExtSPR(Tau{all},V{all})
10.00 % NNI(Tau{all},V{all})
10.00 % ParsSPR(Tau{all},V{all})
40.00 % Multiplier(V{all})
14.00 % Nodeslider(V{all})
6.00 % TLMultiplier(V{all})
Division 1 has 6 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 10 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -554.909649 -- 13.556448
Chain 2 -- -554.909649 -- 13.556448
Chain 3 -- -554.909649 -- 13.556448
Chain 4 -- -554.909649 -- 13.556448
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -554.909649 -- 13.556448
Chain 2 -- -554.909649 -- 13.556448
Chain 3 -- -554.909649 -- 13.556448
Chain 4 -- -554.909649 -- 13.556448
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-554.910] (-554.910) (-554.910) (-554.910) * [-554.910] (-554.910) (-554.910) (-554.910)
1000 -- (-535.383) [-523.118] (-525.542) (-527.910) * (-526.158) [-527.345] (-528.195) (-528.724) -- 0:00:00
2000 -- (-525.042) [-524.272] (-526.055) (-528.821) * [-524.474] (-524.282) (-537.303) (-526.853) -- 0:00:00
3000 -- (-526.604) [-529.581] (-533.957) (-528.526) * [-526.917] (-530.093) (-531.804) (-529.257) -- 0:00:00
4000 -- (-523.656) (-529.612) (-527.989) [-529.949] * (-526.818) (-527.625) [-525.043] (-527.143) -- 0:00:00
5000 -- (-525.463) (-526.174) (-529.950) [-523.038] * (-526.445) [-530.472] (-529.455) (-525.195) -- 0:00:00
Average standard deviation of split frequencies: 0.209513
6000 -- [-522.020] (-530.878) (-524.219) (-525.753) * (-521.671) (-526.129) (-524.477) [-526.829] -- 0:00:00
7000 -- [-528.833] (-526.094) (-524.604) (-526.268) * (-527.925) (-524.844) [-523.319] (-523.186) -- 0:00:00
8000 -- (-525.994) [-525.262] (-527.182) (-524.165) * (-526.386) [-527.267] (-523.449) (-525.274) -- 0:02:04
9000 -- (-521.968) (-526.349) [-525.741] (-522.835) * (-532.861) [-521.990] (-529.203) (-521.938) -- 0:01:50
10000 -- (-524.745) (-525.599) (-527.023) [-524.696] * (-525.371) [-527.882] (-523.801) (-524.551) -- 0:01:39
Average standard deviation of split frequencies: 0.029463
11000 -- (-529.703) (-524.697) (-521.241) [-522.154] * (-530.788) (-525.478) [-525.701] (-524.031) -- 0:01:29
12000 -- (-530.325) (-528.681) [-525.404] (-523.174) * [-521.820] (-525.581) (-530.861) (-523.700) -- 0:01:22
13000 -- (-530.663) (-530.366) (-525.236) [-525.255] * [-523.558] (-527.078) (-522.232) (-527.918) -- 0:01:15
14000 -- (-528.015) (-522.644) (-522.966) [-526.067] * (-523.062) [-527.237] (-522.719) (-524.182) -- 0:01:10
15000 -- [-528.790] (-529.979) (-522.515) (-529.641) * (-524.809) (-524.714) (-523.963) [-526.221] -- 0:01:05
Average standard deviation of split frequencies: 0.117851
16000 -- (-525.913) (-526.904) [-522.886] (-526.366) * (-526.649) (-525.975) [-523.989] (-526.433) -- 0:01:01
17000 -- [-529.641] (-526.257) (-521.908) (-525.806) * (-522.655) [-525.773] (-525.015) (-524.673) -- 0:00:57
18000 -- (-523.975) (-525.351) [-524.740] (-524.517) * (-523.407) (-526.332) (-522.787) [-522.938] -- 0:01:49
19000 -- (-532.495) (-524.963) [-525.534] (-525.280) * (-525.450) (-524.350) [-523.317] (-524.200) -- 0:01:43
20000 -- (-525.483) (-522.787) (-523.591) [-524.887] * (-523.080) (-528.330) [-520.425] (-525.425) -- 0:01:38
Average standard deviation of split frequencies: 0.121653
21000 -- (-525.392) (-524.621) (-526.944) [-527.114] * (-530.596) (-528.326) [-525.087] (-522.347) -- 0:01:33
22000 -- (-522.390) (-523.354) [-524.596] (-525.529) * (-524.515) (-529.146) [-522.777] (-522.754) -- 0:01:28
23000 -- (-527.443) [-522.168] (-525.253) (-526.533) * [-526.279] (-524.416) (-524.039) (-525.381) -- 0:01:24
24000 -- [-525.584] (-527.949) (-526.855) (-527.330) * (-526.062) (-527.400) (-525.784) [-521.734] -- 0:01:21
25000 -- [-524.612] (-523.532) (-523.930) (-522.494) * (-523.136) [-524.117] (-527.493) (-523.155) -- 0:01:18
Average standard deviation of split frequencies: 0.108786
26000 -- [-529.889] (-529.907) (-529.424) (-525.585) * (-528.793) (-524.627) (-529.374) [-524.491] -- 0:01:14
27000 -- [-524.576] (-527.684) (-533.321) (-529.667) * (-527.298) (-524.223) (-527.301) [-524.723] -- 0:01:12
28000 -- (-524.883) (-528.080) [-524.542] (-528.729) * (-529.100) [-526.478] (-529.181) (-526.013) -- 0:01:44
29000 -- [-526.784] (-528.141) (-525.520) (-526.581) * (-524.303) (-525.007) (-525.240) [-528.415] -- 0:01:40
30000 -- [-526.381] (-529.328) (-524.451) (-527.043) * (-524.922) (-526.242) [-526.279] (-531.827) -- 0:01:37
Average standard deviation of split frequencies: 0.071735
31000 -- (-522.700) (-526.840) (-523.923) [-523.117] * (-527.951) (-525.072) [-524.471] (-525.458) -- 0:01:33
32000 -- (-522.797) (-537.179) [-527.435] (-526.779) * (-524.228) (-525.048) (-525.864) [-526.791] -- 0:01:30
33000 -- (-522.271) [-531.503] (-524.957) (-521.349) * [-522.623] (-526.010) (-525.289) (-525.314) -- 0:01:27
34000 -- (-518.287) (-524.645) [-524.040] (-524.061) * (-527.291) (-529.577) (-531.357) [-527.311] -- 0:01:25
35000 -- (-519.419) (-530.338) [-526.070] (-522.038) * [-525.187] (-529.222) (-528.379) (-526.904) -- 0:01:22
Average standard deviation of split frequencies: 0.069838
36000 -- (-531.528) (-526.269) (-528.847) [-523.752] * (-524.707) (-522.655) [-525.916] (-529.491) -- 0:01:20
37000 -- [-521.510] (-522.449) (-527.744) (-525.288) * [-524.604] (-532.506) (-528.044) (-524.907) -- 0:01:18
38000 -- [-523.806] (-523.081) (-528.113) (-524.434) * (-520.670) (-528.113) (-525.924) [-528.320] -- 0:01:41
39000 -- (-525.967) (-534.757) (-523.393) [-526.129] * (-527.463) (-531.513) (-529.448) [-524.563] -- 0:01:38
40000 -- (-526.422) [-529.515] (-530.392) (-524.000) * (-523.360) (-529.300) (-527.386) [-528.785] -- 0:01:36
Average standard deviation of split frequencies: 0.030912
41000 -- (-525.782) [-526.666] (-526.823) (-532.411) * (-523.186) (-525.689) [-527.227] (-527.672) -- 0:01:33
42000 -- [-528.245] (-527.843) (-527.601) (-525.067) * [-527.684] (-530.256) (-525.748) (-523.444) -- 0:01:31
43000 -- [-522.314] (-529.195) (-520.538) (-527.406) * [-522.165] (-524.097) (-523.875) (-529.558) -- 0:01:29
44000 -- [-522.351] (-526.235) (-525.077) (-525.204) * (-523.820) (-525.345) [-528.419] (-525.549) -- 0:01:26
45000 -- (-522.978) (-527.817) [-522.109] (-523.262) * (-522.334) [-535.440] (-526.952) (-525.829) -- 0:01:24
Average standard deviation of split frequencies: 0.006832
46000 -- (-522.763) (-526.397) (-525.102) [-528.113] * (-522.598) [-527.345] (-529.123) (-528.360) -- 0:01:22
47000 -- (-529.569) [-524.155] (-526.688) (-524.439) * (-527.771) (-531.145) (-525.623) [-530.250] -- 0:01:21
48000 -- (-530.687) (-521.819) [-524.155] (-523.748) * (-521.554) (-525.966) (-530.142) [-525.762] -- 0:01:39
49000 -- (-525.920) (-523.779) [-524.768] (-530.081) * [-523.137] (-523.184) (-526.793) (-528.060) -- 0:01:37
50000 -- [-523.278] (-527.779) (-523.784) (-526.356) * (-525.456) (-526.471) [-525.936] (-528.371) -- 0:01:35
Average standard deviation of split frequencies: 0.018608
51000 -- [-524.592] (-525.367) (-523.210) (-522.475) * (-525.151) (-528.553) (-527.416) [-529.191] -- 0:01:33
52000 -- (-522.584) (-531.273) (-523.290) [-524.712] * [-527.882] (-525.798) (-525.996) (-538.324) -- 0:01:31
53000 -- [-523.462] (-532.277) (-524.473) (-523.612) * [-527.033] (-524.343) (-529.216) (-531.564) -- 0:01:29
54000 -- [-523.483] (-531.860) (-522.039) (-525.858) * (-526.855) [-524.738] (-528.596) (-531.400) -- 0:01:27
55000 -- (-527.687) (-525.352) [-522.965] (-524.733) * [-525.783] (-523.531) (-521.343) (-531.719) -- 0:01:25
Average standard deviation of split frequencies: 0.022448
56000 -- [-524.467] (-527.760) (-526.718) (-525.277) * (-526.209) [-524.957] (-520.333) (-529.176) -- 0:01:24
57000 -- [-523.517] (-530.110) (-528.626) (-524.865) * [-527.384] (-522.686) (-521.350) (-529.443) -- 0:01:39
58000 -- [-525.199] (-529.017) (-529.196) (-526.811) * (-526.469) [-526.829] (-522.274) (-530.246) -- 0:01:37
59000 -- [-524.191] (-526.068) (-525.180) (-526.989) * (-526.650) [-525.671] (-522.484) (-525.538) -- 0:01:35
60000 -- (-523.952) [-526.147] (-524.975) (-526.839) * (-531.911) (-524.643) [-524.956] (-524.168) -- 0:01:34
Average standard deviation of split frequencies: 0.025901
61000 -- (-527.338) (-529.337) [-530.221] (-524.066) * [-529.302] (-527.445) (-526.179) (-529.840) -- 0:01:32
62000 -- (-528.460) (-525.454) [-525.213] (-526.572) * [-528.738] (-530.336) (-524.683) (-529.297) -- 0:01:30
63000 -- (-523.948) (-522.842) [-524.870] (-527.865) * (-528.140) (-528.388) [-522.988] (-526.687) -- 0:01:29
64000 -- (-523.254) (-524.986) (-529.019) [-525.089] * [-524.114] (-525.551) (-524.336) (-523.687) -- 0:01:27
65000 -- (-533.457) [-521.949] (-526.020) (-531.941) * (-523.399) (-526.081) (-524.003) [-523.547] -- 0:01:26
Average standard deviation of split frequencies: 0.014285
66000 -- [-529.169] (-528.052) (-527.187) (-530.634) * (-525.196) [-524.444] (-526.226) (-526.305) -- 0:01:24
67000 -- [-527.536] (-525.490) (-520.240) (-522.978) * (-534.225) (-522.759) [-527.000] (-526.375) -- 0:01:37
68000 -- (-527.641) (-524.648) (-525.002) [-526.878] * (-523.994) [-525.906] (-533.406) (-526.191) -- 0:01:35
69000 -- (-531.296) [-522.566] (-532.141) (-524.342) * [-525.837] (-527.839) (-525.508) (-524.028) -- 0:01:34
70000 -- (-529.404) (-527.573) (-524.429) [-529.527] * (-523.294) [-524.139] (-523.066) (-524.019) -- 0:01:33
Average standard deviation of split frequencies: 0.022236
71000 -- (-535.700) (-527.862) [-523.167] (-527.561) * (-524.985) (-531.837) (-527.316) [-523.997] -- 0:01:31
72000 -- (-530.958) [-528.608] (-520.346) (-532.118) * [-523.040] (-524.871) (-522.402) (-523.366) -- 0:01:30
73000 -- (-534.874) [-524.423] (-522.095) (-531.643) * [-524.982] (-528.810) (-526.908) (-525.605) -- 0:01:28
74000 -- (-532.643) (-523.699) [-524.450] (-535.432) * (-526.830) (-535.136) (-525.012) [-531.897] -- 0:01:27
75000 -- (-530.266) [-521.275] (-523.974) (-528.021) * (-527.855) (-528.458) [-526.984] (-525.977) -- 0:01:26
Average standard deviation of split frequencies: 0.016541
76000 -- (-527.322) (-521.465) [-525.468] (-529.606) * [-522.245] (-529.631) (-524.351) (-520.968) -- 0:01:25
77000 -- [-530.875] (-523.214) (-524.071) (-533.563) * (-522.289) (-532.834) (-524.081) [-520.764] -- 0:01:35
78000 -- (-532.023) (-521.403) [-522.043] (-524.977) * (-527.470) (-531.766) [-523.415] (-521.731) -- 0:01:34
79000 -- (-530.599) [-524.071] (-524.652) (-529.701) * (-525.552) (-526.254) [-523.547] (-522.284) -- 0:01:33
80000 -- [-528.413] (-526.813) (-530.845) (-526.583) * (-524.443) (-526.635) (-525.244) [-523.773] -- 0:01:32
Average standard deviation of split frequencies: 0.015584
81000 -- (-528.497) (-526.469) [-524.825] (-527.117) * [-524.559] (-526.209) (-527.750) (-523.489) -- 0:01:30
82000 -- [-526.820] (-528.758) (-528.024) (-534.280) * (-525.210) (-520.634) (-527.775) [-522.374] -- 0:01:29
83000 -- (-525.319) [-522.911] (-525.013) (-521.007) * (-523.094) (-523.448) [-527.892] (-529.806) -- 0:01:28
84000 -- (-534.568) (-523.985) [-533.630] (-522.458) * [-527.222] (-523.906) (-525.423) (-529.200) -- 0:01:27
85000 -- (-526.888) (-521.825) [-527.583] (-523.971) * (-525.139) [-524.021] (-527.386) (-528.856) -- 0:01:26
Average standard deviation of split frequencies: 0.014617
86000 -- (-526.153) (-524.192) [-524.060] (-528.338) * [-536.695] (-525.256) (-526.722) (-529.740) -- 0:01:35
87000 -- (-529.624) (-525.674) [-525.309] (-523.331) * [-523.613] (-522.962) (-530.220) (-524.392) -- 0:01:34
88000 -- [-524.535] (-527.243) (-532.059) (-526.879) * (-527.530) [-519.837] (-525.738) (-532.683) -- 0:01:33
89000 -- [-524.176] (-523.881) (-524.155) (-525.618) * (-525.585) (-521.940) (-523.862) [-523.298] -- 0:01:32
90000 -- (-529.924) [-522.418] (-524.672) (-524.422) * (-522.825) (-523.791) [-528.457] (-523.427) -- 0:01:31
Average standard deviation of split frequencies: 0.010399
91000 -- (-528.374) (-521.321) [-520.334] (-532.359) * [-528.404] (-521.262) (-521.668) (-524.610) -- 0:01:29
92000 -- (-528.399) (-526.465) (-524.716) [-527.418] * (-524.295) (-522.236) [-526.356] (-522.853) -- 0:01:28
93000 -- (-528.347) (-526.843) [-524.394] (-523.789) * [-524.974] (-523.283) (-540.253) (-524.568) -- 0:01:27
94000 -- [-525.447] (-523.835) (-523.930) (-526.531) * (-529.700) (-526.358) [-524.437] (-527.646) -- 0:01:26
95000 -- (-523.200) [-522.241] (-525.866) (-525.835) * (-526.954) (-528.719) (-529.182) [-523.406] -- 0:01:25
Average standard deviation of split frequencies: 0.026189
96000 -- (-523.394) (-527.983) [-527.728] (-528.278) * (-526.046) [-527.775] (-524.339) (-528.833) -- 0:01:34
97000 -- (-522.205) [-522.260] (-526.295) (-526.747) * [-524.074] (-530.209) (-525.575) (-524.333) -- 0:01:33
98000 -- (-525.135) [-523.210] (-524.667) (-526.824) * (-523.357) (-525.673) (-520.734) [-524.454] -- 0:01:32
99000 -- (-524.487) (-520.972) (-526.469) [-522.304] * (-526.292) [-525.582] (-525.946) (-528.037) -- 0:01:31
100000 -- (-527.594) [-526.151] (-524.696) (-524.563) * (-521.834) [-525.164] (-523.312) (-525.058) -- 0:01:30
Average standard deviation of split frequencies: 0.028097
101000 -- [-524.021] (-523.235) (-525.081) (-529.269) * [-523.184] (-522.594) (-533.864) (-525.152) -- 0:01:29
102000 -- (-524.342) (-524.527) (-527.126) [-526.159] * (-524.415) (-523.464) (-530.285) [-527.077] -- 0:01:28
103000 -- (-521.542) [-522.579] (-522.032) (-526.719) * [-522.277] (-526.747) (-529.609) (-529.416) -- 0:01:27
104000 -- (-527.067) (-524.902) (-534.903) [-526.108] * (-528.184) (-527.769) [-526.216] (-529.583) -- 0:01:26
105000 -- (-521.739) [-521.683] (-521.887) (-529.433) * (-527.772) [-520.659] (-521.825) (-528.828) -- 0:01:25
Average standard deviation of split frequencies: 0.035578
106000 -- (-525.466) [-530.079] (-523.404) (-523.383) * [-522.927] (-528.146) (-521.780) (-530.745) -- 0:01:32
107000 -- (-521.360) (-525.397) [-526.200] (-523.791) * [-524.577] (-525.379) (-532.717) (-526.634) -- 0:01:31
108000 -- (-525.535) (-526.211) [-524.217] (-525.667) * (-524.538) (-525.293) (-528.910) [-527.821] -- 0:01:30
109000 -- (-525.150) [-522.508] (-524.343) (-523.084) * [-528.249] (-521.250) (-524.366) (-523.470) -- 0:01:29
110000 -- [-523.998] (-524.993) (-522.857) (-525.582) * (-522.998) [-522.859] (-521.962) (-528.366) -- 0:01:29
Average standard deviation of split frequencies: 0.028398
111000 -- [-524.811] (-527.448) (-525.494) (-525.816) * (-526.139) (-533.445) (-525.323) [-521.632] -- 0:01:28
112000 -- (-525.096) (-525.477) [-524.197] (-523.748) * [-522.554] (-524.365) (-520.817) (-522.642) -- 0:01:27
113000 -- (-532.089) (-522.602) (-528.532) [-523.946] * (-526.571) (-523.489) (-524.653) [-526.270] -- 0:01:26
114000 -- (-530.100) (-525.451) [-528.558] (-527.267) * (-524.812) [-521.502] (-523.954) (-525.568) -- 0:01:25
115000 -- [-523.310] (-522.199) (-526.689) (-526.824) * (-526.271) (-523.873) [-524.108] (-526.452) -- 0:01:32
Average standard deviation of split frequencies: 0.032511
116000 -- (-524.952) (-522.322) [-526.486] (-526.079) * [-524.894] (-524.942) (-528.301) (-528.209) -- 0:01:31
117000 -- (-524.158) [-521.924] (-526.766) (-525.765) * [-522.769] (-525.729) (-526.685) (-525.570) -- 0:01:30
118000 -- (-522.977) (-533.641) [-521.935] (-522.077) * (-530.391) [-524.684] (-524.619) (-524.512) -- 0:01:29
119000 -- (-523.139) (-526.095) (-530.878) [-526.050] * (-530.522) (-527.326) (-526.665) [-526.499] -- 0:01:28
120000 -- [-521.877] (-525.449) (-536.915) (-527.662) * (-528.591) (-524.033) [-524.594] (-521.103) -- 0:01:28
Average standard deviation of split frequencies: 0.036462
121000 -- [-522.006] (-528.042) (-524.608) (-525.842) * (-524.063) (-520.841) [-524.077] (-527.043) -- 0:01:27
122000 -- (-520.700) (-526.896) (-524.211) [-525.135] * (-524.315) (-525.139) (-525.516) [-529.076] -- 0:01:26
123000 -- (-526.337) (-527.009) [-522.604] (-527.441) * (-527.234) [-523.868] (-523.593) (-524.974) -- 0:01:25
124000 -- (-525.142) (-528.211) [-521.912] (-527.542) * (-521.670) (-525.087) (-527.414) [-524.427] -- 0:01:24
125000 -- (-526.317) (-522.699) (-523.881) [-527.050] * (-521.023) [-526.349] (-527.784) (-528.635) -- 0:01:31
Average standard deviation of split frequencies: 0.034919
126000 -- (-531.526) (-521.627) (-530.614) [-526.779] * (-528.545) (-524.839) [-524.698] (-527.642) -- 0:01:30
127000 -- [-524.173] (-524.262) (-523.463) (-526.034) * (-522.853) [-523.030] (-526.796) (-532.514) -- 0:01:29
128000 -- (-524.025) [-529.065] (-521.961) (-527.524) * (-521.602) (-525.776) [-526.605] (-523.531) -- 0:01:28
129000 -- (-524.385) [-526.446] (-523.496) (-527.167) * [-521.706] (-527.871) (-528.057) (-529.453) -- 0:01:27
130000 -- (-528.822) (-524.522) (-521.793) [-523.795] * (-524.817) (-525.311) [-525.027] (-530.964) -- 0:01:27
Average standard deviation of split frequencies: 0.038482
131000 -- [-520.520] (-523.461) (-525.970) (-525.271) * [-523.188] (-530.663) (-529.751) (-530.814) -- 0:01:26
132000 -- [-523.524] (-522.243) (-525.913) (-532.504) * (-525.805) (-525.806) (-524.596) [-531.545] -- 0:01:25
133000 -- (-527.214) [-523.684] (-526.510) (-527.132) * (-521.573) (-527.133) [-522.768] (-526.906) -- 0:01:24
134000 -- [-522.686] (-522.559) (-522.934) (-521.850) * [-525.131] (-525.300) (-530.165) (-530.211) -- 0:01:24
135000 -- (-523.632) [-522.357] (-522.847) (-523.458) * (-529.584) (-526.174) (-524.496) [-525.395] -- 0:01:29
Average standard deviation of split frequencies: 0.034662
136000 -- [-524.926] (-527.781) (-522.157) (-525.668) * (-529.799) [-524.127] (-527.500) (-529.118) -- 0:01:28
137000 -- [-521.786] (-527.321) (-526.696) (-523.976) * [-525.164] (-531.779) (-527.612) (-533.442) -- 0:01:28
138000 -- (-525.716) (-531.307) [-522.744] (-524.065) * (-529.129) (-528.136) (-526.691) [-529.442] -- 0:01:27
139000 -- (-526.218) [-526.759] (-524.006) (-522.753) * (-523.305) (-526.374) [-522.756] (-534.820) -- 0:01:26
140000 -- (-524.860) (-526.877) (-528.558) [-521.511] * (-526.355) (-532.812) [-523.694] (-530.779) -- 0:01:26
Average standard deviation of split frequencies: 0.031278
141000 -- (-520.407) (-528.604) (-523.777) [-524.370] * (-524.151) (-528.491) [-527.257] (-528.942) -- 0:01:25
142000 -- (-525.632) [-525.284] (-523.504) (-522.724) * [-532.998] (-526.100) (-526.790) (-528.857) -- 0:01:24
143000 -- [-524.620] (-524.278) (-528.488) (-535.812) * (-524.088) (-524.417) [-527.824] (-526.408) -- 0:01:23
144000 -- [-526.737] (-528.919) (-531.475) (-525.374) * [-526.363] (-522.557) (-527.346) (-531.490) -- 0:01:23
145000 -- [-523.599] (-532.682) (-522.226) (-531.815) * [-525.661] (-523.601) (-526.390) (-526.659) -- 0:01:28
Average standard deviation of split frequencies: 0.034441
146000 -- (-525.518) (-526.167) [-525.789] (-530.274) * (-526.995) [-523.356] (-524.335) (-528.501) -- 0:01:27
147000 -- (-529.478) [-524.437] (-527.005) (-535.664) * (-530.541) [-522.012] (-528.320) (-534.472) -- 0:01:27
148000 -- (-528.849) (-528.518) (-530.512) [-527.402] * [-522.502] (-523.770) (-529.787) (-526.720) -- 0:01:26
149000 -- (-523.504) (-524.732) [-525.485] (-527.934) * [-524.578] (-527.594) (-523.876) (-526.997) -- 0:01:25
150000 -- (-525.395) (-520.818) (-528.680) [-525.262] * (-521.797) (-527.964) (-524.878) [-524.360] -- 0:01:25
Average standard deviation of split frequencies: 0.035460
151000 -- [-522.187] (-523.455) (-524.901) (-527.541) * (-526.658) (-527.384) (-524.487) [-526.160] -- 0:01:24
152000 -- (-520.582) (-525.440) [-520.366] (-526.305) * [-526.899] (-525.889) (-523.643) (-525.597) -- 0:01:23
153000 -- (-529.032) (-524.286) (-524.759) [-531.264] * (-522.667) [-524.733] (-522.159) (-523.345) -- 0:01:23
154000 -- (-527.021) (-522.541) (-523.523) [-532.713] * (-523.735) [-525.749] (-530.362) (-525.136) -- 0:01:22
155000 -- [-524.655] (-527.662) (-524.147) (-528.691) * (-526.803) (-526.750) (-528.147) [-525.319] -- 0:01:27
Average standard deviation of split frequencies: 0.040291
156000 -- (-524.914) [-524.328] (-526.577) (-535.222) * (-522.562) (-527.569) [-525.319] (-521.295) -- 0:01:26
157000 -- [-526.306] (-524.508) (-531.751) (-527.911) * (-527.885) (-527.532) [-523.767] (-527.443) -- 0:01:25
158000 -- [-527.008] (-525.637) (-524.644) (-523.666) * (-524.406) [-527.253] (-524.565) (-526.311) -- 0:01:25
159000 -- [-522.098] (-523.271) (-528.627) (-531.333) * (-524.872) [-524.129] (-527.586) (-528.477) -- 0:01:24
160000 -- (-536.304) [-526.121] (-526.937) (-532.702) * (-524.452) [-524.408] (-523.274) (-532.595) -- 0:01:24
Average standard deviation of split frequencies: 0.033253
161000 -- (-530.130) [-524.851] (-530.742) (-526.639) * [-522.798] (-529.360) (-523.226) (-529.647) -- 0:01:23
162000 -- [-528.267] (-525.661) (-526.631) (-522.986) * (-522.764) (-526.954) (-526.388) [-526.213] -- 0:01:22
163000 -- [-528.971] (-525.001) (-526.856) (-522.754) * (-525.193) (-522.793) (-523.805) [-522.171] -- 0:01:22
164000 -- (-525.678) [-527.839] (-529.582) (-525.031) * [-521.226] (-524.564) (-526.431) (-522.814) -- 0:01:21
165000 -- (-529.201) [-523.390] (-527.464) (-526.313) * (-524.043) (-523.281) (-525.312) [-523.302] -- 0:01:20
Average standard deviation of split frequencies: 0.034077
166000 -- (-529.408) (-523.655) [-527.697] (-522.838) * (-525.611) [-525.979] (-530.360) (-532.179) -- 0:01:25
167000 -- [-528.502] (-527.245) (-525.884) (-525.292) * (-520.884) [-527.743] (-521.888) (-522.982) -- 0:01:24
168000 -- (-524.605) (-524.902) [-528.775] (-528.176) * (-526.443) [-526.207] (-523.117) (-525.706) -- 0:01:24
169000 -- [-523.277] (-524.846) (-524.416) (-527.448) * (-525.359) (-530.065) (-526.002) [-529.333] -- 0:01:23
170000 -- [-523.825] (-527.045) (-528.561) (-525.599) * (-520.993) (-527.559) (-531.137) [-525.613] -- 0:01:23
Average standard deviation of split frequencies: 0.025780
171000 -- [-526.351] (-524.395) (-527.842) (-535.026) * (-524.851) [-531.355] (-523.782) (-529.116) -- 0:01:22
172000 -- (-527.173) [-524.575] (-529.057) (-531.854) * (-526.377) (-525.161) (-525.164) [-523.660] -- 0:01:21
173000 -- (-536.174) [-531.582] (-525.311) (-521.532) * (-524.459) (-523.721) (-528.265) [-525.809] -- 0:01:21
174000 -- (-530.344) [-530.840] (-525.802) (-530.814) * (-526.516) (-529.361) (-528.168) [-525.554] -- 0:01:20
175000 -- (-525.905) (-525.040) (-531.209) [-528.666] * (-523.062) [-529.042] (-523.316) (-529.387) -- 0:01:20
Average standard deviation of split frequencies: 0.021427
176000 -- (-524.221) (-527.981) [-523.446] (-527.813) * [-525.208] (-526.202) (-524.936) (-523.308) -- 0:01:24
177000 -- [-525.620] (-523.859) (-521.934) (-522.369) * (-523.451) [-527.596] (-522.782) (-532.180) -- 0:01:23
178000 -- (-528.829) (-525.495) [-525.514] (-523.561) * [-523.104] (-527.977) (-533.154) (-531.001) -- 0:01:23
179000 -- (-527.298) (-524.997) [-523.133] (-524.884) * (-528.237) (-530.195) (-526.107) [-526.207] -- 0:01:22
180000 -- (-526.020) (-523.136) [-533.562] (-529.262) * (-531.358) (-526.556) [-526.011] (-524.032) -- 0:01:22
Average standard deviation of split frequencies: 0.020874
181000 -- [-523.216] (-524.751) (-529.735) (-534.721) * (-526.689) [-522.909] (-522.882) (-526.846) -- 0:01:21
182000 -- (-527.350) (-523.869) [-525.646] (-532.748) * (-525.966) (-526.651) [-521.168] (-523.600) -- 0:01:20
183000 -- (-524.904) [-525.176] (-529.648) (-527.265) * (-528.670) [-527.202] (-522.482) (-525.725) -- 0:01:20
184000 -- (-526.891) [-526.363] (-526.399) (-526.795) * (-526.300) (-526.440) (-521.998) [-521.300] -- 0:01:19
185000 -- (-535.561) (-524.877) (-527.403) [-521.096] * [-525.325] (-527.855) (-521.986) (-520.542) -- 0:01:19
Average standard deviation of split frequencies: 0.023655
186000 -- (-524.770) [-524.136] (-524.182) (-527.418) * (-528.217) (-524.431) [-522.282] (-526.515) -- 0:01:23
187000 -- (-526.596) (-526.731) (-527.067) [-521.177] * (-537.646) [-523.814] (-525.471) (-526.890) -- 0:01:22
188000 -- (-528.656) (-528.056) [-525.760] (-521.388) * [-527.567] (-529.800) (-525.621) (-527.545) -- 0:01:22
189000 -- (-522.790) (-524.229) [-524.666] (-526.718) * (-523.281) [-522.911] (-525.256) (-521.061) -- 0:01:21
190000 -- (-526.853) (-524.001) [-526.596] (-530.577) * (-524.317) [-529.819] (-524.277) (-527.649) -- 0:01:21
Average standard deviation of split frequencies: 0.023076
191000 -- (-523.571) [-518.916] (-522.461) (-525.322) * (-527.387) [-522.291] (-523.027) (-525.595) -- 0:01:20
192000 -- [-522.010] (-522.271) (-524.945) (-522.752) * (-529.086) (-522.019) [-523.212] (-524.474) -- 0:01:19
193000 -- (-523.285) (-521.787) [-526.398] (-523.529) * [-525.491] (-525.615) (-527.513) (-523.619) -- 0:01:19
194000 -- [-524.328] (-530.221) (-530.685) (-519.896) * (-529.538) (-524.195) [-522.746] (-523.159) -- 0:01:18
195000 -- (-527.072) (-527.169) [-521.439] (-529.609) * (-531.330) (-526.787) [-522.740] (-525.416) -- 0:01:18
Average standard deviation of split frequencies: 0.019241
196000 -- [-521.705] (-531.481) (-523.382) (-522.213) * [-524.679] (-526.010) (-523.541) (-523.413) -- 0:01:17
197000 -- (-528.244) (-526.768) [-525.679] (-522.938) * [-521.914] (-525.814) (-525.553) (-523.075) -- 0:01:21
198000 -- (-523.410) (-531.669) (-524.121) [-522.137] * [-521.655] (-524.456) (-524.056) (-524.295) -- 0:01:21
199000 -- (-526.003) [-527.850] (-525.282) (-527.549) * (-523.745) (-524.248) [-523.935] (-522.404) -- 0:01:20
200000 -- (-530.071) (-525.643) (-528.862) [-524.398] * (-523.048) (-531.003) (-522.739) [-522.188] -- 0:01:20
Average standard deviation of split frequencies: 0.017227
201000 -- (-533.417) (-533.104) [-522.232] (-523.587) * (-526.855) (-524.892) [-521.617] (-525.977) -- 0:01:19
202000 -- (-534.766) (-530.054) [-521.590] (-526.253) * [-521.454] (-532.348) (-523.918) (-525.984) -- 0:01:19
203000 -- (-523.404) (-528.892) [-523.736] (-530.661) * (-520.524) (-523.288) (-528.152) [-525.269] -- 0:01:18
204000 -- (-527.778) (-526.056) [-525.662] (-526.611) * (-526.050) (-527.404) (-528.255) [-525.203] -- 0:01:18
205000 -- (-524.547) (-526.442) [-525.036] (-529.380) * [-523.387] (-528.548) (-525.923) (-523.358) -- 0:01:17
Average standard deviation of split frequencies: 0.013730
206000 -- (-526.778) (-524.550) [-524.837] (-531.829) * [-526.306] (-525.066) (-521.118) (-523.249) -- 0:01:17
207000 -- [-525.173] (-526.582) (-526.357) (-531.761) * [-525.225] (-523.046) (-521.835) (-525.878) -- 0:01:20
208000 -- (-529.215) (-523.035) [-523.163] (-522.666) * (-523.421) (-522.548) (-524.982) [-525.473] -- 0:01:19
209000 -- (-523.026) (-525.322) (-520.918) [-526.117] * (-529.850) (-523.111) [-524.835] (-525.600) -- 0:01:19
210000 -- (-522.295) (-527.482) (-523.026) [-524.284] * [-522.802] (-521.805) (-525.239) (-523.461) -- 0:01:19
Average standard deviation of split frequencies: 0.007459
211000 -- (-528.862) [-523.389] (-521.853) (-525.005) * (-525.341) (-526.943) [-531.020] (-523.357) -- 0:01:18
212000 -- (-530.581) (-520.247) [-527.539] (-528.230) * (-527.394) [-526.450] (-523.938) (-539.213) -- 0:01:18
213000 -- (-531.893) [-523.760] (-528.820) (-523.129) * (-521.817) (-529.794) [-526.673] (-526.587) -- 0:01:17
214000 -- (-523.275) (-521.990) (-529.608) [-529.882] * (-525.160) (-525.650) [-521.655] (-522.528) -- 0:01:17
215000 -- (-526.493) (-530.399) (-528.198) [-520.994] * [-522.907] (-522.127) (-528.991) (-532.447) -- 0:01:16
Average standard deviation of split frequencies: 0.013095
216000 -- (-519.798) (-530.086) (-524.037) [-523.558] * (-526.645) (-525.457) (-523.417) [-525.614] -- 0:01:16
217000 -- [-521.383] (-523.183) (-523.759) (-529.739) * (-528.902) [-521.015] (-524.343) (-528.263) -- 0:01:15
218000 -- (-529.935) (-524.510) [-523.623] (-529.325) * [-524.954] (-527.476) (-526.784) (-525.114) -- 0:01:18
219000 -- (-525.174) [-525.744] (-520.726) (-527.707) * (-527.305) (-525.986) [-523.717] (-527.467) -- 0:01:18
220000 -- (-527.140) (-526.070) (-524.094) [-522.043] * (-527.308) (-520.940) [-523.672] (-531.550) -- 0:01:18
Average standard deviation of split frequencies: 0.009969
221000 -- (-528.282) [-523.633] (-523.289) (-521.420) * (-529.658) [-521.711] (-526.768) (-525.623) -- 0:01:17
222000 -- (-529.703) (-520.809) (-522.101) [-525.784] * (-528.017) (-520.435) (-524.350) [-524.683] -- 0:01:17
223000 -- (-525.130) (-523.631) [-523.097] (-522.703) * (-528.419) (-527.515) (-528.679) [-526.390] -- 0:01:16
224000 -- (-524.397) (-528.350) [-524.376] (-522.473) * (-531.117) (-524.533) [-528.303] (-527.350) -- 0:01:16
225000 -- (-523.872) (-519.516) (-521.529) [-523.053] * (-526.340) (-524.787) (-525.919) [-524.119] -- 0:01:15
Average standard deviation of split frequencies: 0.005562
226000 -- (-526.584) (-522.606) (-523.190) [-524.598] * (-524.903) (-528.772) (-527.551) [-521.876] -- 0:01:15
227000 -- [-527.702] (-524.382) (-523.767) (-519.601) * (-528.598) [-521.168] (-525.652) (-523.615) -- 0:01:14
228000 -- [-522.386] (-532.563) (-526.464) (-523.878) * (-526.384) (-523.471) [-525.773] (-529.588) -- 0:01:17
229000 -- (-521.910) (-526.321) [-532.281] (-539.157) * (-526.537) [-522.246] (-522.323) (-522.012) -- 0:01:17
230000 -- (-529.461) (-527.971) (-524.209) [-527.018] * (-524.604) (-525.657) [-526.735] (-521.379) -- 0:01:17
Average standard deviation of split frequencies: 0.010900
231000 -- (-526.257) (-525.934) [-523.245] (-526.646) * (-523.140) (-523.122) (-528.776) [-525.214] -- 0:01:16
232000 -- [-524.383] (-527.022) (-520.512) (-524.413) * [-524.058] (-524.985) (-525.012) (-524.459) -- 0:01:16
233000 -- (-526.925) (-523.815) (-528.574) [-522.346] * [-530.129] (-523.365) (-520.960) (-521.729) -- 0:01:15
234000 -- (-525.738) [-524.236] (-527.131) (-525.878) * (-529.803) (-523.726) (-525.180) [-524.068] -- 0:01:15
235000 -- (-522.426) [-523.342] (-528.320) (-525.361) * (-523.710) [-522.722] (-524.228) (-527.560) -- 0:01:14
Average standard deviation of split frequencies: 0.010653
236000 -- (-526.187) [-526.834] (-527.053) (-529.631) * (-526.497) [-523.312] (-530.678) (-523.944) -- 0:01:14
237000 -- (-525.658) (-523.766) (-524.051) [-530.373] * [-527.712] (-529.285) (-528.401) (-525.475) -- 0:01:14
238000 -- (-524.984) (-524.630) (-533.832) [-524.878] * (-523.290) [-525.370] (-533.314) (-522.848) -- 0:01:13
239000 -- (-529.668) (-525.839) (-526.603) [-527.519] * (-524.394) (-524.737) (-529.632) [-524.181] -- 0:01:16
240000 -- (-528.043) (-527.005) [-526.143] (-524.221) * [-523.316] (-526.069) (-528.706) (-528.147) -- 0:01:16
Average standard deviation of split frequencies: 0.007835
241000 -- (-522.593) (-526.196) [-528.677] (-526.039) * [-526.448] (-524.633) (-533.568) (-529.451) -- 0:01:15
242000 -- (-527.596) [-526.277] (-528.889) (-529.087) * [-525.633] (-522.351) (-531.938) (-526.415) -- 0:01:15
243000 -- (-525.162) [-527.241] (-531.787) (-526.357) * (-529.553) (-524.339) (-528.087) [-527.607] -- 0:01:14
244000 -- (-524.368) (-528.388) [-525.619] (-524.405) * (-521.954) (-526.552) (-528.975) [-526.764] -- 0:01:14
245000 -- (-524.409) (-532.384) [-532.275] (-529.479) * [-524.466] (-525.177) (-535.050) (-521.530) -- 0:01:13
Average standard deviation of split frequencies: 0.010220
246000 -- (-525.109) [-532.076] (-530.961) (-525.486) * (-525.127) [-522.216] (-527.248) (-523.176) -- 0:01:13
247000 -- (-527.082) (-530.262) (-526.437) [-527.598] * (-523.297) [-526.355] (-528.647) (-525.367) -- 0:01:13
248000 -- (-531.453) [-526.216] (-527.364) (-526.362) * (-527.627) (-525.499) (-526.243) [-523.455] -- 0:01:12
249000 -- [-525.901] (-526.863) (-523.376) (-524.321) * (-527.731) (-522.177) [-524.029] (-528.593) -- 0:01:15
250000 -- [-523.222] (-535.528) (-526.003) (-525.225) * (-527.547) [-524.659] (-529.673) (-527.666) -- 0:01:15
Average standard deviation of split frequencies: 0.008776
251000 -- (-524.610) (-524.708) (-528.885) [-524.493] * (-524.486) (-521.567) (-523.194) [-525.951] -- 0:01:14
252000 -- [-526.071] (-525.786) (-528.371) (-526.867) * (-526.950) (-528.360) (-525.536) [-527.814] -- 0:01:14
253000 -- (-529.121) [-523.925] (-523.729) (-521.909) * (-526.244) (-526.116) (-524.502) [-528.269] -- 0:01:13
254000 -- (-532.329) (-523.135) [-520.999] (-524.047) * [-524.572] (-527.415) (-525.701) (-521.769) -- 0:01:13
255000 -- [-522.527] (-530.539) (-525.845) (-524.028) * (-527.105) (-526.343) [-521.946] (-526.847) -- 0:01:13
Average standard deviation of split frequencies: 0.013504
256000 -- [-532.549] (-528.360) (-523.974) (-525.844) * (-532.294) (-526.632) (-522.992) [-525.186] -- 0:01:12
257000 -- (-525.707) (-526.284) (-527.749) [-524.453] * (-526.329) (-521.326) (-523.519) [-522.134] -- 0:01:12
258000 -- (-523.205) (-527.069) [-520.018] (-521.975) * (-525.228) (-526.503) (-521.760) [-524.690] -- 0:01:11
259000 -- (-521.606) [-525.697] (-521.111) (-524.380) * [-528.315] (-527.259) (-521.691) (-530.695) -- 0:01:14
260000 -- (-533.496) [-522.494] (-528.002) (-528.599) * (-522.144) (-523.432) [-526.661] (-529.256) -- 0:01:14
Average standard deviation of split frequencies: 0.010851
261000 -- (-522.950) (-532.269) [-523.541] (-522.161) * (-524.821) (-525.785) [-524.697] (-528.360) -- 0:01:13
262000 -- (-523.307) [-524.535] (-524.268) (-519.801) * (-527.035) (-524.728) (-527.456) [-525.604] -- 0:01:13
263000 -- (-528.480) (-528.126) [-527.486] (-528.676) * (-525.067) [-529.794] (-524.601) (-528.882) -- 0:01:12
264000 -- [-525.436] (-527.941) (-524.617) (-526.229) * [-525.341] (-527.445) (-530.943) (-528.164) -- 0:01:12
265000 -- (-524.861) (-523.659) (-529.246) [-530.055] * (-524.452) [-530.067] (-526.022) (-525.259) -- 0:01:12
Average standard deviation of split frequencies: 0.010633
266000 -- (-521.338) (-526.245) (-527.780) [-525.220] * (-526.192) [-528.857] (-530.457) (-522.341) -- 0:01:11
267000 -- (-525.993) [-524.836] (-526.978) (-527.817) * (-527.793) [-523.750] (-533.316) (-533.019) -- 0:01:11
268000 -- (-526.587) (-526.536) (-527.619) [-523.486] * (-523.301) [-528.129] (-524.576) (-525.142) -- 0:01:11
269000 -- (-526.633) (-526.164) (-526.991) [-521.897] * (-524.488) [-525.525] (-529.298) (-524.821) -- 0:01:13
270000 -- (-525.236) (-533.739) [-526.290] (-528.418) * [-521.565] (-523.833) (-530.656) (-525.929) -- 0:01:13
Average standard deviation of split frequencies: 0.010450
271000 -- (-529.769) (-524.135) (-525.243) [-522.446] * [-525.325] (-522.697) (-524.235) (-526.444) -- 0:01:12
272000 -- (-540.868) [-525.204] (-525.772) (-522.199) * (-525.929) (-524.643) (-529.960) [-530.928] -- 0:01:12
273000 -- (-526.012) [-525.666] (-525.315) (-526.182) * [-521.976] (-530.129) (-527.353) (-519.733) -- 0:01:11
274000 -- (-528.477) (-523.649) (-522.724) [-524.436] * [-522.591] (-530.226) (-523.025) (-522.529) -- 0:01:11
275000 -- [-536.861] (-527.285) (-523.363) (-530.305) * (-521.691) (-522.574) (-525.505) [-529.749] -- 0:01:11
Average standard deviation of split frequencies: 0.012525
276000 -- (-532.415) [-530.077] (-522.206) (-528.515) * (-527.613) (-525.830) (-524.808) [-529.272] -- 0:01:10
277000 -- (-525.035) [-522.061] (-527.958) (-528.303) * (-526.073) (-525.317) [-521.929] (-523.832) -- 0:01:10
278000 -- (-524.925) [-522.962] (-521.995) (-543.725) * (-523.355) (-526.636) [-525.381] (-524.747) -- 0:01:10
279000 -- (-533.358) (-530.401) [-526.006] (-530.035) * (-523.476) [-526.552] (-524.756) (-524.715) -- 0:01:12
280000 -- (-530.954) [-522.267] (-525.163) (-526.805) * [-524.468] (-528.913) (-522.668) (-524.636) -- 0:01:12
Average standard deviation of split frequencies: 0.012317
281000 -- (-532.400) (-521.173) (-531.514) [-528.259] * (-525.692) (-530.085) (-535.343) [-521.023] -- 0:01:11
282000 -- (-531.598) [-524.729] (-527.158) (-529.978) * [-526.870] (-523.054) (-521.625) (-527.153) -- 0:01:11
283000 -- [-527.362] (-524.067) (-530.163) (-525.472) * (-534.023) (-526.755) (-521.216) [-523.792] -- 0:01:10
284000 -- (-533.428) (-524.137) [-527.379] (-528.228) * (-526.266) (-523.633) (-523.500) [-522.873] -- 0:01:10
285000 -- [-526.678] (-522.051) (-525.051) (-525.023) * (-524.490) (-521.007) [-525.431] (-522.717) -- 0:01:10
Average standard deviation of split frequencies: 0.013186
286000 -- [-524.765] (-527.950) (-526.181) (-533.514) * [-524.680] (-520.932) (-525.211) (-526.934) -- 0:01:09
287000 -- (-529.184) (-525.497) [-527.086] (-529.686) * (-531.345) (-522.979) (-526.229) [-526.147] -- 0:01:09
288000 -- (-528.432) (-523.659) [-529.804] (-531.470) * (-529.618) (-526.820) (-531.365) [-526.246] -- 0:01:09
289000 -- (-530.471) [-524.837] (-524.359) (-531.579) * (-522.243) [-527.008] (-526.639) (-527.720) -- 0:01:08
290000 -- [-527.330] (-523.915) (-525.276) (-523.032) * (-523.888) (-525.378) [-522.406] (-528.092) -- 0:01:11
Average standard deviation of split frequencies: 0.015137
291000 -- (-525.718) (-526.469) [-522.193] (-527.202) * (-527.247) (-526.519) (-525.844) [-524.344] -- 0:01:10
292000 -- [-525.964] (-532.920) (-524.538) (-530.149) * (-526.654) [-522.061] (-525.136) (-527.071) -- 0:01:10
293000 -- [-525.036] (-527.742) (-524.668) (-528.536) * (-530.626) [-524.958] (-522.298) (-526.746) -- 0:01:09
294000 -- [-527.987] (-533.725) (-523.865) (-527.993) * (-523.593) (-528.853) (-521.749) [-526.572] -- 0:01:09
295000 -- (-533.128) (-524.178) (-539.429) [-522.920] * (-532.061) [-529.106] (-523.258) (-530.156) -- 0:01:09
Average standard deviation of split frequencies: 0.019111
296000 -- (-528.572) (-523.908) [-525.222] (-528.502) * (-523.350) (-533.842) [-522.302] (-526.200) -- 0:01:08
297000 -- [-527.968] (-525.574) (-521.166) (-525.752) * (-522.267) [-527.055] (-526.469) (-530.140) -- 0:01:08
298000 -- (-534.097) (-529.880) [-524.978] (-529.400) * (-527.993) [-524.841] (-528.148) (-527.712) -- 0:01:08
299000 -- (-528.803) (-527.424) [-523.979] (-532.231) * [-526.269] (-534.855) (-522.765) (-525.740) -- 0:01:07
300000 -- (-523.982) [-526.278] (-527.071) (-524.597) * [-521.506] (-528.155) (-526.970) (-521.841) -- 0:01:10
Average standard deviation of split frequencies: 0.019860
301000 -- (-523.727) [-526.907] (-528.891) (-529.075) * [-523.557] (-528.034) (-523.107) (-526.435) -- 0:01:09
302000 -- (-528.372) [-525.060] (-523.152) (-529.651) * [-522.720] (-529.456) (-527.443) (-527.696) -- 0:01:09
303000 -- (-523.038) [-525.529] (-527.252) (-529.249) * [-523.188] (-525.998) (-525.367) (-525.969) -- 0:01:09
304000 -- (-532.303) [-527.372] (-529.637) (-526.326) * (-531.234) (-526.813) (-527.588) [-526.429] -- 0:01:08
305000 -- [-524.005] (-530.495) (-524.909) (-528.487) * (-527.173) [-526.937] (-524.929) (-527.482) -- 0:01:08
Average standard deviation of split frequencies: 0.022595
306000 -- (-524.695) [-523.970] (-521.282) (-531.881) * (-526.266) (-528.344) [-524.796] (-525.924) -- 0:01:08
307000 -- [-525.846] (-522.901) (-522.909) (-527.950) * (-525.355) (-526.851) [-522.361] (-531.389) -- 0:01:07
308000 -- (-525.618) (-524.997) [-524.301] (-527.705) * [-524.996] (-520.404) (-520.991) (-525.978) -- 0:01:07
309000 -- (-525.320) [-524.859] (-527.555) (-525.655) * [-526.933] (-523.285) (-529.538) (-525.999) -- 0:01:07
310000 -- (-525.457) (-525.165) [-525.552] (-525.133) * (-530.807) (-526.407) (-526.439) [-529.996] -- 0:01:09
Average standard deviation of split frequencies: 0.020232
311000 -- (-529.366) (-526.779) (-523.106) [-523.176] * (-527.787) [-521.283] (-528.434) (-529.065) -- 0:01:08
312000 -- (-528.005) (-525.792) (-526.912) [-532.098] * (-525.150) (-526.622) [-525.634] (-526.316) -- 0:01:08
313000 -- [-520.205] (-523.852) (-523.167) (-525.019) * (-525.524) [-527.945] (-525.998) (-526.258) -- 0:01:08
314000 -- (-528.979) (-521.987) [-525.813] (-526.824) * (-530.790) (-521.786) [-527.624] (-527.248) -- 0:01:07
315000 -- (-528.608) (-527.801) (-520.829) [-526.369] * (-526.006) (-531.745) (-525.732) [-525.568] -- 0:01:07
Average standard deviation of split frequencies: 0.022874
316000 -- (-526.869) (-526.760) [-521.161] (-529.239) * (-528.045) (-526.311) [-528.726] (-522.486) -- 0:01:07
317000 -- (-526.692) [-524.922] (-533.108) (-526.119) * (-527.813) (-524.524) [-524.785] (-520.711) -- 0:01:06
318000 -- (-523.576) (-526.053) [-525.804] (-527.455) * (-531.741) (-527.729) [-523.897] (-524.587) -- 0:01:06
319000 -- (-524.216) (-523.279) [-525.558] (-529.346) * (-527.157) (-527.641) [-527.017] (-527.003) -- 0:01:06
320000 -- (-523.833) [-521.863] (-522.916) (-525.127) * (-525.225) (-525.725) (-524.928) [-531.659] -- 0:01:05
Average standard deviation of split frequencies: 0.022541
321000 -- (-526.591) (-528.388) [-525.307] (-527.069) * (-526.243) (-528.281) [-521.886] (-524.323) -- 0:01:07
322000 -- (-526.217) [-527.405] (-524.520) (-528.686) * (-525.067) (-522.434) (-523.246) [-526.498] -- 0:01:07
323000 -- (-532.278) (-530.781) (-531.345) [-528.972] * (-528.982) (-526.134) (-527.353) [-520.789] -- 0:01:07
324000 -- (-527.955) [-524.733] (-527.366) (-528.748) * (-526.678) [-527.154] (-527.936) (-524.370) -- 0:01:06
325000 -- (-540.248) [-527.496] (-527.758) (-532.360) * (-532.208) (-524.882) [-523.208] (-523.629) -- 0:01:06
Average standard deviation of split frequencies: 0.025064
326000 -- (-532.481) (-529.478) (-528.944) [-526.406] * [-531.134] (-529.977) (-528.571) (-522.258) -- 0:01:06
327000 -- (-527.907) (-534.537) (-523.029) [-521.612] * (-524.045) [-526.074] (-526.756) (-521.842) -- 0:01:05
328000 -- (-526.980) (-529.451) (-526.511) [-524.706] * (-523.468) (-525.026) (-533.409) [-524.345] -- 0:01:05
329000 -- (-524.066) (-527.070) [-521.069] (-527.143) * (-520.121) [-521.767] (-530.391) (-526.416) -- 0:01:05
330000 -- (-521.864) (-540.711) (-527.018) [-523.712] * (-525.911) [-529.103] (-532.168) (-522.094) -- 0:01:04
Average standard deviation of split frequencies: 0.023760
331000 -- (-525.382) (-535.326) (-531.372) [-522.536] * (-521.420) (-526.035) [-528.281] (-519.951) -- 0:01:06
332000 -- [-522.836] (-529.291) (-522.956) (-521.275) * (-525.937) (-531.045) [-523.650] (-536.643) -- 0:01:06
333000 -- (-530.881) (-531.478) (-531.735) [-525.669] * (-529.817) (-533.493) [-528.412] (-524.894) -- 0:01:06
334000 -- (-529.782) (-522.127) (-526.233) [-522.028] * [-526.911] (-532.441) (-523.357) (-523.350) -- 0:01:05
335000 -- [-526.824] (-524.654) (-531.789) (-523.306) * [-525.802] (-528.334) (-529.139) (-528.688) -- 0:01:05
Average standard deviation of split frequencies: 0.026189
336000 -- (-522.687) (-521.958) [-524.607] (-526.519) * (-525.015) (-533.855) [-525.098] (-523.658) -- 0:01:05
337000 -- (-530.365) [-527.069] (-524.594) (-522.034) * (-523.332) (-533.211) (-524.912) [-524.393] -- 0:01:04
338000 -- (-525.508) (-529.820) [-528.113] (-523.173) * [-529.426] (-536.283) (-526.490) (-524.605) -- 0:01:04
339000 -- [-528.082] (-525.007) (-526.496) (-520.448) * [-522.980] (-527.028) (-525.068) (-528.050) -- 0:01:04
340000 -- [-524.782] (-523.852) (-524.519) (-531.158) * (-522.231) (-531.786) [-522.229] (-524.275) -- 0:01:04
Average standard deviation of split frequencies: 0.026753
341000 -- (-524.804) [-525.983] (-525.874) (-525.476) * (-524.072) (-532.366) [-526.157] (-525.526) -- 0:01:03
342000 -- (-527.112) (-524.740) [-523.047] (-522.030) * (-528.651) (-524.525) (-521.862) [-527.253] -- 0:01:05
343000 -- (-522.272) [-521.486] (-530.984) (-528.240) * (-524.094) (-531.074) [-525.381] (-525.782) -- 0:01:05
344000 -- (-522.425) (-524.312) [-525.817] (-526.887) * [-521.454] (-530.127) (-522.649) (-522.866) -- 0:01:04
345000 -- [-525.223] (-525.495) (-523.937) (-524.125) * [-523.353] (-526.460) (-522.881) (-520.923) -- 0:01:04
Average standard deviation of split frequencies: 0.029974
346000 -- (-526.653) (-529.513) (-528.996) [-530.680] * (-534.660) (-528.425) (-529.465) [-522.573] -- 0:01:04
347000 -- (-530.437) (-529.881) (-524.909) [-523.357] * (-525.602) (-527.274) [-523.614] (-523.770) -- 0:01:03
348000 -- (-524.464) (-526.558) [-525.600] (-525.246) * (-526.773) (-529.449) [-523.510] (-522.827) -- 0:01:03
349000 -- (-523.765) (-526.067) [-526.692] (-523.171) * (-530.974) (-523.000) [-521.455] (-527.173) -- 0:01:03
350000 -- (-525.791) [-526.229] (-522.429) (-526.549) * [-526.678] (-526.200) (-526.761) (-529.807) -- 0:01:03
Average standard deviation of split frequencies: 0.031367
351000 -- (-526.773) (-526.483) [-526.175] (-526.840) * (-527.048) [-527.658] (-528.609) (-524.830) -- 0:01:02
352000 -- (-522.361) (-528.974) [-522.906] (-524.212) * [-526.932] (-528.062) (-525.042) (-523.744) -- 0:01:04
353000 -- (-526.546) (-528.919) [-527.467] (-528.163) * (-529.712) [-520.407] (-525.234) (-525.451) -- 0:01:04
354000 -- (-526.262) (-530.775) [-525.083] (-526.851) * [-524.890] (-525.765) (-525.459) (-525.091) -- 0:01:03
355000 -- [-525.888] (-525.794) (-525.321) (-531.896) * (-522.501) [-522.366] (-523.439) (-523.965) -- 0:01:03
Average standard deviation of split frequencies: 0.026483
356000 -- (-523.636) (-531.823) (-522.387) [-524.987] * [-527.255] (-526.314) (-523.865) (-521.981) -- 0:01:03
357000 -- (-525.265) (-525.438) [-523.894] (-525.446) * (-528.525) (-521.434) (-522.520) [-524.963] -- 0:01:03
358000 -- (-525.957) (-523.083) [-527.435] (-525.883) * (-526.628) [-525.367] (-534.341) (-523.915) -- 0:01:02
359000 -- [-522.191] (-526.119) (-526.050) (-524.280) * (-523.534) (-523.936) [-527.809] (-525.740) -- 0:01:02
360000 -- (-521.843) [-522.588] (-524.492) (-522.066) * (-528.898) [-522.506] (-527.253) (-523.256) -- 0:01:02
Average standard deviation of split frequencies: 0.027883
361000 -- (-522.267) [-522.612] (-531.100) (-523.654) * (-523.595) (-521.203) [-524.634] (-530.963) -- 0:01:01
362000 -- (-526.976) [-523.004] (-527.144) (-531.338) * [-521.320] (-520.866) (-531.301) (-527.466) -- 0:01:03
363000 -- (-527.984) [-523.484] (-525.509) (-522.678) * (-524.379) [-525.738] (-535.168) (-527.920) -- 0:01:03
364000 -- [-523.694] (-523.409) (-523.936) (-525.265) * (-526.410) [-523.951] (-525.361) (-524.301) -- 0:01:02
365000 -- (-526.573) (-524.956) [-524.805] (-526.092) * (-529.176) (-530.712) [-525.131] (-525.457) -- 0:01:02
Average standard deviation of split frequencies: 0.027477
366000 -- (-526.615) [-523.348] (-524.279) (-524.401) * (-527.097) [-529.342] (-524.796) (-522.054) -- 0:01:02
367000 -- [-526.958] (-524.323) (-522.808) (-527.611) * (-521.939) (-524.803) (-528.235) [-523.163] -- 0:01:02
368000 -- [-528.570] (-528.831) (-524.548) (-523.976) * (-525.449) (-524.407) (-522.806) [-524.914] -- 0:01:01
369000 -- (-527.587) (-523.369) (-523.980) [-523.310] * (-524.775) (-528.694) (-530.887) [-520.159] -- 0:01:01
370000 -- (-533.285) (-523.388) (-523.922) [-525.589] * [-525.494] (-521.960) (-523.890) (-526.502) -- 0:01:01
Average standard deviation of split frequencies: 0.027979
371000 -- (-527.653) (-526.459) [-528.542] (-525.493) * (-524.540) (-525.706) (-524.492) [-527.378] -- 0:01:01
372000 -- (-524.452) [-522.441] (-531.202) (-525.689) * (-523.283) (-528.407) [-529.765] (-522.366) -- 0:01:02
373000 -- (-524.897) [-522.540] (-528.515) (-526.289) * (-524.167) (-531.041) [-524.725] (-525.148) -- 0:01:02
374000 -- [-523.234] (-525.767) (-524.915) (-522.321) * (-525.374) [-524.615] (-523.269) (-525.967) -- 0:01:01
375000 -- (-523.837) [-524.516] (-527.640) (-524.116) * [-524.631] (-524.662) (-523.456) (-531.133) -- 0:01:01
Average standard deviation of split frequencies: 0.027582
376000 -- (-523.412) (-521.209) (-522.774) [-522.350] * (-525.339) [-526.860] (-530.177) (-524.179) -- 0:01:01
377000 -- [-525.632] (-524.426) (-522.001) (-524.347) * [-523.899] (-526.648) (-523.459) (-525.453) -- 0:01:01
378000 -- (-537.324) (-526.753) (-531.905) [-520.715] * (-522.730) (-525.694) (-527.541) [-521.339] -- 0:01:00
379000 -- [-526.452] (-528.363) (-529.624) (-522.326) * (-526.541) (-527.386) (-523.322) [-520.329] -- 0:01:00
380000 -- (-525.938) (-524.485) (-521.837) [-523.472] * [-527.147] (-528.576) (-522.628) (-527.998) -- 0:01:00
Average standard deviation of split frequencies: 0.025593
381000 -- (-526.921) [-525.763] (-530.865) (-524.537) * [-525.599] (-532.174) (-525.888) (-528.040) -- 0:01:00
382000 -- (-526.386) [-522.634] (-534.323) (-531.830) * [-526.438] (-525.310) (-524.397) (-526.587) -- 0:01:01
383000 -- (-527.613) (-524.101) (-524.688) [-522.657] * (-526.314) (-523.955) (-525.238) [-522.516] -- 0:01:01
384000 -- (-523.907) [-525.956] (-533.007) (-521.641) * (-521.447) (-531.567) (-525.074) [-522.320] -- 0:01:00
385000 -- (-523.605) [-532.134] (-532.013) (-522.820) * (-520.027) (-525.457) (-529.835) [-522.437] -- 0:01:00
Average standard deviation of split frequencies: 0.021983
386000 -- (-529.338) (-529.040) (-526.623) [-524.158] * [-525.739] (-529.394) (-526.508) (-524.315) -- 0:01:00
387000 -- [-525.011] (-528.623) (-527.113) (-526.960) * (-521.352) [-526.702] (-522.316) (-525.331) -- 0:01:00
388000 -- [-524.165] (-529.832) (-527.564) (-524.018) * [-526.023] (-528.885) (-530.283) (-522.591) -- 0:00:59
389000 -- [-524.469] (-528.551) (-521.428) (-522.932) * (-523.074) (-532.643) [-533.501] (-525.686) -- 0:00:59
390000 -- (-521.902) [-523.969] (-525.451) (-525.409) * [-521.477] (-526.759) (-524.479) (-529.482) -- 0:00:59
Average standard deviation of split frequencies: 0.020916
391000 -- [-524.672] (-532.447) (-527.517) (-526.370) * (-522.455) (-527.219) (-523.980) [-524.569] -- 0:00:59
392000 -- [-525.358] (-524.413) (-529.222) (-529.976) * [-525.194] (-523.937) (-525.531) (-523.254) -- 0:00:58
393000 -- (-521.267) (-527.329) (-523.761) [-523.452] * (-521.963) (-525.181) (-532.124) [-521.995] -- 0:01:00
394000 -- (-522.770) (-524.136) (-526.942) [-523.743] * (-522.787) (-524.643) (-530.461) [-523.473] -- 0:00:59
395000 -- (-522.235) [-531.252] (-530.486) (-528.631) * (-525.555) [-523.824] (-522.104) (-521.677) -- 0:00:59
Average standard deviation of split frequencies: 0.021427
396000 -- (-525.772) (-527.906) [-522.092] (-526.137) * (-534.217) [-528.971] (-523.022) (-522.961) -- 0:00:59
397000 -- (-525.892) (-535.506) (-526.160) [-524.575] * (-527.673) (-526.922) [-522.266] (-525.795) -- 0:00:59
398000 -- (-523.243) [-531.382] (-530.650) (-520.500) * (-522.061) (-525.023) [-524.081] (-526.659) -- 0:00:58
399000 -- (-527.838) [-526.449] (-522.795) (-526.720) * (-528.643) [-520.448] (-530.333) (-524.070) -- 0:00:58
400000 -- (-524.802) [-528.106] (-522.516) (-523.703) * (-525.554) (-530.831) (-524.994) [-525.977] -- 0:00:58
Average standard deviation of split frequencies: 0.021178
401000 -- (-526.281) [-523.473] (-521.867) (-526.485) * (-528.162) (-527.995) (-521.258) [-524.231] -- 0:00:58
402000 -- (-531.889) (-523.204) [-523.010] (-522.237) * (-527.025) (-523.040) (-524.936) [-529.747] -- 0:00:58
403000 -- (-526.331) (-526.614) (-523.241) [-522.962] * (-532.431) (-523.487) [-521.770] (-530.162) -- 0:00:59
404000 -- (-525.206) (-525.623) (-524.601) [-525.885] * (-530.713) (-523.487) (-523.598) [-527.487] -- 0:00:59
405000 -- (-524.842) (-525.559) [-525.034] (-522.827) * (-526.647) [-527.453] (-527.711) (-525.826) -- 0:00:58
Average standard deviation of split frequencies: 0.022448
406000 -- [-526.030] (-525.636) (-524.884) (-530.380) * (-524.655) [-529.003] (-525.751) (-525.393) -- 0:00:58
407000 -- (-527.456) (-532.971) [-530.561] (-526.244) * (-530.570) (-526.413) (-523.311) [-526.365] -- 0:00:58
408000 -- (-531.528) (-522.913) (-525.636) [-522.275] * (-523.923) (-526.168) (-523.290) [-524.821] -- 0:00:58
409000 -- (-524.767) (-531.101) [-526.190] (-522.449) * [-521.043] (-528.018) (-521.752) (-531.610) -- 0:00:57
410000 -- [-527.843] (-529.339) (-525.681) (-523.550) * (-526.502) (-524.203) [-523.079] (-523.268) -- 0:00:57
Average standard deviation of split frequencies: 0.025254
411000 -- (-526.169) [-524.513] (-533.438) (-527.285) * (-526.043) (-522.427) [-528.304] (-530.014) -- 0:00:57
412000 -- (-527.609) (-527.407) (-522.048) [-521.485] * [-525.443] (-522.080) (-524.100) (-530.842) -- 0:00:57
413000 -- (-531.457) (-524.491) (-529.049) [-527.658] * [-525.540] (-526.614) (-526.786) (-529.606) -- 0:00:58
414000 -- (-539.012) [-522.109] (-524.009) (-524.534) * (-526.142) [-527.102] (-526.982) (-534.962) -- 0:00:58
415000 -- (-527.135) (-527.892) (-527.451) [-527.585] * (-529.969) [-525.339] (-526.378) (-524.920) -- 0:00:57
Average standard deviation of split frequencies: 0.024175
416000 -- (-528.991) (-525.402) [-525.899] (-529.497) * (-530.588) [-525.997] (-526.985) (-526.834) -- 0:00:57
417000 -- (-523.942) [-522.526] (-526.426) (-526.146) * (-529.454) (-524.204) (-525.445) [-523.417] -- 0:00:57
418000 -- [-521.064] (-525.291) (-525.892) (-525.715) * (-525.313) (-527.912) (-526.293) [-522.377] -- 0:00:57
419000 -- (-521.361) (-533.350) [-531.964] (-527.115) * (-530.565) (-522.268) (-524.933) [-525.692] -- 0:00:56
420000 -- (-528.687) (-535.006) (-526.581) [-525.178] * (-525.003) [-522.032] (-528.590) (-526.778) -- 0:00:56
Average standard deviation of split frequencies: 0.026148
421000 -- (-522.804) [-523.938] (-523.929) (-523.808) * (-526.972) [-521.743] (-530.858) (-526.985) -- 0:00:56
422000 -- (-524.972) [-526.333] (-525.721) (-521.974) * (-528.608) (-523.351) [-526.392] (-527.699) -- 0:00:56
423000 -- (-522.580) (-524.331) (-533.657) [-527.285] * (-526.134) [-519.735] (-525.805) (-526.704) -- 0:00:57
424000 -- (-528.101) [-527.365] (-531.360) (-529.954) * (-523.455) (-523.277) [-521.351] (-525.842) -- 0:00:57
425000 -- (-523.326) [-522.311] (-524.601) (-528.355) * (-526.137) [-524.120] (-526.371) (-533.027) -- 0:00:56
Average standard deviation of split frequencies: 0.025083
426000 -- [-521.175] (-525.919) (-530.362) (-529.734) * (-525.428) [-525.733] (-525.158) (-531.612) -- 0:00:56
427000 -- (-523.867) (-529.932) [-527.035] (-530.520) * (-525.931) (-530.662) [-523.439] (-526.772) -- 0:00:56
428000 -- (-521.658) [-523.216] (-521.741) (-528.734) * (-529.539) (-524.988) [-522.048] (-532.979) -- 0:00:56
429000 -- [-522.155] (-521.481) (-527.755) (-522.329) * (-530.493) (-524.470) (-522.227) [-527.409] -- 0:00:55
430000 -- (-523.470) [-528.200] (-531.802) (-524.230) * (-520.651) (-531.935) (-525.292) [-525.195] -- 0:00:55
Average standard deviation of split frequencies: 0.027000
431000 -- [-525.379] (-521.275) (-531.692) (-526.292) * [-522.378] (-528.031) (-522.200) (-530.626) -- 0:00:55
432000 -- (-530.639) [-522.483] (-524.939) (-523.672) * (-526.255) [-521.949] (-524.076) (-526.869) -- 0:00:55
433000 -- (-523.509) [-525.124] (-526.378) (-523.060) * (-523.873) (-526.950) (-528.581) [-524.916] -- 0:00:54
434000 -- [-534.719] (-526.418) (-527.266) (-528.012) * (-523.935) [-522.987] (-529.803) (-525.943) -- 0:00:56
435000 -- [-523.406] (-524.800) (-531.899) (-523.389) * [-528.829] (-530.638) (-523.865) (-525.695) -- 0:00:55
Average standard deviation of split frequencies: 0.030274
436000 -- [-526.498] (-530.388) (-524.323) (-527.503) * (-522.937) (-527.926) (-521.403) [-525.649] -- 0:00:55
437000 -- [-526.939] (-526.167) (-530.497) (-523.140) * [-525.730] (-529.483) (-523.184) (-525.299) -- 0:00:55
438000 -- [-520.880] (-524.659) (-527.062) (-523.168) * (-526.398) (-525.989) [-521.630] (-530.293) -- 0:00:55
439000 -- [-523.329] (-527.919) (-523.782) (-528.589) * [-523.902] (-521.944) (-523.165) (-523.864) -- 0:00:54
440000 -- (-529.130) [-522.346] (-526.438) (-524.709) * (-528.284) (-527.812) (-526.902) [-523.276] -- 0:00:54
Average standard deviation of split frequencies: 0.028527
441000 -- (-524.218) [-526.375] (-522.612) (-528.776) * (-520.882) (-526.621) [-530.751] (-526.312) -- 0:00:54
442000 -- (-531.591) (-528.745) [-525.916] (-526.565) * (-523.340) [-524.767] (-526.113) (-532.877) -- 0:00:54
443000 -- (-537.318) [-531.190] (-524.707) (-529.262) * (-529.977) (-520.371) (-524.975) [-529.821] -- 0:00:54
444000 -- [-525.323] (-526.561) (-532.564) (-523.478) * (-526.371) [-521.202] (-524.747) (-524.295) -- 0:00:55
445000 -- (-525.747) (-528.161) (-528.494) [-526.571] * [-524.043] (-525.096) (-524.450) (-522.940) -- 0:00:54
Average standard deviation of split frequencies: 0.028890
446000 -- (-525.432) [-526.987] (-528.616) (-532.081) * (-525.249) (-527.089) [-526.262] (-522.896) -- 0:00:54
447000 -- (-529.579) (-530.130) [-522.801] (-527.423) * (-524.299) (-525.689) [-523.295] (-526.627) -- 0:00:54
448000 -- (-527.404) (-529.160) [-523.460] (-529.117) * (-524.757) (-529.552) (-527.844) [-524.968] -- 0:00:54
449000 -- (-526.833) [-524.566] (-525.069) (-528.905) * [-526.566] (-522.527) (-529.536) (-525.183) -- 0:00:53
450000 -- (-529.379) (-528.217) [-519.160] (-522.719) * [-531.674] (-523.379) (-527.541) (-523.745) -- 0:00:53
Average standard deviation of split frequencies: 0.026499
451000 -- (-528.588) (-529.593) [-525.533] (-528.134) * (-525.666) [-521.927] (-523.588) (-531.893) -- 0:00:53
452000 -- (-526.277) [-522.735] (-526.736) (-530.056) * (-526.582) (-521.790) (-527.976) [-531.776] -- 0:00:53
453000 -- [-524.371] (-525.049) (-524.450) (-527.547) * [-525.950] (-541.723) (-524.490) (-527.518) -- 0:00:53
454000 -- (-531.558) (-523.716) (-525.056) [-525.867] * (-525.805) (-528.957) (-521.083) [-523.609] -- 0:00:52
455000 -- (-525.516) (-524.299) (-530.848) [-527.155] * (-528.565) (-528.751) (-530.421) [-524.842] -- 0:00:53
Average standard deviation of split frequencies: 0.026189
456000 -- (-535.670) (-531.588) [-527.710] (-524.317) * (-528.262) [-525.931] (-521.764) (-529.002) -- 0:00:53
457000 -- (-527.837) (-526.724) [-525.723] (-524.420) * (-525.533) (-531.584) (-528.469) [-529.138] -- 0:00:53
458000 -- [-525.071] (-525.074) (-530.248) (-527.697) * [-528.567] (-526.049) (-525.080) (-530.807) -- 0:00:53
459000 -- (-531.719) (-526.063) [-521.740] (-527.249) * (-523.021) [-524.569] (-523.895) (-535.955) -- 0:00:53
460000 -- (-527.358) (-522.268) (-529.323) [-524.540] * [-523.905] (-528.868) (-527.708) (-526.808) -- 0:00:52
Average standard deviation of split frequencies: 0.028653
461000 -- [-525.746] (-525.150) (-525.819) (-525.603) * (-525.006) (-525.700) (-529.202) [-527.504] -- 0:00:52
462000 -- (-533.306) (-522.162) (-528.473) [-525.771] * (-526.625) (-526.152) [-527.461] (-524.649) -- 0:00:52
463000 -- (-527.184) (-521.477) (-526.251) [-528.206] * (-536.125) [-524.248] (-525.979) (-524.777) -- 0:00:52
464000 -- (-525.915) (-526.104) (-525.572) [-524.536] * (-527.612) (-524.989) [-525.920] (-526.539) -- 0:00:51
465000 -- (-528.613) (-523.560) (-526.293) [-523.295] * (-533.592) (-528.429) [-529.909] (-525.148) -- 0:00:52
Average standard deviation of split frequencies: 0.029674
466000 -- (-523.159) (-529.880) (-528.133) [-524.147] * (-527.247) [-524.862] (-529.079) (-528.795) -- 0:00:52
467000 -- (-534.696) (-525.053) (-531.603) [-521.637] * (-527.860) [-525.844] (-525.880) (-527.096) -- 0:00:52
468000 -- [-523.736] (-524.040) (-523.156) (-524.360) * [-522.351] (-527.187) (-523.326) (-522.154) -- 0:00:52
469000 -- (-529.798) [-527.152] (-526.044) (-521.814) * (-527.466) [-527.438] (-522.864) (-526.702) -- 0:00:52
470000 -- (-526.943) [-524.547] (-528.114) (-523.114) * (-528.155) [-530.173] (-526.185) (-527.943) -- 0:00:51
Average standard deviation of split frequencies: 0.030715
471000 -- (-533.391) [-524.718] (-531.995) (-524.108) * (-525.309) (-523.937) [-526.259] (-525.296) -- 0:00:51
472000 -- (-526.577) [-523.616] (-531.533) (-524.496) * (-529.453) [-523.345] (-527.618) (-527.819) -- 0:00:51
473000 -- (-530.203) (-521.540) (-524.145) [-521.366] * (-531.138) (-526.899) (-524.252) [-524.329] -- 0:00:51
474000 -- (-525.684) (-529.509) [-525.036] (-522.708) * (-524.540) [-529.818] (-527.690) (-531.914) -- 0:00:51
475000 -- (-529.351) (-532.137) [-524.208] (-528.021) * (-532.534) (-525.259) [-524.470] (-531.046) -- 0:00:51
Average standard deviation of split frequencies: 0.031691
476000 -- (-524.416) [-526.394] (-532.982) (-523.041) * (-524.282) [-523.918] (-522.067) (-530.709) -- 0:00:51
477000 -- [-527.461] (-525.865) (-522.138) (-529.961) * (-530.224) (-524.152) (-526.183) [-524.674] -- 0:00:51
478000 -- (-529.460) (-521.486) (-532.343) [-524.857] * [-522.137] (-533.844) (-522.627) (-524.505) -- 0:00:51
479000 -- (-528.135) (-522.102) [-523.365] (-520.948) * [-524.475] (-529.628) (-527.886) (-529.748) -- 0:00:51
480000 -- (-524.685) [-523.101] (-523.657) (-521.859) * [-529.322] (-525.912) (-526.168) (-532.946) -- 0:00:50
Average standard deviation of split frequencies: 0.033345
481000 -- [-525.401] (-522.109) (-530.776) (-524.985) * (-528.069) (-526.265) [-526.251] (-524.683) -- 0:00:50
482000 -- (-528.683) [-522.283] (-526.495) (-527.351) * (-523.702) (-524.702) [-525.148] (-533.205) -- 0:00:50
483000 -- (-522.399) (-523.336) (-524.650) [-525.389] * (-527.392) [-527.307] (-524.257) (-528.701) -- 0:00:50
484000 -- (-526.350) [-525.540] (-530.846) (-526.668) * [-524.662] (-528.299) (-518.966) (-530.291) -- 0:00:50
485000 -- [-525.173] (-526.431) (-534.138) (-526.697) * (-523.784) (-524.954) (-524.447) [-523.490] -- 0:00:49
Average standard deviation of split frequencies: 0.031686
486000 -- (-523.595) (-526.718) (-530.661) [-526.066] * (-526.602) (-526.777) (-528.231) [-521.920] -- 0:00:50
487000 -- (-525.104) (-526.452) (-526.770) [-526.089] * (-525.016) [-521.330] (-526.568) (-530.367) -- 0:00:50
488000 -- (-524.604) (-529.333) (-534.027) [-524.495] * (-527.977) (-525.819) (-523.047) [-525.078] -- 0:00:50
489000 -- [-523.001] (-534.026) (-532.337) (-527.749) * (-524.851) (-522.635) (-522.599) [-528.663] -- 0:00:50
490000 -- (-522.339) (-527.032) (-529.964) [-526.287] * [-527.123] (-526.122) (-523.264) (-533.228) -- 0:00:49
Average standard deviation of split frequencies: 0.032025
491000 -- (-526.321) (-523.759) (-529.001) [-525.536] * (-526.925) (-524.094) [-530.464] (-524.467) -- 0:00:49
492000 -- (-528.346) (-526.581) (-531.161) [-523.255] * (-523.695) (-526.408) [-520.634] (-528.388) -- 0:00:49
493000 -- (-522.319) (-523.807) (-528.360) [-521.835] * [-526.702] (-528.099) (-523.756) (-528.895) -- 0:00:49
494000 -- (-522.650) (-526.696) (-532.593) [-523.246] * (-526.049) (-528.872) [-523.292] (-533.040) -- 0:00:49
495000 -- (-535.327) [-522.880] (-528.688) (-530.636) * [-525.767] (-526.454) (-524.229) (-528.407) -- 0:00:48
Average standard deviation of split frequencies: 0.032314
496000 -- [-520.952] (-529.157) (-528.611) (-527.706) * (-522.280) (-524.570) [-521.821] (-530.630) -- 0:00:49
497000 -- (-521.519) (-529.182) (-531.680) [-524.263] * (-526.153) (-524.006) [-523.767] (-525.281) -- 0:00:49
498000 -- (-522.548) (-527.310) (-532.638) [-528.003] * (-521.239) [-520.045] (-530.038) (-528.571) -- 0:00:49
499000 -- (-533.291) (-531.051) [-534.137] (-525.422) * (-523.831) [-524.006] (-523.515) (-541.431) -- 0:00:49
500000 -- (-521.311) [-526.589] (-524.210) (-521.614) * (-527.139) (-527.153) [-523.449] (-530.613) -- 0:00:49
Average standard deviation of split frequencies: 0.030757
501000 -- [-525.359] (-526.200) (-523.212) (-526.245) * (-534.523) (-523.246) [-526.828] (-526.346) -- 0:00:48
502000 -- [-523.657] (-523.992) (-526.714) (-531.255) * (-523.792) [-526.449] (-523.075) (-530.536) -- 0:00:48
503000 -- (-520.597) (-532.784) (-524.814) [-526.247] * (-524.552) (-522.386) [-522.895] (-525.671) -- 0:00:48
504000 -- [-520.945] (-530.852) (-528.250) (-526.797) * (-527.253) [-525.839] (-522.155) (-528.468) -- 0:00:48
505000 -- [-522.347] (-532.210) (-524.511) (-528.070) * [-521.980] (-522.588) (-525.635) (-532.377) -- 0:00:48
Average standard deviation of split frequencies: 0.029812
506000 -- (-524.059) (-530.462) (-526.283) [-525.698] * (-522.355) (-523.693) [-522.191] (-528.805) -- 0:00:48
507000 -- [-522.270] (-529.682) (-529.391) (-526.393) * (-524.330) [-523.692] (-520.602) (-526.396) -- 0:00:48
508000 -- (-524.355) (-533.186) (-524.952) [-527.327] * (-524.659) (-529.876) [-527.216] (-522.722) -- 0:00:48
509000 -- (-524.060) (-530.197) (-529.225) [-524.569] * [-524.350] (-525.778) (-526.908) (-525.202) -- 0:00:48
510000 -- [-529.679] (-522.425) (-525.800) (-525.711) * (-524.584) [-521.403] (-532.212) (-525.018) -- 0:00:48
Average standard deviation of split frequencies: 0.026463
511000 -- (-528.040) (-525.018) (-527.990) [-523.615] * (-526.206) (-522.007) (-528.216) [-524.495] -- 0:00:47
512000 -- (-525.558) (-532.859) (-526.980) [-524.441] * (-523.493) (-525.907) [-529.461] (-528.699) -- 0:00:47
513000 -- (-526.475) (-525.898) (-527.213) [-523.865] * (-527.248) [-525.371] (-526.259) (-525.568) -- 0:00:47
514000 -- (-524.226) [-526.530] (-530.623) (-522.143) * [-526.096] (-527.143) (-527.929) (-522.798) -- 0:00:47
515000 -- [-525.212] (-526.806) (-530.564) (-522.001) * [-525.139] (-529.850) (-532.298) (-522.653) -- 0:00:47
Average standard deviation of split frequencies: 0.028625
516000 -- [-526.004] (-524.428) (-531.775) (-531.179) * [-525.632] (-522.939) (-528.087) (-527.677) -- 0:00:47
517000 -- [-525.902] (-529.637) (-528.211) (-527.083) * (-528.197) [-525.017] (-527.867) (-528.148) -- 0:00:47
518000 -- [-523.942] (-522.840) (-527.039) (-525.040) * (-525.797) (-522.448) (-529.479) [-525.039] -- 0:00:47
519000 -- [-522.949] (-526.155) (-529.979) (-527.293) * [-530.033] (-522.123) (-530.906) (-528.925) -- 0:00:47
520000 -- (-523.888) [-523.679] (-529.120) (-524.754) * [-531.571] (-524.754) (-526.459) (-528.018) -- 0:00:47
Average standard deviation of split frequencies: 0.030180
521000 -- (-525.631) [-522.657] (-529.601) (-530.204) * (-532.119) (-525.204) [-525.840] (-523.399) -- 0:00:46
522000 -- (-524.488) [-526.143] (-526.977) (-521.518) * (-522.504) (-521.242) (-525.113) [-521.924] -- 0:00:46
523000 -- (-521.685) (-527.138) (-523.968) [-522.186] * (-539.499) [-522.483] (-530.043) (-524.390) -- 0:00:46
524000 -- [-523.866] (-525.462) (-533.556) (-526.546) * (-525.930) (-526.075) [-525.757] (-525.381) -- 0:00:46
525000 -- [-520.672] (-523.327) (-524.679) (-522.833) * (-525.138) (-528.283) (-524.949) [-524.379] -- 0:00:46
Average standard deviation of split frequencies: 0.029276
526000 -- (-523.454) [-526.623] (-524.482) (-527.932) * [-522.598] (-526.889) (-525.897) (-524.798) -- 0:00:46
527000 -- (-526.174) [-524.823] (-529.048) (-526.235) * (-523.543) (-524.741) (-531.276) [-527.096] -- 0:00:46
528000 -- (-521.854) (-525.765) [-530.983] (-525.496) * (-526.334) [-527.962] (-525.322) (-528.224) -- 0:00:46
529000 -- [-524.205] (-527.777) (-528.573) (-523.621) * (-528.217) (-521.505) (-527.814) [-520.836] -- 0:00:46
530000 -- (-532.746) [-523.374] (-531.198) (-527.178) * [-528.794] (-525.661) (-538.199) (-523.513) -- 0:00:46
Average standard deviation of split frequencies: 0.027242
531000 -- [-524.658] (-527.617) (-528.951) (-526.070) * (-524.353) (-525.930) [-529.924] (-526.100) -- 0:00:45
532000 -- (-521.170) (-530.574) (-525.190) [-521.660] * (-521.583) (-531.478) [-529.689] (-522.665) -- 0:00:45
533000 -- (-524.165) (-529.597) (-524.972) [-525.904] * (-522.792) (-529.765) (-523.008) [-525.463] -- 0:00:45
534000 -- [-522.993] (-529.697) (-523.146) (-524.048) * (-522.627) (-525.034) (-527.464) [-526.305] -- 0:00:45
535000 -- [-521.531] (-522.996) (-530.569) (-522.341) * (-524.481) [-526.029] (-524.210) (-524.260) -- 0:00:45
Average standard deviation of split frequencies: 0.025798
536000 -- (-525.511) (-520.457) (-530.007) [-522.541] * (-525.343) [-524.674] (-524.199) (-521.329) -- 0:00:45
537000 -- (-523.813) (-524.967) (-530.060) [-523.807] * [-520.451] (-522.272) (-531.632) (-532.578) -- 0:00:45
538000 -- (-525.561) (-528.111) (-529.304) [-526.685] * (-524.354) [-524.918] (-533.956) (-523.858) -- 0:00:45
539000 -- [-527.252] (-527.246) (-526.807) (-525.056) * (-523.794) (-525.262) (-531.643) [-524.986] -- 0:00:45
540000 -- [-526.122] (-527.474) (-526.296) (-531.123) * [-523.997] (-524.561) (-525.842) (-522.666) -- 0:00:45
Average standard deviation of split frequencies: 0.024413
541000 -- [-526.392] (-523.852) (-531.007) (-522.181) * [-524.810] (-529.613) (-530.461) (-520.917) -- 0:00:44
542000 -- (-529.761) [-523.056] (-523.809) (-522.477) * (-531.139) (-527.044) (-521.935) [-526.964] -- 0:00:44
543000 -- (-522.327) (-526.877) (-527.464) [-522.403] * [-528.685] (-520.451) (-531.709) (-529.367) -- 0:00:44
544000 -- [-522.138] (-528.555) (-521.173) (-523.426) * (-529.255) [-526.717] (-541.591) (-530.415) -- 0:00:44
545000 -- (-525.299) (-522.492) [-521.618] (-526.903) * (-527.457) (-523.722) (-526.133) [-528.439] -- 0:00:44
Average standard deviation of split frequencies: 0.024175
546000 -- (-531.819) (-525.051) (-523.023) [-524.989] * (-536.152) [-524.524] (-527.782) (-528.767) -- 0:00:44
547000 -- [-524.500] (-525.725) (-521.351) (-522.896) * (-527.198) [-523.829] (-525.787) (-528.349) -- 0:00:44
548000 -- (-525.103) (-524.548) [-525.427] (-524.514) * (-527.879) (-527.339) (-525.930) [-525.643] -- 0:00:44
549000 -- [-523.337] (-524.234) (-525.378) (-526.980) * (-530.139) [-524.450] (-533.001) (-528.197) -- 0:00:44
550000 -- (-527.424) [-522.191] (-525.024) (-527.422) * (-523.633) (-525.913) [-525.115] (-525.924) -- 0:00:44
Average standard deviation of split frequencies: 0.022258
551000 -- (-529.596) (-525.726) [-531.113] (-526.896) * (-525.713) (-526.898) (-526.925) [-527.927] -- 0:00:44
552000 -- (-524.697) (-529.515) [-522.136] (-526.576) * [-524.835] (-526.789) (-530.437) (-523.967) -- 0:00:43
553000 -- (-526.471) [-522.590] (-525.308) (-527.876) * [-522.287] (-530.695) (-530.160) (-530.613) -- 0:00:43
554000 -- (-528.034) (-526.958) [-523.822] (-523.670) * (-525.855) (-524.043) (-530.559) [-526.141] -- 0:00:43
555000 -- (-527.399) [-520.790] (-525.919) (-527.254) * (-522.409) [-525.137] (-525.257) (-530.992) -- 0:00:43
Average standard deviation of split frequencies: 0.022609
556000 -- [-528.064] (-526.375) (-526.415) (-522.380) * (-520.962) (-523.010) (-526.984) [-526.509] -- 0:00:43
557000 -- (-528.817) (-525.299) [-523.215] (-530.889) * (-526.732) (-524.830) (-527.689) [-534.335] -- 0:00:43
558000 -- (-527.404) (-535.575) (-525.081) [-527.022] * (-523.232) [-522.653] (-529.234) (-529.295) -- 0:00:43
559000 -- [-533.555] (-530.842) (-524.767) (-527.205) * [-527.193] (-526.260) (-522.067) (-526.475) -- 0:00:43
560000 -- [-525.509] (-525.988) (-523.945) (-525.695) * [-526.667] (-524.572) (-527.325) (-534.894) -- 0:00:43
Average standard deviation of split frequencies: 0.022421
561000 -- (-526.362) [-522.079] (-528.917) (-525.689) * (-530.333) (-526.429) (-528.507) [-522.511] -- 0:00:43
562000 -- [-523.595] (-523.007) (-530.367) (-528.297) * (-522.993) (-523.165) (-524.873) [-525.991] -- 0:00:42
563000 -- [-523.954] (-524.063) (-531.812) (-523.678) * (-523.204) (-530.718) (-531.089) [-529.218] -- 0:00:42
564000 -- (-534.281) [-525.680] (-526.012) (-527.958) * [-523.140] (-531.395) (-536.489) (-528.863) -- 0:00:42
565000 -- (-523.025) (-522.324) (-537.060) [-523.908] * [-526.477] (-528.449) (-529.406) (-527.434) -- 0:00:42
Average standard deviation of split frequencies: 0.022765
566000 -- [-525.998] (-527.883) (-527.600) (-526.102) * (-526.423) [-526.312] (-528.123) (-533.720) -- 0:00:42
567000 -- (-526.930) [-522.227] (-523.949) (-527.862) * (-529.594) (-526.525) (-527.511) [-526.167] -- 0:00:42
568000 -- [-520.872] (-527.463) (-529.243) (-533.110) * (-530.889) [-522.967] (-522.495) (-524.578) -- 0:00:42
569000 -- [-527.559] (-527.705) (-521.057) (-530.233) * (-528.606) [-526.257] (-526.302) (-544.334) -- 0:00:42
570000 -- (-524.474) [-524.485] (-525.778) (-531.364) * (-530.709) (-526.574) [-526.647] (-532.754) -- 0:00:42
Average standard deviation of split frequencies: 0.022579
571000 -- (-526.590) (-529.941) [-530.848] (-531.959) * (-524.534) (-527.117) [-527.004] (-530.040) -- 0:00:42
572000 -- (-526.373) [-526.363] (-528.025) (-523.036) * (-527.655) [-528.525] (-529.623) (-529.722) -- 0:00:41
573000 -- (-531.994) [-526.334] (-527.775) (-531.959) * [-526.910] (-527.592) (-528.027) (-525.884) -- 0:00:41
574000 -- (-527.031) [-525.171] (-525.888) (-527.747) * (-523.448) (-524.137) (-528.633) [-526.646] -- 0:00:41
575000 -- (-527.042) (-525.186) [-523.018] (-523.930) * (-525.720) [-526.372] (-526.033) (-522.519) -- 0:00:41
Average standard deviation of split frequencies: 0.021279
576000 -- (-525.209) (-529.947) (-531.918) [-529.380] * (-524.890) (-525.767) (-530.567) [-523.524] -- 0:00:41
577000 -- (-526.093) [-529.350] (-524.091) (-529.311) * (-520.211) [-522.725] (-529.443) (-520.154) -- 0:00:41
578000 -- (-527.855) (-526.605) (-527.326) [-533.311] * [-525.761] (-526.348) (-524.288) (-524.593) -- 0:00:41
579000 -- [-529.470] (-529.827) (-523.065) (-523.018) * (-527.402) [-525.206] (-526.353) (-528.711) -- 0:00:41
580000 -- (-529.763) [-525.173] (-528.409) (-527.505) * [-520.701] (-523.452) (-527.013) (-527.631) -- 0:00:41
Average standard deviation of split frequencies: 0.021649
581000 -- (-528.776) [-525.804] (-521.882) (-529.932) * (-522.578) [-523.760] (-525.234) (-528.677) -- 0:00:41
582000 -- (-528.333) [-528.444] (-523.056) (-529.165) * [-524.560] (-521.288) (-523.267) (-526.751) -- 0:00:40
583000 -- [-523.422] (-523.298) (-527.655) (-529.079) * [-520.139] (-524.922) (-520.114) (-528.207) -- 0:00:40
584000 -- (-523.734) [-524.970] (-522.634) (-525.629) * (-522.456) (-525.772) (-525.733) [-521.580] -- 0:00:40
585000 -- (-538.305) (-527.784) [-523.669] (-528.982) * [-520.514] (-527.249) (-525.741) (-522.063) -- 0:00:40
Average standard deviation of split frequencies: 0.020916
586000 -- (-529.737) (-526.377) (-520.924) [-524.583] * (-523.155) [-525.016] (-530.805) (-523.559) -- 0:00:40
587000 -- (-527.039) [-529.013] (-528.013) (-527.853) * (-523.418) (-527.578) (-524.158) [-522.769] -- 0:00:40
588000 -- (-526.655) [-523.797] (-522.466) (-527.835) * (-528.373) (-530.239) [-521.550] (-532.655) -- 0:00:40
589000 -- (-529.349) (-525.747) [-526.114] (-527.333) * (-525.082) (-525.697) (-524.340) [-525.764] -- 0:00:40
590000 -- [-526.825] (-528.337) (-524.127) (-529.592) * (-521.175) (-527.300) (-522.549) [-524.229] -- 0:00:40
Average standard deviation of split frequencies: 0.022879
591000 -- [-526.227] (-524.698) (-527.583) (-529.564) * (-524.942) (-524.441) (-529.180) [-526.558] -- 0:00:40
592000 -- [-525.059] (-525.973) (-521.335) (-532.999) * (-524.914) (-524.317) (-525.812) [-524.864] -- 0:00:39
593000 -- (-528.417) (-524.047) (-521.826) [-528.094] * (-524.334) (-525.701) (-528.136) [-522.912] -- 0:00:39
594000 -- [-525.906] (-524.907) (-524.540) (-522.353) * (-524.961) (-523.816) [-527.357] (-530.282) -- 0:00:39
595000 -- (-527.318) (-524.796) [-524.980] (-537.312) * (-525.697) [-523.392] (-523.524) (-528.499) -- 0:00:39
Average standard deviation of split frequencies: 0.021092
596000 -- (-525.251) [-523.927] (-528.434) (-524.912) * (-528.766) (-525.477) [-527.515] (-525.896) -- 0:00:39
597000 -- (-532.074) (-523.576) (-533.753) [-524.657] * (-524.818) [-525.003] (-528.113) (-527.092) -- 0:00:39
598000 -- (-526.197) (-525.514) [-529.863] (-528.636) * (-523.052) (-522.133) [-527.712] (-536.235) -- 0:00:39
599000 -- (-529.269) (-526.676) (-526.897) [-525.507] * [-523.831] (-519.407) (-527.340) (-532.117) -- 0:00:39
600000 -- (-527.486) (-523.811) [-529.161] (-522.376) * [-522.677] (-526.965) (-523.585) (-539.576) -- 0:00:39
Average standard deviation of split frequencies: 0.020928
601000 -- (-529.226) [-524.684] (-530.270) (-522.243) * (-524.293) [-522.349] (-530.206) (-522.678) -- 0:00:39
602000 -- (-527.288) [-524.970] (-522.796) (-528.895) * (-532.215) [-522.261] (-528.183) (-525.597) -- 0:00:39
603000 -- [-525.658] (-529.296) (-525.173) (-527.439) * [-526.143] (-520.764) (-526.700) (-528.436) -- 0:00:38
604000 -- (-527.350) [-525.075] (-522.475) (-526.726) * (-522.807) (-524.723) [-527.661] (-528.464) -- 0:00:38
605000 -- (-528.230) [-526.804] (-523.915) (-526.155) * [-524.983] (-524.135) (-528.266) (-530.906) -- 0:00:38
Average standard deviation of split frequencies: 0.021262
606000 -- (-532.014) (-527.765) [-528.371] (-526.580) * (-527.798) [-523.004] (-523.625) (-527.951) -- 0:00:38
607000 -- (-526.518) [-524.384] (-525.919) (-520.169) * (-527.731) [-522.318] (-524.604) (-530.344) -- 0:00:38
608000 -- [-527.955] (-528.689) (-529.745) (-529.470) * [-524.002] (-525.215) (-527.559) (-531.775) -- 0:00:38
609000 -- (-527.731) [-523.726] (-523.750) (-526.452) * [-527.344] (-527.853) (-527.931) (-529.280) -- 0:00:38
610000 -- [-525.904] (-526.228) (-524.615) (-527.783) * [-523.916] (-525.497) (-529.684) (-535.996) -- 0:00:38
Average standard deviation of split frequencies: 0.021615
611000 -- (-522.222) (-539.247) (-525.190) [-524.237] * [-525.782] (-527.083) (-527.272) (-535.608) -- 0:00:38
612000 -- (-522.026) (-534.603) (-524.436) [-524.860] * [-521.745] (-523.762) (-527.897) (-524.325) -- 0:00:38
613000 -- (-523.680) (-526.812) (-525.088) [-525.992] * (-520.792) (-524.802) [-527.706] (-527.514) -- 0:00:37
614000 -- (-525.060) (-523.616) [-529.829] (-529.699) * (-521.722) [-522.988] (-526.551) (-525.802) -- 0:00:37
615000 -- [-526.505] (-526.012) (-533.955) (-528.934) * (-528.737) (-527.401) (-527.735) [-530.275] -- 0:00:37
Average standard deviation of split frequencies: 0.021427
616000 -- (-530.595) (-528.410) [-523.911] (-522.313) * (-523.946) [-525.965] (-524.896) (-524.198) -- 0:00:37
617000 -- (-524.362) (-530.827) [-529.255] (-519.141) * [-530.481] (-525.021) (-528.665) (-530.836) -- 0:00:37
618000 -- (-528.312) [-526.520] (-527.750) (-523.569) * [-530.053] (-528.470) (-523.298) (-529.306) -- 0:00:37
619000 -- [-524.474] (-525.978) (-529.569) (-524.505) * (-530.650) (-529.350) [-527.600] (-524.097) -- 0:00:37
620000 -- (-524.935) (-524.665) [-530.711] (-525.465) * [-524.182] (-528.210) (-526.399) (-522.402) -- 0:00:37
Average standard deviation of split frequencies: 0.020254
621000 -- (-528.102) [-525.393] (-530.527) (-526.324) * (-525.330) (-525.372) (-527.213) [-522.660] -- 0:00:37
622000 -- (-523.732) (-523.619) [-526.878] (-521.386) * [-524.789] (-527.285) (-525.762) (-522.509) -- 0:00:37
623000 -- (-527.838) [-526.382] (-530.732) (-527.263) * (-522.186) (-523.988) (-525.671) [-525.849] -- 0:00:36
624000 -- (-528.042) (-528.156) (-528.887) [-523.525] * (-525.477) (-526.601) [-526.390] (-527.070) -- 0:00:36
625000 -- (-526.836) (-525.071) [-523.334] (-520.364) * (-525.259) (-524.505) (-528.267) [-527.631] -- 0:00:36
Average standard deviation of split frequencies: 0.021085
626000 -- (-530.446) (-537.815) [-527.201] (-523.677) * (-529.568) (-525.213) [-526.870] (-525.121) -- 0:00:36
627000 -- (-525.826) [-526.383] (-529.201) (-522.680) * [-525.675] (-528.777) (-537.346) (-529.575) -- 0:00:36
628000 -- (-525.419) [-521.631] (-525.569) (-524.933) * (-526.561) [-522.897] (-529.592) (-524.299) -- 0:00:36
629000 -- (-525.700) [-522.365] (-527.593) (-522.116) * (-522.652) (-524.527) [-526.919] (-533.743) -- 0:00:36
630000 -- [-523.240] (-526.293) (-523.588) (-524.986) * (-521.850) (-526.387) (-529.056) [-526.032] -- 0:00:36
Average standard deviation of split frequencies: 0.020929
631000 -- (-526.556) [-522.658] (-529.624) (-523.901) * (-525.822) (-527.641) (-526.122) [-524.671] -- 0:00:36
632000 -- (-525.273) (-523.078) (-522.021) [-523.178] * (-523.605) (-527.630) [-524.472] (-527.937) -- 0:00:36
633000 -- (-530.719) (-521.855) (-527.309) [-526.730] * [-528.073] (-524.128) (-523.050) (-525.629) -- 0:00:35
634000 -- (-525.576) (-524.941) (-528.239) [-526.877] * (-523.023) (-526.523) (-525.501) [-522.430] -- 0:00:35
635000 -- (-527.617) (-527.131) (-524.747) [-523.608] * (-523.595) [-531.611] (-526.611) (-529.069) -- 0:00:35
Average standard deviation of split frequencies: 0.020260
636000 -- [-526.157] (-525.379) (-531.377) (-523.046) * (-524.723) (-529.692) [-524.977] (-523.011) -- 0:00:35
637000 -- (-525.633) (-532.113) [-528.891] (-525.769) * (-524.937) (-523.509) (-528.960) [-527.801] -- 0:00:35
638000 -- [-524.563] (-526.255) (-525.149) (-528.339) * (-528.424) [-521.976] (-522.944) (-524.425) -- 0:00:35
639000 -- (-530.488) [-525.428] (-524.313) (-525.466) * [-530.731] (-523.998) (-530.668) (-531.244) -- 0:00:35
640000 -- (-523.234) (-523.845) (-525.787) [-526.849] * (-530.242) (-524.653) [-522.915] (-526.388) -- 0:00:35
Average standard deviation of split frequencies: 0.020602
641000 -- (-524.084) (-525.825) [-523.049] (-527.612) * (-521.580) [-526.170] (-524.188) (-530.041) -- 0:00:35
642000 -- (-525.181) [-522.796] (-524.225) (-532.859) * (-520.869) [-521.581] (-530.210) (-530.399) -- 0:00:35
643000 -- (-528.632) (-528.293) (-525.094) [-534.024] * [-521.982] (-520.752) (-523.673) (-526.845) -- 0:00:34
644000 -- (-521.767) (-531.302) [-524.605] (-529.683) * [-521.588] (-524.659) (-521.704) (-527.958) -- 0:00:34
645000 -- [-528.228] (-535.254) (-522.722) (-534.000) * [-522.307] (-525.045) (-526.590) (-528.036) -- 0:00:34
Average standard deviation of split frequencies: 0.020432
646000 -- [-526.144] (-531.368) (-522.703) (-525.571) * (-521.517) (-520.383) (-531.426) [-526.915] -- 0:00:34
647000 -- (-529.947) (-524.476) [-525.630] (-526.930) * (-523.236) [-523.431] (-523.088) (-522.273) -- 0:00:34
648000 -- (-526.596) (-525.663) [-522.210] (-528.435) * (-525.800) (-529.686) [-524.940] (-527.606) -- 0:00:34
649000 -- (-529.196) [-522.807] (-531.008) (-521.961) * (-527.496) (-522.708) (-522.920) [-527.594] -- 0:00:34
650000 -- [-523.837] (-522.820) (-530.233) (-524.108) * (-532.810) (-529.689) [-523.579] (-526.072) -- 0:00:34
Average standard deviation of split frequencies: 0.020769
651000 -- (-522.870) (-522.677) (-526.107) [-522.561] * [-527.527] (-525.658) (-524.794) (-525.221) -- 0:00:34
652000 -- (-521.435) (-529.392) (-523.621) [-524.828] * (-524.012) [-522.560] (-525.897) (-524.466) -- 0:00:34
653000 -- (-523.428) (-528.290) [-525.302] (-526.688) * (-524.382) [-525.678] (-522.229) (-525.883) -- 0:00:34
654000 -- (-527.039) [-537.875] (-521.761) (-525.345) * (-524.882) (-522.869) [-523.767] (-527.413) -- 0:00:33
655000 -- (-524.633) (-533.187) (-523.335) [-526.063] * (-526.897) [-532.367] (-524.123) (-524.672) -- 0:00:33
Average standard deviation of split frequencies: 0.022037
656000 -- (-523.382) [-523.803] (-526.881) (-529.179) * (-526.308) [-523.506] (-526.351) (-529.111) -- 0:00:33
657000 -- (-520.102) [-524.200] (-530.466) (-525.338) * (-526.183) (-523.443) [-524.163] (-520.929) -- 0:00:33
658000 -- (-524.140) (-525.738) (-529.310) [-525.470] * (-524.081) (-525.318) (-531.491) [-527.611] -- 0:00:33
659000 -- (-526.298) [-528.587] (-526.214) (-528.437) * (-526.011) [-524.008] (-529.181) (-525.301) -- 0:00:33
660000 -- (-524.834) [-526.317] (-527.924) (-531.404) * [-524.184] (-531.962) (-526.663) (-526.486) -- 0:00:33
Average standard deviation of split frequencies: 0.021406
661000 -- (-525.326) (-523.140) (-529.553) [-526.622] * (-526.486) (-524.708) (-524.350) [-531.375] -- 0:00:33
662000 -- (-521.694) [-527.999] (-525.294) (-530.128) * (-527.291) [-523.742] (-532.117) (-526.811) -- 0:00:33
663000 -- [-522.011] (-533.696) (-525.149) (-523.854) * [-521.477] (-525.650) (-527.767) (-526.506) -- 0:00:33
664000 -- (-523.141) (-530.119) [-522.453] (-524.241) * (-528.105) (-529.472) [-527.870] (-525.750) -- 0:00:32
665000 -- (-521.832) [-527.577] (-521.729) (-520.942) * (-526.844) [-529.233] (-522.027) (-527.061) -- 0:00:32
Average standard deviation of split frequencies: 0.021234
666000 -- (-524.010) (-523.505) [-527.828] (-522.582) * (-523.631) [-525.530] (-525.302) (-525.061) -- 0:00:32
667000 -- (-519.980) [-528.350] (-520.305) (-525.555) * (-531.464) (-528.377) (-526.130) [-525.615] -- 0:00:32
668000 -- (-528.297) (-530.537) [-527.365] (-524.152) * (-522.233) (-530.880) (-524.336) [-524.756] -- 0:00:32
669000 -- [-522.385] (-525.930) (-525.199) (-522.529) * (-525.202) [-524.524] (-526.725) (-531.844) -- 0:00:32
670000 -- (-525.322) (-532.411) (-526.084) [-525.288] * (-526.593) [-523.902] (-523.957) (-527.335) -- 0:00:32
Average standard deviation of split frequencies: 0.022492
671000 -- (-524.781) (-523.072) [-531.041] (-528.467) * (-527.174) [-525.169] (-528.069) (-530.756) -- 0:00:32
672000 -- (-524.845) (-529.972) [-526.420] (-525.811) * (-525.882) (-528.224) [-522.547] (-530.541) -- 0:00:32
673000 -- (-527.775) [-523.223] (-526.804) (-527.259) * (-524.809) (-522.746) [-525.846] (-524.406) -- 0:00:32
674000 -- (-531.097) (-526.912) (-526.049) [-527.558] * (-529.069) [-524.371] (-526.156) (-544.559) -- 0:00:31
675000 -- (-526.150) (-523.797) (-525.800) [-527.247] * [-525.569] (-523.676) (-524.017) (-530.180) -- 0:00:31
Average standard deviation of split frequencies: 0.021850
676000 -- (-525.195) (-532.874) [-525.335] (-521.797) * (-529.768) [-524.161] (-530.025) (-526.655) -- 0:00:31
677000 -- (-525.856) (-525.963) [-525.144] (-524.850) * (-527.535) [-525.899] (-528.634) (-526.928) -- 0:00:31
678000 -- (-526.938) (-525.067) (-527.180) [-524.326] * (-526.174) (-525.127) (-530.242) [-526.618] -- 0:00:31
679000 -- (-523.290) (-526.307) [-524.379] (-523.554) * (-525.478) (-526.078) (-521.738) [-525.933] -- 0:00:31
680000 -- [-525.710] (-525.929) (-524.257) (-528.880) * (-526.455) [-524.812] (-528.030) (-529.013) -- 0:00:31
Average standard deviation of split frequencies: 0.021700
681000 -- (-523.275) (-527.037) [-521.790] (-526.828) * (-531.211) [-521.868] (-527.529) (-525.647) -- 0:00:31
682000 -- (-521.432) (-526.076) [-520.675] (-530.238) * (-530.607) [-523.473] (-522.143) (-523.435) -- 0:00:31
683000 -- (-524.678) (-532.359) [-524.462] (-525.264) * (-523.653) [-524.142] (-526.206) (-527.379) -- 0:00:31
684000 -- (-522.053) (-524.405) (-524.559) [-531.314] * (-530.935) [-526.315] (-532.126) (-524.766) -- 0:00:30
685000 -- (-526.627) (-525.973) (-522.746) [-527.004] * (-523.819) (-529.596) (-527.304) [-525.693] -- 0:00:30
Average standard deviation of split frequencies: 0.023364
686000 -- [-523.154] (-536.232) (-526.564) (-526.766) * (-524.798) (-529.340) (-529.341) [-525.630] -- 0:00:30
687000 -- [-525.866] (-529.154) (-525.009) (-530.610) * [-521.791] (-525.812) (-525.487) (-526.443) -- 0:00:30
688000 -- [-525.930] (-524.482) (-523.839) (-528.097) * (-521.187) (-529.796) [-523.671] (-523.238) -- 0:00:30
689000 -- [-529.130] (-533.067) (-527.728) (-533.002) * (-525.172) [-532.530] (-524.819) (-528.325) -- 0:00:30
690000 -- (-527.051) (-525.162) (-522.689) [-526.093] * [-524.208] (-526.538) (-524.297) (-527.754) -- 0:00:30
Average standard deviation of split frequencies: 0.022296
691000 -- (-526.242) (-524.922) [-524.136] (-525.673) * (-523.949) (-523.856) [-525.162] (-526.149) -- 0:00:29
692000 -- [-522.406] (-526.725) (-529.487) (-528.220) * (-527.054) (-525.483) [-526.160] (-528.973) -- 0:00:30
693000 -- [-523.327] (-528.925) (-523.973) (-529.697) * (-526.623) (-528.736) [-524.178] (-525.854) -- 0:00:30
694000 -- (-530.019) (-523.654) [-521.677] (-530.878) * (-522.033) (-522.848) (-523.878) [-526.229] -- 0:00:29
695000 -- (-534.085) (-524.674) (-522.841) [-524.806] * (-523.783) [-527.610] (-525.753) (-526.476) -- 0:00:29
Average standard deviation of split frequencies: 0.021674
696000 -- (-526.896) (-525.288) [-526.405] (-521.880) * (-523.154) (-526.437) (-531.426) [-525.234] -- 0:00:29
697000 -- (-526.717) (-522.659) [-528.176] (-527.688) * (-528.090) [-529.497] (-525.279) (-522.335) -- 0:00:29
698000 -- (-532.252) (-524.641) [-522.297] (-525.937) * (-526.913) [-522.475] (-525.752) (-526.301) -- 0:00:29
699000 -- (-526.970) [-525.058] (-527.502) (-526.313) * (-524.387) (-526.667) (-524.472) [-524.668] -- 0:00:29
700000 -- (-525.893) [-523.577] (-527.137) (-523.990) * (-527.691) [-525.198] (-525.433) (-529.049) -- 0:00:29
Average standard deviation of split frequencies: 0.023324
701000 -- (-527.311) (-526.306) (-523.905) [-523.300] * (-525.416) (-524.937) (-525.405) [-522.408] -- 0:00:29
702000 -- (-526.288) (-522.792) (-527.975) [-528.652] * (-525.000) (-530.567) [-523.321] (-528.374) -- 0:00:29
703000 -- (-526.531) [-523.833] (-528.579) (-530.917) * [-526.350] (-533.423) (-519.955) (-524.931) -- 0:00:29
704000 -- (-527.161) [-525.709] (-533.055) (-525.885) * [-525.522] (-529.386) (-528.697) (-524.515) -- 0:00:29
705000 -- (-526.966) [-525.592] (-529.167) (-523.599) * (-523.861) (-529.344) [-526.663] (-524.465) -- 0:00:28
Average standard deviation of split frequencies: 0.023592
706000 -- (-526.496) (-525.928) [-526.375] (-531.424) * (-527.736) (-526.262) [-525.053] (-527.280) -- 0:00:28
707000 -- (-524.603) (-531.054) [-521.768] (-521.618) * (-527.385) [-526.666] (-521.237) (-525.290) -- 0:00:28
708000 -- (-528.215) [-528.014] (-525.502) (-526.097) * (-525.931) [-524.513] (-526.507) (-524.269) -- 0:00:28
709000 -- [-522.562] (-528.159) (-524.282) (-523.823) * (-523.079) (-530.105) [-523.095] (-525.818) -- 0:00:28
710000 -- (-526.141) [-527.068] (-525.255) (-524.112) * [-521.697] (-523.369) (-531.747) (-526.925) -- 0:00:28
Average standard deviation of split frequencies: 0.022995
711000 -- [-525.096] (-521.951) (-523.969) (-527.289) * (-520.966) [-523.305] (-522.703) (-528.962) -- 0:00:28
712000 -- (-522.092) [-524.163] (-527.651) (-526.776) * (-522.210) [-524.868] (-524.523) (-524.779) -- 0:00:27
713000 -- (-526.024) (-524.477) [-524.100] (-523.107) * [-521.181] (-527.363) (-524.201) (-526.265) -- 0:00:28
714000 -- [-522.693] (-523.906) (-521.522) (-522.826) * [-523.712] (-523.748) (-526.206) (-530.448) -- 0:00:28
715000 -- [-528.097] (-519.589) (-524.799) (-525.523) * [-525.201] (-522.539) (-526.088) (-525.798) -- 0:00:27
Average standard deviation of split frequencies: 0.021068
716000 -- [-526.578] (-529.934) (-519.868) (-534.490) * (-524.143) (-524.909) [-524.747] (-528.751) -- 0:00:27
717000 -- (-524.044) (-531.739) (-533.238) [-524.834] * (-525.553) (-526.956) [-525.142] (-528.241) -- 0:00:27
718000 -- (-524.424) (-532.099) (-524.697) [-525.728] * (-529.655) (-534.121) [-522.306] (-525.888) -- 0:00:27
719000 -- (-524.024) (-525.956) (-528.098) [-523.416] * (-521.789) (-525.468) [-521.044] (-527.696) -- 0:00:27
720000 -- (-535.172) [-528.696] (-521.823) (-525.023) * (-523.052) [-525.294] (-524.052) (-525.474) -- 0:00:27
Average standard deviation of split frequencies: 0.020060
721000 -- [-521.737] (-521.350) (-524.868) (-526.255) * (-527.878) (-525.270) (-527.003) [-527.211] -- 0:00:27
722000 -- (-522.709) (-527.010) [-525.426] (-527.161) * (-525.306) (-527.120) (-526.595) [-526.127] -- 0:00:26
723000 -- (-527.699) [-528.535] (-527.316) (-533.599) * [-523.416] (-525.070) (-533.240) (-522.684) -- 0:00:27
724000 -- (-527.851) [-528.237] (-528.158) (-528.460) * (-530.299) [-526.034] (-532.570) (-527.193) -- 0:00:27
725000 -- (-521.953) (-527.655) [-523.579] (-523.859) * (-528.432) [-520.704] (-526.228) (-527.824) -- 0:00:26
Average standard deviation of split frequencies: 0.019912
726000 -- [-521.667] (-525.769) (-525.351) (-529.614) * [-519.838] (-531.900) (-528.063) (-529.042) -- 0:00:26
727000 -- [-520.631] (-526.713) (-533.712) (-525.618) * (-525.035) (-522.111) [-526.194] (-527.589) -- 0:00:26
728000 -- (-523.939) [-523.302] (-522.853) (-522.707) * (-524.182) [-524.219] (-523.131) (-529.721) -- 0:00:26
729000 -- (-525.650) [-521.985] (-523.258) (-528.938) * (-525.480) (-524.959) (-535.027) [-527.020] -- 0:00:26
730000 -- (-523.602) [-522.052] (-521.057) (-528.540) * [-526.772] (-527.925) (-529.608) (-522.578) -- 0:00:26
Average standard deviation of split frequencies: 0.021506
731000 -- [-523.720] (-527.832) (-521.405) (-528.340) * (-522.597) (-522.545) (-535.161) [-526.258] -- 0:00:26
732000 -- (-526.326) (-528.045) (-526.929) [-530.140] * (-522.301) [-524.855] (-524.671) (-533.742) -- 0:00:25
733000 -- (-529.784) [-524.278] (-526.548) (-525.552) * [-523.152] (-527.588) (-525.861) (-526.814) -- 0:00:25
734000 -- (-527.903) [-529.544] (-526.753) (-525.486) * [-525.114] (-535.269) (-527.890) (-529.119) -- 0:00:26
735000 -- (-525.021) [-524.193] (-523.611) (-527.144) * [-521.714] (-527.398) (-537.442) (-525.434) -- 0:00:25
Average standard deviation of split frequencies: 0.022204
736000 -- (-525.003) (-522.807) [-520.309] (-523.113) * (-530.502) [-527.331] (-532.775) (-529.516) -- 0:00:25
737000 -- [-524.812] (-532.210) (-523.266) (-529.969) * (-531.077) (-525.102) [-525.417] (-526.728) -- 0:00:25
738000 -- [-525.102] (-524.462) (-522.722) (-526.796) * [-530.458] (-522.834) (-528.352) (-520.269) -- 0:00:25
739000 -- (-523.048) [-523.968] (-524.857) (-532.589) * (-529.197) [-521.610] (-527.002) (-522.495) -- 0:00:25
740000 -- (-523.026) [-519.870] (-528.369) (-528.075) * [-522.795] (-524.791) (-535.831) (-525.056) -- 0:00:25
Average standard deviation of split frequencies: 0.020791
741000 -- (-522.187) [-528.716] (-520.006) (-527.024) * (-529.914) (-526.834) [-526.485] (-523.412) -- 0:00:25
742000 -- [-525.886] (-525.356) (-528.400) (-532.099) * (-523.264) [-522.574] (-526.395) (-523.272) -- 0:00:25
743000 -- [-523.990] (-524.431) (-526.001) (-525.668) * [-525.092] (-524.547) (-527.445) (-525.782) -- 0:00:24
744000 -- [-525.752] (-529.096) (-529.255) (-524.317) * [-525.458] (-526.659) (-524.410) (-532.518) -- 0:00:25
745000 -- [-524.527] (-523.712) (-524.824) (-525.628) * (-527.674) [-526.811] (-527.361) (-525.353) -- 0:00:24
Average standard deviation of split frequencies: 0.021906
746000 -- (-527.013) [-525.573] (-523.914) (-524.594) * (-523.506) (-524.916) [-525.644] (-523.102) -- 0:00:24
747000 -- [-521.800] (-523.052) (-529.084) (-530.929) * (-531.025) [-522.602] (-523.479) (-522.620) -- 0:00:24
748000 -- (-526.811) (-526.869) (-524.724) [-524.144] * [-524.385] (-528.316) (-531.583) (-527.524) -- 0:00:24
749000 -- (-522.647) [-522.729] (-523.897) (-528.586) * (-525.336) (-522.872) [-528.415] (-525.770) -- 0:00:24
750000 -- (-529.445) (-528.358) [-522.894] (-522.483) * (-526.126) (-522.010) [-524.519] (-524.774) -- 0:00:24
Average standard deviation of split frequencies: 0.020514
751000 -- [-525.145] (-524.331) (-525.200) (-528.396) * (-522.984) [-524.918] (-528.498) (-521.682) -- 0:00:24
752000 -- (-525.272) (-528.111) [-521.026] (-525.641) * [-522.351] (-525.675) (-532.609) (-530.828) -- 0:00:24
753000 -- (-523.108) [-524.338] (-525.692) (-520.700) * (-529.496) (-531.237) (-522.081) [-526.264] -- 0:00:23
754000 -- (-527.878) (-526.868) [-527.571] (-524.653) * (-528.419) (-523.919) (-527.088) [-522.349] -- 0:00:24
755000 -- [-524.884] (-530.421) (-527.194) (-524.532) * (-527.606) [-524.767] (-523.044) (-524.277) -- 0:00:24
Average standard deviation of split frequencies: 0.019122
756000 -- (-528.602) [-521.364] (-525.006) (-521.587) * [-527.402] (-526.453) (-530.737) (-526.148) -- 0:00:23
757000 -- (-526.605) [-520.284] (-529.367) (-521.523) * (-522.286) (-532.920) (-521.829) [-526.393] -- 0:00:23
758000 -- (-528.357) (-523.912) (-524.462) [-523.091] * (-524.275) (-523.150) [-525.503] (-523.737) -- 0:00:23
759000 -- (-525.546) (-524.318) (-530.663) [-525.699] * (-525.068) (-534.197) [-525.525] (-525.941) -- 0:00:23
760000 -- [-525.473] (-526.541) (-528.890) (-524.198) * (-525.898) (-522.446) [-526.826] (-520.239) -- 0:00:23
Average standard deviation of split frequencies: 0.019831
761000 -- (-521.728) [-524.706] (-529.510) (-526.787) * [-524.869] (-527.569) (-522.764) (-521.513) -- 0:00:23
762000 -- (-528.662) [-522.162] (-530.990) (-526.995) * (-528.221) (-524.039) (-528.104) [-520.601] -- 0:00:23
763000 -- (-527.327) (-525.875) [-529.605] (-523.645) * (-522.685) (-521.206) [-527.234] (-523.436) -- 0:00:22
764000 -- [-525.352] (-528.660) (-526.904) (-530.805) * (-526.876) (-525.975) (-524.075) [-525.441] -- 0:00:22
765000 -- [-523.179] (-526.429) (-528.408) (-527.524) * (-528.870) (-523.161) [-527.268] (-527.519) -- 0:00:23
Average standard deviation of split frequencies: 0.020514
766000 -- [-528.674] (-524.406) (-522.344) (-530.167) * (-528.702) (-529.952) (-523.232) [-525.171] -- 0:00:22
767000 -- (-524.495) (-524.969) [-523.756] (-526.116) * (-528.503) (-527.732) (-527.244) [-523.738] -- 0:00:22
768000 -- (-526.404) (-526.679) [-526.365] (-528.529) * (-522.422) [-530.014] (-525.548) (-527.764) -- 0:00:22
769000 -- [-525.120] (-528.676) (-525.916) (-522.779) * [-523.328] (-535.235) (-527.137) (-527.078) -- 0:00:22
770000 -- (-528.845) (-526.535) [-522.507] (-529.468) * (-526.058) [-526.982] (-529.012) (-526.510) -- 0:00:22
Average standard deviation of split frequencies: 0.020797
771000 -- (-527.096) [-526.936] (-528.069) (-524.572) * (-526.105) (-525.712) (-526.036) [-529.326] -- 0:00:22
772000 -- (-523.568) (-526.682) (-528.784) [-524.040] * (-525.820) [-522.084] (-533.049) (-525.666) -- 0:00:22
773000 -- (-522.016) [-524.524] (-524.944) (-524.762) * [-524.051] (-523.911) (-529.166) (-528.293) -- 0:00:22
774000 -- [-521.283] (-529.095) (-526.623) (-523.100) * (-526.956) (-528.640) (-527.370) [-522.099] -- 0:00:21
775000 -- (-525.663) [-522.133] (-523.645) (-529.634) * [-530.636] (-527.716) (-523.115) (-526.482) -- 0:00:22
Average standard deviation of split frequencies: 0.020654
776000 -- (-528.704) (-526.304) [-524.413] (-526.581) * (-528.619) (-521.891) (-520.852) [-522.386] -- 0:00:21
777000 -- [-522.476] (-523.515) (-529.004) (-526.426) * [-524.341] (-522.725) (-526.671) (-525.465) -- 0:00:21
778000 -- (-520.697) [-523.231] (-524.907) (-521.333) * (-524.635) [-524.059] (-528.035) (-524.008) -- 0:00:21
779000 -- (-527.534) (-525.360) (-524.737) [-525.564] * (-528.068) (-524.963) [-526.151] (-521.682) -- 0:00:21
780000 -- (-526.195) (-520.515) (-524.266) [-528.233] * (-525.094) (-523.714) [-524.917] (-521.208) -- 0:00:21
Average standard deviation of split frequencies: 0.021739
781000 -- (-527.901) [-522.903] (-526.327) (-527.211) * [-522.239] (-524.897) (-528.480) (-527.435) -- 0:00:21
782000 -- (-526.022) (-527.146) (-524.107) [-527.820] * (-523.033) (-524.978) [-527.877] (-524.810) -- 0:00:21
783000 -- (-525.312) (-525.241) [-525.567] (-524.375) * (-533.597) [-525.245] (-522.611) (-527.615) -- 0:00:21
784000 -- (-522.442) (-528.016) [-523.716] (-523.453) * (-523.206) (-523.856) [-528.772] (-522.707) -- 0:00:20
785000 -- (-526.651) (-528.378) (-522.670) [-523.509] * (-531.307) (-526.886) [-523.033] (-526.606) -- 0:00:21
Average standard deviation of split frequencies: 0.022791
786000 -- (-523.870) (-526.169) [-526.238] (-520.285) * [-521.916] (-521.837) (-524.524) (-526.634) -- 0:00:20
787000 -- [-523.850] (-527.008) (-528.340) (-532.015) * (-527.775) (-525.767) [-524.440] (-522.373) -- 0:00:20
788000 -- (-533.204) (-527.118) (-524.839) [-526.860] * (-530.637) (-528.249) (-526.545) [-524.389] -- 0:00:20
789000 -- (-528.370) [-526.350] (-521.913) (-524.840) * [-527.761] (-525.583) (-528.976) (-522.498) -- 0:00:20
790000 -- (-526.003) (-525.471) (-528.063) [-527.601] * (-521.686) (-520.540) [-525.732] (-528.348) -- 0:00:20
Average standard deviation of split frequencies: 0.024643
791000 -- (-524.323) (-526.224) [-526.807] (-526.464) * [-523.013] (-527.998) (-523.941) (-529.070) -- 0:00:20
792000 -- (-522.602) [-527.226] (-531.125) (-524.598) * (-522.554) (-532.350) [-522.260] (-522.204) -- 0:00:20
793000 -- (-526.285) (-534.389) [-526.497] (-524.611) * [-524.492] (-523.832) (-526.337) (-532.407) -- 0:00:20
794000 -- (-526.578) [-520.742] (-524.915) (-524.771) * (-524.197) (-524.989) [-529.184] (-523.681) -- 0:00:19
795000 -- [-532.461] (-524.704) (-525.585) (-527.217) * (-522.771) [-524.164] (-527.123) (-526.998) -- 0:00:20
Average standard deviation of split frequencies: 0.023294
796000 -- (-533.071) (-523.241) (-523.483) [-526.444] * (-527.067) (-524.812) [-525.707] (-527.982) -- 0:00:19
797000 -- (-529.276) [-522.342] (-526.013) (-523.007) * [-525.837] (-525.226) (-523.687) (-524.704) -- 0:00:19
798000 -- (-530.243) (-521.820) (-522.335) [-523.177] * [-523.296] (-532.489) (-522.782) (-524.254) -- 0:00:19
799000 -- [-528.122] (-526.944) (-525.437) (-525.577) * (-522.405) (-529.875) [-524.438] (-527.818) -- 0:00:19
800000 -- (-526.497) [-523.708] (-526.181) (-524.230) * (-524.356) (-527.682) (-523.202) [-528.420] -- 0:00:19
Average standard deviation of split frequencies: 0.020803
801000 -- (-525.716) [-524.925] (-525.174) (-534.613) * (-523.952) [-526.988] (-524.228) (-526.451) -- 0:00:19
802000 -- (-525.532) [-529.190] (-528.909) (-527.562) * (-526.942) [-526.346] (-521.439) (-527.236) -- 0:00:19
803000 -- (-529.604) (-525.550) [-528.739] (-523.264) * (-522.062) (-532.980) (-530.238) [-523.212] -- 0:00:19
804000 -- [-524.573] (-527.656) (-524.911) (-529.812) * (-527.216) (-526.043) (-527.722) [-525.344] -- 0:00:19
805000 -- (-525.820) (-525.811) (-523.213) [-523.615] * (-527.131) (-524.676) [-523.615] (-524.104) -- 0:00:18
Average standard deviation of split frequencies: 0.021055
806000 -- (-527.921) [-524.927] (-519.751) (-523.069) * [-522.518] (-524.933) (-527.323) (-528.554) -- 0:00:19
807000 -- (-526.754) [-527.470] (-523.303) (-523.596) * [-524.615] (-526.001) (-523.883) (-524.648) -- 0:00:18
808000 -- (-528.482) (-528.822) (-531.902) [-522.033] * (-528.617) (-526.362) [-521.375] (-536.552) -- 0:00:18
809000 -- (-527.789) (-528.611) (-524.326) [-520.713] * (-528.201) (-527.394) (-520.794) [-521.692] -- 0:00:18
810000 -- (-521.019) (-525.160) (-526.399) [-520.560] * (-522.450) [-522.274] (-524.361) (-525.375) -- 0:00:18
Average standard deviation of split frequencies: 0.021322
811000 -- (-526.956) (-527.255) [-523.551] (-523.696) * (-522.007) (-526.373) [-527.443] (-524.480) -- 0:00:18
812000 -- (-523.404) [-524.417] (-524.651) (-526.302) * (-525.191) [-530.159] (-523.872) (-527.095) -- 0:00:18
813000 -- (-524.154) (-523.759) (-525.938) [-524.789] * (-525.435) (-525.482) (-524.171) [-526.038] -- 0:00:18
814000 -- (-527.428) (-528.905) (-533.700) [-528.026] * (-525.073) (-522.352) [-525.497] (-528.245) -- 0:00:18
815000 -- (-524.645) (-527.007) [-522.432] (-526.299) * [-526.101] (-527.989) (-527.635) (-525.615) -- 0:00:17
Average standard deviation of split frequencies: 0.021953
816000 -- (-525.899) (-526.071) (-526.794) [-524.626] * (-528.521) (-522.402) [-529.794] (-528.150) -- 0:00:18
817000 -- (-528.355) [-521.996] (-526.696) (-524.016) * (-530.158) (-523.869) [-525.854] (-522.956) -- 0:00:17
818000 -- (-526.809) (-531.822) (-527.239) [-527.528] * (-531.249) (-526.437) [-523.367] (-522.159) -- 0:00:17
819000 -- (-528.560) (-524.937) (-525.077) [-526.613] * (-525.593) [-525.097] (-529.714) (-524.304) -- 0:00:17
820000 -- (-524.852) (-521.738) [-525.077] (-527.242) * (-521.740) [-524.552] (-526.379) (-531.365) -- 0:00:17
Average standard deviation of split frequencies: 0.020679
821000 -- (-525.202) (-526.261) [-523.404] (-529.266) * (-525.661) (-525.697) (-525.423) [-524.366] -- 0:00:17
822000 -- (-526.960) [-523.002] (-525.233) (-528.144) * [-526.173] (-524.336) (-525.072) (-528.126) -- 0:00:17
823000 -- (-522.058) (-519.902) (-527.409) [-526.806] * (-522.699) [-523.077] (-525.549) (-535.534) -- 0:00:17
824000 -- [-526.778] (-528.457) (-523.775) (-526.972) * (-530.867) (-528.291) [-523.816] (-529.732) -- 0:00:17
825000 -- (-520.623) (-526.880) [-520.681] (-526.723) * (-526.644) [-522.072] (-529.723) (-524.771) -- 0:00:16
Average standard deviation of split frequencies: 0.019404
826000 -- [-528.615] (-523.714) (-524.836) (-525.187) * (-526.852) (-524.710) [-520.026] (-528.912) -- 0:00:16
827000 -- (-530.728) (-524.581) (-529.264) [-528.340] * (-528.871) (-534.139) [-526.048] (-521.187) -- 0:00:16
828000 -- [-522.615] (-527.695) (-524.282) (-527.872) * (-526.027) [-524.888] (-523.791) (-522.790) -- 0:00:16
829000 -- [-527.728] (-524.571) (-523.652) (-539.518) * (-526.946) (-524.655) [-525.561] (-525.638) -- 0:00:16
830000 -- (-522.008) [-519.308] (-526.000) (-529.035) * (-524.887) (-532.524) (-527.705) [-531.296] -- 0:00:16
Average standard deviation of split frequencies: 0.018160
831000 -- (-525.918) [-525.838] (-523.963) (-525.326) * [-525.279] (-526.865) (-526.602) (-528.123) -- 0:00:16
832000 -- (-524.776) (-520.435) (-522.638) [-524.066] * [-529.770] (-526.098) (-525.095) (-526.325) -- 0:00:16
833000 -- (-528.560) (-527.076) [-522.378] (-527.492) * (-523.562) (-525.873) [-522.728] (-525.091) -- 0:00:16
834000 -- (-531.801) (-522.266) (-527.900) [-521.211] * (-524.916) [-523.795] (-528.839) (-528.985) -- 0:00:16
835000 -- (-524.092) (-523.735) [-524.657] (-523.147) * (-526.932) [-523.341] (-526.745) (-527.883) -- 0:00:16
Average standard deviation of split frequencies: 0.018796
836000 -- (-526.604) (-532.275) (-528.996) [-529.105] * (-522.938) (-526.327) (-524.254) [-528.821] -- 0:00:15
837000 -- (-525.908) [-527.270] (-529.222) (-521.786) * (-524.554) [-526.048] (-526.677) (-533.136) -- 0:00:15
838000 -- (-530.354) (-521.333) [-530.620] (-523.359) * (-528.463) [-522.583] (-530.296) (-529.392) -- 0:00:15
839000 -- (-525.918) [-525.069] (-525.548) (-524.144) * (-524.689) (-529.287) [-526.643] (-530.650) -- 0:00:15
840000 -- (-531.724) (-526.072) [-525.706] (-527.519) * [-527.268] (-526.006) (-523.308) (-523.774) -- 0:00:15
Average standard deviation of split frequencies: 0.017944
841000 -- [-525.813] (-528.187) (-530.789) (-529.911) * (-525.289) [-521.759] (-523.207) (-520.759) -- 0:00:15
842000 -- (-528.282) [-523.362] (-528.040) (-526.228) * (-526.380) (-529.305) (-526.012) [-525.415] -- 0:00:15
843000 -- (-532.887) [-528.087] (-524.053) (-527.620) * (-522.749) (-527.636) [-525.258] (-523.272) -- 0:00:15
844000 -- (-524.051) (-528.508) [-522.174] (-530.692) * (-527.875) (-527.631) (-525.575) [-524.284] -- 0:00:15
845000 -- (-530.719) [-528.093] (-531.100) (-525.045) * (-532.894) (-526.915) (-531.911) [-530.164] -- 0:00:15
Average standard deviation of split frequencies: 0.017459
846000 -- [-525.685] (-524.612) (-522.981) (-524.741) * [-522.591] (-526.575) (-526.005) (-519.599) -- 0:00:14
847000 -- [-525.366] (-524.310) (-522.615) (-522.116) * (-527.212) (-530.126) (-529.595) [-528.076] -- 0:00:14
848000 -- (-527.726) (-529.081) [-529.389] (-525.499) * (-525.706) [-525.455] (-529.410) (-529.123) -- 0:00:14
849000 -- (-525.987) [-523.013] (-525.958) (-523.342) * (-533.152) (-529.212) (-533.244) [-524.157] -- 0:00:14
850000 -- (-531.375) (-522.965) (-523.516) [-529.405] * (-531.169) (-528.984) (-527.735) [-526.154] -- 0:00:14
Average standard deviation of split frequencies: 0.017733
851000 -- (-529.331) (-524.870) [-522.300] (-525.832) * (-531.598) [-527.342] (-526.309) (-528.105) -- 0:00:14
852000 -- (-525.086) (-525.586) (-525.615) [-524.423] * (-529.856) (-527.476) (-528.142) [-526.762] -- 0:00:14
853000 -- (-526.306) [-525.206] (-525.217) (-525.692) * (-524.142) (-525.383) (-528.163) [-528.065] -- 0:00:14
854000 -- (-528.597) (-523.263) [-526.912] (-525.555) * (-532.303) [-526.462] (-529.023) (-525.388) -- 0:00:14
855000 -- (-524.925) [-522.921] (-528.917) (-523.375) * (-526.529) (-523.405) (-521.855) [-525.610] -- 0:00:14
Average standard deviation of split frequencies: 0.016521
856000 -- (-526.075) (-523.988) [-524.443] (-524.577) * [-522.913] (-524.966) (-524.742) (-529.575) -- 0:00:13
857000 -- [-528.567] (-524.214) (-522.816) (-523.703) * (-526.269) (-522.972) [-525.745] (-524.060) -- 0:00:14
858000 -- (-528.401) (-526.412) (-522.286) [-523.406] * (-521.431) (-527.291) (-524.236) [-527.258] -- 0:00:13
859000 -- [-526.639] (-523.544) (-526.160) (-526.207) * (-528.016) [-524.907] (-525.195) (-524.976) -- 0:00:13
860000 -- (-532.253) (-523.946) [-524.455] (-527.532) * (-526.282) (-522.179) (-524.857) [-519.938] -- 0:00:13
Average standard deviation of split frequencies: 0.015701
861000 -- [-525.191] (-527.516) (-524.965) (-524.535) * (-530.116) [-525.669] (-527.945) (-522.367) -- 0:00:13
862000 -- (-524.332) [-526.750] (-523.117) (-526.332) * [-529.970] (-529.368) (-529.148) (-526.952) -- 0:00:13
863000 -- (-526.283) [-529.027] (-535.980) (-529.234) * [-524.753] (-526.286) (-524.297) (-528.516) -- 0:00:13
864000 -- (-527.759) [-524.079] (-528.590) (-523.226) * [-522.184] (-532.155) (-527.301) (-529.337) -- 0:00:13
865000 -- (-521.709) (-523.227) [-524.379] (-525.608) * [-524.873] (-528.933) (-526.840) (-521.901) -- 0:00:13
Average standard deviation of split frequencies: 0.016330
866000 -- (-520.965) [-526.149] (-529.514) (-523.583) * [-528.667] (-529.226) (-527.107) (-520.806) -- 0:00:12
867000 -- (-527.342) (-524.456) [-524.252] (-526.334) * [-527.965] (-523.191) (-531.534) (-528.939) -- 0:00:13
868000 -- [-523.538] (-526.887) (-524.113) (-526.836) * (-529.992) (-520.482) [-527.801] (-525.656) -- 0:00:12
869000 -- (-527.635) [-527.400] (-527.778) (-528.683) * [-524.599] (-522.424) (-525.017) (-523.183) -- 0:00:12
870000 -- (-531.215) (-524.252) [-523.093] (-530.993) * (-523.672) (-530.830) [-528.521] (-523.587) -- 0:00:12
Average standard deviation of split frequencies: 0.015521
871000 -- (-530.650) [-525.647] (-533.636) (-527.766) * (-526.578) [-523.038] (-525.109) (-529.460) -- 0:00:12
872000 -- (-526.002) (-522.709) (-525.381) [-523.160] * [-522.401] (-527.829) (-522.702) (-527.209) -- 0:00:12
873000 -- (-527.067) (-529.109) (-531.848) [-524.200] * (-525.096) [-529.035] (-527.688) (-525.675) -- 0:00:12
874000 -- (-527.514) [-524.824] (-537.327) (-527.558) * [-526.996] (-526.984) (-529.433) (-528.191) -- 0:00:12
875000 -- [-523.648] (-526.152) (-528.420) (-522.562) * (-521.678) [-524.663] (-523.143) (-528.122) -- 0:00:12
Average standard deviation of split frequencies: 0.016862
876000 -- (-534.116) [-524.068] (-523.384) (-528.239) * (-523.408) (-524.034) [-526.129] (-531.378) -- 0:00:12
877000 -- (-523.698) (-542.583) (-524.786) [-523.363] * (-523.926) (-521.101) [-522.828] (-530.690) -- 0:00:12
878000 -- (-524.659) (-522.997) [-521.642] (-524.750) * (-523.635) (-525.988) [-522.909] (-524.594) -- 0:00:11
879000 -- (-524.723) (-525.597) [-527.225] (-523.434) * (-524.253) (-530.160) [-522.881] (-535.031) -- 0:00:11
880000 -- [-524.794] (-524.207) (-534.721) (-524.151) * [-522.630] (-523.901) (-531.132) (-521.787) -- 0:00:11
Average standard deviation of split frequencies: 0.016058
881000 -- (-525.645) (-524.606) (-531.951) [-523.204] * [-526.311] (-527.361) (-531.451) (-522.781) -- 0:00:11
882000 -- [-524.097] (-525.514) (-528.834) (-523.930) * (-525.981) (-529.348) [-525.457] (-530.280) -- 0:00:11
883000 -- (-527.375) (-531.256) [-526.125] (-525.021) * [-525.143] (-528.690) (-527.321) (-525.937) -- 0:00:11
884000 -- (-532.361) (-523.323) [-524.010] (-526.122) * (-525.733) [-523.291] (-525.244) (-523.506) -- 0:00:11
885000 -- (-531.767) [-526.789] (-530.203) (-524.451) * (-530.426) (-523.428) [-529.667] (-525.735) -- 0:00:11
Average standard deviation of split frequencies: 0.017735
886000 -- (-527.216) [-524.748] (-520.873) (-528.921) * (-524.465) [-524.068] (-527.395) (-525.404) -- 0:00:11
887000 -- (-525.259) (-523.262) (-531.688) [-522.779] * [-525.981] (-520.934) (-523.859) (-530.519) -- 0:00:11
888000 -- (-526.991) (-523.247) (-526.651) [-524.372] * (-531.955) (-529.391) (-522.636) [-524.160] -- 0:00:10
889000 -- (-525.270) (-529.362) [-527.448] (-526.028) * (-524.006) (-527.107) (-526.930) [-525.186] -- 0:00:10
890000 -- [-527.245] (-527.281) (-524.461) (-526.867) * (-525.141) [-523.683] (-529.440) (-524.968) -- 0:00:10
Average standard deviation of split frequencies: 0.018701
891000 -- (-526.856) (-524.462) (-524.094) [-523.911] * (-530.773) (-521.254) [-528.209] (-521.725) -- 0:00:10
892000 -- (-531.223) (-525.198) (-525.304) [-523.305] * (-526.430) (-524.010) [-523.021] (-526.348) -- 0:00:10
893000 -- (-524.459) (-525.943) (-518.896) [-522.124] * (-526.769) [-525.563] (-528.876) (-525.124) -- 0:00:10
894000 -- (-530.738) (-526.891) [-521.365] (-525.897) * (-527.348) [-525.398] (-527.536) (-525.938) -- 0:00:10
895000 -- (-526.569) [-522.606] (-527.950) (-522.765) * (-531.084) (-526.886) [-523.344] (-524.292) -- 0:00:10
Average standard deviation of split frequencies: 0.018239
896000 -- [-523.709] (-524.786) (-524.539) (-528.356) * (-528.789) (-525.484) [-526.789] (-524.236) -- 0:00:10
897000 -- [-523.914] (-522.183) (-525.437) (-523.734) * (-526.220) (-525.411) [-522.689] (-530.457) -- 0:00:10
898000 -- (-525.513) (-525.802) (-526.139) [-528.012] * [-526.084] (-526.405) (-527.006) (-526.889) -- 0:00:09
899000 -- (-526.020) (-526.676) [-525.504] (-525.199) * (-528.364) (-524.255) [-524.082] (-525.509) -- 0:00:09
900000 -- (-527.860) (-521.026) (-526.600) [-524.500] * (-528.786) [-522.473] (-526.769) (-528.477) -- 0:00:09
Average standard deviation of split frequencies: 0.017447
901000 -- (-536.362) (-524.380) [-522.526] (-527.288) * (-522.054) (-519.071) (-522.843) [-525.338] -- 0:00:09
902000 -- (-525.147) (-526.540) (-529.367) [-523.537] * (-525.015) (-527.593) [-522.572] (-524.118) -- 0:00:09
903000 -- [-527.783] (-521.718) (-522.483) (-529.194) * (-533.364) [-523.929] (-526.339) (-527.327) -- 0:00:09
904000 -- (-526.745) (-522.225) (-532.789) [-529.907] * (-523.687) (-522.119) (-523.453) [-527.485] -- 0:00:09
905000 -- (-528.361) [-526.857] (-526.511) (-525.497) * (-525.882) (-524.499) (-526.494) [-522.116] -- 0:00:09
Average standard deviation of split frequencies: 0.016997
906000 -- [-525.318] (-526.833) (-525.018) (-528.829) * (-532.874) [-525.460] (-528.023) (-520.834) -- 0:00:09
907000 -- (-524.670) (-525.173) [-522.764] (-528.695) * (-522.186) [-527.335] (-523.273) (-524.745) -- 0:00:09
908000 -- [-528.642] (-533.166) (-529.960) (-525.261) * (-525.339) (-523.964) (-526.228) [-522.353] -- 0:00:09
909000 -- (-523.931) (-526.954) (-527.663) [-526.257] * (-530.389) (-525.102) [-525.759] (-524.220) -- 0:00:08
910000 -- (-522.334) [-528.002] (-522.540) (-525.387) * (-532.818) [-522.338] (-533.526) (-523.598) -- 0:00:08
Average standard deviation of split frequencies: 0.016910
911000 -- (-526.035) (-520.279) [-523.063] (-525.388) * (-526.438) [-527.880] (-525.911) (-526.057) -- 0:00:08
912000 -- (-522.945) (-525.355) [-523.872] (-524.925) * (-524.459) [-522.856] (-527.806) (-532.652) -- 0:00:08
913000 -- (-522.839) [-525.094] (-526.211) (-526.233) * (-526.165) (-521.927) (-522.651) [-522.877] -- 0:00:08
914000 -- (-524.721) (-527.093) [-523.688] (-522.962) * (-528.631) [-527.087] (-524.944) (-527.390) -- 0:00:08
915000 -- (-527.156) [-528.896] (-526.646) (-522.238) * (-527.347) (-535.450) [-521.807] (-524.869) -- 0:00:08
Average standard deviation of split frequencies: 0.016811
916000 -- (-531.906) [-522.016] (-524.475) (-525.045) * (-527.127) (-528.802) [-522.741] (-523.684) -- 0:00:08
917000 -- [-521.767] (-527.777) (-524.589) (-527.209) * [-527.222] (-521.975) (-524.599) (-521.845) -- 0:00:08
918000 -- (-526.076) [-523.679] (-529.128) (-524.268) * (-527.452) (-524.857) [-524.356] (-528.300) -- 0:00:08
919000 -- (-527.382) (-523.855) (-522.531) [-524.707] * (-526.608) (-524.427) [-524.117] (-522.423) -- 0:00:07
920000 -- (-522.644) (-525.432) [-525.161] (-524.690) * (-529.219) (-524.197) [-524.826] (-524.268) -- 0:00:07
Average standard deviation of split frequencies: 0.017750
921000 -- (-523.394) (-526.256) (-527.408) [-524.745] * (-528.779) [-524.234] (-524.230) (-523.675) -- 0:00:07
922000 -- (-523.147) (-522.290) [-526.972] (-526.207) * (-527.791) [-520.384] (-523.213) (-521.239) -- 0:00:07
923000 -- (-524.647) (-524.538) [-525.127] (-522.269) * (-526.738) (-522.985) [-524.422] (-527.975) -- 0:00:07
924000 -- (-524.717) (-527.292) [-522.016] (-531.443) * (-530.891) (-525.944) [-524.501] (-528.946) -- 0:00:07
925000 -- [-524.105] (-527.964) (-528.726) (-526.028) * (-525.589) [-523.255] (-527.465) (-527.049) -- 0:00:07
Average standard deviation of split frequencies: 0.018327
926000 -- (-531.924) (-524.995) [-524.909] (-526.139) * [-528.631] (-523.271) (-523.292) (-523.508) -- 0:00:07
927000 -- [-523.901] (-526.868) (-525.688) (-528.934) * [-524.928] (-530.296) (-530.162) (-527.578) -- 0:00:07
928000 -- (-530.625) (-526.922) [-524.206] (-522.407) * [-522.702] (-532.269) (-521.107) (-528.233) -- 0:00:07
929000 -- (-529.563) (-528.221) [-523.406] (-523.795) * (-525.625) (-523.998) [-524.095] (-529.915) -- 0:00:06
930000 -- (-526.145) (-526.301) (-527.745) [-524.048] * (-525.054) [-525.739] (-522.372) (-528.515) -- 0:00:06
Average standard deviation of split frequencies: 0.017559
931000 -- [-525.366] (-526.270) (-523.835) (-526.056) * (-522.163) (-520.977) [-527.816] (-522.893) -- 0:00:06
932000 -- [-522.232] (-521.949) (-524.765) (-524.470) * (-523.324) (-529.548) (-524.597) [-529.821] -- 0:00:06
933000 -- (-530.811) (-526.714) [-523.799] (-522.947) * (-525.744) (-522.612) (-526.231) [-522.248] -- 0:00:06
934000 -- (-525.917) (-527.114) [-526.689] (-527.711) * (-530.469) (-526.275) (-527.801) [-521.258] -- 0:00:06
935000 -- (-527.081) [-525.004] (-528.509) (-527.939) * (-524.851) (-519.776) [-524.736] (-524.691) -- 0:00:06
Average standard deviation of split frequencies: 0.018802
936000 -- [-523.984] (-531.933) (-533.317) (-526.663) * [-525.212] (-535.755) (-527.716) (-526.486) -- 0:00:06
937000 -- (-523.187) (-524.496) [-524.284] (-524.823) * [-520.093] (-525.464) (-534.863) (-526.025) -- 0:00:06
938000 -- (-522.413) (-526.515) [-522.794] (-525.487) * [-522.018] (-527.128) (-529.224) (-523.096) -- 0:00:06
939000 -- (-525.341) (-527.435) (-530.201) [-521.442] * (-522.985) [-523.802] (-523.240) (-522.858) -- 0:00:05
940000 -- (-524.092) [-526.731] (-525.089) (-520.841) * (-527.408) (-525.487) (-524.525) [-523.661] -- 0:00:05
Average standard deviation of split frequencies: 0.018375
941000 -- (-527.976) (-527.143) (-528.422) [-528.091] * (-524.966) (-527.023) [-528.616] (-524.723) -- 0:00:05
942000 -- (-523.763) [-527.077] (-523.693) (-529.185) * (-522.628) (-527.954) (-525.688) [-526.800] -- 0:00:05
943000 -- (-528.096) (-525.467) [-523.238] (-523.486) * (-527.897) [-521.558] (-527.286) (-521.253) -- 0:00:05
944000 -- (-525.420) (-520.723) [-522.733] (-522.674) * [-523.227] (-525.866) (-523.420) (-524.254) -- 0:00:05
945000 -- (-523.567) [-525.369] (-529.986) (-523.587) * [-523.742] (-530.459) (-526.774) (-528.677) -- 0:00:05
Average standard deviation of split frequencies: 0.017939
946000 -- (-527.007) (-527.321) [-526.637] (-525.104) * [-524.451] (-527.925) (-529.259) (-522.214) -- 0:00:05
947000 -- (-524.783) (-529.442) (-533.214) [-526.935] * [-523.806] (-526.555) (-543.969) (-530.353) -- 0:00:05
948000 -- [-526.605] (-526.108) (-529.370) (-526.247) * (-522.914) (-525.716) (-523.313) [-532.033] -- 0:00:05
949000 -- (-524.391) [-525.045] (-526.077) (-525.422) * (-526.976) [-525.732] (-525.447) (-532.178) -- 0:00:04
950000 -- (-531.010) [-527.909] (-525.282) (-525.488) * (-528.366) (-526.227) (-530.403) [-521.721] -- 0:00:04
Average standard deviation of split frequencies: 0.016198
951000 -- (-526.099) [-525.147] (-527.508) (-526.306) * (-528.916) (-528.974) [-526.609] (-529.493) -- 0:00:04
952000 -- (-526.238) (-521.431) (-530.152) [-529.289] * [-529.012] (-533.238) (-529.181) (-522.120) -- 0:00:04
953000 -- (-526.811) (-525.040) [-524.469] (-533.611) * (-526.259) (-529.008) [-526.876] (-526.309) -- 0:00:04
954000 -- (-525.201) [-522.523] (-522.377) (-526.149) * [-525.379] (-531.348) (-523.031) (-528.566) -- 0:00:04
955000 -- (-524.222) (-529.223) [-524.213] (-523.510) * [-529.105] (-531.090) (-525.767) (-528.977) -- 0:00:04
Average standard deviation of split frequencies: 0.016765
956000 -- (-527.194) (-525.362) (-524.864) [-522.819] * (-529.082) (-531.483) (-525.668) [-525.952] -- 0:00:04
957000 -- [-526.327] (-528.275) (-526.048) (-533.392) * (-526.386) (-524.979) [-524.371] (-530.649) -- 0:00:04
958000 -- (-528.308) [-522.475] (-524.993) (-525.118) * (-525.446) (-520.017) (-521.449) [-522.692] -- 0:00:04
959000 -- (-526.036) (-527.733) (-526.171) [-529.700] * (-528.370) (-526.433) [-522.179] (-521.912) -- 0:00:04
960000 -- (-527.743) (-525.328) [-521.254] (-528.503) * (-526.490) (-521.385) [-528.171] (-521.743) -- 0:00:03
Average standard deviation of split frequencies: 0.016030
961000 -- [-530.124] (-528.728) (-528.452) (-532.054) * [-523.161] (-520.261) (-528.003) (-524.356) -- 0:00:03
962000 -- (-526.446) (-529.135) (-524.358) [-525.686] * (-527.040) [-524.356] (-522.807) (-527.980) -- 0:00:03
963000 -- (-524.986) (-524.015) [-525.745] (-527.771) * (-527.431) (-532.036) [-524.116] (-530.161) -- 0:00:03
964000 -- (-526.552) (-523.985) (-526.410) [-527.248] * (-528.793) (-527.425) [-523.046] (-524.505) -- 0:00:03
965000 -- (-522.314) (-523.974) [-524.622] (-526.524) * (-525.496) [-524.926] (-526.683) (-534.067) -- 0:00:03
Average standard deviation of split frequencies: 0.014965
966000 -- [-527.610] (-522.326) (-524.350) (-527.413) * [-522.930] (-525.271) (-524.796) (-530.446) -- 0:00:03
967000 -- (-522.302) [-527.951] (-528.804) (-527.440) * (-527.423) (-524.659) [-526.501] (-527.004) -- 0:00:03
968000 -- (-524.023) [-529.653] (-524.554) (-526.104) * [-523.621] (-524.395) (-520.907) (-525.166) -- 0:00:03
969000 -- (-532.211) (-526.221) (-525.199) [-523.437] * (-533.625) (-524.711) (-525.844) [-526.083] -- 0:00:03
970000 -- (-525.202) (-529.781) [-521.929] (-525.452) * (-527.911) (-529.393) (-523.190) [-525.702] -- 0:00:02
Average standard deviation of split frequencies: 0.014893
971000 -- [-527.948] (-529.992) (-526.522) (-529.124) * [-528.253] (-533.752) (-532.909) (-531.417) -- 0:00:02
972000 -- [-525.628] (-532.969) (-535.984) (-523.992) * (-524.268) (-526.267) (-526.313) [-521.203] -- 0:00:02
973000 -- (-531.102) [-527.804] (-525.476) (-528.980) * [-523.927] (-529.053) (-528.818) (-525.600) -- 0:00:02
974000 -- (-529.741) (-524.739) [-523.646] (-526.513) * (-521.451) (-538.583) (-530.944) [-524.078] -- 0:00:02
975000 -- (-527.390) (-522.918) (-531.381) [-524.700] * (-527.131) (-521.929) (-522.302) [-527.415] -- 0:00:02
Average standard deviation of split frequencies: 0.014168
976000 -- (-524.507) (-524.321) [-526.734] (-523.889) * (-522.518) (-525.366) (-524.411) [-528.204] -- 0:00:02
977000 -- (-521.141) [-525.081] (-527.220) (-524.567) * (-527.193) (-522.107) (-523.866) [-525.246] -- 0:00:02
978000 -- (-521.607) (-524.648) (-538.797) [-523.268] * (-526.434) (-528.242) (-526.611) [-523.402] -- 0:00:02
979000 -- (-524.492) (-525.901) [-530.397] (-521.859) * (-531.734) (-529.180) (-527.282) [-519.786] -- 0:00:02
980000 -- (-526.084) (-524.847) (-526.124) [-525.562] * [-525.505] (-522.236) (-524.587) (-524.593) -- 0:00:01
Average standard deviation of split frequencies: 0.014100
981000 -- (-530.409) (-526.910) (-537.237) [-523.255] * (-526.383) [-523.234] (-528.104) (-524.827) -- 0:00:01
982000 -- (-525.377) [-523.329] (-532.831) (-534.436) * (-526.131) (-526.755) [-528.032] (-526.982) -- 0:00:01
983000 -- (-530.599) [-522.365] (-530.544) (-525.139) * [-523.534] (-523.601) (-522.992) (-525.791) -- 0:00:01
984000 -- (-526.003) [-523.434] (-525.180) (-528.599) * [-524.581] (-525.627) (-526.281) (-525.200) -- 0:00:01
985000 -- [-526.616] (-523.419) (-525.217) (-523.588) * (-526.883) (-535.845) (-529.069) [-523.147] -- 0:00:01
Average standard deviation of split frequencies: 0.012749
986000 -- (-523.458) (-524.597) (-525.139) [-523.852] * (-529.832) (-532.075) (-525.773) [-524.232] -- 0:00:01
987000 -- (-529.817) (-526.677) (-522.201) [-525.302] * (-526.816) (-529.910) [-521.825] (-532.590) -- 0:00:01
988000 -- [-523.117] (-526.688) (-522.122) (-525.734) * (-530.498) (-530.054) [-526.533] (-525.447) -- 0:00:01
989000 -- [-523.272] (-525.075) (-524.367) (-525.814) * (-526.421) (-527.333) (-530.335) [-530.383] -- 0:00:01
990000 -- (-522.197) (-524.281) (-528.360) [-523.082] * [-525.257] (-529.735) (-530.755) (-529.901) -- 0:00:00
Average standard deviation of split frequencies: 0.013641
991000 -- (-528.466) [-526.852] (-528.135) (-524.510) * [-524.601] (-527.441) (-523.943) (-524.602) -- 0:00:00
992000 -- (-521.208) (-523.097) [-532.134] (-527.236) * (-527.091) [-523.717] (-522.233) (-524.564) -- 0:00:00
993000 -- (-522.738) (-523.605) [-532.190] (-532.603) * (-528.428) [-526.605] (-522.619) (-524.003) -- 0:00:00
994000 -- (-526.830) (-527.422) [-524.784] (-525.455) * (-527.549) [-521.892] (-522.040) (-521.368) -- 0:00:00
995000 -- (-526.200) [-522.613] (-530.716) (-525.641) * (-528.438) [-526.008] (-525.461) (-525.343) -- 0:00:00
Average standard deviation of split frequencies: 0.013252
996000 -- (-529.700) [-521.838] (-525.659) (-523.441) * [-523.401] (-524.041) (-529.483) (-528.611) -- 0:00:00
997000 -- [-524.415] (-525.094) (-523.097) (-532.575) * (-524.708) (-525.272) (-523.459) [-521.906] -- 0:00:00
998000 -- (-525.160) (-525.209) [-525.004] (-530.116) * (-538.909) [-522.320] (-525.761) (-525.611) -- 0:00:00
999000 -- (-525.290) (-527.358) (-527.954) [-524.729] * (-530.302) (-523.902) [-526.580] (-525.203) -- 0:00:00
1000000 -- (-523.798) [-528.760] (-530.875) (-530.681) * (-521.101) [-522.977] (-526.972) (-528.336) -- 0:00:00
Average standard deviation of split frequencies: 0.014133
Analysis completed in 1 mins 38 seconds
Analysis used 97.90 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -517.06
Likelihood of best state for "cold" chain of run 2 was -517.42
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
73.7 % ( 69 %) Dirichlet(Revmat{all})
89.9 % ( 85 %) Slider(Revmat{all})
37.2 % ( 27 %) Dirichlet(Pi{all})
37.0 % ( 20 %) Slider(Pi{all})
79.6 % ( 60 %) Multiplier(Alpha{1,2})
72.9 % ( 52 %) Multiplier(Alpha{3})
86.5 % ( 71 %) Slider(Pinvar{all})
93.2 % ( 94 %) ExtSPR(Tau{all},V{all})
94.0 % ( 96 %) NNI(Tau{all},V{all})
69.2 % ( 68 %) ParsSPR(Tau{all},V{all})
27.2 % ( 26 %) Multiplier(V{all})
50.0 % ( 50 %) Nodeslider(V{all})
29.1 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
72.9 % ( 67 %) Dirichlet(Revmat{all})
89.9 % ( 73 %) Slider(Revmat{all})
37.5 % ( 29 %) Dirichlet(Pi{all})
37.2 % ( 26 %) Slider(Pi{all})
79.9 % ( 54 %) Multiplier(Alpha{1,2})
72.2 % ( 49 %) Multiplier(Alpha{3})
87.5 % ( 71 %) Slider(Pinvar{all})
93.6 % ( 94 %) ExtSPR(Tau{all},V{all})
94.3 % ( 99 %) NNI(Tau{all},V{all})
69.4 % ( 75 %) ParsSPR(Tau{all},V{all})
27.2 % ( 24 %) Multiplier(V{all})
49.9 % ( 42 %) Nodeslider(V{all})
28.9 % ( 20 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.82 0.65 0.51
2 | 166350 0.83 0.67
3 | 166737 166937 0.83
4 | 166464 166600 166912
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.82 0.66 0.52
2 | 166198 0.83 0.67
3 | 166924 166669 0.84
4 | 166574 166854 166781
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -523.83
| 2 1 1 |
| |
| 1 2 2 |
| 1 1 1 * 2111 2 2 122 1 1 12 1 |
|2 2 *1 12 2 1 2 12 2 1 111 22 * 1 |
|1 2 21 112 1 1 2 21 1 222|
| 1 2 2 2 2 22 1 2 2 2 1 1|
| * 2 2 2 22 11 1 2 2 * 1 1 2 2 |
| *1 2 * 1 1 2 1 1 1 2 |
| 2 11 2 1 |
| 12 1 2 |
| 2 |
| |
| 1 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -526.94
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -522.96 -531.20
2 -522.93 -529.51
--------------------------------------
TOTAL -522.95 -530.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.067129 0.005479 0.020404 0.156036 0.052374 803.10 930.81 1.000
r(A<->C){all} 0.077425 0.005248 0.000116 0.213177 0.057067 333.77 478.53 1.009
r(A<->G){all} 0.237039 0.012814 0.027209 0.454012 0.226231 298.20 425.25 1.001
r(A<->T){all} 0.137357 0.007187 0.002153 0.300616 0.121676 325.09 377.46 1.005
r(C<->G){all} 0.070768 0.004301 0.000009 0.194659 0.054487 537.33 539.33 1.000
r(C<->T){all} 0.312634 0.013815 0.094085 0.535790 0.301517 459.99 461.76 1.000
r(G<->T){all} 0.164777 0.007820 0.011285 0.332747 0.154379 227.99 339.48 1.000
pi(A){all} 0.214226 0.000470 0.172139 0.256951 0.213774 1356.39 1377.09 1.000
pi(C){all} 0.203237 0.000456 0.161211 0.244329 0.202569 1336.73 1370.13 1.000
pi(G){all} 0.241667 0.000532 0.199794 0.289365 0.241808 1282.90 1315.82 1.000
pi(T){all} 0.340870 0.000629 0.290643 0.386766 0.340811 1360.98 1396.75 1.000
alpha{1,2} 0.677870 0.736841 0.000397 2.434321 0.350909 1126.88 1188.02 1.000
alpha{3} 1.378713 1.270098 0.000417 3.607951 1.079052 1038.91 1057.73 1.000
pinvar{all} 0.501948 0.072726 0.029839 0.903398 0.531543 267.26 505.28 1.004
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .**.
6 -- ..**
7 -- .*.*
----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 1138 0.379081 0.020728 0.364424 0.393738 2
6 945 0.314790 0.000471 0.314457 0.315123 2
7 919 0.306129 0.021199 0.291139 0.321119 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.052420 0.004892 0.012397 0.128643 0.038364 1.000 2
length{all}[2] 0.002897 0.000013 0.000003 0.008761 0.001894 1.000 2
length{all}[3] 0.002997 0.000013 0.000000 0.009182 0.001911 1.000 2
length{all}[4] 0.005551 0.000021 0.000090 0.014856 0.004355 1.000 2
length{all}[5] 0.003824 0.000028 0.000002 0.012051 0.002332 0.999 2
length{all}[6] 0.002957 0.000010 0.000006 0.009331 0.001913 1.002 2
length{all}[7] 0.002884 0.000010 0.000001 0.009221 0.001823 0.999 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.014133
Maximum standard deviation of split frequencies = 0.021199
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\------------------------------------------------------------------------ C4 (4)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|---- C2 (2)
+
|---- C3 (3)
|
\-------- C4 (4)
|--------| 0.005 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Fri Oct 21 22:38:34 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=110
C1 MSINQLTLAVASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVASGLQ
C2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
C3 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
C4 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQ
*********:************************************ ***
C1 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLEE
C2 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
C3 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
C4 DIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDE
************************************************:*
C1 FHVIFGKRGG
C2 FQVIFGKRGG
C3 FQVIFGKRGG
C4 FQVIFGKRGG
*:********
-- Starting log on Fri Oct 21 22:57:30 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/codeml,HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C1 330 sites
reading seq# 2 C2 330 sites
reading seq# 3 C3 330 sites
reading seq# 4 C4 330 sitesns = 4 ls = 330
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 110 / 110 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 110 / 110 sites (100.0%), 0:00
Counting codons..
48 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4); MP score: 11
0.041945 0.024633 0.092294 0.084143 0.300000 0.822840 0.411364
ntime & nrate & np: 4 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.262054
np = 7
lnL0 = -529.230434
Iterating by ming2
Initial: fx= 529.230434
x= 0.04195 0.02463 0.09229 0.08414 0.30000 0.82284 0.41136
1 h-m-p 0.0000 0.0002 255.3151 +++ 517.877120 m 0.0002 13 | 1/7
2 h-m-p 0.0001 0.0004 211.5079 ++ 506.804990 m 0.0004 23 | 2/7
3 h-m-p 0.0027 0.0367 21.2129 ++ 500.370320 m 0.0367 33 | 2/7
4 h-m-p 0.0004 0.0018 115.8478 +YCCC 499.350497 3 0.0011 49 | 2/7
5 h-m-p 0.0055 0.0953 23.8754 YYCYC 498.643658 4 0.0074 64 | 2/7
6 h-m-p 0.1866 0.9328 0.2425 +YCYCCC 498.035543 5 0.5427 83 | 2/7
7 h-m-p 0.3896 7.7195 0.3378 +CYCCC 497.141096 4 1.1738 107 | 2/7
8 h-m-p 1.1122 5.5610 0.1173 YCCCCC 496.889709 5 2.2743 131 | 2/7
9 h-m-p 1.6000 8.0000 0.0678 +CCC 496.630568 2 5.9953 151 | 2/7
10 h-m-p 1.6000 8.0000 0.0948 YCCC 496.474697 3 2.4542 171 | 2/7
11 h-m-p 0.4153 2.0763 0.0929 ++ 496.401732 m 2.0763 186 | 3/7
12 h-m-p 1.1787 8.0000 0.1627 YCCC 496.378517 3 0.5857 206 | 3/7
13 h-m-p 0.7266 8.0000 0.1311 +YCC 496.337364 2 2.1304 224 | 3/7
14 h-m-p 1.6000 8.0000 0.1483 YCCC 496.267940 3 3.2523 243 | 3/7
15 h-m-p 1.6000 8.0000 0.0454 YCC 496.264021 2 0.9602 260 | 3/7
16 h-m-p 1.6000 8.0000 0.0152 YC 496.263863 1 1.1607 275 | 3/7
17 h-m-p 1.6000 8.0000 0.0037 YC 496.263851 1 0.9456 290 | 3/7
18 h-m-p 1.6000 8.0000 0.0000 Y 496.263851 0 1.1072 304 | 3/7
19 h-m-p 1.6000 8.0000 0.0000 --Y 496.263851 0 0.0250 320 | 3/7
20 h-m-p 0.0392 8.0000 0.0000 -------------C 496.263851 0 0.0000 347
Out..
lnL = -496.263851
348 lfun, 1044 eigenQcodon, 2784 P(t)
end of tree file.
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4); MP score: 11
0.033498 0.086326 0.074094 0.023058 2.257950 1.121181 0.433292 0.241212 1.391261
ntime & nrate & np: 4 3 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.349689
np = 9
lnL0 = -523.627719
Iterating by ming2
Initial: fx= 523.627719
x= 0.03350 0.08633 0.07409 0.02306 2.25795 1.12118 0.43329 0.24121 1.39126
1 h-m-p 0.0000 0.0004 299.6578 +++ 511.943767 m 0.0004 15 | 0/9
2 h-m-p 0.0000 0.0000 5833.2925 ++ 504.529204 m 0.0000 27 | 1/9
3 h-m-p 0.0000 0.0001 118.6194 ++ 503.242780 m 0.0001 39 | 2/9
4 h-m-p 0.0003 0.1280 3.9103 +++++ 500.722890 m 0.1280 54 | 3/9
5 h-m-p 0.1011 0.5054 1.0986 ++ 498.457098 m 0.5054 66 | 4/9
6 h-m-p 0.0619 0.3095 2.3824 +YCYCCC 497.798170 5 0.1710 87 | 4/9
7 h-m-p 0.3015 8.0000 1.3511 YYCCC 496.448011 4 0.4292 105 | 4/9
8 h-m-p 1.2913 8.0000 0.4491 YC 496.316970 1 0.6334 118 | 4/9
9 h-m-p 1.5134 8.0000 0.1880 CCCC 496.265904 3 2.0369 141 | 4/9
10 h-m-p 1.6000 8.0000 0.0420 CY 496.263957 1 1.5071 160 | 3/9
11 h-m-p 0.1992 8.0000 0.3181 ++YYCCC 496.114974 4 4.3390 185 | 3/9
12 h-m-p 1.5606 8.0000 0.8845 YCCC 495.963780 3 1.1536 208 | 2/9
13 h-m-p 0.0145 0.3827 70.4766 CYCCC 495.817370 4 0.0268 233 | 2/9
14 h-m-p 1.4382 8.0000 1.3156 CCC 495.736906 2 1.2560 249 | 2/9
15 h-m-p 0.6001 3.0006 0.7899 YYC 495.659503 2 0.4892 263 | 2/9
16 h-m-p 0.3573 8.0000 1.0815 +YC 495.510715 1 3.3893 284 | 2/9
17 h-m-p 1.6000 8.0000 1.1446 YCCC 495.403010 3 3.1813 301 | 2/9
18 h-m-p 1.5766 8.0000 2.3096 YYCC 495.250989 3 1.2024 317 | 2/9
19 h-m-p 0.5571 8.0000 4.9852 +YCCC 494.894342 3 3.7328 335 | 2/9
20 h-m-p 1.6000 8.0000 4.5447 YCCC 494.814043 3 1.1773 352 | 2/9
21 h-m-p 0.4547 6.9853 11.7686 YCCC 494.708848 3 1.0374 369 | 2/9
22 h-m-p 1.6000 8.0000 5.5520 YCCC 494.648701 3 3.6046 386 | 2/9
23 h-m-p 1.6000 8.0000 5.6584 YC 494.640987 1 0.7784 399 | 2/9
24 h-m-p 1.6000 8.0000 2.7164 CC 494.639130 1 2.0362 413 | 2/9
25 h-m-p 1.6000 8.0000 0.0914 CC 494.638933 1 2.2436 427 | 2/9
26 h-m-p 1.4185 8.0000 0.1445 +YC 494.638736 1 3.5550 448 | 2/9
27 h-m-p 1.6000 8.0000 0.0510 C 494.638720 0 1.6751 467 | 2/9
28 h-m-p 1.6000 8.0000 0.0342 ++ 494.638714 m 8.0000 486 | 2/9
29 h-m-p 1.6000 8.0000 0.0152 Y 494.638705 0 2.7098 505 | 2/9
30 h-m-p 0.4149 8.0000 0.0995 +Y 494.638704 0 1.0929 525 | 2/9
31 h-m-p 1.6000 8.0000 0.0002 Y 494.638704 0 0.9520 544 | 2/9
32 h-m-p 1.6000 8.0000 0.0000 ++ 494.638704 m 8.0000 563 | 2/9
33 h-m-p 1.1349 8.0000 0.0000 ----C 494.638704 0 0.0011 586
Out..
lnL = -494.638704
587 lfun, 2348 eigenQcodon, 7044 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -501.410221 S = -481.138692 -27.723653
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:05
did 20 / 57 patterns 0:05
did 30 / 57 patterns 0:05
did 40 / 57 patterns 0:05
did 50 / 57 patterns 0:05
did 57 / 57 patterns 0:05end of tree file.
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4); MP score: 11
0.051458 0.096175 0.015106 0.053002 2.843176 0.401168 1.471675
ntime & nrate & np: 4 1 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 8.580488
np = 7
lnL0 = -514.566153
Iterating by ming2
Initial: fx= 514.566153
x= 0.05146 0.09617 0.01511 0.05300 2.84318 0.40117 1.47168
1 h-m-p 0.0000 0.0001 211.0149 ++ 508.658278 m 0.0001 12 | 1/7
2 h-m-p 0.0001 0.0003 227.0006 +YYCYYYYYYY 502.015339 10 0.0003 33 | 1/7
3 h-m-p 0.0000 0.0001 320.3593 ++ 498.930347 m 0.0001 43 | 2/7
4 h-m-p 0.0005 0.1881 2.1325 +++YCYCCC 498.577881 5 0.0757 64 | 2/7
5 h-m-p 0.3696 6.1543 0.4366 +YCCCC 496.911582 4 1.0462 82 | 2/7
6 h-m-p 0.3169 1.5847 0.3840 CYYCCC 496.755619 5 0.6630 106 | 2/7
7 h-m-p 0.3526 1.7629 0.4394 CYYCCC 496.690189 5 0.7178 129 | 2/7
8 h-m-p 0.0777 0.3885 1.7412 +YYCYCC 496.556231 5 0.2540 152 | 2/7
9 h-m-p 0.0231 0.1153 2.6496 YC 496.503342 1 0.0575 163 | 2/7
10 h-m-p 0.5850 2.9248 0.1287 YCCC 496.404141 3 0.3956 178 | 2/7
11 h-m-p 0.3679 3.6738 0.1384 YCCC 496.386901 3 0.9279 198 | 2/7
12 h-m-p 0.5023 8.0000 0.2557 CCC 496.377886 2 0.4166 217 | 2/7
13 h-m-p 1.2722 6.3611 0.0343 YCCC 496.374500 3 1.5382 237 | 2/7
14 h-m-p 1.0542 5.2708 0.0140 YCY 496.370958 2 3.1225 256 | 2/7
15 h-m-p 0.9226 4.6131 0.0101 YC 496.370880 1 0.1442 272 | 2/7
16 h-m-p 0.5738 8.0000 0.0025 YC 496.370836 1 1.3344 288 | 2/7
17 h-m-p 1.0293 8.0000 0.0033 Y 496.370827 0 1.7569 303 | 2/7
18 h-m-p 1.6000 8.0000 0.0002 -----------Y 496.370827 0 0.0000 329 | 2/7
19 h-m-p 0.0160 8.0000 0.0069 -----------C 496.370827 0 0.0000 355 | 2/7
20 h-m-p 0.0160 8.0000 0.0000 +++Y 496.370827 0 1.7027 373 | 2/7
21 h-m-p 1.6000 8.0000 0.0000 Y 496.370827 0 2.6348 388 | 2/7
22 h-m-p 1.6000 8.0000 0.0000 ++ 496.370827 m 8.0000 403 | 2/7
23 h-m-p 1.1047 8.0000 0.0000 ---Y 496.370827 0 0.0022 421
Out..
lnL = -496.370827
422 lfun, 4642 eigenQcodon, 16880 P(t)
end of tree file.
Time used: 0:11
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4); MP score: 11
0.024363 0.049554 0.083763 0.018230 2.306979 0.900000 0.799731 1.831095 1.300000
ntime & nrate & np: 4 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 7.168620
np = 9
lnL0 = -521.657549
Iterating by ming2
Initial: fx= 521.657549
x= 0.02436 0.04955 0.08376 0.01823 2.30698 0.90000 0.79973 1.83109 1.30000
1 h-m-p 0.0000 0.0004 418.8857 +++ 508.562193 m 0.0004 15 | 0/9
2 h-m-p 0.0000 0.0000 18704.9102 ++ 505.031345 m 0.0000 27 | 1/9
3 h-m-p 0.0001 0.0003 107.7532 ++ 501.464728 m 0.0003 39 | 2/9
4 h-m-p 0.0000 0.0014 71.4512 +++ 499.654073 m 0.0014 52 | 3/9
5 h-m-p 0.0112 0.2051 2.6774 +CYCCCC 497.930396 5 0.0798 74 | 3/9
6 h-m-p 0.0722 0.3608 1.6725 CYCYC 497.541109 4 0.1616 93 | 2/9
7 h-m-p 0.0007 0.0037 91.0024 YCYCCC 497.278688 5 0.0020 113 | 2/9
8 h-m-p 0.1166 0.5829 0.7934 +
QuantileBeta(0.15, 0.00500, 2.26175) = 1.153349e-160 2000 rounds
+ 496.403722 m 0.5829 125
QuantileBeta(0.15, 0.00500, 2.26175) = 1.153349e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26175) = 1.153349e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26175) = 1.153349e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26175) = 1.153349e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26175) = 1.153349e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26175) = 1.153349e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26175) = 1.153349e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26175) = 1.153349e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26175) = 1.153349e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26175) = 1.153349e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26188) = 1.153270e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26163) = 1.153427e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26175) = 1.153349e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26175) = 1.153349e-160 2000 rounds
| 3/9
9 h-m-p 1.6000 8.0000 0.2029
QuantileBeta(0.15, 0.00500, 2.25419) = 1.158191e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23151) = 1.172961e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25462) = 1.157918e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.25818) = 1.155629e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25568) = 1.157235e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.25570) = 1.157222e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.25694) = 1.156425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25573) = 1.157204e-160 2000 rounds
C 496.196675 3 1.2751 149
QuantileBeta(0.15, 0.00500, 2.25573) = 1.157204e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25573) = 1.157204e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25573) = 1.157204e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25573) = 1.157204e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25573) = 1.157204e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25573) = 1.157204e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25573) = 1.157204e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25573) = 1.157204e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25573) = 1.157204e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25573) = 1.157204e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25573) = 1.197602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25585) = 1.157125e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25560) = 1.157283e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25573) = 1.157204e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.25573) = 1.157204e-160 2000 rounds
| 3/9
10 h-m-p 1.1721 5.8607 0.1930 YCCCC 496.034843 4 1.2701 174 | 3/9
11 h-m-p 1.6000 8.0000 0.1326 CYC 495.990604 2 2.1312 195 | 3/9
12 h-m-p 1.6000 8.0000 0.1356 YCC 495.980787 2 1.1197 216 | 3/9
13 h-m-p 1.6000 8.0000 0.0542 ++ 495.971820 m 8.0000 234 | 3/9
14 h-m-p 1.6000 8.0000 0.0385 CYC 495.969526 2 1.4608 255 | 3/9
15 h-m-p 1.6000 8.0000 0.0208 YC 495.969213 1 0.8233 274 | 3/9
16 h-m-p 1.6000 8.0000 0.0048 C 495.969205 0 1.8465 292 | 3/9
17 h-m-p 1.6000 8.0000 0.0014 C 495.969205 0 1.3029 310 | 2/9
18 h-m-p 0.2751 8.0000 0.0067 ++YCCC 495.961892 3 3.3192 335 | 2/9
19 h-m-p 0.0160 8.0000 2.2361 ---Y 495.961892 0 0.0000 357 | 2/9
20 h-m-p 0.0515 8.0000 0.0018 ++++ 495.960690 m 8.0000 371 | 2/9
21 h-m-p 0.0096 0.4095 1.4932 -------------.. | 2/9
22 h-m-p 0.0001 0.0341 2.5599 +YC 495.958758 1 0.0006 415 | 2/9
23 h-m-p 0.0002 0.0067 9.8905 YC 495.955280 1 0.0003 428 | 2/9
24 h-m-p 0.0031 0.1725 0.9846 YC 495.952321 1 0.0070 441 | 2/9
25 h-m-p 0.0026 0.0950 2.6107 +CCC 495.941816 2 0.0113 465 | 2/9
26 h-m-p 0.3536 8.0000 0.0836 +++ 495.902881 m 8.0000 478 | 2/9
27 h-m-p 0.9902 5.3939 0.6756 CYCYC 495.834018 4 2.2722 504 | 2/9
28 h-m-p 0.7161 5.4913 2.1437 YCC 495.792916 2 0.2965 526 | 2/9
29 h-m-p 0.2675 2.2767 2.3759 +YYYCCCCC 495.631049 7 1.1248 550 | 2/9
30 h-m-p 0.9581 7.8756 2.7894 YCCC 495.398010 3 2.2742 567 | 2/9
31 h-m-p 0.8620 4.3100 4.6570 CYC 495.341132 2 0.1471 582 | 2/9
32 h-m-p 0.2998 8.0000 2.2846 +++ 495.047436 m 8.0000 595 | 2/9
33 h-m-p 1.6000 8.0000 6.5666 YCCC 494.882348 3 1.0318 612 | 2/9
34 h-m-p 0.7493 7.1034 9.0425 CCCC 494.775203 3 1.2975 630 | 2/9
35 h-m-p 1.6000 8.0000 7.0655 CYC 494.729686 2 2.1120 645 | 2/9
36 h-m-p 1.6000 8.0000 7.0746 YYC 494.709923 2 1.2601 659 | 2/9
37 h-m-p 1.6000 8.0000 3.2683 CC 494.704690 1 1.5949 673 | 2/9
38 h-m-p 1.6000 8.0000 1.9618 CC 494.702918 1 2.0731 687 | 2/9
39 h-m-p 1.6000 8.0000 0.0711 +YC 494.701232 1 4.0157 701 | 2/9
40 h-m-p 0.9420 8.0000 0.3031 ++ 494.695097 m 8.0000 720 | 2/9
41 h-m-p 1.6000 8.0000 0.0158 CYC 494.692097 2 1.9774 742 | 2/9
42 h-m-p 0.0378 8.0000 0.8262 +++YC 494.691011 1 1.9040 765 | 2/9
43 h-m-p 1.6000 8.0000 0.6143 +C 494.690027 0 6.2257 785 | 2/9
44 h-m-p 1.6000 8.0000 0.5107 ++ 494.682960 m 8.0000 804 | 2/9
45 h-m-p 1.2923 8.0000 3.1615 YC 494.666407 1 3.0701 824 | 2/9
46 h-m-p 1.6000 8.0000 5.2906 CYC 494.659534 2 2.0131 839 | 2/9
47 h-m-p 1.6000 8.0000 2.3442 +YC 494.651738 1 4.4143 853 | 2/9
48 h-m-p 1.6000 8.0000 3.1133 YC 494.647933 1 2.5370 866 | 2/9
49 h-m-p 1.6000 8.0000 3.1918 +YC 494.644653 1 4.4368 880 | 2/9
50 h-m-p 1.6000 8.0000 5.3155 YCC 494.642890 2 2.4038 895 | 2/9
51 h-m-p 1.6000 8.0000 6.7781 +YC 494.641318 1 4.8302 909 | 2/9
52 h-m-p 0.3906 1.9528 11.1139 ++ 494.640577 m 1.9528 921 | 2/9
53 h-m-p 0.0000 0.0000 17.4916
h-m-p: 0.00000000e+00 0.00000000e+00 1.74916198e+01 494.640577
.. | 2/9
54 h-m-p 0.0000 0.0249 0.4239 Y 494.640575 0 0.0000 942 | 3/9
55 h-m-p 0.0002 0.0942 0.1508 C 494.640572 0 0.0002 961 | 3/9
56 h-m-p 0.0160 8.0000 0.0158 Y 494.640568 0 0.0371 979 | 3/9
57 h-m-p 0.3306 8.0000 0.0018 ++Y 494.640563 0 3.3904 999 | 3/9
58 h-m-p 1.6000 8.0000 0.0002 C 494.640563 0 1.4518 1017 | 3/9
59 h-m-p 1.6000 8.0000 0.0001 -C 494.640563 0 0.1000 1036 | 3/9
60 h-m-p 0.0661 8.0000 0.0001 Y 494.640563 0 0.1136 1054 | 3/9
61 h-m-p 0.0754 8.0000 0.0001 Y 494.640563 0 0.1260 1072 | 3/9
62 h-m-p 0.0894 8.0000 0.0002 C 494.640563 0 0.1417 1090 | 3/9
63 h-m-p 0.1056 8.0000 0.0003 C 494.640563 0 0.1612 1108 | 3/9
64 h-m-p 0.1240 8.0000 0.0004 C 494.640563 0 0.1877 1126 | 3/9
65 h-m-p 0.1471 8.0000 0.0005 C 494.640563 0 0.2225 1144 | 3/9
66 h-m-p 0.1759 8.0000 0.0006 C 494.640563 0 0.2723 1162 | 3/9
67 h-m-p 0.2150 8.0000 0.0008 Y 494.640563 0 0.3462 1180 | 3/9
68 h-m-p 0.2698 8.0000 0.0010 Y 494.640563 0 0.4662 1198 | 3/9
69 h-m-p 0.3526 8.0000 0.0013 Y 494.640563 0 0.6834 1216 | 3/9
70 h-m-p 0.4852 8.0000 0.0018 Y 494.640563 0 1.1504 1234 | 3/9
71 h-m-p 0.7122 8.0000 0.0029 +C 494.640563 0 2.4682 1253 | 3/9
72 h-m-p 1.0846 8.0000 0.0066 ++ 494.640562 m 8.0000 1271 | 3/9
73 h-m-p 1.5638 8.0000 0.0339 ++ 494.640555 m 8.0000 1289 | 3/9
74 h-m-p 1.6000 8.0000 0.0380 Y 494.640554 0 1.2123 1307 | 3/9
75 h-m-p 1.6000 8.0000 0.0081 C 494.640554 0 2.4857 1325 | 3/9
76 h-m-p 1.6000 8.0000 0.0024 ++ 494.640553 m 8.0000 1343 | 3/9
77 h-m-p 0.4861 8.0000 0.0393 +C 494.640551 0 2.8387 1362 | 3/9
78 h-m-p 1.6000 8.0000 0.0556 C 494.640550 0 1.5611 1380 | 3/9
79 h-m-p 1.6000 8.0000 0.0069 --C 494.640550 0 0.0247 1400 | 3/9
80 h-m-p 0.0251 8.0000 0.0068 C 494.640550 0 0.0060 1418 | 3/9
81 h-m-p 0.0160 8.0000 0.0065 -------------.. | 3/9
82 h-m-p 0.0123 6.1367 0.0017 --C 494.640550 0 0.0002 1467 | 3/9
83 h-m-p 0.0160 8.0000 0.0003 -------------.. | 3/9
84 h-m-p 0.0160 8.0000 0.0158 ------------- | 3/9
85 h-m-p 0.0160 8.0000 0.0158 -------------
Out..
lnL = -494.640550
1555 lfun, 18660 eigenQcodon, 68420 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -500.673878 S = -481.138837 -36.539607
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:39
did 20 / 57 patterns 0:39
did 30 / 57 patterns 0:39
did 40 / 57 patterns 0:39
did 50 / 57 patterns 0:39
did 57 / 57 patterns 0:39end of tree file.
Time used: 0:39
The loglikelihoods for models M1, M2, M7 and M8 are -496.263851 -494.638704 -496.370827 -494.640550 respectively
CLUSTAL W (1.8) multiple sequence alignment (ALTER 1.3.3)
HKU2_GD_430_2006_nsp1_VIPR_P_148283140_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 MSINQLTLAVASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVASGLQDIVIGVEPSD
HKU2_HK_33_2006_NA_VIPR_P_148283167_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQDIVIGVEPSD
HKU2_HK_298_2006_NA_VIPR_P_148283158_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQDIVIGVEPSD
HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQDIVIGVEPSD
*********:************************************ *************
HKU2_GD_430_2006_nsp1_VIPR_P_148283140_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 FVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLEEFHVIFGKRGG
HKU2_HK_33_2006_NA_VIPR_P_148283167_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 FVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDEFQVIFGKRGG
HKU2_HK_298_2006_NA_VIPR_P_148283158_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 FVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDEFQVIFGKRGG
HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 FVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDEFQVIFGKRGG
**************************************:**:********
>HKU2_GD_430_2006_nsp1_VIPR_P_148283140_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 ATGTCTATCAACCAATTGACACTTGCAGTTGCAAGTGACCAGGAAATTTCAGCTCATGGCTATCCTACTATGTCTGATGCCGTTGAACATTTTAGTTCCTCCGCATCACACGGTTTTAAGGATTGCCGTTTTGTAGCCTCTGGGCTGCAGGACATCGTTATTGGAGTTGAACCCAGTGACTTTGTCGTGGCTTTGGAGGGTGATGAAATTCTCACTGCCTATATAGCCACTTTTGGAGCTAGACCTCGTTGTTTGCGCGGCTGGCTTATACCTTCTAATTCTAATTATGTTTTGGAGGAATTTCATGTAATTTTTGGCAAGCGCGGCGGT >HKU2_HK_33_2006_NA_VIPR_P_148283167_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 ATGTCTATCAACCAATTGACACTTGCAATTGCAAGTGATCAGGAAATTTCAGCTCATGGCTATCCTACTATGTCTGATGCCGTTGAACATTTTAGTTCCTCCGCATCACACGGTTTTAAGGATTGCCGTTTTGTAGCCGTGGGGCTGCAGGACATTGTTATTGGAGTTGAACCCAGTGACTTTGTCGTGGCTTTGGAGGGTGATGAAATTCTCACTGCCTATATAGCCACATTTGGAGCTAGACCTCGTTGTTTGCGCGGTTGGCTTATACCTTCTAATTCTAATTATGTTTTGGATGAGTTTCAAGTGATTTTTGGCAAGCGCGGCGGT >HKU2_HK_298_2006_NA_VIPR_P_148283158_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 ATGTCTATCAACCAATTGACACTTGCAATTGCAAGTGATCAGGAAATTTCAGCTCATGGCTATCCTACTATGTCTGATGCCGTTGAACATTTTAGTTCCTCCGCATCACACGGTTTTAAGGATTGCCGTTTTGTAGCCGTGGGGCTGCAGGACATTGTTATTGGAGTTGAACCCAGTGACTTTGTCGTGGCTTTGGAGGGTGATGAAATTCTCACTGCCTATATAGCCACATTTGGAGCTAGACCTCGTTGTTTGCGCGGTTGGCTTATACCTTCTAATTCTAATTATGTTTTGGATGAGTTTCAAGTGATTTTTGGCAAGCGCGGCGGT >HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 ATGTCTATCAACCAATTGACACTTGCAATTGCAAGTGATCAGGAAATTTCAGCTCATGGCTATCCTACTATGTCTGATGCCGTTGAACATTTTAGTTCCTCCGCATCACACGGTTTTAAGGATTGCCGTTTTGTAGCCGTGGGGCTGCAGGACATTGTTATTGGAGTTGAACCCAGTGACTTTGTCGTGGCTTTGGAGGGTGATGAAATTCTCACTGCCTATATAGCCACATTTGGAGCTAGACCTCGTTGTTTGCGCGGTTGGCTTATACCTTCTAATTCTAATTATGTCTTGGATGAGTTTCAAGTGATTTTTGGCAAGCGCGGCGGT
>HKU2_GD_430_2006_nsp1_VIPR_P_148283140_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 MSINQLTLAVASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVASGLQDIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLEEFHVIFGKRGG >HKU2_HK_33_2006_NA_VIPR_P_148283167_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQDIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDEFQVIFGKRGG >HKU2_HK_298_2006_NA_VIPR_P_148283158_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQDIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDEFQVIFGKRGG >HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 MSINQLTLAIASDQEISAHGYPTMSDAVEHFSSSASHGFKDCRFVAVGLQDIVIGVEPSDFVVALEGDEILTAYIATFGARPRCLRGWLIPSNSNYVLDEFQVIFGKRGG
Reading sequence file /data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/codeml/fasta/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1 Found 4 sequences of length 330 Alignment looks like a valid DNA alignment. Estimated diversity is (pairwise deletion - ignoring missing/ambig): 2.0% Found 0 informative sites. Writing alignment of informative sites to: Phi.inf.sites Writing list of informative sites to: Phi.inf.list Calculating all pairwise incompatibilities... 100.0% Using a window size of 80 with k as 1 Too few informative sites to use normal approximation. Try doing a permutation test or increasing alignment length Can also try decreasing windowsize.
#NEXUS
[ID: 8942909580]
begin taxa;
dimensions ntax=4;
taxlabels
HKU2_GD_430_2006_nsp1_VIPR_P_148283140_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
HKU2_HK_33_2006_NA_VIPR_P_148283167_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
HKU2_HK_298_2006_NA_VIPR_P_148283158_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
;
end;
begin trees;
translate
1 HKU2_GD_430_2006_nsp1_VIPR_P_148283140_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2,
2 HKU2_HK_33_2006_NA_VIPR_P_148283167_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2,
3 HKU2_HK_298_2006_NA_VIPR_P_148283158_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2,
4 HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:3.836379e-02,2:1.893927e-03,3:1.911460e-03,4:4.355127e-03);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:3.836379e-02,2:1.893927e-03,3:1.911460e-03,4:4.355127e-03);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -522.96 -531.20
2 -522.93 -529.51
--------------------------------------
TOTAL -522.95 -530.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.067129 0.005479 0.020404 0.156036 0.052374 803.10 930.81 1.000
r(A<->C){all} 0.077425 0.005248 0.000116 0.213177 0.057067 333.77 478.53 1.009
r(A<->G){all} 0.237039 0.012814 0.027209 0.454012 0.226231 298.20 425.25 1.001
r(A<->T){all} 0.137357 0.007187 0.002153 0.300616 0.121676 325.09 377.46 1.005
r(C<->G){all} 0.070768 0.004301 0.000009 0.194659 0.054487 537.33 539.33 1.000
r(C<->T){all} 0.312634 0.013815 0.094085 0.535790 0.301517 459.99 461.76 1.000
r(G<->T){all} 0.164777 0.007820 0.011285 0.332747 0.154379 227.99 339.48 1.000
pi(A){all} 0.214226 0.000470 0.172139 0.256951 0.213774 1356.39 1377.09 1.000
pi(C){all} 0.203237 0.000456 0.161211 0.244329 0.202569 1336.73 1370.13 1.000
pi(G){all} 0.241667 0.000532 0.199794 0.289365 0.241808 1282.90 1315.82 1.000
pi(T){all} 0.340870 0.000629 0.290643 0.386766 0.340811 1360.98 1396.75 1.000
alpha{1,2} 0.677870 0.736841 0.000397 2.434321 0.350909 1126.88 1188.02 1.000
alpha{3} 1.378713 1.270098 0.000417 3.607951 1.079052 1038.91 1057.73 1.000
pinvar{all} 0.501948 0.072726 0.029839 0.903398 0.531543 267.26 505.28 1.004
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/HKU2_HK_46_2006_NA_VIPR_P_148283149_297_626_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 4 ls = 110
Codon usage in sequences
------------------------------------------------------------------------------------------------------
Phe TTT 7 7 7 7 | Ser TCT 5 4 4 4 | Tyr TAT 3 3 3 3 | Cys TGT 1 1 1 1
TTC 0 0 0 0 | TCC 2 2 2 2 | TAC 0 0 0 0 | TGC 1 1 1 1
Leu TTA 0 0 0 0 | TCA 2 2 2 2 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 4 4 4 4 | TCG 0 0 0 0 | TAG 0 0 0 0 | Trp TGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 | Pro CCT 3 3 3 3 | His CAT 3 2 2 2 | Arg CGT 2 2 2 2
CTC 1 1 1 1 | CCC 1 1 1 1 | CAC 1 1 1 1 | CGC 2 2 2 2
CTA 0 0 0 0 | CCA 0 0 0 0 | Gln CAA 1 2 2 2 | CGA 0 0 0 0
CTG 1 1 1 1 | CCG 0 0 0 0 | CAG 2 2 2 2 | CGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Ile ATT 4 6 6 6 | Thr ACT 3 2 2 2 | Asn AAT 2 2 2 2 | Ser AGT 3 3 3 3
ATC 2 1 1 1 | ACC 0 0 0 0 | AAC 1 1 1 1 | AGC 0 0 0 0
ATA 2 2 2 2 | ACA 1 2 2 2 | Lys AAA 0 0 0 0 | Arg AGA 1 1 1 1
Met ATG 2 2 2 2 | ACG 0 0 0 0 | AAG 2 2 2 2 | AGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Val GTT 5 4 4 3 | Ala GCT 3 3 3 3 | Asp GAT 3 5 5 5 | Gly GGT 3 4 4 4
GTC 1 1 1 2 | GCC 4 4 4 4 | GAC 3 2 2 2 | GGC 4 3 3 3
GTA 2 1 1 1 | GCA 3 3 3 3 | Glu GAA 5 4 4 4 | GGA 2 2 2 2
GTG 1 3 3 3 | GCG 0 0 0 0 | GAG 2 2 2 2 | GGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C1
position 1: T:0.23636 C:0.17273 A:0.20909 G:0.38182
position 2: T:0.30909 C:0.24545 A:0.25455 G:0.19091
position 3: T:0.47273 C:0.20909 A:0.17273 G:0.14545
Average T:0.33939 C:0.20909 A:0.21212 G:0.23939
#2: C2
position 1: T:0.22727 C:0.17273 A:0.21818 G:0.38182
position 2: T:0.31818 C:0.23636 A:0.25455 G:0.19091
position 3: T:0.48182 C:0.18182 A:0.17273 G:0.16364
Average T:0.34242 C:0.19697 A:0.21515 G:0.24545
#3: C3
position 1: T:0.22727 C:0.17273 A:0.21818 G:0.38182
position 2: T:0.31818 C:0.23636 A:0.25455 G:0.19091
position 3: T:0.48182 C:0.18182 A:0.17273 G:0.16364
Average T:0.34242 C:0.19697 A:0.21515 G:0.24545
#4: C4
position 1: T:0.22727 C:0.17273 A:0.21818 G:0.38182
position 2: T:0.31818 C:0.23636 A:0.25455 G:0.19091
position 3: T:0.47273 C:0.19091 A:0.17273 G:0.16364
Average T:0.33939 C:0.20000 A:0.21515 G:0.24545
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 28 | Ser S TCT 17 | Tyr Y TAT 12 | Cys C TGT 4
TTC 0 | TCC 8 | TAC 0 | TGC 4
Leu L TTA 0 | TCA 8 | *** * TAA 0 | *** * TGA 0
TTG 16 | TCG 0 | TAG 0 | Trp W TGG 4
------------------------------------------------------------------------------
Leu L CTT 8 | Pro P CCT 12 | His H CAT 9 | Arg R CGT 8
CTC 4 | CCC 4 | CAC 4 | CGC 8
CTA 0 | CCA 0 | Gln Q CAA 7 | CGA 0
CTG 4 | CCG 0 | CAG 8 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 22 | Thr T ACT 9 | Asn N AAT 8 | Ser S AGT 12
ATC 5 | ACC 0 | AAC 4 | AGC 0
ATA 8 | ACA 7 | Lys K AAA 0 | Arg R AGA 4
Met M ATG 8 | ACG 0 | AAG 8 | AGG 0
------------------------------------------------------------------------------
Val V GTT 16 | Ala A GCT 12 | Asp D GAT 18 | Gly G GGT 15
GTC 5 | GCC 16 | GAC 9 | GGC 13
GTA 5 | GCA 12 | Glu E GAA 17 | GGA 8
GTG 10 | GCG 0 | GAG 8 | GGG 4
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.22955 C:0.17273 A:0.21591 G:0.38182
position 2: T:0.31591 C:0.23864 A:0.25455 G:0.19091
position 3: T:0.47727 C:0.19091 A:0.17273 G:0.15909
Average T:0.34091 C:0.20076 A:0.21439 G:0.24394
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4); MP score: 11
lnL(ntime: 4 np: 7): -496.263851 +0.000000
5..1 5..2 5..3 5..4
0.123355 0.000004 0.000004 0.009619 2.257950 0.847064 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.132982
(1: 0.123355, 2: 0.000004, 3: 0.000004, 4: 0.009619);
(C1: 0.123355, C2: 0.000004, C3: 0.000004, C4: 0.009619);
Detailed output identifying parameters
kappa (ts/tv) = 2.25795
MLEs of dN/dS (w) for site classes (K=2)
p: 0.84706 0.15294
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.123 252.5 77.5 0.1529 0.0179 0.1168 4.5 9.1
5..2 0.000 252.5 77.5 0.1529 0.0000 0.0000 0.0 0.0
5..3 0.000 252.5 77.5 0.1529 0.0000 0.0000 0.0 0.0
5..4 0.010 252.5 77.5 0.1529 0.0014 0.0091 0.4 0.7
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4); MP score: 11
lnL(ntime: 4 np: 9): -494.638704 +0.000000
5..1 5..2 5..3 5..4
0.273412 0.000004 0.000004 0.013995 2.843176 0.989877 0.000000 0.118433 80.387042
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.287414
(1: 0.273412, 2: 0.000004, 3: 0.000004, 4: 0.013995);
(C1: 0.273412, C2: 0.000004, C3: 0.000004, C4: 0.013995);
Detailed output identifying parameters
kappa (ts/tv) = 2.84318
MLEs of dN/dS (w) for site classes (K=3)
p: 0.98988 0.00000 0.01012
w: 0.11843 1.00000 80.38704
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.273 250.3 79.7 0.9310 0.0895 0.0962 22.4 7.7
5..2 0.000 250.3 79.7 0.9310 0.0000 0.0000 0.0 0.0
5..3 0.000 250.3 79.7 0.9310 0.0000 0.0000 0.0 0.0
5..4 0.014 250.3 79.7 0.9310 0.0046 0.0049 1.1 0.4
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
47 S 0.993** 79.825
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
47 S 0.828 5.233 +- 3.255
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.638 0.263 0.076 0.018 0.004 0.001 0.000 0.000 0.000 0.000
w2: 0.129 0.108 0.102 0.099 0.097 0.095 0.094 0.093 0.092 0.091
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.005
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.003 0.021
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.003 0.015 0.076
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.003 0.011 0.052 0.211
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.002 0.005 0.012 0.034 0.143 0.398
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4); MP score: 11
lnL(ntime: 4 np: 7): -496.370827 +0.000000
5..1 5..2 5..3 5..4
0.123397 0.000004 0.000004 0.009666 2.306979 0.010896 0.057457
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.133072
(1: 0.123397, 2: 0.000004, 3: 0.000004, 4: 0.009666);
(C1: 0.123397, C2: 0.000004, C3: 0.000004, C4: 0.009666);
Detailed output identifying parameters
kappa (ts/tv) = 2.30698
Parameters in M7 (beta):
p = 0.01090 q = 0.05746
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 0.74170 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.123 252.3 77.7 0.1742 0.0194 0.1116 4.9 8.7
5..2 0.000 252.3 77.7 0.1742 0.0000 0.0000 0.0 0.0
5..3 0.000 252.3 77.7 0.1742 0.0000 0.0000 0.0 0.0
5..4 0.010 252.3 77.7 0.1742 0.0015 0.0087 0.4 0.7
Time used: 0:11
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4); MP score: 11
check convergence..
lnL(ntime: 4 np: 9): -494.640550 +0.000000
5..1 5..2 5..3 5..4
0.273369 0.000004 0.000004 0.013994 2.843787 0.989880 13.360528 99.000000 80.409438
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.287370
(1: 0.273369, 2: 0.000004, 3: 0.000004, 4: 0.013994);
(C1: 0.273369, C2: 0.000004, C3: 0.000004, C4: 0.013994);
Detailed output identifying parameters
kappa (ts/tv) = 2.84379
Parameters in M8 (beta&w>1):
p0 = 0.98988 p = 13.36053 q = 99.00000
(p1 = 0.01012) w = 80.40944
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09899 0.09899 0.09899 0.09899 0.09899 0.09899 0.09899 0.09899 0.09899 0.09899 0.01012
w: 0.07303 0.08771 0.09725 0.10531 0.11287 0.12049 0.12866 0.13812 0.15047 0.17251 80.40944
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.273 250.3 79.7 0.9312 0.0895 0.0961 22.4 7.7
5..2 0.000 250.3 79.7 0.9312 0.0000 0.0000 0.0 0.0
5..3 0.000 250.3 79.7 0.9312 0.0000 0.0000 0.0 0.0
5..4 0.014 250.3 79.7 0.9312 0.0046 0.0049 1.1 0.4
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
47 S 0.993** 79.814
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
47 S 0.888 5.209 +- 3.114
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.010 0.070 0.918
p : 0.608 0.230 0.090 0.038 0.017 0.008 0.004 0.002 0.001 0.001
q : 0.001 0.016 0.042 0.067 0.090 0.113 0.135 0.157 0.179 0.201
ws: 0.135 0.117 0.111 0.106 0.101 0.095 0.090 0.085 0.081 0.078
Time used: 0:39
Model 1: NearlyNeutral -496.263851 Model 2: PositiveSelection -494.638704 Model 7: beta -496.370827 Model 8: beta&w>1 -494.640550 Model 2 vs 1 3.250294 Model 8 vs 7 3.460554
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken. # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
